2L12A

Solution nmr structure of the chromobox protein 7 with h3k9me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox homolog 7
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l12A00
1RJTA 2N55A 3IL8A 1J9OA 1QG7A 5CBEE 1AP0A 4HAEA 1U4RA 1XYIA 1NR4A 1PFNA 3I91A 1NAPA 5EPLA 4ZAIA 4CJ0B 1U4MA 1B2TA 1BF4A 1HHVA 2L11A 1B4OA 1WD1A 4XT1B 5DNFA 1F2LA 4CJ1B 3KUPA 2JP1A 1XX8A 2BDNA 1QNKA 1MSGA 1MSHA 5EPKA 1VMCA 2FFKB 1IKMA 1M8AA 2EPBA 3N52A 1B53A 4U68A 1MI2A 2RSNA 1DZ1A 3I90A 2X6GA 1EIHA 1TVXA 2K05A 4DN4M 1HRJA 3FPUB 5T1GA 3F2UA 1G2TA 1HUMA 2FMMA 4IUVA 1AZPA 1HFNA 1X32A 2EE1A 2L12A 1EL0A 4XT3B 4R9WA 4X3UA 4RWSC 3P7JA 4HCSA 5E4WC 2XIWA 4HEDA 4QUCA 1ICWA 2FINB 1BO0A 2Q8RE 4IUUA 4O42A 5T1IA 1AZQA 1BNZA 2B2WC 3SVMA 5D65A 1ILQA 2K03A 1WTXA 1G6ZA 2MJ8A 5CMDA 1MGSA 1CM9A 1KNAA 2B2YC 2KUMA 2N88A 4CJ2C 1WTRA 2RSOA 3D6WA 4IUTA 1F9PA 2B2UA 1S4ZA 1VMPA 1JE4A 2KOLA 3TZDA 4ZKBB 2M2LA 5E4XA 5AFWA 2RA4A 4IUPA 1WTVA 1WTPA 2FJ2A 2VXWA 1BBXC 4ZLTF 3MTSA 4NW2A 3GV6A 2J7ZA 2DY7A 1PLFA 2MPMA 2MP1A 3LWEA 2B2VA 2MGSA 1NR2A 4MN3A 1PDQA 1EIGA 2CVRA 5CORA 1DONA 4X3SA 1QE6A 1RHPA 2R3ZA 1GUWA 2X69A 2HUGA 1B3AA 1LV9A 1O7YA 3DEOA 1PFMA 2RVLA 5CBAE 1HUNA 2SDFA 2HCCA 2HDMA 1DOLA 1SDFA 2B2TC 4R8IA 1U4LA 1PFBA 3QO2A 2K1BA 1F9RA 2IL8A 1KNEA 2K01A 4OIKA 4OIJA 1WD0A 1X3QA 2H1EA 4HSVA 3DM1A 1RTOA 5D14A 2HDLA 3FDTA 2B2WA 4X3TA 4ZK9B 4RAUC 4ZKCB 2KVMA 3GV3A 4X3KA 1C8CA 1ESRA 3I3CA 3HP3A 3I8ZA 3R93A 2B2YA 1B50A 1DOKA 2KECA 2NWGA 1WTOA 2K28A 1F9QA 1EQTA 3TN2A 1JICA 1U4PA 1X3PA 1IL8A 4RA8A 2B2UC 2KEEA 4XDXA 4IUQA 5JJZA 1RODA 1HFGA 1ZXTA 1O7ZA 3KBXA 3UI2A 2EOTA 1E0BA 3H91A 2JYOA 2D9UA 1DOMA 5EJWA 1O80A 3DEPA 1G91A 2FHTA 4UAIA 2DY8A 5EQ0A 2L1BA 2L9HA 1IKLA 2HCIA 2B2VC 3ONAB 1G2SA 4IURA 1SSOA 2KEDA 2K04A 5EPJA 1WTWA 1HA6A 1EOTA 2NYZD 4MHEA 1CA6A 1Q3LA 5EKIA 1J8IA 1CA5A 1A15A 1ML0D 2B2TA 2L4NA 2X6LA 4QUFA 1ILPA 1WVLA 2Q8TA 1NCVA 1SAPA 4LMQD 1RTNA 2NZ1D 3G7LA 3IFDA 3Q6SA 5COYA 1WTQA 1F9SA 3MWYW
chains in the Genus database with same CATH superfamily
3IL8A 4L8JA 1HZ9A 4B3RQ 1W2BA 1CK1A 2L11A 1JMCA 1PVOA 3M4YA 2MUYA 1IBKQ 2ASBA 2Z8LA 1K28A 3KDFB 4DK0A 3I4NB 3K6OA 4JBMA 3UE0A 3GTGH 5C4XG 4P72A 2ZM6L 1JOOA 2FMMA 3L9AX 4DR2Q 2F0WA 2L12A 1R4PB 2LXKA 3A0JA 3I4OA 4K6DA 3RR5A 4L5SA 2PPBC 3ZJYC 1MJEA 3GP7A 3NBIA 2KQ3A 4KHZA 1VQ7A 3KOJA 1E2ZA 4MTNA 4BY1H 5I6YA 5M5XB 2JA6H 3J80i 3DWQA 1B7YB 3OMCA 2OTJA 2NBFA 2RSOA 3TMEA 1PTOF 1Y1WG 4X6AH 1YITA 1VMPA 3TZDA 4JI5L 2VXWA 4JBJA 1VCIA 1D6EC 2HHHL 3MEHA 4OO1I 4CGYB 2WACA 3GO5A 3TP5A 3CW2C 2J4XA 1O7YA 1LV9A 1FNVA 4OO1G 2Y0SB 3NQTA 2BOSA 4U673 3NQIA 5LL6X 4LFAQ 5K5PA 3T4AC 1W3SA 3D4DA 3V05A 5C4JB 2C35B 5D14A 3FDTA 2B63H 1ESFA 4NPSA 1SYEA 4ZKCB 3CCVA 3HOYB 4PQXA 4DV0L 2R93H 1ESRA 2D2CC 3GTKH 1DOKA 2NVTH 2YU9B 1LUZA 2ZTEA 1CKNA 3M85A 2AHOB 4JI8Q 1TWHB 3DWAA 5FLXL 3H0GG 2QEJC 1U4PA 5BR8L 4OX9Q 1QJOA 2B2UC 3QOJA 1N33L 3MA2B 3MFGA 1VQ8A 1ZXTA 3UI2A 2EOTA 2QA4A 1H9JA 1Q8IA 2WFWA 3S15B 4HN7A 4BS9A 1UNSA 4A93B 5C3XA 4EQPA 4GN4B 2A74C 5I9OA 1SE4A 3NPPA 5IWAQ 5EKIA 2QF7A 2F4VL 4PMBA 5CV9A 1I3QB 1Q1BA 5IYCG 3DXJC 1XWEA 4V190 2CHBD 1N36L 1WCMH 1CSQA 3H6MA 3K7AH 4XTCS 3U9OA 4HAEA 3T1HL 4IALA 1ET6A 1OXTA 4XT1B 3RZDH 1GHKA 5CYUA 5E3FA 2E2IB 4YCVA 4JW0A 2EJMA 4U68A 1H9RA 3FRPB 4DV2L 3R2TA 5BN3A 1STNA 1S40A 2CFMA 4R4TA 2BA1A 4KN7C 3NUCA 2GVBA 1Q86C 2B3GA 2UXCL 1LTSD 3RN5A 1B9NA 1GOZA 4LF8L 1BDOA 5EBCA 4UP9A 4BBSH 4KLKA 3L0OA 4DR6L 2MJ8A 3S1NB 4FP5D 2EVBA 3GTLB 3QG1A 2A1AA 2ZTCA 1YJWA 2GVAA 3AFPA 2D5DA 2WINB 2L55A 4AIMA 1O7IA 4XQQA 4DV7Q 4MN3A 5IP7H 5CORA 1EZ6A 4IPGA 3V96A 3PO2G 4HIKA 1GUWA 1PZJD 2AQ3B 3SE0A 3CQZB 5A35A 4I7ZC 5CBAE 3K8AA 1PH9A 2HCCA 4GNXB 1VF5C 2B2TC 3S24A 2Z0SA 1DGSA 1H9SA 2NVQH 2IL8A 4WJWA 5IGGA 4A3JB 4GZYC 4IQZA 4LF4L 5IP7G 4FF3A 2FMCA 4POGA 2JSOA 1YNND 1HR0Q 1WI5A 4NXNL 3R93A 2JA5H 1K0RA 4A3DB 1JORA 3PIO3 2EY1A 3BDCA 4LF7Q 3S17H 2R92B 3CP0A 4GS3A 5EJWA 2F0SA 1O80A 4OL7A 4YY3Q 2OCEA 4QF4A 3OWFA 1PHJA 3HOWH 2K04A 4BXXH 1NY4A 1CA6A 2N49A 4X65L 1N8RC 2B2TA 2K14A 1MIUA 2XRSD 3FVQA 2P5ZX 5COYA 4A3MH 2PW7A 3LWEA 3VR2A 3MWYW 1FGUA 1RJTA 3BU2A 3K57A 4UHVA 3HOUB 1PH5A 3HOWG 4HJ7A 4BXXG 1VQJA 1T5EA 3F1ZA 3BS1A 1SYDA 2E8GA 2PQAA 1S3OA 5IGBA 4A3MG 1VMCA 2FXQA 1SFOB 1I4RA 1Z7TA 2PNRC 3S2HB 4F87A 4A3KG 1WYDA 2YV5A 2JK8A 2AQ2B 1OXXK 3UDIA 3R3OA 2IHFA 2ZM6Q 1CKOA 4DV6Q 5IODA 1SNMA 1C48A 1EY6A 1F2YA 1VS0A 3EQLC 1P16A 1NMFA 1SE2A 1E3PA 1SNCA 5C4ZA 4LF9L 3RNUA 1YNJD 1TWAH 1HQMC 2IX3A 3CC4A 2I5MX 4YWMA 1JB7A 3HOVH 4C2MB 4RFBA 5I2YA 1M1KC 1I50H 4J1MA 4JI4L 3RZOH 2KHSA 3SR1A 3MTSA 4ZLTF 1IBLL 4J6HA 1IL2A 3SDZA 3CPWA 3P20A 1A2TA 3FKIG 4DK1A 2AMCB 2EQSA 1B3AA 1LABA 4RHRA 1CFMA 1TS2A 2OQKA 3HOVG 4OELB 1SDFA 2F0IA 1PH3A 1KL9A 2K01A 2PZWA 1DYQA 4OIKA 5HURA 4OIJA 4JI1L 4JI6L 2KCNA 3W2DA 4JI3Q 5C4XB 1SBBB 2KECA 2K28A 1AE2A 5G3LF 2A6ED 4DV0Q 3OW2A 1X3PA 2NN6I 3I4NH 1S5CD 1RODA 4FXDA 2A5HA 3PUWA 2E75C 1FNUA 3K5MA 1R9TB 1G8ZD 4KY5A 5DEHA 2NN6G 1Y8NB 1K8MA 1I6HB 2HCIA 1Y1WB 4RCOA 4A3BG 4DR5L 3NTIA 4PZ8A 2BE5D 3GTJB 4GOPB 4KKTA 4BA2I 5IGEA 1QVGA 1SAPA 5C44B 3DM3A 3STBD 5M5XH 1UEBA 4DR4L 3CKIB 1STGA 4HJ5A 4DAMA 1V1QA 2XSCA 4A3EB 1SN8A 1VQ5A 1D2BA 2A8VA 1X3FA 1B70B 4EGVA 3HRZC 3BJUA 2UU9L 3PO3G 3VYTA 1E22A 1B4OA 4Y7NB 1WD1A 3EN2A 2B8FA 3KJPA 1PRTB 1QVFA 2AKWB 2EPBA 2JE6I 2EYJA 2ZTDA 2NZOA 3CCQA 3F2UA 4IJHA 3D4WA 2LFNA 3H0GB 3KLSX 5C4JH 1AH9A 3P7JA 4B3RL 1D5XC 4XIGS 1V1OA 1ICWA 2FINB 2PMZB 5ELNA 2EXDA 1MHWC 3HOYH 2UXCQ 1YHQA 1VDZA 2Y0SG 4LF8Q 2YU9H 5DM73 2KUMA 3J81i 1TWHH 2UUCL 1FD7D 1JE4A 4FXKC 1X3EA 1IW7D 1AEXA 4DR2L 4P73A 4CKEA 3GDEA 3Q22A 1YNNC 4NW2A 3FP9A 4P2CB 2AWNA 3S15H 5J39A 1LO5D 1PRTD 2A6HD 1LTID 1A2UA 4A93H 1B3QA 1EQVA 1EFID 1EY9A 1RKNA 5IIFA 4I65A 3EVQA 3E9IA 2F0OA 4B3ML 2SDFA 3D6CA 1I3QH 4L5QA 3TP7A 3SEBA 1WD0A 3MXGA 2A68D 3FPPA 4A93G 4IPHA 2ICEC 1SYGA 2MNAA 4GNXC 1XPUA 3EIVA 4LF4Q 3SK8A 3CPFA 2ENBA 4DFAA 5M3MG 3QOLA 2E2IH 4NXNQ 5JPMC 3CRLC 3SK4A 1VQIA 2DN8A 1JOQA 2ZXPA 1YI2A 1XNRQ 2JQOA 3T51B 1V1PB 3NEMA 4KV6A 2K5NA 2NZHA 3C2PA 4OXPA 3L2PA 3OOCA 4CDDC 4JOIC 4IURA 1SSOA 5JAVA 3CD6A 1ICFB 4DV3L 4YIJA 3S16B 1D1IA 4IUNA 1CHQD 1TQOA 2R7ZB 3S1NH 2EJGC 4X65Q 3GTLH 1F9SA 3PO2B 1QG7A 5ELFA 4GNXA 1PH2A 1NR4A 4EQNA 4K2KA 2B8GA 2SNSA 1PMRA 3S14B 2SNMA 4DAYB 5ELBA 2DJGC 2EY6A 1YNJC 1A6XA 2JP1A 2ZXRA 1QILA 2HIVA 2JJQA 3K59A 4ID6A 1PH7A 3E5SA 3CQZH 4JCVE 3WDNA 2K05A 3Q23A 1Q12A 1BCPF 2EE1A 3TBIB 3AFQA 5CV7A 5EKLA 1BBWA 1H95A 2HD3A 4KY6A 2CH4W 4A3JH 3J81c 1SR3A 2IW3A 4DUYL 2ICIA 3SK6A 5D3IB 1Q82C 2IHEA 2K03A 5DAUA 5KRUA 4B08A 5CMDA 1OTCA 1LYLA 4A3DH 2N88A 1SEBD 2ALYB 2F0VA 3SGIA 1O7LA 4ZKBB 4HR7B 5E4XA 2R92H 4N9TA 3JAMi 1BBXC 3Q8DA 3T13A 1A3VA 1HHVA 1PYWD 2A6EC 4N8X1 4JI4Q 4X3SA 1IBLQ 2X69A 3F8TA 4L6TB 1BUVT 1JOKA 2XTIA 2R92G 2RHQB 4R8IA 2CWAA 5AJ3L 5M5YB 4H0LC 3VDYA 5LMUQ 3HOUH 3K81C 4A3KB 2K50A 3A8IE 4IPDA 1TY2A 2BE5C 1C8CA 4CBVA 4CKBA 4JI1Q 1HQRD 1QUQB 2MO0A 5GAHC 3STBC 1V8QA 1E1TA 1XXGA 4LW1A 4C1NI 4LNQA 4OEMB 4UP7A 1SFOH 3TEHB 3S2HH 3KBXA 3VR5A 3BVMA 1LACA 1DOMA 1A8VA 3FHWA 5JJLA 2UXDL 1Q8KA 1ZEQX 4POFA 4K6LA 2H4OA 2WIIB 1MD2D 1WTWA 2KEDA 5HY6A 4DAPA 3M4QA 2KHIA 2RCNA 1NNXA 4IN3A 3PUXA 1RTNA 4DR5Q 4FYDA 2E2JB 1UE1A 5M3FG 2JA9A 3FKIB 3J80L 4NB3A 1XPRA 4K8IA 5CBEE 3KF6A 4DR4Q 4YY3L 2G5DA 4C2MH 4GOPC 1NAPA 3VR4A 4HIDA 5LMNW 4ZCKA 4CJ1B 3KUPA 1F2ZA 5JEAJ 3TS2A 1QNKA 1MSGA 5EPKA 1SMXA 2LMCB 3NENA 1IW7C 3A5UA 2X6GA 1HRJA 2I5HA 4EQ5A 4G7ZC 1L0XB 1G2TA 2TMPA 1PTOB 1PRTC 2A6HC 4K5WA 1HNWL 1EWIA 2EYPA 1CZGA 2XIWA 1IHZA 3RLNA 5GROA 1BKBA 5IP9G 5JPNC 4A3CH 4ME5A 1M4VA 5C4XH 1RD9D 1TWGB 2F0QA 3MXNB 3UE1A 3JAMc 1HNZL 5C3WA 5GAEC 3AYHB 4CJ2C 2DNEA 4NDXA 2MO1A 2BA0A 4A3BB 2A68C 2IJ0A 4GOPA 4GLXA 2ID0A 2K5QA 1R9TH 3CAMA 4XYQA 4A3CG 2UUCQ 4ALPA 2VB2X 3GV6A 1YNXA 4DV6L 2F3IA 1I6HH 1Y1WH 1EIGA 1PDQA 2CVRA 1EYAA 1QE6A 3K5OA 4TRDA 3PO3B 2YTVA 3GTJH 1XJVA 2UUBL 5C44H 1PFBA 1PTOD 1QVCA 4B3MQ 1RDPD 4A3EH 1CKMA 1CHPD 4GKKL 1X54A 4OO1H 3BZCA 2XWJB 3RUZA 3GV3A 3VYSA 4Y7NH 4DPGA 5C44G 5IT9c 2KJXA 1DCZA 4A3EG 3GTQB 5NUCA 5GADC 3S1QB 3DEPA 4AH6A 3MAQA 2F0TA 4JI3L 2VUMG 3H0GH 1TS5A 3K0XA 1FR3A 3NTHA 2K5VA 4JI0L 4DV3Q 3NTKA 4KKSA 5C0XH 2OWOA 4N8FA 3TREA 1HNXL 2F0LA 1VF7A 1NUCA 1C7YA 3QJYA 1K83B 4C3HG 3ULLA 4K0KL 1XYIA 1D8LA 1GUSA 5C0XI 1PH1A 2KENA 5IYCH 2IX1A 1PYBA 2C9OA 1EOVA 4TSSA 5C0XG 2RQXA 1M8AA 1N32L 3IAYA 1HZBA 2XNAC 1DZ1A 1FNWA 2O4XA 4KHPL 3S1RB 1NTGA 4IUVA 3CC7A 5BN4A 1X32A 2NB0A 5M3MB 3MC0B 2DNCA 4R4CA 3OSOA 3MEFA 3AQQA 4UP8A 2VW9A 5GAGC 1VQ6A 1CQFA 1V1PA 2B2WC 2NTTA 1TY0A 4IO9A 2L0CA 4DUYQ 1MGSA 2OT2A 4FNFA 1GKHA 4IUTA 5JVG3 2B2UA 3IFTA 4K14A 5C5LA 1LM0A 5A2QE 1WFQA 2J7ZA 1NE3A 4IOAA 2QDLA 1SE3A 2LXJA 3NE5B 1PH8A 2WAQE 3KLSA 3PSIA 1RHPA 4RKBA 2B39A 3M3YB 1XNQL 1BXTA 1L0WA 2Z6KC 2BCOA 4APVA 3HOXG 3S16H 3HKZE 1U4LA 2R7ZH 1AE3A 1GD7A 1TR5A 3JC66 4KN4C 2PNHA 3PO2H 3J81E 1LTAD 4JPBW 2HDLA 2M9VA 4K2LA 2B2WA 5AJ3Q 1X55A 3G6JB 4DU9A 1L2FA 4PMCA 3F2DA 1YHBA 4PZ7A 3S14H 2NWGA 4A3FG 2O5JC 2H5XA 2R7ZG 1VQAA 3KJOA 3U58A 3MVVA 2MQHA 1VQLA 1EZ8A 5ELDA 3HOZB 3ERQA 1Z47A 1IKLA 3LX0A 2DJFC 2R61A 3T1YQ 1SE8A 3A5ZB 4A4IA 2Z6KA 2UXDQ 3TP6A 1VQNA 3OPOA 4PV1C 3HS0C 2Q2TA 1EQRA 1NCVA 1VQ9A 2K52A 5ELOA 3CC2A 1SJED 4EVOA 5KYLA 4IOCA 2RKSA 4HMIA 3CRKC 4PZ6A 1XNRL 2B29A 4BA1I 1AN8A 5TSSA 1KDBA 3OWEB 4CDEC 1LTLA 2CQAA 4H02A 3CCSA 3D8GA 4A3LH 5FKAC 1IYVA 2FFKB 1B53A 3E0EA 1QUQA 2F0HA 3M4OB 5C3EG 1CZWA 1EYDA 1XMOQ 1PXUA 5IYBG 4NP5A 3U4VA 1GUGA 4IFDJ 4XT3B 1CQVA 5M5YH 3PF5A 4HCSA 1K8GA 2JA8G 4A3LG 5FO8B 4DR1Q 4A3KH 5J3BA 1G291 1HNWQ 1X3GA 1WTXA 2F1MA 5JJIA 1PTOC 1B1ZA 3A7AB 4KKUA 1Y69U 2RF4A 1HNZQ 2RA4A 4IUPA 1HJPA 1LTBD 1QNUA 2FJ2A 4Z9CB 1EQQA 3BYYB 1DXMA 4J15A 4ZUJA 5M3FB 1I94L 1DONA 3K5NA 3LGJA 1I4QA 2D62A 1JWUD 3PMFA 1DOLA 1SRUA 2VS1A 4JC0A 1K8OA 3TS0A 1VQKA 1Z6HA 2JN4A 2E2JH 3SHLA 3FKIH 2H1EA 4HJAA 2UUBQ 1RTOA 1Y14B 4KY7A 1R4QB 3V2TA 3JAME 1KLGD 4GKKQ 4O1NA 2OQ0A 1X6OA 3H09A 2WKCA 2UXBQ 2OXPA 3MXNA 2F3VA 5LMNL 5FLMG 1KXLA 3F2CA 1YVCA 4ZYSA 4LWCA 3GTPB 2QGQA 1GJXA 1ASYA 5EQ0A 5LMUL 4R4OA 3KDFA 1PTOH 3VYUA 1ENAA 1RL2A 5JJKA 2VL6A 1I5FA 2K6AA 1YIJA 1FJGQ 3KF8B 4AYBB 2AQ1B 1CI3M 2CQOA 1TWGH 3PIOA 5G3LD 1KAWA 2VQFL 2NN6H 3G7LA 1PZID 1QZGA 1Y8OB 2E5LL 3NBHB 2QCPX 4A3BH 4ZQ3A 4JI0Q 2HT1A 1U5KA 1NJIC 4KJNA 3W5OA 4DV1L 1HNXQ 1T9HA 1N34L 4LK1C 1GVPA 4K0KQ 5IT9E 2ZJPA 1MSHA 4DV5L 3OIPA 2KBNA 4YHHL 4JVZA 3PO3H 1XTDA 1EIHA 4L5RC 3G48A 1N32Q 2QEXA 4R9WA 4X3UA 3I4MG 3VA7A 2O5IC 2HIXA 4KHPQ 4R4IA 1C4QA 2PCFB 3PUZA 3SVMA 3FEWX 1G6ZA 1JE5A 2VUMB 3RD4A 5H1SE 4OWXB 1QB5D 2EYLA 3GTQH 4AQYQ 3BVGA 4R1JA 3ERSX 3S1QH 1QWYA 1PLFA 2MPMA 3W3AA 1NR2A 5IGCA 3ITPA 2JXMB 1A3TA 3PUYA 3SXHA 4C3HB 3I73A 5CV6A 3G71A 4YCUA 2F0EA 3AMUA 5IYDG 1A62A 2LSSA 1XNQQ 4FXGC 4HSVA 3DM1A 1EY5A 2WKDA 1K83H 4ZK9B 2F03A 2PI2A 1NBWA 2F0UA 1WTHA 2F0FA 3OYYA 3BDOA 4HCEA 1HA5A 2IT1A 1JICA 4DR3L 4BBRG 1RF2D 4IUQA 2GN5A 3NP8A 5DM63 4NMZA 4KD4A 2AUKA 1L1OB 1XTCD 3S1RH 1G91A 1S5ED 3ND9A 5M3MH 3TDQA 1TXYA 4OONA 2G9HD 4MHEA 3S1MB 3NXWA 2L4NA 3C3LA 1ILPA 5HGTA 1W6JA 4BY7B 2N8NA 3E6ZX 5CR3A 1KDAA 4FF2A 3L3OC 1J9OA 4KHVA 4RGNA 3RMHA 2G9DA 4ZAIA 1U4MA 3HOXB 1BCPB 1KQSA 1UUPA 3HEJA 3X3NA 1STYA 1KTKA 1TWCB 4DGZA 3N52A 4LUZA 3OW7A 3M3YH 3VA5A 4X62L 4A3GG 3FPUB 4A3IB 5BN5A 4A3FB 3BVZA 1KABA 2J0TD 1PH6A 2KCTA 1PH4A 1MKHA 2R7DA 3OIQA 1EIFA 4QUCA 1G6PA 2F0JA 4J8QA 3S9WA 4K5VA 1ILQA 1CM9A 1LT5D 3WOEA 4QJFA 1E2WA 3D6WA 2EYOA 1SXTA 3BYTB 1KLUD 2KOLA 2LKVA 1NSNS 1BCPD 1GM5A 2OEOA 4IPCA 1O78A 1SLJA 1GUNA 3HOZH 4EQOA 2DY7A 2PQEA 1GUOA 4HMJA 4NXMQ 4JOIA 1S5FD 4RCNA 1RIPA 2A73B 2R7FA 1KHIA 3T16A 1I94Q 4C3JG 2UUAQ 1J6QA 1NMGA 3Q24A 1OXUA 2PW5A 4DK3C 4LFBL 2E74C 3HOZG 3ER0A 3I4LA 2Q2UA 4I7AA 3CMEA 2EDGA 2BH2A 4X3TA 4B9XA 5C3EB 3RN2A 3J7YW 4QGUA 5JOBA 3I3CA 3I8ZA 2E2HB 5L37A 2VQEL 2WB1E 4QIWE 1KRTA 1JCKB 3BZDB 2JA8B 3M4OH 1E0BA 1EEID 4L63B 4TVAB 1UAPA 1Q7YC 3E0JA 2YTXA 2CWPA 5LMNQ 2I5LX 1OXSC 1STBA 2B2VC 4MIUA 4JV5Q 1CA5A 3SK5A 5I6WA 3O13A 5I9PA 1VQBA 3A7LA 4ODGA 5M9OA 1VQFA 3H3VC 2VQFQ 4P71A 1Q81C 1VQOA 1PFNA 3D0FA 2E5LQ 1BF4A 3T1YL 1I4GA 3CHBD 5DNFA 5FLXE 5M3FH 4DV1Q 3PIP3 1N34Q 3QB3A 3KYHC 1MI2A 1WJJA 1GHJA 5E1FA 3KLWA 4DV5Q 3A74A 2ES2A 4TQUS 2I07B 2JA7G 2F0MA 4YHHQ 1X56A 1YHAA 2BDOA 2EY5A 1AZQA 2VNUD 4RGTA 3C1FA 4ILWA 3CCUA 2EXZA 1HTPA 3BZKA 2C5CA 3KF8A 1XMOL 3QWNA 2XRQD 1IXRA 4RGMA 5IP9H 5AFWA 5C6AA 4KI0A 5CGKA 4LUVA 1WTPA 5ELEA 2V1CC 4HSPA 1IBML 3NBHA 3GTPH 2PYKA 4CDCC 2EIFA 4DR1L 1LLRD 3HGBA 1Y1VG 4R8NA 1TIID 3RLOA 4FF1A 5K36G 1TU2B 2K1BA 1F9RA 3H3VI 2HQEA 1X65A 1B9MA 2IWHA 4KJOA 3HZXA 3EA6A 2NVYB 1HH2P 4AYBG 1KC8C 3HP3A 4DKAC 2PMZE 1K9MC 3I4MB 1S5DD 3CCLA 4ZRZA 2R6GA 1TT2A 4QQBX 4QY7A 4WJ3M 2OF1A 5JJZA 1E24A 4GKJL 3H91A 4H13C 1LTRD 2D9UA 4DR3Q 4GN5A 4UAIA 4DNTB 2L9HA 2K5WA 1EY8A 2ZJQA 2JEBI 2NYZD 1J8IA 4MZ9A 1L1OC 2TSSA 1CUKA 4L5TA 4ZUIA 5KIXA 5I4DA 3GTMB 2UXBL 3IFDA 4X66L 1WTQA 1MJCA 2VUMH 1SROA 2F0NA 1YEZA 3VYRA 2NVXB 4S3SA 1AP0A 1W6KA 3I91A 5EPLA 2QW7A 3PIPA 1B2TA 1EY4A 1ZKOA 4DUZL 1K8AC 4P74A 1EY7A 4YWLA 1FJGL 1Q46A 1BQQT 4YWKA 2E2DC 4C3HH 1EY0A 4X64L 1BCPC 1Z9FA 4CHTB 1VQMA 1TVXA 4BY1G 4DN4M 3OTOL 3UDFA 3FMCA 2JA6G 1VQCA 1T5XD 4X62Q 2EYMA 3M7NA 2KCCA 4RWSC 1UWVA 2CW0D 4BBRB 2ZXOA 3DWPA 1L1OA 3ULJA 4DNIA 5T1IA 1JC7A 4QCLA 3P1HA 4RMFA 1SYFA 3ULPA 5J1ZA 3I55A 2CH4A 1JJGA 3K5LA 1X9NA 1B44D 3M7GA 4M1UB 3VR6A 1WTVA 2Q2IA 1HZCA 4PMWA 1SNOA 3Q0AA 2MGSA 4JK1C 4ABNA 2DGYA 4YCWA 2B63G 5FO7B 2RVLA 3S1MH 2F0DA 2IX0A 3BG3A 1SYBA 2R93G 1Q90A 4BY7H 2KCMA 4UPAA 4C3IB 4AQYL 1S5BD 1FL0A 1Y8PB 1SMYD 3QR8A 5KEEA 1XPOA 2EYHA 4LFBQ 4A3GB 3UDGA 1ZYRD 2WP8J 3TSSA 3HOXH 4OWWB 4BY7G 3K80C 5CC4A 4JI2L 5ELCA 1C0AA 1VQ4A 1KIXA 1TWCH 2K33A 5M5WB 2VQEQ 4QMGA 1K73C 4DAYA 3EROA 4A3IH 2FHTA 2F3WA 4A3FH 1Q1EA 1I4HA 4BWGB 4HJ9A 3A55A 5IE8A 1V43A 4FVMA 3I2ZA 4LF6L 1JJCB 1WCMG 1HA6A 1B8AA 1EOTA 2PZTA 3CCEA 1Q3LA 5JEAH 2BH8A 1A15A 2X6LA 2Z4HA 1SNPA 2E76C 3EJIA 3ICEA 5EBDA 3J80c 4A3IG 3MZ5A 1TS3A 4IZ8A 2I0QA 1EU3A 2CKZB 2N55A 3H15A 5LL6S 1PZKD 4P75A 1PFSA 4C3JB 3CXCA 3CF5A 2YYZA 1E1OA 4F7XA 5KGUA 5JEAG 1EWCA 2Z4IA 1ONLA 4KTAA 2OTLA 1F2LA 1U0LA 1EWHA 1XX8A 3F2BA 3W1BA 2ATWA 4LF5L 4F8MA 4C1NK 1N9WA 1OO9B 1QZHA 1HXYD 1D1KA 4DXGA 2EZVA 5T1GA 1PV4A 1SNDA 4BBSG 4DK6C 3DHQA 1EL0A 3LWUA 3J7A5 4JI7L 2CCZA 3CCJA 3U9SA 5C3EH 2Q8RE 3EBEA 3URYA 5C5MA 5IYBH 3T53B 4DNRB 4DR7L 4O2DA 1JWSD 2E2HH 4DAVA 1JQYD 2B2YC 1HZAA 1F9PA 3D3RA 4MTKA 2JA8H 5CV5A 1D5ZC 1GO3E 2M2LA 1H9KA 4JYAL 2IY5B 2XWBB 3S2DB 1ENCA 2MP1A 2K32A 1JB3A 2K5HA 1IBMQ 2LY7A 1A3UA 1UE5A 3TZUA 1LT3D 1PFMA 2KA7A 4A76A 5FK9C 2HDMA 3TP8A 2RDHA 2AWOA 3T56B 2JA5G 2WAQG 1KNEA 1CT1D 4R4QA 1TWFB 2QDBA 3I70A 1JWMD 3HKZG 1IYUA 1G51A 1KAAA 4X3KA 4NXML 4DV4Q 1L0YB 2B2YA 3CU7A 2JA7B 1DM0B 2RDGA 1P8LA 2UUAL 1AFPA 4RA8A 1IL8A 4KMUC 2KEEA 4XDXA 2NTSA 3OHXC 4G4KA 1STEA 4LFCL 1KRSA 3R8BA 5KNDA 4O0AA 4GKJQ 1XMQL 1G2SA 5J22A 5EPJA 3D31A 3PQIA 3NSWA 5FLMH 1HR0W 3MXUA 3QIAA 4QUFA 1WVLA 4WORA 3A54A 3MXPA 1H9MA 1UEAB 3Q6SA 3GTOB 2K5DA 2YTYA 4M8AA 1Y1VB 5FLXc 4FDBA 2CW0C 3PUVA 4B3SL 3VR3A 4X66Q 5D3DA 4CJ0B 2WB1B 5CV8A 4QIWB 4WJ4A 2Q2HA 1K0SA 5A2QL 4JV5L 2VY3A 1FVIA 2L5TA 4KD3A 1UE6A 4JG2A 4DUZQ 1BR9A 3GQBA 2XN9C 2PO4A 5IOCA 1EIYB 2F0PA 3HG9A 3I90A 2L15A 2PZUA 3A8KE 1HUMA 4HIOA 2AUJD 4EX5A 5E7NA 1AZPA 4JI5Q 2Z9HA 4X64Q 3GD7A 2Y0SE 4RH6A 1PA6A 2HHHQ 4RGOS 3OTOQ 2HQLA 5E4WC 1VQPA 4XYOA 4O42A 3K7UC 3KF6B 3MFYA 3J81L 2NVYH 3J81j 1E7ZA 4G57A 4TKOB 2SOBA 3E9HA 4IJLA 1KNAA 3I4MH 5I2XA 1SMYC 4RHSA 1WOCA 3K0YA 5IGDA 1ZYRC 4Q0FA 4RG1A 5F2DA 2MFIA 4CDFC 4B3TL 1LT6D 2R3ZA 3BDLA 3DEOA 3E3XA 1JR0D 3GTGB 5BR8Q 1BBUA 1J5EL 1N33Q 3U4ZA 3NWTA 3GTMH 4H44C 2PI2E 3NHHA 1IYJB 3I4NG 2NVXH 4BY1B 1LTTD 2A69D 5DLQE 1VQDA 5IYDH 3J7AV 2JA6B 1B50A 2F4VQ 3M9BA 3NELA 4FO2A 1EQTA 4MNOA 1KDCA 3NK9A 3NWSA 1DJRD 4JI2Q 1SYCA 1O7ZA 4UDUC 5KNBA 1N36Q 4OGQC 1KD1C 2DY8A 3I7FA 2L1BA 2I46A 3HKSA 5IY0A 2A19A 3T1HQ 1ENFA 4NKLA 4C56C 1DD2A 3DUZA 4BBRH 1IZ6A 5GQOA 3R2IA 4HTHA 5LHY1 1YBYA 4GLVB 4UY8C 4LF6Q 2Z6BA 4JBWA 4LMQD 4V0BA 3TQYA 4DV2Q 2QILA 1F2MA 3I56A 3DLLA 1I6VC 1YZ6A 2ZT9C 3A8JE 3AB9A 4IFDH 2B63B 2RHSB 4CKCA 1IBKL 1K3RA 2R93B 1LT4D 3GTKB 1EYGA 1VQGA 4IFDI 2NVTB 2XGTA 3PF4A 1V9PA 3H94A 5FO9B 1RCVD 2BDNA 4DR6Q 1E2VA 1IKMA 4N9PA 4IFDG 2RSNA 2QKIC 2RCFA 4ME3A 4LF5Q 3KFUA 1A0IA 3PGZA 5HGQA 3HOYG 4K5XA 4C3IH 3KLRA 3J7AF 3TRZA 3X3MA 1CKNB 4HEDA 4K8JA 1PRTF 1ET9A 2V4DA 4IUUA 4A3GH 3IKJA 5KNCA 4JI7Q 1YJ9A 2EYFA 1UE7A 2F4IA 1MBYA 4OWTB 3J80E 1WTRA 3JAML 4DR7Q 3K58A 4C3IG 1TKWB 1WCMB 3K7AB 5M5WH 3IRBA 4KK7A 4RKLA 1EFWA 3L7ZC 1F77A 3RZDB 4JYAQ 1QCBD 2RBMA 4LJZC 3CCMA 2HUGA 2VZAA 2F0GA 4LFAL 4GLAC 3RLFA 3A56A 2F52A 1EUJA 1TS4A 2EY2A 5IGFA 3C1EA 4XQJA 2SEBD 3CCRA 3G4SA 4B9WA 4FF4A 4C3JH 4RAUC 4G7HC 4JI8L 4OX9L 4BBSB 1I4XA 1WTOA 5EKKA 1F9QA 1SJHD 3EFXD 3TN2A 5IT9L 2JEAI 3B6YA 4QB4A 3J7ZC 1C9OA 2JYOA 3HFZB 3LNNA 3CMAA 5IWAL 4H7BA 2K75A 1D5MC 2MHVA 4LFCQ 3C46A 1BVSA 3ONAB 4XQNA 1ASZA 5CV4A 3N6RA 3PV0A 1HCZA 4DXFA 1XMQQ 1K3BC 2RDFA 2Q8TA 1S72A 1STHA 2D0OA 2NVQB 2NZ1D 2K4KA 3I72A 3ZYYX 3UDXA 2XVSA 2WV6D 1U4RA 2O2LD 4ULLA 4QL5A 2Z1CA 1EU4A 3S2DH 2JA5B 2WAQB 5JVH3 4B3SQ 2ZJRA 1H9SB 1U9RA 3KBGA 4LF9Q 4A3JG 1JJ2A 4F88A 3S17B 3HKZB 4WRDA 1GUTA 5FJ8H 5C0XJ 4HJ8A 2D0PA 1SNQA 1HFNA 1OXVA 2Q8IB 5EAYA 4A3DG 1TWFH 2IPKD 4LUOA 3HOWB 5C4HA 1FGBD 3ND8A 1BO0A 1BNZA 5D65A 5FJ8G 4AYBE 2JA7H 4A3MB 1GXDC 1VQEA 2KHJA 3MHBA 1S4ZA 1STAA 4LAAA 3WWVA 4DV7L 1EEFD 4JI6Q 2K7VA 2A69C 1YJNA 1A63A 4E6IA 1D7QA 2B2VA 3DMUA 2F0KA 5ISRA 3HOUG 1HUNA 4B3TQ 2LS01 3QO2A 1JT8A 4WFN3 3GTOH 1II3A 1Y1VH 2NUCA 1X3QA 2DUDA 4DA2A 1J5EQ 1HR0L 2EJFC 3PCOB 4Y52H 2PQAB 5K36H 4HIMA 1AW7A 2KVMA 2M00A 3AEVA 4PNYA 2N3SA 1BOSA 3AU7A 4LF7L 5KYIA 4Q5VA 1TWAB 4XXEA 1FYCA 3W1GA 4GN3B 3HOVB 1HFGA 4A75A 1VQHA 2VB3X 5EGTA 1I50B 5FOBB 3H3VH 3RZOB 1LTGD 3OMGA 3KK7A 1HTLD 2WB1G 1QOHA 1CSPA 3D4RA 3WOFA 2UU9Q 3U50C 4OHJA 1HPCA 2GA4B 1EYCA 3G6EA 4DV4L 1I4PA 1M90C 4JBKA 1ML0D 4PG3A 1CTMA 3M4PA 1PYSB 2N78A 3P75A 4G7OC 4DF7A
chains in the Genus database with same CATH topology
3IL8A 4L8JA 1CK1A 2L11A 3M4YA 2MUYA 2Z8LA 4DK0A 3I4NB 3K6OA 1JOOA 2FMMA 3L9AX 2F0WA 2L12A 1R4PB 4K6DA 2PPBC 3GP7A 3NBIA 2KQ3A 4KHZA 1E2ZA 5I6YA 5M5XB 3DWQA 3OMCA 2NBFA 2RSOA 3TMEA 1PTOF 1VMPA 3TZDA 2VXWA 1VCIA 1D6EC 3MEHA 4OO1I 4CGYB 2WACA 3GO5A 3TP5A 2J4XA 1O7YA 1LV9A 1FNVA 4OO1G 2Y0SB 3NQTA 2BOSA 4U673 3NQIA 5LL6X 5K5PA 3T4AC 3D4DA 3V05A 5C4JB 5D14A 3FDTA 1ESFA 1SYEA 4ZKCB 3HOYB 4PQXA 1ESRA 2D2CC 1DOKA 2YU9B 3M85A 1TWHB 3DWAA 5FLXL 2QEJC 1U4PA 1QJOA 2B2UC 3QOJA 3MA2B 3MFGA 1ZXTA 3UI2A 2EOTA 1H9JA 1Q8IA 3S15B 4HN7A 4BS9A 1UNSA 4A93B 5C3XA 4EQPA 2A74C 5I9OA 1SE4A 3NPPA 5EKIA 2QF7A 4PMBA 5CV9A 1I3QB 1Q1BA 3DXJC 1XWEA 4V190 2CHBD 3H6MA 4XTCS 3U9OA 4HAEA 4IALA 1ET6A 1OXTA 4XT1B 1GHKA 5CYUA 5E3FA 2E2IB 2EJMA 4U68A 1H9RA 3FRPB 3R2TA 5BN3A 1STNA 2BA1A 4KN7C 3NUCA 1LTSD 1B9NA 1GOZA 1BDOA 5EBCA 2MJ8A 3S1NB 4FP5D 2EVBA 3GTLB 3QG1A 2D5DA 2WINB 2L55A 4XQQA 4MN3A 5CORA 1EZ6A 3V96A 1GUWA 1PZJD 2AQ3B 3SE0A 3CQZB 5A35A 4I7ZC 5CBAE 2HCCA 1VF5C 2B2TC 1H9SA 2IL8A 4WJWA 5IGGA 4A3JB 4GZYC 4IQZA 4FF3A 2FMCA 2JSOA 1YNND 3R93A 4A3DB 1JORA 3PIO3 2EY1A 3BDCA 2R92B 5EJWA 2F0SA 1O80A 4OL7A 4QF4A 3OWFA 2K04A 1CA6A 2B2TA 2XRSD 3FVQA 5COYA 2PW7A 3LWEA 3VR2A 3MWYW 1RJTA 3K57A 3HOUB 1T5EA 3BS1A 1SYDA 5IGBA 1VMCA 1SFOB 1I4RA 1Z7TA 2PNRC 3S2HB 4F87A 2AQ2B 1OXXK 3R3OA 5IODA 1SNMA 1C48A 1EY6A 1F2YA 3EQLC 1SE2A 1SNCA 5C4ZA 1YNJD 1HQMC 2IX3A 4C2MB 4RFBA 5I2YA 4J1MA 2KHSA 3SR1A 3MTSA 4ZLTF 4J6HA 3SDZA 3P20A 1A2TA 4DK1A 1B3AA 1LABA 4RHRA 1CFMA 1TS2A 1SDFA 2F0IA 2K01A 2PZWA 4OIKA 1DYQA 5HURA 4OIJA 2KCNA 3W2DA 5C4XB 1SBBB 2KECA 2K28A 5G3LF 2A6ED 1X3PA 2NN6I 1S5CD 1RODA 4FXDA 2A5HA 3PUWA 2E75C 1FNUA 3K5MA 1R9TB 1G8ZD 4KY5A 5DEHA 2NN6G 1Y8NB 1K8MA 1I6HB 2HCIA 1Y1WB 4RCOA 3NTIA 2BE5D 3GTJB 4BA2I 4KKTA 5IGEA 1SAPA 5C44B 3CKIB 1STGA 2XSCA 4A3EB 1D2BA 4EGVA 3HRZC 3VYTA 1B4OA 4Y7NB 1WD1A 2B8FA 1PRTB 2EPBA 2JE6I 2EYJA 3F2UA 3D4WA 2LFNA 3H0GB 3KLSX 3P7JA 1D5XC 4XIGS 1V1OA 1ICWA 2FINB 2PMZB 1VDZA 5DM73 2KUMA 1FD7D 1JE4A 4FXKC 1IW7D 1AEXA 4CKEA 3Q22A 1YNNC 4NW2A 4P2CB 2AWNA 5J39A 1LO5D 1PRTD 2A6HD 1LTID 1A2UA 1EQVA 1EFID 1EY9A 1RKNA 5IIFA 4I65A 3EVQA 2F0OA 2SDFA 3D6CA 3TP7A 3SEBA 1WD0A 3MXGA 2A68D 3FPPA 2ICEC 1SYGA 3SK8A 2ENBA 4DFAA 3QOLA 5JPMC 3CRLC 3SK4A 2DN8A 1JOQA 2ZXPA 3T51B 1V1PB 4KV6A 3C2PA 3OOCA 5JAVA 4IURA 1SSOA 4YIJA 3S16B 1D1IA 4IUNA 1CHQD 1TQOA 2R7ZB 2EJGC 1F9SA 3PO2B 1QG7A 5ELFA 1NR4A 4EQNA 4K2KA 2B8GA 2SNSA 1PMRA 3S14B 2SNMA 5ELBA 2EY6A 1YNJC 1A6XA 2JP1A 2ZXRA 1QILA 3K59A 4ID6A 3E5SA 3WDNA 2K05A 3Q23A 1Q12A 1BCPF 2EE1A 3TBIB 5CV7A 5EKLA 4KY6A 2IW3A 2ICIA 3SK6A 5D3IB 2K03A 5DAUA 5KRUA 4B08A 5CMDA 2N88A 1SEBD 2F0VA 1O7LA 4ZKBB 4HR7B 5E4XA 4N9TA 1BBXC 3T13A 1A3VA 1HHVA 1PYWD 2A6EC 4X3SA 2X69A 4L6TB 1BUVT 1JOKA 4R8IA 5M5YB 4H0LC 4A3KB 3A8IE 1TY2A 2BE5C 1C8CA 4CBVA 4CKBA 1HQRD 1V8QA 1XXGA 4C1NI 3KBXA 3VR5A 3BVMA 1LACA 1DOMA 1ZEQX 4K6LA 2H4OA 2WIIB 1MD2D 1WTWA 2KEDA 4DAPA 4IN3A 3PUXA 1RTNA 4FYDA 2E2JB 3FKIB 3J80L 4K8IA 5CBEE 1NAPA 3VR4A 4CJ1B 3KUPA 1F2ZA 5JEAJ 1QNKA 1MSGA 5EPKA 2LMCB 1IW7C 2X6GA 1HRJA 4G7ZC 1L0XB 1G2TA 2TMPA 1PTOB 1PRTC 2A6HC 4K5WA 2EYPA 2XIWA 1CZGA 1IHZA 5JPNC 4ME5A 1M4VA 1RD9D 1TWGB 2F0QA 5C3WA 4CJ2C 2DNEA 4NDXA 2BA0A 4A3BB 2A68C 2IJ0A 2ID0A 2K5QA 4XYQA 2VB2X 3GV6A 1EIGA 1PDQA 2CVRA 1EYAA 1QE6A 3K5OA 4TRDA 3PO3B 1PFBA 1PTOD 1RDPD 1CHPD 4OO1H 2XWJB 3RUZA 3GV3A 3VYSA 2KJXA 1DCZA 3GTQB 5NUCA 3S1QB 3DEPA 3MAQA 2F0TA 1TS5A 1FR3A 3NTHA 3NTKA 4KKSA 5C0XH 2F0LA 1VF7A 1NUCA 3QJYA 1K83B 4C3HG 1XYIA 1GUSA 5C0XI 2IX1A 2C9OA 4TSSA 5C0XG 2RQXA 1M8AA 3IAYA 2XNAC 1DZ1A 1FNWA 2O4XA 3S1RB 4IUVA 5BN4A 1X32A 2NB0A 5M3MB 3MC0B 2DNCA 3OSOA 1CQFA 1V1PA 2B2WC 2NTTA 1TY0A 2L0CA 1MGSA 2OT2A 4FNFA 4IUTA 5JVG3 2B2UA 3IFTA 4K14A 5C5LA 5A2QE 2J7ZA 1SE3A 3NE5B 3KLSA 1RHPA 4RKBA 2B39A 3M3YB 1BXTA 2BCOA 1U4LA 1TR5A 4KN4C 3J81E 1LTAD 2HDLA 2M9VA 4K2LA 2B2WA 3G6JB 4DU9A 4PMCA 2NWGA 2O5JC 3MVVA 1EZ8A 5ELDA 3HOZB 3ERQA 1Z47A 1IKLA 3LX0A 2R61A 3TP6A 3OPOA 4PV1C 3HS0C 1NCVA 1SJED 4EVOA 5KYLA 2RKSA 4HMIA 3CRKC 4BA1I 1AN8A 5TSSA 1KDBA 3OWEB 2CQAA 3D8GA 5FKAC 1IYVA 2FFKB 1B53A 2F0HA 3M4OB 1CZWA 1EYDA 1PXUA 4NP5A 4IFDJ 1GUGA 4XT3B 1CQVA 4HCSA 5FO8B 1G291 1WTXA 2F1MA 1PTOC 1B1ZA 3A7AB 4KKUA 1Y69U 2RA4A 4IUPA 1LTBD 1QNUA 2FJ2A 4Z9CB 3BYYB 1DXMA 4ZUJA 5M3FB 1DONA 3K5NA 1I4QA 2D62A 1JWUD 3PMFA 1DOLA 1K8OA 1Z6HA 3SHLA 2H1EA 1RTOA 4KY7A 1R4QB 3V2TA 3JAME 1KLGD 4O1NA 3H09A 2WKCA 2OXPA 3MXNA 2F3VA 4ZYSA 3GTPB 1GJXA 5EQ0A 1PTOH 3VYUA 1ENAA 2K6AA 4AYBB 2AQ1B 1CI3M 5G3LD 2NN6H 3G7LA 1PZID 1Y8OB 2QCPX 4ZQ3A 4KJNA 4LK1C 5IT9E 1MSHA 3OIPA 1EIHA 4R9WA 4X3UA 3VA7A 2O5IC 1C4QA 2PCFB 3PUZA 3SVMA 3FEWX 1G6ZA 2VUMB 3RD4A 1QB5D 2EYLA 3BVGA 1QWYA 1PLFA 2MPMA 3W3AA 1NR2A 5IGCA 3ITPA 2JXMB 1A3TA 3PUYA 3SXHA 4C3HB 3I73A 5CV6A 2F0EA 3AMUA 4FXGC 4HSVA 3DM1A 1EY5A 2WKDA 4ZK9B 2F03A 2F0UA 2F0FA 3BDOA 4HCEA 1HA5A 2IT1A 1JICA 1RF2D 4IUQA 3NP8A 5DM63 4NMZA 4KD4A 2AUKA 1XTCD 1G91A 1S5ED 3ND9A 3TDQA 2G9HD 4MHEA 3S1MB 3NXWA 2L4NA 3C3LA 1ILPA 5HGTA 1W6JA 4BY7B 5CR3A 3E6ZX 1KDAA 4FF2A 3L3OC 1J9OA 4KHVA 4RGNA 3RMHA 2G9DA 4ZAIA 1U4MA 3HOXB 1BCPB 1UUPA 3HEJA 3X3NA 1STYA 1KTKA 1TWCB 4DGZA 3N52A 3OW7A 3VA5A 3FPUB 4A3IB 5BN5A 4A3FB 3BVZA 1KABA 2J0TD 3OIQA 4QUCA 2F0JA 4J8QA 3S9WA 4K5VA 1ILQA 1CM9A 1LT5D 3WOEA 1E2WA 3D6WA 2EYOA 1SXTA 3BYTB 1KLUD 2KOLA 2LKVA 1NSNS 1BCPD 2OEOA 1O78A 1GUNA 4EQOA 2DY7A 2PQEA 1GUOA 4HMJA 4RCNA 1S5FD 2A73B 3T16A 4C3JG 3Q24A 1OXUA 2PW5A 2E74C 3I4LA 2EDGA 4X3TA 4B9XA 5C3EB 3J7YW 5JOBA 3I3CA 3I8ZA 2E2HB 1JCKB 3BZDB 2JA8B 1E0BA 1EEID 4L63B 1UAPA 3E0JA 1OXSC 1STBA 2B2VC 4MIUA 1CA5A 3SK5A 5I6WA 3O13A 5I9PA 3A7LA 4ODGA 5M9OA 3H3VC 1PFNA 1BF4A 1I4GA 3CHBD 5DNFA 5FLXE 3PIP3 3QB3A 1MI2A 1GHJA 5E1FA 4TQUS 2I07B 2F0MA 2BDOA 2EY5A 1AZQA 2VNUD 4RGTA 3C1FA 4ILWA 2EXZA 1HTPA 2C5CA 3KF8A 3QWNA 2XRQD 4RGMA 5AFWA 5C6AA 4KI0A 5CGKA 1WTPA 5ELEA 4HSPA 3NBHA 2PYKA 1LLRD 3HGBA 4R8NA 1TIID 4FF1A 5K36G 1TU2B 2K1BA 1F9RA 2HQEA 1B9MA 2IWHA 4KJOA 3HZXA 3EA6A 2NVYB 3HP3A 3I4MB 1S5DD 4ZRZA 2R6GA 1TT2A 2OF1A 5JJZA 3H91A 4H13C 1LTRD 2D9UA 4UAIA 4DNTB 2L9HA 2K5WA 1EY8A 2JEBI 2NYZD 1J8IA 2TSSA 5KIXA 4ZUIA 5I4DA 3GTMB 3IFDA 1WTQA 2F0NA 3VYRA 2NVXB 4S3SA 1AP0A 1W6KA 3I91A 5EPLA 1B2TA 1EY4A 1ZKOA 1EY7A 1BQQT 2E2DC 1EY0A 1BCPC 4CHTB 1TVXA 4DN4M 3FMCA 1T5XD 2EYMA 3M7NA 2KCCA 4RWSC 2CW0D 4BBRB 2ZXOA 3DWPA 5T1IA 1JC7A 4QCLA 3P1HA 1SYFA 5J1ZA 3K5LA 1B44D 3M7GA 4M1UB 3VR6A 1WTVA 4PMWA 1SNOA 3Q0AA 2MGSA 4JK1C 4ABNA 5FO7B 2RVLA 2F0DA 2IX0A 3BG3A 1SYBA 1Q90A 4C3IB 1S5BD 1Y8PB 1SMYD 5KEEA 2EYHA 4A3GB 1ZYRD 2WP8J 3TSSA 5CC4A 5ELCA 2K33A 5M5WB 4QMGA 4DAYA 3EROA 2FHTA 2F3WA 1Q1EA 1I4HA 4BWGB 3A55A 1V43A 4FVMA 1HA6A 1EOTA 2PZTA 1Q3LA 5JEAH 1A15A 2X6LA 2Z4HA 1SNPA 2E76C 3EJIA 5EBDA 3MZ5A 1TS3A 4IZ8A 1EU3A 2N55A 5LL6S 1PZKD 4C3JB 2YYZA 4F7XA 5KGUA 5JEAG 1EWCA 2Z4IA 1ONLA 4KTAA 1F2LA 1EWHA 1XX8A 4F8MA 4C1NK 1OO9B 1HXYD 1D1KA 4DXGA 2EZVA 5T1GA 1SNDA 3DHQA 1EL0A 3LWUA 3U9SA 2Q8RE 3URYA 5C5MA 3T53B 4DNRB 1JWSD 4DAVA 1JQYD 2B2YC 1F9PA 3D3RA 5CV5A 1D5ZC 2M2LA 1H9KA 2XWBB 3S2DB 1ENCA 2MP1A 2K32A 1JB3A 2LY7A 1A3UA 3TZUA 1LT3D 1PFMA 2KA7A 5FK9C 2HDMA 3TP8A 2RDHA 2AWOA 3T56B 1KNEA 1CT1D 1TWFB 2QDBA 3I70A 1JWMD 1IYUA 1KAAA 4X3KA 1L0YB 2B2YA 3CU7A 2JA7B 1DM0B 2RDGA 1AFPA 4RA8A 1IL8A 4KMUC 2KEEA 4XDXA 2NTSA 3OHXC 4G4KA 1STEA 3R8BA 5KNDA 1G2SA 5J22A 5EPJA 3D31A 3NSWA 3MXUA 3QIAA 4QUFA 1WVLA 4WORA 3A54A 3MXPA 1H9MA 1UEAB 3Q6SA 3GTOB 2K5DA 4M8AA 1Y1VB 2CW0C 3PUVA 3VR3A 5D3DA 4CJ0B 2WB1B 5CV8A 4QIWB 5A2QL 2L5TA 4KD3A 1BR9A 3GQBA 2XN9C 2PO4A 5IOCA 2F0PA 3HG9A 3I90A 2PZUA 3A8KE 1HUMA 2AUJD 1AZPA 3GD7A 4RH6A 4RGOS 5E4WC 4XYOA 4O42A 3MFYA 3J81L 4G57A 4TKOB 2SOBA 1KNAA 5I2XA 1SMYC 4RHSA 3K0YA 5IGDA 1ZYRC 4Q0FA 5F2DA 1LT6D 2R3ZA 3BDLA 3DEOA 1JR0D 3GTGB 3NWTA 4H44C 3NHHA 4BY1B 1LTTD 2A69D 3J7AV 2JA6B 1B50A 4FO2A 1EQTA 1KDCA 3NK9A 3NWSA 1DJRD 1SYCA 1O7ZA 4UDUC 5KNBA 4OGQC 2DY8A 2L1BA 2I46A 1ENFA 4NKLA 4C56C 1DD2A 3DUZA 3R2IA 4HTHA 5LHY1 4JBWA 4LMQD 4V0BA 2QILA 1F2MA 1I6VC 3A8JE 2ZT9C 3AB9A 4IFDH 2B63B 4CKCA 2R93B 1LT4D 3GTKB 4IFDI 2NVTB 3H94A 5FO9B 1RCVD 2BDNA 1E2VA 1IKMA 4N9PA 4IFDG 2RSNA 2QKIC 4K5XA 3KLRA 3J7AF 3X3MA 4HEDA 4K8JA 1PRTF 1ET9A 2V4DA 4IUUA 3IKJA 5KNCA 2EYFA 2F4IA 1MBYA 3J80E 1WTRA 3JAML 3K58A 4C3IG 1TKWB 1WCMB 3K7AB 4KK7A 4RKLA 3L7ZC 1F77A 3RZDB 1QCBD 2RBMA 4LJZC 2HUGA 2F0GA 3RLFA 3A56A 1TS4A 2EY2A 5IGFA 3C1EA 4XQJA 2SEBD 4B9WA 4FF4A 4RAUC 4G7HC 4BBSB 1I4XA 1WTOA 5EKKA 1F9QA 1SJHD 3EFXD 3TN2A 5IT9L 2JEAI 4QB4A 2JYOA 3LNNA 4H7BA 2MHVA 1D5MC 3C46A 3ONAB 4XQNA 5CV4A 3N6RA 3PV0A 1HCZA 4DXFA 2RDFA 2Q8TA 1STHA 2NVQB 2NZ1D 3I72A 3ZYYX 2XVSA 2WV6D 1U4RA 2O2LD 4ULLA 2Z1CA 1EU4A 2JA5B 2WAQB 5JVH3 1H9SB 1U9RA 3KBGA 4F88A 3S17B 3HKZB 4WRDA 1GUTA 5C0XJ 1SNQA 1HFNA 1OXVA 2Q8IB 2IPKD 3HOWB 5C4HA 1FGBD 3ND8A 1BO0A 1BNZA 5D65A 4A3MB 1GXDC 3MHBA 1S4ZA 1STAA 4LAAA 1EEFD 2K7VA 2A69C 4E6IA 2B2VA 3DMUA 2F0KA 5ISRA 1HUNA 2LS01 3QO2A 4WFN3 1II3A 2NUCA 1X3QA 4DA2A 2EJFC 5K36H 1AW7A 2KVMA 2M00A 4PNYA 1BOSA 3AU7A 5KYIA 4Q5VA 1TWAB 4XXEA 1FYCA 3HOVB 1HFGA 2VB3X 5EGTA 1I50B 5FOBB 3RZOB 1LTGD 3OMGA 3KK7A 1HTLD 1QOHA 3D4RA 3WOFA 4OHJA 1HPCA 2GA4B 1EYCA 1I4PA 1ML0D 1CTMA 3P75A 4G7OC 4DF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJT A;  2N55 A;  3IL8 A;  1J9O A;  1QG7 A;  5CBE E;  1AP0 A;  4HAE A;  1U4R A;  1XYI A;  1NR4 A;  1PFN A;  3I91 A;  1NAP A;  5EPL A;  4ZAI A;  4CJ0 B;  1U4M A;  1B2T A;  1BF4 A;  1HHV A;  2L11 A;  1B4O A;  1WD1 A;  4XT1 B;  5DNF A;  1F2L A;  4CJ1 B;  3KUP A;  2JP1 A;  1XX8 A;  2BDN A;  1QNK A;  1MSG A;  1MSH A;  5EPK A;  1VMC A;  2FFK B;  1IKM A;  1M8A A;  2EPB A;  3N52 A;  1B53 A;  4U68 A;  1MI2 A;  2RSN A;  1DZ1 A;  3I90 A;  2X6G A;  1EIH A;  1TVX A;  2K05 A;  4DN4 M;  1HRJ A;  3FPU B;  5T1G A;  3F2U A;  1G2T A;  1HUM A;  2FMM A;  4IUV A;  1AZP A;  1HFN A;  1X32 A;  2EE1 A;  2L12 A;  1EL0 A;  4XT3 B;  4R9W A;  4X3U A;  4RWS C;  3P7J A;  4HCS A;  5E4W C;  2XIW A;  4HED A;  4QUC A;  1ICW A;  2FIN B;  1BO0 A;  2Q8R E;  4IUU A;  4O42 A;  5T1I A;  1AZQ A;  1BNZ A;  2B2W C;  3SVM A;  5D65 A;  1ILQ A;  2K03 A;  1WTX A;  1G6Z A;  2MJ8 A;  5CMD A;  1MGS A;  1CM9 A;  1KNA A;  2B2Y C;  2KUM A;  2N88 A;  4CJ2 C;  1WTR A;  2RSO A;  3D6W A;  4IUT A;  1F9P A;  2B2U A;  1S4Z A;  1VMP A;  1JE4 A;  2KOL A;  3TZD A;  4ZKB B;  2M2L A;  5E4X A;  5AFW A;  2RA4 A;  4IUP A;  1WTV A;  1WTP A;  2FJ2 A;  2VXW A;  1BBX C;  4ZLT F;  3MTS A;  4NW2 A;  3GV6 A;  2J7Z A;  2DY7 A;  1PLF A;  2MPM A;  2MP1 A;  3LWE A;  2B2V A;  2MGS A;  1NR2 A;  4MN3 A;  1PDQ A;  1EIG A;  2CVR A;  5COR A;  1DON A;  4X3S A;  1QE6 A;  1RHP A;  2R3Z A;  1GUW A;  2X69 A;  2HUG A;  1B3A A;  1LV9 A;  1O7Y A;  3DEO A;  1PFM A;  2RVL A;  5CBA E;  1HUN A;  2SDF A;  2HCC A;  2HDM A;  1DOL A;  1SDF A;  2B2T C;  4R8I A;  1U4L A;  1PFB A;  3QO2 A;  2K1B A;  1F9R A;  2IL8 A;  1KNE A;  2K01 A;  4OIK A;  4OIJ A;  1WD0 A;  1X3Q A;  2H1E A;  4HSV A;  3DM1 A;  1RTO A;  5D14 A;  2HDL A;  3FDT A;  2B2W A;  4X3T A;  4ZK9 B;  4RAU C;  4ZKC B;  2KVM A;  3GV3 A;  4X3K A;  1C8C A;  1ESR A;  3I3C A;  3HP3 A;  3I8Z A;  3R93 A;  2B2Y A;  1B50 A;  1DOK A;  2KEC A;  2NWG A;  1WTO A;  2K28 A;  1F9Q A;  1EQT A;  3TN2 A;  1JIC A;  1U4P A;  1X3P A;  1IL8 A;  4RA8 A;  2B2U C;  2KEE A;  4XDX A;  4IUQ A;  5JJZ A;  1ROD A;  1HFG A;  1ZXT A;  1O7Z A;  3KBX A;  3UI2 A;  2EOT A;  1E0B A;  3H91 A;  2JYO A;  2D9U A;  1DOM A;  5EJW A;  1O80 A;  3DEP A;  1G91 A;  2FHT A;  4UAI A;  2DY8 A;  5EQ0 A;  2L1B A;  2L9H A;  1IKL A;  2HCI A;  2B2V C;  3ONA B;  1G2S A;  4IUR A;  1SSO A;  2KED A;  2K04 A;  5EPJ A;  1WTW A;  1HA6 A;  1EOT A;  2NYZ D;  4MHE A;  1CA6 A;  1Q3L A;  5EKI A;  1J8I A;  1CA5 A;  1A15 A;  1ML0 D;  2B2T A;  2L4N A;  2X6L A;  4QUF A;  1ILP A;  1WVL A;  2Q8T A;  1NCV A;  1SAP A;  4LMQ D;  1RTN A;  2NZ1 D;  3G7L A;  3IFD A;  3Q6S A;  5COY A;  1WTQ A;  1F9S A;  3MWY W; 
#chains in the Genus database with same CATH topology
 3IL8 A;  4L8J A;  1HZ9 A;  4B3R Q;  1W2B A;  1CK1 A;  2L11 A;  1JMC A;  1PVO A;  3M4Y A;  2MUY A;  1IBK Q;  2ASB A;  2Z8L A;  1K28 A;  3KDF B;  4DK0 A;  3I4N B;  3K6O A;  4JBM A;  3UE0 A;  3GTG H;  5C4X G;  4P72 A;  2ZM6 L;  1JOO A;  2FMM A;  3L9A X;  4DR2 Q;  2F0W A;  2L12 A;  1R4P B;  2LXK A;  3A0J A;  3I4O A;  4K6D A;  3RR5 A;  4L5S A;  2PPB C;  3ZJY C;  1MJE A;  3GP7 A;  3NBI A;  2KQ3 A;  4KHZ A;  1VQ7 A;  3KOJ A;  1E2Z A;  4MTN A;  4BY1 H;  5I6Y A;  5M5X B;  2JA6 H;  3J80 i;  3DWQ A;  1B7Y B;  3OMC A;  2OTJ A;  2NBF A;  2RSO A;  3TME A;  1PTO F;  1Y1W G;  4X6A H;  1YIT A;  1VMP A;  3TZD A;  4JI5 L;  2VXW A;  4JBJ A;  1VCI A;  1D6E C;  2HHH L;  3MEH A;  4OO1 I;  4CGY B;  2WAC A;  3GO5 A;  3TP5 A;  3CW2 C;  2J4X A;  1O7Y A;  1LV9 A;  1FNV A;  4OO1 G;  2Y0S B;  3NQT A;  2BOS A;  4U67 3;  3NQI A;  5LL6 X;  4LFA Q;  5K5P A;  3T4A C;  1W3S A;  3D4D A;  3V05 A;  5C4J B;  2C35 B;  5D14 A;  3FDT A;  2B63 H;  1ESF A;  4NPS A;  1SYE A;  4ZKC B;  3CCV A;  3HOY B;  4PQX A;  4DV0 L;  2R93 H;  1ESR A;  2D2C C;  3GTK H;  1DOK A;  2NVT H;  2YU9 B;  1LUZ A;  2ZTE A;  1CKN A;  3M85 A;  2AHO B;  4JI8 Q;  1TWH B;  3DWA A;  5FLX L;  3H0G G;  2QEJ C;  1U4P A;  5BR8 L;  4OX9 Q;  1QJO A;  2B2U C;  3QOJ A;  1N33 L;  3MA2 B;  3MFG A;  1VQ8 A;  1ZXT A;  3UI2 A;  2EOT A;  2QA4 A;  1H9J A;  1Q8I A;  2WFW A;  3S15 B;  4HN7 A;  4BS9 A;  1UNS A;  4A93 B;  5C3X A;  4EQP A;  4GN4 B;  2A74 C;  5I9O A;  1SE4 A;  3NPP A;  5IWA Q;  5EKI A;  2QF7 A;  2F4V L;  4PMB A;  5CV9 A;  1I3Q B;  1Q1B A;  5IYC G;  3DXJ C;  1XWE A;  4V19 0;  2CHB D;  1N36 L;  1WCM H;  1CSQ A;  3H6M A;  3K7A H;  4XTC S;  3U9O A;  4HAE A;  3T1H L;  4IAL A;  1ET6 A;  1OXT A;  4XT1 B;  3RZD H;  1GHK A;  5CYU A;  5E3F A;  2E2I B;  4YCV A;  4JW0 A;  2EJM A;  4U68 A;  1H9R A;  3FRP B;  4DV2 L;  3R2T A;  5BN3 A;  1STN A;  1S40 A;  2CFM A;  4R4T A;  2BA1 A;  4KN7 C;  3NUC A;  2GVB A;  1Q86 C;  2B3G A;  2UXC L;  1LTS D;  3RN5 A;  1B9N A;  1GOZ A;  4LF8 L;  1BDO A;  5EBC A;  4UP9 A;  4BBS H;  4KLK A;  3L0O A;  4DR6 L;  2MJ8 A;  3S1N B;  4FP5 D;  2EVB A;  3GTL B;  3QG1 A;  2A1A A;  2ZTC A;  1YJW A;  2GVA A;  3AFP A;  2D5D A;  2WIN B;  2L55 A;  4AIM A;  1O7I A;  4XQQ A;  4DV7 Q;  4MN3 A;  5IP7 H;  5COR A;  1EZ6 A;  4IPG A;  3V96 A;  3PO2 G;  4HIK A;  1GUW A;  1PZJ D;  2AQ3 B;  3SE0 A;  3CQZ B;  5A35 A;  4I7Z C;  5CBA E;  3K8A A;  1PH9 A;  2HCC A;  4GNX B;  1VF5 C;  2B2T C;  3S24 A;  2Z0S A;  1DGS A;  1H9S A;  2NVQ H;  2IL8 A;  4WJW A;  5IGG A;  4A3J B;  4GZY C;  4IQZ A;  4LF4 L;  5IP7 G;  4FF3 A;  2FMC A;  4POG A;  2JSO A;  1YNN D;  1HR0 Q;  1WI5 A;  4NXN L;  3R93 A;  2JA5 H;  1K0R A;  4A3D B;  1JOR A;  3PIO 3;  2EY1 A;  3BDC A;  4LF7 Q;  3S17 H;  2R92 B;  3CP0 A;  4GS3 A;  5EJW A;  2F0S A;  1O80 A;  4OL7 A;  4YY3 Q;  2OCE A;  4QF4 A;  3OWF A;  1PHJ A;  3HOW H;  2K04 A;  4BXX H;  1NY4 A;  1CA6 A;  2N49 A;  4X65 L;  1N8R C;  2B2T A;  2K14 A;  1MIU A;  2XRS D;  3FVQ A;  2P5Z X;  5COY A;  4A3M H;  2PW7 A;  3LWE A;  3VR2 A;  3MWY W;  1FGU A;  1RJT A;  3BU2 A;  3K57 A;  4UHV A;  3HOU B;  1PH5 A;  3HOW G;  4HJ7 A;  4BXX G;  1VQJ A;  1T5E A;  3F1Z A;  3BS1 A;  1SYD A;  2E8G A;  2PQA A;  1S3O A;  5IGB A;  4A3M G;  1VMC A;  2FXQ A;  1SFO B;  1I4R A;  1Z7T A;  2PNR C;  3S2H B;  4F87 A;  4A3K G;  1WYD A;  2YV5 A;  2JK8 A;  2AQ2 B;  1OXX K;  3UDI A;  3R3O A;  2IHF A;  2ZM6 Q;  1CKO A;  4DV6 Q;  5IOD A;  1SNM A;  1C48 A;  1EY6 A;  1F2Y A;  1VS0 A;  3EQL C;  1P16 A;  1NMF A;  1SE2 A;  1E3P A;  1SNC A;  5C4Z A;  4LF9 L;  3RNU A;  1YNJ D;  1TWA H;  1HQM C;  2IX3 A;  3CC4 A;  2I5M X;  4YWM A;  1JB7 A;  3HOV H;  4C2M B;  4RFB A;  5I2Y A;  1M1K C;  1I50 H;  4J1M A;  4JI4 L;  3RZO H;  2KHS A;  3SR1 A;  3MTS A;  4ZLT F;  1IBL L;  4J6H A;  1IL2 A;  3SDZ A;  3CPW A;  3P20 A;  1A2T A;  3FKI G;  4DK1 A;  2AMC B;  2EQS A;  1B3A A;  1LAB A;  4RHR A;  1CFM A;  1TS2 A;  2OQK A;  3HOV G;  4OEL B;  1SDF A;  2F0I A;  1PH3 A;  1KL9 A;  2K01 A;  2PZW A;  1DYQ A;  4OIK A;  5HUR A;  4OIJ A;  4JI1 L;  4JI6 L;  2KCN A;  3W2D A;  4JI3 Q;  5C4X B;  1SBB B;  2KEC A;  2K28 A;  1AE2 A;  5G3L F;  2A6E D;  4DV0 Q;  3OW2 A;  1X3P A;  2NN6 I;  3I4N H;  1S5C D;  1ROD A;  4FXD A;  2A5H A;  3PUW A;  2E75 C;  1FNU A;  3K5M A;  1R9T B;  1G8Z D;  4KY5 A;  5DEH A;  2NN6 G;  1Y8N B;  1K8M A;  1I6H B;  2HCI A;  1Y1W B;  4RCO A;  4A3B G;  4DR5 L;  3NTI A;  4PZ8 A;  2BE5 D;  3GTJ B;  4GOP B;  4KKT A;  4BA2 I;  5IGE A;  1QVG A;  1SAP A;  5C44 B;  3DM3 A;  3STB D;  5M5X H;  1UEB A;  4DR4 L;  3CKI B;  1STG A;  4HJ5 A;  4DAM A;  1V1Q A;  2XSC A;  4A3E B;  1SN8 A;  1VQ5 A;  1D2B A;  2A8V A;  1X3F A;  1B70 B;  4EGV A;  3HRZ C;  3BJU A;  2UU9 L;  3PO3 G;  3VYT A;  1E22 A;  1B4O A;  4Y7N B;  1WD1 A;  3EN2 A;  2B8F A;  3KJP A;  1PRT B;  1QVF A;  2AKW B;  2EPB A;  2JE6 I;  2EYJ A;  2ZTD A;  2NZO A;  3CCQ A;  3F2U A;  4IJH A;  3D4W A;  2LFN A;  3H0G B;  3KLS X;  5C4J H;  1AH9 A;  3P7J A;  4B3R L;  1D5X C;  4XIG S;  1V1O A;  1ICW A;  2FIN B;  2PMZ B;  5ELN A;  2EXD A;  1MHW C;  3HOY H;  2UXC Q;  1YHQ A;  1VDZ A;  2Y0S G;  4LF8 Q;  2YU9 H;  5DM7 3;  2KUM A;  3J81 i;  1TWH H;  2UUC L;  1FD7 D;  1JE4 A;  4FXK C;  1X3E A;  1IW7 D;  1AEX A;  4DR2 L;  4P73 A;  4CKE A;  3GDE A;  3Q22 A;  1YNN C;  4NW2 A;  3FP9 A;  4P2C B;  2AWN A;  3S15 H;  5J39 A;  1LO5 D;  1PRT D;  2A6H D;  1LTI D;  1A2U A;  4A93 H;  1B3Q A;  1EQV A;  1EFI D;  1EY9 A;  1RKN A;  5IIF A;  4I65 A;  3EVQ A;  3E9I A;  2F0O A;  4B3M L;  2SDF A;  3D6C A;  1I3Q H;  4L5Q A;  3TP7 A;  3SEB A;  1WD0 A;  3MXG A;  2A68 D;  3FPP A;  4A93 G;  4IPH A;  2ICE C;  1SYG A;  2MNA A;  4GNX C;  1XPU A;  3EIV A;  4LF4 Q;  3SK8 A;  3CPF A;  2ENB A;  4DFA A;  5M3M G;  3QOL A;  2E2I H;  4NXN Q;  5JPM C;  3CRL C;  3SK4 A;  1VQI A;  2DN8 A;  1JOQ A;  2ZXP A;  1YI2 A;  1XNR Q;  2JQO A;  3T51 B;  1V1P B;  3NEM A;  4KV6 A;  2K5N A;  2NZH A;  3C2P A;  4OXP A;  3L2P A;  3OOC A;  4CDD C;  4JOI C;  4IUR A;  1SSO A;  5JAV A;  3CD6 A;  1ICF B;  4DV3 L;  4YIJ A;  3S16 B;  1D1I A;  4IUN A;  1CHQ D;  1TQO A;  2R7Z B;  3S1N H;  2EJG C;  4X65 Q;  3GTL H;  1F9S A;  3PO2 B;  1QG7 A;  5ELF A;  4GNX A;  1PH2 A;  1NR4 A;  4EQN A;  4K2K A;  2B8G A;  2SNS A;  1PMR A;  3S14 B;  2SNM A;  4DAY B;  5ELB A;  2DJG C;  2EY6 A;  1YNJ C;  1A6X A;  2JP1 A;  2ZXR A;  1QIL A;  2HIV A;  2JJQ A;  3K59 A;  4ID6 A;  1PH7 A;  3E5S A;  3CQZ H;  4JCV E;  3WDN A;  2K05 A;  3Q23 A;  1Q12 A;  1BCP F;  2EE1 A;  3TBI B;  3AFQ A;  5CV7 A;  5EKL A;  1BBW A;  1H95 A;  2HD3 A;  4KY6 A;  2CH4 W;  4A3J H;  3J81 c;  1SR3 A;  2IW3 A;  4DUY L;  2ICI A;  3SK6 A;  5D3I B;  1Q82 C;  2IHE A;  2K03 A;  5DAU A;  5KRU A;  4B08 A;  5CMD A;  1OTC A;  1LYL A;  4A3D H;  2N88 A;  1SEB D;  2ALY B;  2F0V A;  3SGI A;  1O7L A;  4ZKB B;  4HR7 B;  5E4X A;  2R92 H;  4N9T A;  3JAM i;  1BBX C;  3Q8D A;  3T13 A;  1A3V A;  1HHV A;  1PYW D;  2A6E C;  4N8X 1;  4JI4 Q;  4X3S A;  1IBL Q;  2X69 A;  3F8T A;  4L6T B;  1BUV T;  1JOK A;  2XTI A;  2R92 G;  2RHQ B;  4R8I A;  2CWA A;  5AJ3 L;  5M5Y B;  4H0L C;  3VDY A;  5LMU Q;  3HOU H;  3K81 C;  4A3K B;  2K50 A;  3A8I E;  4IPD A;  1TY2 A;  2BE5 C;  1C8C A;  4CBV A;  4CKB A;  4JI1 Q;  1HQR D;  1QUQ B;  2MO0 A;  5GAH C;  3STB C;  1V8Q A;  1E1T A;  1XXG A;  4LW1 A;  4C1N I;  4LNQ A;  4OEM B;  4UP7 A;  1SFO H;  3TEH B;  3S2H H;  3KBX A;  3VR5 A;  3BVM A;  1LAC A;  1DOM A;  1A8V A;  3FHW A;  5JJL A;  2UXD L;  1Q8K A;  1ZEQ X;  4POF A;  4K6L A;  2H4O A;  2WII B;  1MD2 D;  1WTW A;  2KED A;  5HY6 A;  4DAP A;  3M4Q A;  2KHI A;  2RCN A;  1NNX A;  4IN3 A;  3PUX A;  1RTN A;  4DR5 Q;  4FYD A;  2E2J B;  1UE1 A;  5M3F G;  2JA9 A;  3FKI B;  3J80 L;  4NB3 A;  1XPR A;  4K8I A;  5CBE E;  3KF6 A;  4DR4 Q;  4YY3 L;  2G5D A;  4C2M H;  4GOP C;  1NAP A;  3VR4 A;  4HID A;  5LMN W;  4ZCK A;  4CJ1 B;  3KUP A;  1F2Z A;  5JEA J;  3TS2 A;  1QNK A;  1MSG A;  5EPK A;  1SMX A;  2LMC B;  3NEN A;  1IW7 C;  3A5U A;  2X6G A;  1HRJ A;  2I5H A;  4EQ5 A;  4G7Z C;  1L0X B;  1G2T A;  2TMP A;  1PTO B;  1PRT C;  2A6H C;  4K5W A;  1HNW L;  1EWI A;  2EYP A;  1CZG A;  2XIW A;  1IHZ A;  3RLN A;  5GRO A;  1BKB A;  5IP9 G;  5JPN C;  4A3C H;  4ME5 A;  1M4V A;  5C4X H;  1RD9 D;  1TWG B;  2F0Q A;  3MXN B;  3UE1 A;  3JAM c;  1HNZ L;  5C3W A;  5GAE C;  3AYH B;  4CJ2 C;  2DNE A;  4NDX A;  2MO1 A;  2BA0 A;  4A3B B;  2A68 C;  2IJ0 A;  4GOP A;  4GLX A;  2ID0 A;  2K5Q A;  1R9T H;  3CAM A;  4XYQ A;  4A3C G;  2UUC Q;  4ALP A;  2VB2 X;  3GV6 A;  1YNX A;  4DV6 L;  2F3I A;  1I6H H;  1Y1W H;  1EIG A;  1PDQ A;  2CVR A;  1EYA A;  1QE6 A;  3K5O A;  4TRD A;  3PO3 B;  2YTV A;  3GTJ H;  1XJV A;  2UUB L;  5C44 H;  1PFB A;  1PTO D;  1QVC A;  4B3M Q;  1RDP D;  4A3E H;  1CKM A;  1CHP D;  4GKK L;  1X54 A;  4OO1 H;  3BZC A;  2XWJ B;  3RUZ A;  3GV3 A;  3VYS A;  4Y7N H;  4DPG A;  5C44 G;  5IT9 c;  2KJX A;  1DCZ A;  4A3E G;  3GTQ B;  5NUC A;  5GAD C;  3S1Q B;  3DEP A;  4AH6 A;  3MAQ A;  2F0T A;  4JI3 L;  2VUM G;  3H0G H;  1TS5 A;  3K0X A;  1FR3 A;  3NTH A;  2K5V A;  4JI0 L;  4DV3 Q;  3NTK A;  4KKS A;  5C0X H;  2OWO A;  4N8F A;  3TRE A;  1HNX L;  2F0L A;  1VF7 A;  1NUC A;  1C7Y A;  3QJY A;  1K83 B;  4C3H G;  3ULL A;  4K0K L;  1XYI A;  1D8L A;  1GUS A;  5C0X I;  1PH1 A;  2KEN A;  5IYC H;  2IX1 A;  1PYB A;  2C9O A;  1EOV A;  4TSS A;  5C0X G;  2RQX A;  1M8A A;  1N32 L;  3IAY A;  1HZB A;  2XNA C;  1DZ1 A;  1FNW A;  2O4X A;  4KHP L;  3S1R B;  1NTG A;  4IUV A;  3CC7 A;  5BN4 A;  1X32 A;  2NB0 A;  5M3M B;  3MC0 B;  2DNC A;  4R4C A;  3OSO A;  3MEF A;  3AQQ A;  4UP8 A;  2VW9 A;  5GAG C;  1VQ6 A;  1CQF A;  1V1P A;  2B2W C;  2NTT A;  1TY0 A;  4IO9 A;  2L0C A;  4DUY Q;  1MGS A;  2OT2 A;  4FNF A;  1GKH A;  4IUT A;  5JVG 3;  2B2U A;  3IFT A;  4K14 A;  5C5L A;  1LM0 A;  5A2Q E;  1WFQ A;  2J7Z A;  1NE3 A;  4IOA A;  2QDL A;  1SE3 A;  2LXJ A;  3NE5 B;  1PH8 A;  2WAQ E;  3KLS A;  3PSI A;  1RHP A;  4RKB A;  2B39 A;  3M3Y B;  1XNQ L;  1BXT A;  1L0W A;  2Z6K C;  2BCO A;  4APV A;  3HOX G;  3S16 H;  3HKZ E;  1U4L A;  2R7Z H;  1AE3 A;  1GD7 A;  1TR5 A;  3JC6 6;  4KN4 C;  2PNH A;  3PO2 H;  3J81 E;  1LTA D;  4JPB W;  2HDL A;  2M9V A;  4K2L A;  2B2W A;  5AJ3 Q;  1X55 A;  3G6J B;  4DU9 A;  1L2F A;  4PMC A;  3F2D A;  1YHB A;  4PZ7 A;  3S14 H;  2NWG A;  4A3F G;  2O5J C;  2H5X A;  2R7Z G;  1VQA A;  3KJO A;  3U58 A;  3MVV A;  2MQH A;  1VQL A;  1EZ8 A;  5ELD A;  3HOZ B;  3ERQ A;  1Z47 A;  1IKL A;  3LX0 A;  2DJF C;  2R61 A;  3T1Y Q;  1SE8 A;  3A5Z B;  4A4I A;  2Z6K A;  2UXD Q;  3TP6 A;  1VQN A;  3OPO A;  4PV1 C;  3HS0 C;  2Q2T A;  1EQR A;  1NCV A;  1VQ9 A;  2K52 A;  5ELO A;  3CC2 A;  1SJE D;  4EVO A;  5KYL A;  4IOC A;  2RKS A;  4HMI A;  3CRK C;  4PZ6 A;  1XNR L;  2B29 A;  4BA1 I;  1AN8 A;  5TSS A;  1KDB A;  3OWE B;  4CDE C;  1LTL A;  2CQA A;  4H02 A;  3CCS A;  3D8G A;  4A3L H;  5FKA C;  1IYV A;  2FFK B;  1B53 A;  3E0E A;  1QUQ A;  2F0H A;  3M4O B;  5C3E G;  1CZW A;  1EYD A;  1XMO Q;  1PXU A;  5IYB G;  4NP5 A;  3U4V A;  1GUG A;  4IFD J;  4XT3 B;  1CQV A;  5M5Y H;  3PF5 A;  4HCS A;  1K8G A;  2JA8 G;  4A3L G;  5FO8 B;  4DR1 Q;  4A3K H;  5J3B A;  1G29 1;  1HNW Q;  1X3G A;  1WTX A;  2F1M A;  5JJI A;  1PTO C;  1B1Z A;  3A7A B;  4KKU A;  1Y69 U;  2RF4 A;  1HNZ Q;  2RA4 A;  4IUP A;  1HJP A;  1LTB D;  1QNU A;  2FJ2 A;  4Z9C B;  1EQQ A;  3BYY B;  1DXM A;  4J15 A;  4ZUJ A;  5M3F B;  1I94 L;  1DON A;  3K5N A;  3LGJ A;  1I4Q A;  2D62 A;  1JWU D;  3PMF A;  1DOL A;  1SRU A;  2VS1 A;  4JC0 A;  1K8O A;  3TS0 A;  1VQK A;  1Z6H A;  2JN4 A;  2E2J H;  3SHL A;  3FKI H;  2H1E A;  4HJA A;  2UUB Q;  1RTO A;  1Y14 B;  4KY7 A;  1R4Q B;  3V2T A;  3JAM E;  1KLG D;  4GKK Q;  4O1N A;  2OQ0 A;  1X6O A;  3H09 A;  2WKC A;  2UXB Q;  2OXP A;  3MXN A;  2F3V A;  5LMN L;  5FLM G;  1KXL A;  3F2C A;  1YVC A;  4ZYS A;  4LWC A;  3GTP B;  2QGQ A;  1GJX A;  1ASY A;  5EQ0 A;  5LMU L;  4R4O A;  3KDF A;  1PTO H;  3VYU A;  1ENA A;  1RL2 A;  5JJK A;  2VL6 A;  1I5F A;  2K6A A;  1YIJ A;  1FJG Q;  3KF8 B;  4AYB B;  2AQ1 B;  1CI3 M;  2CQO A;  1TWG H;  3PIO A;  5G3L D;  1KAW A;  2VQF L;  2NN6 H;  3G7L A;  1PZI D;  1QZG A;  1Y8O B;  2E5L L;  3NBH B;  2QCP X;  4A3B H;  4ZQ3 A;  4JI0 Q;  2HT1 A;  1U5K A;  1NJI C;  4KJN A;  3W5O A;  4DV1 L;  1HNX Q;  1T9H A;  1N34 L;  4LK1 C;  1GVP A;  4K0K Q;  5IT9 E;  2ZJP A;  1MSH A;  4DV5 L;  3OIP A;  2KBN A;  4YHH L;  4JVZ A;  3PO3 H;  1XTD A;  1EIH A;  4L5R C;  3G48 A;  1N32 Q;  2QEX A;  4R9W A;  4X3U A;  3I4M G;  3VA7 A;  2O5I C;  2HIX A;  4KHP Q;  4R4I A;  1C4Q A;  2PCF B;  3PUZ A;  3SVM A;  3FEW X;  1G6Z A;  1JE5 A;  2VUM B;  3RD4 A;  5H1S E;  4OWX B;  1QB5 D;  2EYL A;  3GTQ H;  4AQY Q;  3BVG A;  4R1J A;  3ERS X;  3S1Q H;  1QWY A;  1PLF A;  2MPM A;  3W3A A;  1NR2 A;  5IGC A;  3ITP A;  2JXM B;  1A3T A;  3PUY A;  3SXH A;  4C3H B;  3I73 A;  5CV6 A;  3G71 A;  4YCU A;  2F0E A;  3AMU A;  5IYD G;  1A62 A;  2LSS A;  1XNQ Q;  4FXG C;  4HSV A;  3DM1 A;  1EY5 A;  2WKD A;  1K83 H;  4ZK9 B;  2F03 A;  2PI2 A;  1NBW A;  2F0U A;  1WTH A;  2F0F A;  3OYY A;  3BDO A;  4HCE A;  1HA5 A;  2IT1 A;  1JIC A;  4DR3 L;  4BBR G;  1RF2 D;  4IUQ A;  2GN5 A;  3NP8 A;  5DM6 3;  4NMZ A;  4KD4 A;  2AUK A;  1L1O B;  1XTC D;  3S1R H;  1G91 A;  1S5E D;  3ND9 A;  5M3M H;  3TDQ A;  1TXY A;  4OON A;  2G9H D;  4MHE A;  3S1M B;  3NXW A;  2L4N A;  3C3L A;  1ILP A;  5HGT A;  1W6J A;  4BY7 B;  2N8N A;  3E6Z X;  5CR3 A;  1KDA A;  4FF2 A;  3L3O C;  1J9O A;  4KHV A;  4RGN A;  3RMH A;  2G9D A;  4ZAI A;  1U4M A;  3HOX B;  1BCP B;  1KQS A;  1UUP A;  3HEJ A;  3X3N A;  1STY A;  1KTK A;  1TWC B;  4DGZ A;  3N52 A;  4LUZ A;  3OW7 A;  3M3Y H;  3VA5 A;  4X62 L;  4A3G G;  3FPU B;  4A3I B;  5BN5 A;  4A3F B;  3BVZ A;  1KAB A;  2J0T D;  1PH6 A;  2KCT A;  1PH4 A;  1MKH A;  2R7D A;  3OIQ A;  1EIF A;  4QUC A;  1G6P A;  2F0J A;  4J8Q A;  3S9W A;  4K5V A;  1ILQ A;  1CM9 A;  1LT5 D;  3WOE A;  4QJF A;  1E2W A;  3D6W A;  2EYO A;  1SXT A;  3BYT B;  1KLU D;  2KOL A;  2LKV A;  1NSN S;  1BCP D;  1GM5 A;  2OEO A;  4IPC A;  1O78 A;  1SLJ A;  1GUN A;  3HOZ H;  4EQO A;  2DY7 A;  2PQE A;  1GUO A;  4HMJ A;  4NXM Q;  4JOI A;  1S5F D;  4RCN A;  1RIP A;  2A73 B;  2R7F A;  1KHI A;  3T16 A;  1I94 Q;  4C3J G;  2UUA Q;  1J6Q A;  1NMG A;  3Q24 A;  1OXU A;  2PW5 A;  4DK3 C;  4LFB L;  2E74 C;  3HOZ G;  3ER0 A;  3I4L A;  2Q2U A;  4I7A A;  3CME A;  2EDG A;  2BH2 A;  4X3T A;  4B9X A;  5C3E B;  3RN2 A;  3J7Y W;  4QGU A;  5JOB A;  3I3C A;  3I8Z A;  2E2H B;  5L37 A;  2VQE L;  2WB1 E;  4QIW E;  1KRT A;  1JCK B;  3BZD B;  2JA8 B;  3M4O H;  1E0B A;  1EEI D;  4L63 B;  4TVA B;  1UAP A;  1Q7Y C;  3E0J A;  2YTX A;  2CWP A;  5LMN Q;  2I5L X;  1OXS C;  1STB A;  2B2V C;  4MIU A;  4JV5 Q;  1CA5 A;  3SK5 A;  5I6W A;  3O13 A;  5I9P A;  1VQB A;  3A7L A;  4ODG A;  5M9O A;  1VQF A;  3H3V C;  2VQF Q;  4P71 A;  1Q81 C;  1VQO A;  1PFN A;  3D0F A;  2E5L Q;  1BF4 A;  3T1Y L;  1I4G A;  3CHB D;  5DNF A;  5FLX E;  5M3F H;  4DV1 Q;  3PIP 3;  1N34 Q;  3QB3 A;  3KYH C;  1MI2 A;  1WJJ A;  1GHJ A;  5E1F A;  3KLW A;  4DV5 Q;  3A74 A;  2ES2 A;  4TQU S;  2I07 B;  2JA7 G;  2F0M A;  4YHH Q;  1X56 A;  1YHA A;  2BDO A;  2EY5 A;  1AZQ A;  2VNU D;  4RGT A;  3C1F A;  4ILW A;  3CCU A;  2EXZ A;  1HTP A;  3BZK A;  2C5C A;  3KF8 A;  1XMO L;  3QWN A;  2XRQ D;  1IXR A;  4RGM A;  5IP9 H;  5AFW A;  5C6A A;  4KI0 A;  5CGK A;  4LUV A;  1WTP A;  5ELE A;  2V1C C;  4HSP A;  1IBM L;  3NBH A;  3GTP H;  2PYK A;  4CDC C;  2EIF A;  4DR1 L;  1LLR D;  3HGB A;  1Y1V G;  4R8N A;  1TII D;  3RLO A;  4FF1 A;  5K36 G;  1TU2 B;  2K1B A;  1F9R A;  3H3V I;  2HQE A;  1X65 A;  1B9M A;  2IWH A;  4KJO A;  3HZX A;  3EA6 A;  2NVY B;  1HH2 P;  4AYB G;  1KC8 C;  3HP3 A;  4DKA C;  2PMZ E;  1K9M C;  3I4M B;  1S5D D;  3CCL A;  4ZRZ A;  2R6G A;  1TT2 A;  4QQB X;  4QY7 A;  4WJ3 M;  2OF1 A;  5JJZ A;  1E24 A;  4GKJ L;  3H91 A;  4H13 C;  1LTR D;  2D9U A;  4DR3 Q;  4GN5 A;  4UAI A;  4DNT B;  2L9H A;  2K5W A;  1EY8 A;  2ZJQ A;  2JEB I;  2NYZ D;  1J8I A;  4MZ9 A;  1L1O C;  2TSS A;  1CUK A;  4L5T A;  4ZUI A;  5KIX A;  5I4D A;  3GTM B;  2UXB L;  3IFD A;  4X66 L;  1WTQ A;  1MJC A;  2VUM H;  1SRO A;  2F0N A;  1YEZ A;  3VYR A;  2NVX B;  4S3S A;  1AP0 A;  1W6K A;  3I91 A;  5EPL A;  2QW7 A;  3PIP A;  1B2T A;  1EY4 A;  1ZKO A;  4DUZ L;  1K8A C;  4P74 A;  1EY7 A;  4YWL A;  1FJG L;  1Q46 A;  1BQQ T;  4YWK A;  2E2D C;  4C3H H;  1EY0 A;  4X64 L;  1BCP C;  1Z9F A;  4CHT B;  1VQM A;  1TVX A;  4BY1 G;  4DN4 M;  3OTO L;  3UDF A;  3FMC A;  2JA6 G;  1VQC A;  1T5X D;  4X62 Q;  2EYM A;  3M7N A;  2KCC A;  4RWS C;  1UWV A;  2CW0 D;  4BBR B;  2ZXO A;  3DWP A;  1L1O A;  3ULJ A;  4DNI A;  5T1I A;  1JC7 A;  4QCL A;  3P1H A;  4RMF A;  1SYF A;  3ULP A;  5J1Z A;  3I55 A;  2CH4 A;  1JJG A;  3K5L A;  1X9N A;  1B44 D;  3M7G A;  4M1U B;  3VR6 A;  1WTV A;  2Q2I A;  1HZC A;  4PMW A;  1SNO A;  3Q0A A;  2MGS A;  4JK1 C;  4ABN A;  2DGY A;  4YCW A;  2B63 G;  5FO7 B;  2RVL A;  3S1M H;  2F0D A;  2IX0 A;  3BG3 A;  1SYB A;  2R93 G;  1Q90 A;  4BY7 H;  2KCM A;  4UPA A;  4C3I B;  4AQY L;  1S5B D;  1FL0 A;  1Y8P B;  1SMY D;  3QR8 A;  5KEE A;  1XPO A;  2EYH A;  4LFB Q;  4A3G B;  3UDG A;  1ZYR D;  2WP8 J;  3TSS A;  3HOX H;  4OWW B;  4BY7 G;  3K80 C;  5CC4 A;  4JI2 L;  5ELC A;  1C0A A;  1VQ4 A;  1KIX A;  1TWC H;  2K33 A;  5M5W B;  2VQE Q;  4QMG A;  1K73 C;  4DAY A;  3ERO A;  4A3I H;  2FHT A;  2F3W A;  4A3F H;  1Q1E A;  1I4H A;  4BWG B;  4HJ9 A;  3A55 A;  5IE8 A;  1V43 A;  4FVM A;  3I2Z A;  4LF6 L;  1JJC B;  1WCM G;  1HA6 A;  1B8A A;  1EOT A;  2PZT A;  3CCE A;  1Q3L A;  5JEA H;  2BH8 A;  1A15 A;  2X6L A;  2Z4H A;  1SNP A;  2E76 C;  3EJI A;  3ICE A;  5EBD A;  3J80 c;  4A3I G;  3MZ5 A;  1TS3 A;  4IZ8 A;  2I0Q A;  1EU3 A;  2CKZ B;  2N55 A;  3H15 A;  5LL6 S;  1PZK D;  4P75 A;  1PFS A;  4C3J B;  3CXC A;  3CF5 A;  2YYZ A;  1E1O A;  4F7X A;  5KGU A;  5JEA G;  1EWC A;  2Z4I A;  1ONL A;  4KTA A;  2OTL A;  1F2L A;  1U0L A;  1EWH A;  1XX8 A;  3F2B A;  3W1B A;  2ATW A;  4LF5 L;  4F8M A;  4C1N K;  1N9W A;  1OO9 B;  1QZH A;  1HXY D;  1D1K A;  4DXG A;  2EZV A;  5T1G A;  1PV4 A;  1SND A;  4BBS G;  4DK6 C;  3DHQ A;  1EL0 A;  3LWU A;  3J7A 5;  4JI7 L;  2CCZ A;  3CCJ A;  3U9S A;  5C3E H;  2Q8R E;  3EBE A;  3URY A;  5C5M A;  5IYB H;  3T53 B;  4DNR B;  4DR7 L;  4O2D A;  1JWS D;  2E2H H;  4DAV A;  1JQY D;  2B2Y C;  1HZA A;  1F9P A;  3D3R A;  4MTK A;  2JA8 H;  5CV5 A;  1D5Z C;  1GO3 E;  2M2L A;  1H9K A;  4JYA L;  2IY5 B;  2XWB B;  3S2D B;  1ENC A;  2MP1 A;  2K32 A;  1JB3 A;  2K5H A;  1IBM Q;  2LY7 A;  1A3U A;  1UE5 A;  3TZU A;  1LT3 D;  1PFM A;  2KA7 A;  4A76 A;  5FK9 C;  2HDM A;  3TP8 A;  2RDH A;  2AWO A;  3T56 B;  2JA5 G;  2WAQ G;  1KNE A;  1CT1 D;  4R4Q A;  1TWF B;  2QDB A;  3I70 A;  1JWM D;  3HKZ G;  1IYU A;  1G51 A;  1KAA A;  4X3K A;  4NXM L;  4DV4 Q;  1L0Y B;  2B2Y A;  3CU7 A;  2JA7 B;  1DM0 B;  2RDG A;  1P8L A;  2UUA L;  1AFP A;  4RA8 A;  1IL8 A;  4KMU C;  2KEE A;  4XDX A;  2NTS A;  3OHX C;  4G4K A;  1STE A;  4LFC L;  1KRS A;  3R8B A;  5KND A;  4O0A A;  4GKJ Q;  1XMQ L;  1G2S A;  5J22 A;  5EPJ A;  3D31 A;  3PQI A;  3NSW A;  5FLM H;  1HR0 W;  3MXU A;  3QIA A;  4QUF A;  1WVL A;  4WOR A;  3A54 A;  3MXP A;  1H9M A;  1UEA B;  3Q6S A;  3GTO B;  2K5D A;  2YTY A;  4M8A A;  1Y1V B;  5FLX c;  4FDB A;  2CW0 C;  3PUV A;  4B3S L;  3VR3 A;  4X66 Q;  5D3D A;  4CJ0 B;  2WB1 B;  5CV8 A;  4QIW B;  4WJ4 A;  2Q2H A;  1K0S A;  5A2Q L;  4JV5 L;  2VY3 A;  1FVI A;  2L5T A;  4KD3 A;  1UE6 A;  4JG2 A;  4DUZ Q;  1BR9 A;  3GQB A;  2XN9 C;  2PO4 A;  5IOC A;  1EIY B;  2F0P A;  3HG9 A;  3I90 A;  2L15 A;  2PZU A;  3A8K E;  1HUM A;  4HIO A;  2AUJ D;  4EX5 A;  5E7N A;  1AZP A;  4JI5 Q;  2Z9H A;  4X64 Q;  3GD7 A;  2Y0S E;  4RH6 A;  1PA6 A;  2HHH Q;  4RGO S;  3OTO Q;  2HQL A;  5E4W C;  1VQP A;  4XYO A;  4O42 A;  3K7U C;  3KF6 B;  3MFY A;  3J81 L;  2NVY H;  3J81 j;  1E7Z A;  4G57 A;  4TKO B;  2SOB A;  3E9H A;  4IJL A;  1KNA A;  3I4M H;  5I2X A;  1SMY C;  4RHS A;  1WOC A;  3K0Y A;  5IGD A;  1ZYR C;  4Q0F A;  4RG1 A;  5F2D A;  2MFI A;  4CDF C;  4B3T L;  1LT6 D;  2R3Z A;  3BDL A;  3DEO A;  3E3X A;  1JR0 D;  3GTG B;  5BR8 Q;  1BBU A;  1J5E L;  1N33 Q;  3U4Z A;  3NWT A;  3GTM H;  4H44 C;  2PI2 E;  3NHH A;  1IYJ B;  3I4N G;  2NVX H;  4BY1 B;  1LTT D;  2A69 D;  5DLQ E;  1VQD A;  5IYD H;  3J7A V;  2JA6 B;  1B50 A;  2F4V Q;  3M9B A;  3NEL A;  4FO2 A;  1EQT A;  4MNO A;  1KDC A;  3NK9 A;  3NWS A;  1DJR D;  4JI2 Q;  1SYC A;  1O7Z A;  4UDU C;  5KNB A;  1N36 Q;  4OGQ C;  1KD1 C;  2DY8 A;  3I7F A;  2L1B A;  2I46 A;  3HKS A;  5IY0 A;  2A19 A;  3T1H Q;  1ENF A;  4NKL A;  4C56 C;  1DD2 A;  3DUZ A;  4BBR H;  1IZ6 A;  5GQO A;  3R2I A;  4HTH A;  5LHY 1;  1YBY A;  4GLV B;  4UY8 C;  4LF6 Q;  2Z6B A;  4JBW A;  4LMQ D;  4V0B A;  3TQY A;  4DV2 Q;  2QIL A;  1F2M A;  3I56 A;  3DLL A;  1I6V C;  1YZ6 A;  2ZT9 C;  3A8J E;  3AB9 A;  4IFD H;  2B63 B;  2RHS B;  4CKC A;  1IBK L;  1K3R A;  2R93 B;  1LT4 D;  3GTK B;  1EYG A;  1VQG A;  4IFD I;  2NVT B;  2XGT A;  3PF4 A;  1V9P A;  3H94 A;  5FO9 B;  1RCV D;  2BDN A;  4DR6 Q;  1E2V A;  1IKM A;  4N9P A;  4IFD G;  2RSN A;  2QKI C;  2RCF A;  4ME3 A;  4LF5 Q;  3KFU A;  1A0I A;  3PGZ A;  5HGQ A;  3HOY G;  4K5X A;  4C3I H;  3KLR A;  3J7A F;  3TRZ A;  3X3M A;  1CKN B;  4HED A;  4K8J A;  1PRT F;  1ET9 A;  2V4D A;  4IUU A;  4A3G H;  3IKJ A;  5KNC A;  4JI7 Q;  1YJ9 A;  2EYF A;  1UE7 A;  2F4I A;  1MBY A;  4OWT B;  3J80 E;  1WTR A;  3JAM L;  4DR7 Q;  3K58 A;  4C3I G;  1TKW B;  1WCM B;  3K7A B;  5M5W H;  3IRB A;  4KK7 A;  4RKL A;  1EFW A;  3L7Z C;  1F77 A;  3RZD B;  4JYA Q;  1QCB D;  2RBM A;  4LJZ C;  3CCM A;  2HUG A;  2VZA A;  2F0G A;  4LFA L;  4GLA C;  3RLF A;  3A56 A;  2F52 A;  1EUJ A;  1TS4 A;  2EY2 A;  5IGF A;  3C1E A;  4XQJ A;  2SEB D;  3CCR A;  3G4S A;  4B9W A;  4FF4 A;  4C3J H;  4RAU C;  4G7H C;  4JI8 L;  4OX9 L;  4BBS B;  1I4X A;  1WTO A;  5EKK A;  1F9Q A;  1SJH D;  3EFX D;  3TN2 A;  5IT9 L;  2JEA I;  3B6Y A;  4QB4 A;  3J7Z C;  1C9O A;  2JYO A;  3HFZ B;  3LNN A;  3CMA A;  5IWA L;  4H7B A;  2K75 A;  1D5M C;  2MHV A;  4LFC Q;  3C46 A;  1BVS A;  3ONA B;  4XQN A;  1ASZ A;  5CV4 A;  3N6R A;  3PV0 A;  1HCZ A;  4DXF A;  1XMQ Q;  1K3B C;  2RDF A;  2Q8T A;  1S72 A;  1STH A;  2D0O A;  2NVQ B;  2NZ1 D;  2K4K A;  3I72 A;  3ZYY X;  3UDX A;  2XVS A;  2WV6 D;  1U4R A;  2O2L D;  4ULL A;  4QL5 A;  2Z1C A;  1EU4 A;  3S2D H;  2JA5 B;  2WAQ B;  5JVH 3;  4B3S Q;  2ZJR A;  1H9S B;  1U9R A;  3KBG A;  4LF9 Q;  4A3J G;  1JJ2 A;  4F88 A;  3S17 B;  3HKZ B;  4WRD A;  1GUT A;  5FJ8 H;  5C0X J;  4HJ8 A;  2D0P A;  1SNQ A;  1HFN A;  1OXV A;  2Q8I B;  5EAY A;  4A3D G;  1TWF H;  2IPK D;  4LUO A;  3HOW B;  5C4H A;  1FGB D;  3ND8 A;  1BO0 A;  1BNZ A;  5D65 A;  5FJ8 G;  4AYB E;  2JA7 H;  4A3M B;  1GXD C;  1VQE A;  2KHJ A;  3MHB A;  1S4Z A;  1STA A;  4LAA A;  3WWV A;  4DV7 L;  1EEF D;  4JI6 Q;  2K7V A;  2A69 C;  1YJN A;  1A63 A;  4E6I A;  1D7Q A;  2B2V A;  3DMU A;  2F0K A;  5ISR A;  3HOU G;  1HUN A;  4B3T Q;  2LS0 1;  3QO2 A;  1JT8 A;  4WFN 3;  3GTO H;  1II3 A;  1Y1V H;  2NUC A;  1X3Q A;  2DUD A;  4DA2 A;  1J5E Q;  1HR0 L;  2EJF C;  3PCO B;  4Y52 H;  2PQA B;  5K36 H;  4HIM A;  1AW7 A;  2KVM A;  2M00 A;  3AEV A;  4PNY A;  2N3S A;  1BOS A;  3AU7 A;  4LF7 L;  5KYI A;  4Q5V A;  1TWA B;  4XXE A;  1FYC A;  3W1G A;  4GN3 B;  3HOV B;  1HFG A;  4A75 A;  1VQH A;  2VB3 X;  5EGT A;  1I50 B;  5FOB B;  3H3V H;  3RZO B;  1LTG D;  3OMG A;  3KK7 A;  1HTL D;  2WB1 G;  1QOH A;  1CSP A;  3D4R A;  3WOF A;  2UU9 Q;  3U50 C;  4OHJ A;  1HPC A;  2GA4 B;  1EYC A;  3G6E A;  4DV4 L;  1I4P A;  1M90 C;  4JBK A;  1ML0 D;  4PG3 A;  1CTM A;  3M4P A;  1PYS B;  2N78 A;  3P75 A;  4G7O C;  4DF7 A; 
#chains in the Genus database with same CATH homology
 3IL8 A;  4L8J A;  1CK1 A;  2L11 A;  3M4Y A;  2MUY A;  2Z8L A;  4DK0 A;  3I4N B;  3K6O A;  1JOO A;  2FMM A;  3L9A X;  2F0W A;  2L12 A;  1R4P B;  4K6D A;  2PPB C;  3GP7 A;  3NBI A;  2KQ3 A;  4KHZ A;  1E2Z A;  5I6Y A;  5M5X B;  3DWQ A;  3OMC A;  2NBF A;  2RSO A;  3TME A;  1PTO F;  1VMP A;  3TZD A;  2VXW A;  1VCI A;  1D6E C;  3MEH A;  4OO1 I;  4CGY B;  2WAC A;  3GO5 A;  3TP5 A;  2J4X A;  1O7Y A;  1LV9 A;  1FNV A;  4OO1 G;  2Y0S B;  3NQT A;  2BOS A;  4U67 3;  3NQI A;  5LL6 X;  5K5P A;  3T4A C;  3D4D A;  3V05 A;  5C4J B;  5D14 A;  3FDT A;  1ESF A;  1SYE A;  4ZKC B;  3HOY B;  4PQX A;  1ESR A;  2D2C C;  1DOK A;  2YU9 B;  3M85 A;  1TWH B;  3DWA A;  5FLX L;  2QEJ C;  1U4P A;  1QJO A;  2B2U C;  3QOJ A;  3MA2 B;  3MFG A;  1ZXT A;  3UI2 A;  2EOT A;  1H9J A;  1Q8I A;  3S15 B;  4HN7 A;  4BS9 A;  1UNS A;  4A93 B;  5C3X A;  4EQP A;  2A74 C;  5I9O A;  1SE4 A;  3NPP A;  5EKI A;  2QF7 A;  4PMB A;  5CV9 A;  1I3Q B;  1Q1B A;  3DXJ C;  1XWE A;  4V19 0;  2CHB D;  3H6M A;  4XTC S;  3U9O A;  4HAE A;  4IAL A;  1ET6 A;  1OXT A;  4XT1 B;  1GHK A;  5CYU A;  5E3F A;  2E2I B;  2EJM A;  4U68 A;  1H9R A;  3FRP B;  3R2T A;  5BN3 A;  1STN A;  2BA1 A;  4KN7 C;  3NUC A;  1LTS D;  1B9N A;  1GOZ A;  1BDO A;  5EBC A;  2MJ8 A;  3S1N B;  4FP5 D;  2EVB A;  3GTL B;  3QG1 A;  2D5D A;  2WIN B;  2L55 A;  4XQQ A;  4MN3 A;  5COR A;  1EZ6 A;  3V96 A;  1GUW A;  1PZJ D;  2AQ3 B;  3SE0 A;  3CQZ B;  5A35 A;  4I7Z C;  5CBA E;  2HCC A;  1VF5 C;  2B2T C;  1H9S A;  2IL8 A;  4WJW A;  5IGG A;  4A3J B;  4GZY C;  4IQZ A;  4FF3 A;  2FMC A;  2JSO A;  1YNN D;  3R93 A;  4A3D B;  1JOR A;  3PIO 3;  2EY1 A;  3BDC A;  2R92 B;  5EJW A;  2F0S A;  1O80 A;  4OL7 A;  4QF4 A;  3OWF A;  2K04 A;  1CA6 A;  2B2T A;  2XRS D;  3FVQ A;  5COY A;  2PW7 A;  3LWE A;  3VR2 A;  3MWY W;  1RJT A;  3K57 A;  3HOU B;  1T5E A;  3BS1 A;  1SYD A;  5IGB A;  1VMC A;  1SFO B;  1I4R A;  1Z7T A;  2PNR C;  3S2H B;  4F87 A;  2AQ2 B;  1OXX K;  3R3O A;  5IOD A;  1SNM A;  1C48 A;  1EY6 A;  1F2Y A;  3EQL C;  1SE2 A;  1SNC A;  5C4Z A;  1YNJ D;  1HQM C;  2IX3 A;  4C2M B;  4RFB A;  5I2Y A;  4J1M A;  2KHS A;  3SR1 A;  3MTS A;  4ZLT F;  4J6H A;  3SDZ A;  3P20 A;  1A2T A;  4DK1 A;  1B3A A;  1LAB A;  4RHR A;  1CFM A;  1TS2 A;  1SDF A;  2F0I A;  2K01 A;  2PZW A;  4OIK A;  1DYQ A;  5HUR A;  4OIJ A;  2KCN A;  3W2D A;  5C4X B;  1SBB B;  2KEC A;  2K28 A;  5G3L F;  2A6E D;  1X3P A;  2NN6 I;  1S5C D;  1ROD A;  4FXD A;  2A5H A;  3PUW A;  2E75 C;  1FNU A;  3K5M A;  1R9T B;  1G8Z D;  4KY5 A;  5DEH A;  2NN6 G;  1Y8N B;  1K8M A;  1I6H B;  2HCI A;  1Y1W B;  4RCO A;  3NTI A;  2BE5 D;  3GTJ B;  4BA2 I;  4KKT A;  5IGE A;  1SAP A;  5C44 B;  3CKI B;  1STG A;  2XSC A;  4A3E B;  1D2B A;  4EGV A;  3HRZ C;  3VYT A;  1B4O A;  4Y7N B;  1WD1 A;  2B8F A;  1PRT B;  2EPB A;  2JE6 I;  2EYJ A;  3F2U A;  3D4W A;  2LFN A;  3H0G B;  3KLS X;  3P7J A;  1D5X C;  4XIG S;  1V1O A;  1ICW A;  2FIN B;  2PMZ B;  1VDZ A;  5DM7 3;  2KUM A;  1FD7 D;  1JE4 A;  4FXK C;  1IW7 D;  1AEX A;  4CKE A;  3Q22 A;  1YNN C;  4NW2 A;  4P2C B;  2AWN A;  5J39 A;  1LO5 D;  1PRT D;  2A6H D;  1LTI D;  1A2U A;  1EQV A;  1EFI D;  1EY9 A;  1RKN A;  5IIF A;  4I65 A;  3EVQ A;  2F0O A;  2SDF A;  3D6C A;  3TP7 A;  3SEB A;  1WD0 A;  3MXG A;  2A68 D;  3FPP A;  2ICE C;  1SYG A;  3SK8 A;  2ENB A;  4DFA A;  3QOL A;  5JPM C;  3CRL C;  3SK4 A;  2DN8 A;  1JOQ A;  2ZXP A;  3T51 B;  1V1P B;  4KV6 A;  3C2P A;  3OOC A;  5JAV A;  4IUR A;  1SSO A;  4YIJ A;  3S16 B;  1D1I A;  4IUN A;  1CHQ D;  1TQO A;  2R7Z B;  2EJG C;  1F9S A;  3PO2 B;  1QG7 A;  5ELF A;  1NR4 A;  4EQN A;  4K2K A;  2B8G A;  2SNS A;  1PMR A;  3S14 B;  2SNM A;  5ELB A;  2EY6 A;  1YNJ C;  1A6X A;  2JP1 A;  2ZXR A;  1QIL A;  3K59 A;  4ID6 A;  3E5S A;  3WDN A;  2K05 A;  3Q23 A;  1Q12 A;  1BCP F;  2EE1 A;  3TBI B;  5CV7 A;  5EKL A;  4KY6 A;  2IW3 A;  2ICI A;  3SK6 A;  5D3I B;  2K03 A;  5DAU A;  5KRU A;  4B08 A;  5CMD A;  2N88 A;  1SEB D;  2F0V A;  1O7L A;  4ZKB B;  4HR7 B;  5E4X A;  4N9T A;  1BBX C;  3T13 A;  1A3V A;  1HHV A;  1PYW D;  2A6E C;  4X3S A;  2X69 A;  4L6T B;  1BUV T;  1JOK A;  4R8I A;  5M5Y B;  4H0L C;  4A3K B;  3A8I E;  1TY2 A;  2BE5 C;  1C8C A;  4CBV A;  4CKB A;  1HQR D;  1V8Q A;  1XXG A;  4C1N I;  3KBX A;  3VR5 A;  3BVM A;  1LAC A;  1DOM A;  1ZEQ X;  4K6L A;  2H4O A;  2WII B;  1MD2 D;  1WTW A;  2KED A;  4DAP A;  4IN3 A;  3PUX A;  1RTN A;  4FYD A;  2E2J B;  3FKI B;  3J80 L;  4K8I A;  5CBE E;  1NAP A;  3VR4 A;  4CJ1 B;  3KUP A;  1F2Z A;  5JEA J;  1QNK A;  1MSG A;  5EPK A;  2LMC B;  1IW7 C;  2X6G A;  1HRJ A;  4G7Z C;  1L0X B;  1G2T A;  2TMP A;  1PTO B;  1PRT C;  2A6H C;  4K5W A;  2EYP A;  2XIW A;  1CZG A;  1IHZ A;  5JPN C;  4ME5 A;  1M4V A;  1RD9 D;  1TWG B;  2F0Q A;  5C3W A;  4CJ2 C;  2DNE A;  4NDX A;  2BA0 A;  4A3B B;  2A68 C;  2IJ0 A;  2ID0 A;  2K5Q A;  4XYQ A;  2VB2 X;  3GV6 A;  1EIG A;  1PDQ A;  2CVR A;  1EYA A;  1QE6 A;  3K5O A;  4TRD A;  3PO3 B;  1PFB A;  1PTO D;  1RDP D;  1CHP D;  4OO1 H;  2XWJ B;  3RUZ A;  3GV3 A;  3VYS A;  2KJX A;  1DCZ A;  3GTQ B;  5NUC A;  3S1Q B;  3DEP A;  3MAQ A;  2F0T A;  1TS5 A;  1FR3 A;  3NTH A;  3NTK A;  4KKS A;  5C0X H;  2F0L A;  1VF7 A;  1NUC A;  3QJY A;  1K83 B;  4C3H G;  1XYI A;  1GUS A;  5C0X I;  2IX1 A;  2C9O A;  4TSS A;  5C0X G;  2RQX A;  1M8A A;  3IAY A;  2XNA C;  1DZ1 A;  1FNW A;  2O4X A;  3S1R B;  4IUV A;  5BN4 A;  1X32 A;  2NB0 A;  5M3M B;  3MC0 B;  2DNC A;  3OSO A;  1CQF A;  1V1P A;  2B2W C;  2NTT A;  1TY0 A;  2L0C A;  1MGS A;  2OT2 A;  4FNF A;  4IUT A;  5JVG 3;  2B2U A;  3IFT A;  4K14 A;  5C5L A;  5A2Q E;  2J7Z A;  1SE3 A;  3NE5 B;  3KLS A;  1RHP A;  4RKB A;  2B39 A;  3M3Y B;  1BXT A;  2BCO A;  1U4L A;  1TR5 A;  4KN4 C;  3J81 E;  1LTA D;  2HDL A;  2M9V A;  4K2L A;  2B2W A;  3G6J B;  4DU9 A;  4PMC A;  2NWG A;  2O5J C;  3MVV A;  1EZ8 A;  5ELD A;  3HOZ B;  3ERQ A;  1Z47 A;  1IKL A;  3LX0 A;  2R61 A;  3TP6 A;  3OPO A;  4PV1 C;  3HS0 C;  1NCV A;  1SJE D;  4EVO A;  5KYL A;  2RKS A;  4HMI A;  3CRK C;  4BA1 I;  1AN8 A;  5TSS A;  1KDB A;  3OWE B;  2CQA A;  3D8G A;  5FKA C;  1IYV A;  2FFK B;  1B53 A;  2F0H A;  3M4O B;  1CZW A;  1EYD A;  1PXU A;  4NP5 A;  4IFD J;  1GUG A;  4XT3 B;  1CQV A;  4HCS A;  5FO8 B;  1G29 1;  1WTX A;  2F1M A;  1PTO C;  1B1Z A;  3A7A B;  4KKU A;  1Y69 U;  2RA4 A;  4IUP A;  1LTB D;  1QNU A;  2FJ2 A;  4Z9C B;  3BYY B;  1DXM A;  4ZUJ A;  5M3F B;  1DON A;  3K5N A;  1I4Q A;  2D62 A;  1JWU D;  3PMF A;  1DOL A;  1K8O A;  1Z6H A;  3SHL A;  2H1E A;  1RTO A;  4KY7 A;  1R4Q B;  3V2T A;  3JAM E;  1KLG D;  4O1N A;  3H09 A;  2WKC A;  2OXP A;  3MXN A;  2F3V A;  4ZYS A;  3GTP B;  1GJX A;  5EQ0 A;  1PTO H;  3VYU A;  1ENA A;  2K6A A;  4AYB B;  2AQ1 B;  1CI3 M;  5G3L D;  2NN6 H;  3G7L A;  1PZI D;  1Y8O B;  2QCP X;  4ZQ3 A;  4KJN A;  4LK1 C;  5IT9 E;  1MSH A;  3OIP A;  1EIH A;  4R9W A;  4X3U A;  3VA7 A;  2O5I C;  1C4Q A;  2PCF B;  3PUZ A;  3SVM A;  3FEW X;  1G6Z A;  2VUM B;  3RD4 A;  1QB5 D;  2EYL A;  3BVG A;  1QWY A;  1PLF A;  2MPM A;  3W3A A;  1NR2 A;  5IGC A;  3ITP A;  2JXM B;  1A3T A;  3PUY A;  3SXH A;  4C3H B;  3I73 A;  5CV6 A;  2F0E A;  3AMU A;  4FXG C;  4HSV A;  3DM1 A;  1EY5 A;  2WKD A;  4ZK9 B;  2F03 A;  2F0U A;  2F0F A;  3BDO A;  4HCE A;  1HA5 A;  2IT1 A;  1JIC A;  1RF2 D;  4IUQ A;  3NP8 A;  5DM6 3;  4NMZ A;  4KD4 A;  2AUK A;  1XTC D;  1G91 A;  1S5E D;  3ND9 A;  3TDQ A;  2G9H D;  4MHE A;  3S1M B;  3NXW A;  2L4N A;  3C3L A;  1ILP A;  5HGT A;  1W6J A;  4BY7 B;  5CR3 A;  3E6Z X;  1KDA A;  4FF2 A;  3L3O C;  1J9O A;  4KHV A;  4RGN A;  3RMH A;  2G9D A;  4ZAI A;  1U4M A;  3HOX B;  1BCP B;  1UUP A;  3HEJ A;  3X3N A;  1STY A;  1KTK A;  1TWC B;  4DGZ A;  3N52 A;  3OW7 A;  3VA5 A;  3FPU B;  4A3I B;  5BN5 A;  4A3F B;  3BVZ A;  1KAB A;  2J0T D;  3OIQ A;  4QUC A;  2F0J A;  4J8Q A;  3S9W A;  4K5V A;  1ILQ A;  1CM9 A;  1LT5 D;  3WOE A;  1E2W A;  3D6W A;  2EYO A;  1SXT A;  3BYT B;  1KLU D;  2KOL A;  2LKV A;  1NSN S;  1BCP D;  2OEO A;  1O78 A;  1GUN A;  4EQO A;  2DY7 A;  2PQE A;  1GUO A;  4HMJ A;  4RCN A;  1S5F D;  2A73 B;  3T16 A;  4C3J G;  3Q24 A;  1OXU A;  2PW5 A;  2E74 C;  3I4L A;  2EDG A;  4X3T A;  4B9X A;  5C3E B;  3J7Y W;  5JOB A;  3I3C A;  3I8Z A;  2E2H B;  1JCK B;  3BZD B;  2JA8 B;  1E0B A;  1EEI D;  4L63 B;  1UAP A;  3E0J A;  1OXS C;  1STB A;  2B2V C;  4MIU A;  1CA5 A;  3SK5 A;  5I6W A;  3O13 A;  5I9P A;  3A7L A;  4ODG A;  5M9O A;  3H3V C;  1PFN A;  1BF4 A;  1I4G A;  3CHB D;  5DNF A;  5FLX E;  3PIP 3;  3QB3 A;  1MI2 A;  1GHJ A;  5E1F A;  4TQU S;  2I07 B;  2F0M A;  2BDO A;  2EY5 A;  1AZQ A;  2VNU D;  4RGT A;  3C1F A;  4ILW A;  2EXZ A;  1HTP A;  2C5C A;  3KF8 A;  3QWN A;  2XRQ D;  4RGM A;  5AFW A;  5C6A A;  4KI0 A;  5CGK A;  1WTP A;  5ELE A;  4HSP A;  3NBH A;  2PYK A;  1LLR D;  3HGB A;  4R8N A;  1TII D;  4FF1 A;  5K36 G;  1TU2 B;  2K1B A;  1F9R A;  2HQE A;  1B9M A;  2IWH A;  4KJO A;  3HZX A;  3EA6 A;  2NVY B;  3HP3 A;  3I4M B;  1S5D D;  4ZRZ A;  2R6G A;  1TT2 A;  2OF1 A;  5JJZ A;  3H91 A;  4H13 C;  1LTR D;  2D9U A;  4UAI A;  4DNT B;  2L9H A;  2K5W A;  1EY8 A;  2JEB I;  2NYZ D;  1J8I A;  2TSS A;  5KIX A;  4ZUI A;  5I4D A;  3GTM B;  3IFD A;  1WTQ A;  2F0N A;  3VYR A;  2NVX B;  4S3S A;  1AP0 A;  1W6K A;  3I91 A;  5EPL A;  1B2T A;  1EY4 A;  1ZKO A;  1EY7 A;  1BQQ T;  2E2D C;  1EY0 A;  1BCP C;  4CHT B;  1TVX A;  4DN4 M;  3FMC A;  1T5X D;  2EYM A;  3M7N A;  2KCC A;  4RWS C;  2CW0 D;  4BBR B;  2ZXO A;  3DWP A;  5T1I A;  1JC7 A;  4QCL A;  3P1H A;  1SYF A;  5J1Z A;  3K5L A;  1B44 D;  3M7G A;  4M1U B;  3VR6 A;  1WTV A;  4PMW A;  1SNO A;  3Q0A A;  2MGS A;  4JK1 C;  4ABN A;  5FO7 B;  2RVL A;  2F0D A;  2IX0 A;  3BG3 A;  1SYB A;  1Q90 A;  4C3I B;  1S5B D;  1Y8P B;  1SMY D;  5KEE A;  2EYH A;  4A3G B;  1ZYR D;  2WP8 J;  3TSS A;  5CC4 A;  5ELC A;  2K33 A;  5M5W B;  4QMG A;  4DAY A;  3ERO A;  2FHT A;  2F3W A;  1Q1E A;  1I4H A;  4BWG B;  3A55 A;  1V43 A;  4FVM A;  1HA6 A;  1EOT A;  2PZT A;  1Q3L A;  5JEA H;  1A15 A;  2X6L A;  2Z4H A;  1SNP A;  2E76 C;  3EJI A;  5EBD A;  3MZ5 A;  1TS3 A;  4IZ8 A;  1EU3 A;  2N55 A;  5LL6 S;  1PZK D;  4C3J B;  2YYZ A;  4F7X A;  5KGU A;  5JEA G;  1EWC A;  2Z4I A;  1ONL A;  4KTA A;  1F2L A;  1EWH A;  1XX8 A;  4F8M A;  4C1N K;  1OO9 B;  1HXY D;  1D1K A;  4DXG A;  2EZV A;  5T1G A;  1SND A;  3DHQ A;  1EL0 A;  3LWU A;  3U9S A;  2Q8R E;  3URY A;  5C5M A;  3T53 B;  4DNR B;  1JWS D;  4DAV A;  1JQY D;  2B2Y C;  1F9P A;  3D3R A;  5CV5 A;  1D5Z C;  2M2L A;  1H9K A;  2XWB B;  3S2D B;  1ENC A;  2MP1 A;  2K32 A;  1JB3 A;  2LY7 A;  1A3U A;  3TZU A;  1LT3 D;  1PFM A;  2KA7 A;  5FK9 C;  2HDM A;  3TP8 A;  2RDH A;  2AWO A;  3T56 B;  1KNE A;  1CT1 D;  1TWF B;  2QDB A;  3I70 A;  1JWM D;  1IYU A;  1KAA A;  4X3K A;  1L0Y B;  2B2Y A;  3CU7 A;  2JA7 B;  1DM0 B;  2RDG A;  1AFP A;  4RA8 A;  1IL8 A;  4KMU C;  2KEE A;  4XDX A;  2NTS A;  3OHX C;  4G4K A;  1STE A;  3R8B A;  5KND A;  1G2S A;  5J22 A;  5EPJ A;  3D31 A;  3NSW A;  3MXU A;  3QIA A;  4QUF A;  1WVL A;  4WOR A;  3A54 A;  3MXP A;  1H9M A;  1UEA B;  3Q6S A;  3GTO B;  2K5D A;  4M8A A;  1Y1V B;  2CW0 C;  3PUV A;  3VR3 A;  5D3D A;  4CJ0 B;  2WB1 B;  5CV8 A;  4QIW B;  5A2Q L;  2L5T A;  4KD3 A;  1BR9 A;  3GQB A;  2XN9 C;  2PO4 A;  5IOC A;  2F0P A;  3HG9 A;  3I90 A;  2PZU A;  3A8K E;  1HUM A;  2AUJ D;  1AZP A;  3GD7 A;  4RH6 A;  4RGO S;  5E4W C;  4XYO A;  4O42 A;  3MFY A;  3J81 L;  4G57 A;  4TKO B;  2SOB A;  1KNA A;  5I2X A;  1SMY C;  4RHS A;  3K0Y A;  5IGD A;  1ZYR C;  4Q0F A;  5F2D A;  1LT6 D;  2R3Z A;  3BDL A;  3DEO A;  1JR0 D;  3GTG B;  3NWT A;  4H44 C;  3NHH A;  4BY1 B;  1LTT D;  2A69 D;  3J7A V;  2JA6 B;  1B50 A;  4FO2 A;  1EQT A;  1KDC A;  3NK9 A;  3NWS A;  1DJR D;  1SYC A;  1O7Z A;  4UDU C;  5KNB A;  4OGQ C;  2DY8 A;  2L1B A;  2I46 A;  1ENF A;  4NKL A;  4C56 C;  1DD2 A;  3DUZ A;  3R2I A;  4HTH A;  5LHY 1;  4JBW A;  4LMQ D;  4V0B A;  2QIL A;  1F2M A;  1I6V C;  3A8J E;  2ZT9 C;  3AB9 A;  4IFD H;  2B63 B;  4CKC A;  2R93 B;  1LT4 D;  3GTK B;  4IFD I;  2NVT B;  3H94 A;  5FO9 B;  1RCV D;  2BDN A;  1E2V A;  1IKM A;  4N9P A;  4IFD G;  2RSN A;  2QKI C;  4K5X A;  3KLR A;  3J7A F;  3X3M A;  4HED A;  4K8J A;  1PRT F;  1ET9 A;  2V4D A;  4IUU A;  3IKJ A;  5KNC A;  2EYF A;  2F4I A;  1MBY A;  3J80 E;  1WTR A;  3JAM L;  3K58 A;  4C3I G;  1TKW B;  1WCM B;  3K7A B;  4KK7 A;  4RKL A;  3L7Z C;  1F77 A;  3RZD B;  1QCB D;  2RBM A;  4LJZ C;  2HUG A;  2F0G A;  3RLF A;  3A56 A;  1TS4 A;  2EY2 A;  5IGF A;  3C1E A;  4XQJ A;  2SEB D;  4B9W A;  4FF4 A;  4RAU C;  4G7H C;  4BBS B;  1I4X A;  1WTO A;  5EKK A;  1F9Q A;  1SJH D;  3EFX D;  3TN2 A;  5IT9 L;  2JEA I;  4QB4 A;  2JYO A;  3LNN A;  4H7B A;  2MHV A;  1D5M C;  3C46 A;  3ONA B;  4XQN A;  5CV4 A;  3N6R A;  3PV0 A;  1HCZ A;  4DXF A;  2RDF A;  2Q8T A;  1STH A;  2NVQ B;  2NZ1 D;  3I72 A;  3ZYY X;  2XVS A;  2WV6 D;  1U4R A;  2O2L D;  4ULL A;  2Z1C A;  1EU4 A;  2JA5 B;  2WAQ B;  5JVH 3;  1H9S B;  1U9R A;  3KBG A;  4F88 A;  3S17 B;  3HKZ B;  4WRD A;  1GUT A;  5C0X J;  1SNQ A;  1HFN A;  1OXV A;  2Q8I B;  2IPK D;  3HOW B;  5C4H A;  1FGB D;  3ND8 A;  1BO0 A;  1BNZ A;  5D65 A;  4A3M B;  1GXD C;  3MHB A;  1S4Z A;  1STA A;  4LAA A;  1EEF D;  2K7V A;  2A69 C;  4E6I A;  2B2V A;  3DMU A;  2F0K A;  5ISR A;  1HUN A;  2LS0 1;  3QO2 A;  4WFN 3;  1II3 A;  2NUC A;  1X3Q A;  4DA2 A;  2EJF C;  5K36 H;  1AW7 A;  2KVM A;  2M00 A;  4PNY A;  1BOS A;  3AU7 A;  5KYI A;  4Q5V A;  1TWA B;  4XXE A;  1FYC A;  3HOV B;  1HFG A;  2VB3 X;  5EGT A;  1I50 B;  5FOB B;  3RZO B;  1LTG D;  3OMG A;  3KK7 A;  1HTL D;  1QOH A;  3D4R A;  3WOF A;  4OHJ A;  1HPC A;  2GA4 B;  1EYC A;  1I4P A;  1ML0 D;  1CTM A;  3P75 A;  4G7O C;  4DF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...