2L12A

Solution nmr structure of the chromobox protein 7 with h3k9me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Chromobox homolog 7
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l12A00
2X6GA 4RWSC 1O7ZA 1ZXTA 2Q8RE 3I8ZA 1B2TA 4X3KA 1U4PA 1HFNA 2JYOA 1F2LA 1WTWA 2FMMA 2L9HA 3DM1A 1ESRA 2NYZD 3MTSA 1WD1A 1IKLA 3SVMA 3UI2A 1B53A 1AZPA 4R8IA 4ZLTF 2B2VA 2X6LA 4LMQD 1DZ1A 1EQTA 3TZDA 2MJ8A 2CVRA 5EPKA 5T1IA 1JE4A 2NWGA 3I91A 4ZK9B 1ILQA 2IL8A 3P7JA 1A15A 1NAPA 1QE6A 1BNZA 4O42A 5E4WC 4ZKCB 1RTOA 3KUPA 5JJZA 1RTNA 2B2TC 2JP1A 1MI2A 4CJ0B 4QUCA 1O7YA 4NW2A 2D9UA 1SSOA 4OIKA 2HDMA 1J8IA 4RA8A 2K28A 4XDXA 2HDLA 1WTVA 2FFKB 1VMCA 3F2UA 3FPUB 1ILPA 1LV9A 5CORA 1MSHA 2EPBA 2L11A 1G2TA 5D65A 4MHEA 2L12A 1SDFA 3TN2A 1F9PA 2B2UA 2NZ1D 2K05A 2H1EA 2L1BA 3QO2A 2DY8A 3FDTA 1HRJA 4IURA 2RSOA 2KECA 2B2WC 1CM9A 2K1BA 5EPJA 1WVLA 2RA4A 3HP3A 4HSVA 1CA6A 1CA5A 1F9QA 1DONA 4CJ1B 5EJWA 2B2YA 5D14A 3G7LA 1F9RA 1KNEA 2HCCA 4ZAIA 2K04A 2B2UC 3R93A 1B50A 1HA6A 1EIGA 1HUMA 1EOTA 4HAEA 2SDFA 2N55A 1PFNA 3DEPA 1NR2A 1U4LA 1SAPA 1QNKA 2KUMA 2DY7A 4IUTA 4XT3B 1HHVA 1HUNA 1MGSA 2J7ZA 1AP0A 1RHPA 1QG7A 2B2YC 2EE1A 4RAUC 5T1GA 1B4OA 1KNAA 1WTRA 1Q3LA 2MPMA 1ICWA 2K03A 2KEDA 2L4NA 1XX8A 2EOTA 1U4RA 3GV6A 3I3CA 1TVXA 4HCSA 5DNFA 1PFBA 2RSNA 3N52A 4U68A 1WTOA 3KBXA 1DOKA 1VMPA 1BBXC 2KEEA 5CBAE 5E4XA 2FHTA 4HEDA 1O80A 1PLFA 2R3ZA 2X69A 1EL0A 3I90A 3D6WA 1M8AA 3IL8A 4OIJA 1X3PA 4XT1B 5AFWA 4ZKBB 1GUWA 3LWEA 2B2TA 1HFGA 1BO0A 4R9WA 5EPLA 1X32A 1RJTA 4X3SA 1G6ZA 5EQ0A 4DN4M 4IUQA 1C8CA 1J9OA 1AZQA 1G91A 1F9SA 3GV3A 1WTXA 4IUPA 1DOLA 2RVLA 3ONAB 4X3TA 1G2SA 2KVMA 2MGSA 1IKMA 1B3AA 1JICA 2KOLA 2XIWA 1XYIA 1X3QA 2K01A 4MN3A 2HUGA 3H91A 2VXWA 3IFDA 4X3UA 1PFMA 1WTPA 1U4MA 1IL8A 1MSGA 1S4ZA 1DOMA 2FJ2A 1ML0D 2FINB 5COYA 4QUFA 3MWYW 4CJ2C 1NCVA 2B2WA 2N88A 5CMDA 1EIHA 1E0BA 5EKIA 1WTQA 4IUUA 2Q8TA 2MP1A 2HCIA 2M2LA 3DEOA 1NR4A 1RODA 1BF4A 5CBEE 3Q6SA 1WD0A 2B2VC 4UAIA 1PDQA 2BDNA 4IUVA
chains in the Genus database with same CATH superfamily
2VS1A 1GUTA 2L55A 3ERSX 3FPPA 4A3GG 2B8GA 1D2BA 1VQ5A 1M1KC 3K6OA 1KHIA 1ESRA 2SOBA 4WJWA 1QZGA 2DGYA 3BZKA 4R8IA 3T1YQ 1B7YB 1HCZA 4DV7Q 1HZ9A 1I3QB 3EBEA 1A6XA 5EPKA 1XMQQ 5HGTA 3I91A 4DV6Q 1MHWC 4A75A 1CHQD 3Q8DA 5G3LD 3OYYA 5ELFA 3OSOA 1DGSA 1WTHA 5EAYA 4A3GH 4MZ9A 1KAWA 2HDMA 1J8IA 3HKZG 3TP6A 2CWAA 2N49A 2Z8LA 5C6AA 4DR2Q 2QEXA 1LO5D 2F0MA 2O2LD 3J80i 3CRKC 1SYFA 3P75A 4QB4A 1LACA 3A8KE 3STBC 4A3JG 4K14A 2EDGA 3M4QA 2WB1E 2WAQE 3S2DH 4AIMA 5LL6S 3R2IA 1SJED 1JJ2A 3MAQA 2HCCA 4X66Q 3RLFA 3KLSA 3IKJA 2SDFA 2V1CC 4PZ6A 1SAPA 5M5YB 3CCUA 1HUNA 1I6HB 4CDDC 5E7NA 3MHBA 2E74C 5C44G 3CF5A 1XX8A 2JK8A 2ZM6Q 4GOPB 4U68A 3GTJH 2JA5B 5M9OA 4H02A 3JAME 4FF3A 1I3QH 1X3GA 5E4XA 2FHTA 4KKTA 3IL8A 4YWKA 1X3PA 2PQAB 2ID0A 3LWEA 2UUAQ 1OXUA 5J1ZA 4A3GB 2B63G 3T4AC 1LT3D 5BN4A 2Q2HA 1CK1A 4KN4C 3OWFA 2EYHA 4X3TA 1G2SA 4DR5L 2OWOA 3R8BA 1N33L 4RKLA 5I9OA 4TRDA 1K83H 1TWHB 1PFMA 4BBSB 1S72A 4KMUC 5KNDA 5IYCG 4A3CH 2VUMH 4LUZA 4LF6L 2E2JH 2N88A 2NN6H 4ZCKA 2R92H 2ZTDA 3KBGA 3CCMA 1E1TA 1IBKL 4PMCA 2AWNA 4B3TL 5DLQE 1WD0A 4J6HA 1IBLQ 2QEJC 3B6YA 1TWFB 2X6GA 4YWMA 4K5WA 4KHZA 2Z9HA 2Y0SB 4KI0A 1EIYB 3MEFA 4OO1I 2R7FA 5TSSA 1SFOH 3M85A 1L2FA 3PGZA 2F4IA 3QG1A 1JB3A 4LF5L 3D0FA 1PTOH 4XYOA 3F2CA 4DUYL 3E9HA 3K58A 1B70B 1AW7A 1MJCA 2K5VA 3FPUB 5IGFA 4JI5Q 4EQ5A 4KD3A 4HJAA 1CQVA 1DYQA 3EN2A 5BN3A 3G71A 3ULPA 1WVLA 3HZXA 3DMUA 3HP3A 1I94L 1A62A 4UHVA 1H9SB 2Z1CA 3PIPA 4JC0A 1I4QA 2HD3A 1EWCA 2MHVA 2UUBL 1SYEA 2ZJRA 1G51A 2N55A 3DEPA 2KUMA 1PH1A 1MGSA 5C3EB 1Y69U 1QWYA 5LMNW 4GNXA 2ZXPA 4JI7L 3S2HB 4B3RL 2C9OA 4BY1H 1N32Q 1M90C 1D1KA 1A3VA 3CD6A 1STGA 4HEDA 4QY7A 3V96A 5C3WA 1NBWA 2HIXA 3OIPA 4LF7L 4HIKA 4LF9L 3HG9A 5A2QE 4DR1Q 5GADC 2JA9A 2NVQH 2SNMA 2JA7G 2BE5D 5ELEA 1N34L 1TS3A 4TVAB 4MN3A 2HUGA 4A3MH 2IWHA 1M4VA 2JA7B 1XTDA 4KHPQ 5H1SE 4JI0L 1T5EA 2MP1A 2BA1A 2A68D 4O1NA 1XJVA 4IOAA 3MXUA 1PTOC 3CCQA 3G48A 2F0HA 1T5XD 4UDUC 1AEXA 4B3RQ 1FVIA 1WTWA 1N32L 4QIWE 4YHHL 1VQIA 1Y8PB 3VA5A 1A3TA 1IKLA 3TS0A 1QUQA 3PMFA 2NVXH 1SNOA 5FO8B 1PFSA 4GOPC 3T53B 2FXQA 2VUMG 3TP7A 2I5HA 2E2DC 3T1YL 2CHBD 1FNUA 2F0PA 2WB1B 5I4DA 5ELCA 1W6KA 3I4MH 1XMQL 5C3EG 3I7FA 5C5LA 3ZJYC 1U5KA 2D9UA 4K5VA 2YU9B 3NXWA 2GN5A 4OHJA 5JJLA 1A2TA 4IO9A 1B8AA 2I5MX 2L12A 4J15A 2VQEL 4JI5L 2K05A 3HOYB 2A6HC 4GN3B 2NBFA 2KECA 3MA2B 1PH8A 4HCEA 1QNUA 5EPJA 4A93G 3MEHA 3CPFA 1A63A 2RKSA 5JVH3 1ZYRD 5M5WH 1U0LA 1B50A 1EY9A 3MFGA 3PO3B 1LUZA 2UXDL 3NHHA 4BBSH 3ERQA 3U58A 5T1GA 3KOJA 1JJGA 2HQLA 2MPMA 3HOUB 1Q1EA 1SROA 3JAMi 1U4RA 1EY0A 4L5TA 3S1NB 1STBA 1X54A 4B3SQ 1O80A 1H9KA 1LTBD 1C4QA 3GD7A 4XT1B 1K73C 1KC8C 4IFDG 1C48A 4C1NK 3GTMH 4JBMA 2RBMA 5DEHA 3M4OH 5JJIA 3L7ZC 1ENAA 1AE3A 2IX0A 2KVMA 4DV7L 1YIJA 4LNQA 1XYIA 4Q5VA 2K7VA 4C3IB 1SFOB 1KDBA 1GHKA 2YV5A 2Q2UA 1N33Q 1FD7D 3HKZB 4A3JB 2NVXB 2EYMA 2B2WA 3PUVA 3QOLA 3PO2B 1O7IA 2E2IB 5IY0A 1IL2A 4KN7C 5J3BA 3FKIG 2WAQG 2ENBA 2VQFL 4KY6A 4FNFA 3CC2A 2AQ3B 4L5QA 3VR3A 3T1HL 2EZVA 1R4PB 2JYOA 5C44B 5KNBA 1ZEQX 2F0FA 1KTKA 2UXCQ 2K50A 4HR7B 1DZ1A 2Q2TA 2LS01 3CPWA 5T1IA 3FKIH 2ZM6L 4LF5Q 1YHBA 4ZK9B 4DPGA 4O42A 1GXDC 1RTOA 4DAPA 4EQPA 2K4KA 2B29A 2OXPA 1GUSA 4RHSA 4JOIC 3GTOB 1ENCA 4LAAA 3HOVG 1STNA 1HR0W 4U673 2E8GA 4X65Q 4FXDA 4ILWA 3X3MA 3S16B 2L0CA 3VYTA 2V4DA 2L5TA 3J81L 1UWVA 3J81c 1HRJA 1PTOF 3QR8A 2NVYH 3VYUA 3NBHB 4GKJQ 5D14A 3I2ZA 3H0GH 2P5ZX 3E9IA 1TY2A 3LX0A 5C3EH 1Q82C 2Q8IB 3GQBA 4K2LA 4KD4A 3GO5A 2OTLA 2E2JB 4F88A 4RGMA 2E5LL 1RHPA 4IJLA 1B1ZA 5C0XI 2M9VA 3CXCA 4BY1B 1PFBA 1GUNA 3HGBA 1UUPA 3H0GG 2EJMA 1GUWA 2B2TA 1EY7A 1HFGA 4R9WA 4X3SA 4TQUS 2IY5B 4DN4M 3Q23A 4UPAA 5GAHC 1C8CA 2Q2IA 1QUQB 3S14B 2ZTEA 1PYBA 4DKAC 4B08A 3C3LA 2ICIA 4MTKA 4BBSG 3NBHA 4RHRA 3ND9A 3H91A 2VXWA 2HHHQ 3S16H 5NUCA 3AQQA 1VF5C 2CH4A 2OCEA 5KYLA 1YNNC 1TWAH 4IUUA 1ASYA 3WOFA 4C2MH 2KJXA 4DUZQ 3DEOA 4DNIA 3RD4A 1Z9FA 2UXBL 1HNWQ 5C0XJ 1U4PA 3NTKA 1XMOL 3D31A 3F8TA 1C7YA 3G6EA 4BA2I 2NYZD 2WB1G 5FO9B 2N3SA 1WD1A 3CCEA 4K6LA 2BCOA 5LMUL 4DV2L 1JOKA 1SNMA 2PMZE 1CSQA 1RTNA 3S24A 1F2YA 2CW0D 3D8GA 4YIJA 1XWEA 4EX5A 3J7AV 3HEJA 3QOJA 4BY7H 2HDLA 3F2DA 4ZYSA 1VMCA 3S17H 4A3LG 3NQTA 5CORA 3A0JA 4OEMB 5D65A 1UAPA 4O0AA 1PYSB 2K32A 1EUJA 3S1NH 4MIUA 1MD2D 2WKDA 5GQOA 1YZ6A 1CKOA 4LF9Q 2A8VA 4GN5A 4DAYB 2AQ1B 4KY7A 3KK7A 2WP8J 3S14H 1VQAA 1EYGA 2VNUD 1XMOQ 2B63B 4UP9A 2YTVA 4ME5A 4AQYQ 3S2DB 1QG7A 3NUCA 4OWTB 1JQYD 4AYBB 1YI2A 1K0SA 1Q8IA 1SNPA 5HURA 3N6RA 3KBXA 1VMPA 1BBXC 3VR4A 2JA6B 2AWOA 4CGYB 2EJGC 1VF7A 3HOXB 2OT2A 4B3SL 5EQ0A 3H3VH 4Y7NB 1HR0L 3QIAA 2MO0A 5BN5A 1EY8A 2ALYB 1Y8OB 3I55A 3T13A 4DR3L 4R1JA 2K01A 5KGUA 1PTOD 3M7GA 2ES2A 4K2KA 3C2PA 1AH9A 2RDGA 3PO2G 2F0GA 5COYA 1RL2A 2D5DA 1IHZA 1EIHA 3UDXA 3CQZH 5EKIA 3J81E 2ICEC 4FO2A 4C56C 4GKKQ 4XTCS 3BYTB 2K33A 2B2VC 1IYVA 3TDQA 4RWSC 5LL6X 2KHIA 1TKWB 4B3ML 3OWEB 1TXYA 4WJ4A 4F7XA 1DXMA 1UE1A 4ZLTF 2XTIA 1LTID 1WYDA 1N9WA 3ZYYX 4IJHA 1YJNA 4HTHA 3HOUG 1ILQA 2IL8A 4DV3Q 4TKOB 1VQ9A 2RCNA 4QJFA 4CJ0B 5I6WA 3H6MA 4L6TB 4GS3A 4KLKA 4DNTB 3ICEA 2KCMA 3H09A 3NBIA 4AYBE 4F8MA 2WINB 3KLSX 5CV5A 4LFBL 2PNHA 2IX3A 1D5ZC 5IE8A 1AN8A 1I4PA 2B3GA 1JE5A 4MHEA 2GVBA 1V43A 4KKSA 3VDYA 4LFCQ 1GHJA 3TP8A 1PTOB 5KYIA 1CFMA 2F1MA 4JV5L 1EQVA 1PZKD 4HSVA 3I4MB 2EY6A 2PPBC 2C5CA 5J22A 1X3EA 1DONA 5C4XG 3L2PA 3AU7A 3EJIA 3R93A 1EQRA 4K8IA 2XVSA 4N8FA 3HOXH 4DV1Q 1AFPA 4HJ7A 5ELDA 4EQNA 4WRDA 4CKEA 4X66L 2NVTB 1K0RA 3T1HQ 1IXRA 3ER0A 2HQEA 1I4GA 2DNEA 1KQSA 1C9OA 5AJ3Q 1NSNS 4NXNQ 5IT9c 2R3ZA 4C2MB 2XSCA 3D6WA 5AFWA 3RZDH 5FLXL 1QB5D 4J8QA 3UE1A 4A3FH 1Y1VH 1SE3A 2K5NA 2Y0SE 1G91A 3WDNA 3E3XA 1O78A 1IBKQ 1E2WA 2A19A 2PI2A 3SK6A 4DV6L 1IL8A 2F0IA 3VYSA 3SK8A 2F4VQ 1VQ6A 4CJ2C 1E0BA 1KRSA 1TIID 1I4RA 1JR0D 4A3FG 3K8AA 3F2BA 4L5RC 1Q12A 4A3BH 1KLGD 4HJ9A 4IUVA 5C4JB 4JI4Q 1PZID 3TQYA 3CCLA 4DK0A 1SMYD 3M3YH 3I70A 5C0XH 4JI6Q 4GKKL 3S1QB 1FNVA 3MVVA 2VZAA 3OMGA 2D2CC 2F0OA 1VQDA 4A3KH 4YY3L 2E2IH 3PO2H 3D6CA 1EQQA 4DA2A 2MJ8A 3MXNB 5G3LF 3CKIB 5IYDH 1SMYC 5JAVA 3GTLB 1V9PA 2KCNA 1WI5A 3GTPB 1JT8A 2K28A 1X65A 4XDXA 2IPKD 2F0WA 3TRZA 4OWXB 3NSWA 4LW1A 2O4XA 5FLMG 1H9RA 4LFBQ 2DY8A 2K14A 3J80E 1TU2B 4LF8L 2O5JC 1IZ6A 4DV5Q 1L1OC 4H44C 1QVCA 1BVSA 1KDAA 3G7LA 3HOUH 4DV4Q 4AQYL 4HAEA 1NY4A 3I4NB 2QILA 4RCNA 3OMCA 4EGVA 1NE3A 3HFZB 4IUTA 2EYOA 3A74A 1YNND 4NMZA 1SBBB 4NPSA 1B4OA 1PH6A 3OPOA 4PMBA 3BZCA 5M5WB 2L4NA 4JYAQ 2CW0C 3EA6A 4HCSA 3J7A5 1KRTA 5LMNQ 1FYCA 3N52A 4ODGA 3CMAA 4GOPA 1GUGA 1PV4A 2MQHA 4ME3A 1XNQL 4BXXG 4JI2Q 3U9OA 1EL0A 2JEBI 3I90A 1M8AA 3WWVA 1VQLA 1TT2A 4DGZA 4YCVA 4N9TA 2EJFC 2L15A 1EEID 2NUCA 3A54A 4A3IB 2Z6BA 2CH4W 2NTSA 3KLWA 1IKMA 2MGSA 4IPDA 4IN3A 1EWHA 2XIWA 2EY5A 3CHBD 4A93B 5IYCH 5GAGC 2A6EC 5FK9C 1HH2P 1L0YB 4BXXH 4WJ3M 3MWYW 1Z47A 1TWGH 5GAEC 4R4CA 4DK6C 2K5DA 3S17B 1HA5A 1STAA 5ELOA 4X64L 1BCPB 3H15A 3W3AA 5EKKA 4OWWB 2K52A 5C3XA 5CBEE 4DR2L 5IIFA 3S9WA 4GZYC 2LY7A 5BR8Q 5LMNL 1TWAB 2JEAI 1B53A 4OX9Q 1RCVD 3FMCA 1EQTA 4YWLA 1EYCA 3T16A 3K80C 4HIMA 5ISRA 1WCMG 3NE5B 5E4WC 4ZKCB 2NN6I 2YTYA 3C1EA 5JJZA 3K57A 2PO4A 4FYDA 4NW2A 2PI2E 4DK3C 3EFXD 1EY5A 4A3BG 1CZWA 1CHPD 5E1FA 1ILPA 1P8LA 1YNJD 4DR7L 1F77A 1NJIC 4G7OC 1KDCA 2VB2X 1TQOA 1SNDA 2L1BA 2MUYA 5I6YA 4AH6A 3S1RB 3T56B 2B2WC 1BCPC 2PNRC 2VQEQ 1H9SA 3UDGA 4A3KG 4QQBX 1JWUD 2B2YA 4XIGS 1Y1VB 5IYDG 1GVPA 5D3IB 1CQFA 4DR3Q 4JBKA 3HOWB 4P73A 3R2TA 2EIFA 3CCSA 1FJGQ 3MZ5A 4NXMQ 1Q3LA 4GKJL 1TVXA 4NXNL 4R4OA 5FLMH 3HOWG 5EBCA 4ZUIA 4ULLA 1HJPA 1JWSD 1CUKA 4CDEC 4HSPA 1XNRQ 1I50B 2JJQA 5ELBA 1SE8A 4UY8C 2R93G 3VR5A 4A3FB 1G6ZA 2IHFA 2BDOA 1GJXA 1RF2D 3BS1A 1HNXQ 3S15H 2LFNA 1JICA 1VDZA 4RFBA 4A3MG 4QL5A 1BUVT 1NTGA 1EWIA 3S1RH 1S3OA 1LM0A 2FJ2A 1BCPD 1VQCA 4QUFA 3EIVA 1PH2A 5GROA 4DV0Q 4DR4Q 3SK4A 2F0VA 2R93H 4DUYQ 5JEAH 4N9PA 1L1OB 1D1IA 4LFAL 3SGIA 2HCIA 3MXGA 2XNAC 1V1QA 5IODA 3M7NA 1EFID 4M1UB 4WORA 3PUZA 4CKCA 1S5FD 4A3BB 4C3JB 1EY6A 4OIKA 4A3EG 2Q8RE 3I8ZA 4EQOA 3K7UC 1HFNA 5I9PA 4HMIA 1RD9D 4YY3Q 4ZQ3A 3SVMA 4JI3Q 2R7ZG 4QF4A 4JBJA 2I0QA 2B2VA 1ET6A 4JI7Q 4B3TQ 2OQ0A 3A5UA 2F0NA 1A15A 1NAPA 4ZUJA 4PZ8A 2EYJA 1VQMA 1W6JA 5IP7G 1PH7A 4WFN3 4QUCA 3ITPA 4A3EH 1V1OA 3H94A 3U4ZA 3U50C 3AFQA 3RMHA 3GTQH 4FDBA 1LV9A 4YCUA 1HR0Q 2UU9L 3A5ZB 1A0IA 2L11A 2R7ZH 1G2TA 2EY2A 3L9AX 3SK5A 1SDFA 3TN2A 2F0TA 2NZ1D 3K81C 4FF2A 1R4QB 3IRBA 1DM0B 3FDTA 4IURA 2RSOA 4R8NA 4BBRG 3M3YB 4C1NI 4G4KA 1GUOA 2PMZB 1OXSC 4IOCA 1S5DD 2R93B 2D0OA 1PH4A 1Q90A 1QILA 2ATWA 1ENFA 3W5OA 1EOTA 2F3VA 1EEFD 4B9XA 1K8GA 1K28A 4HMJA 1V1PB 1R9TB 2J7ZA 2ZJPA 4BWGB 1CSPA 2B2YC 2EE1A 3J7YW 5JJKA 4DNRB 1KNAA 1ICWA 2K03A 2KEDA 3I3CA 3S1MB 2RSNA 1WTOA 1V1PA 4K0KQ 1H9MA 3FVQA 4RKBA 2X69A 4XXEA 4OIJA 3PUYA 3K0XA 3NPPA 3A8JE 4DAVA 2Z4HA 4ALPA 1I5FA 5KNCA 3DM3A 2B8FA 2F0KA 5IGGA 4POFA 1E22A 3BG3A 4C3JH 1KLUD 1DJRD 2E75C 5M3MG 3GDEA 2AUJD 1Y14B 1BKBA 3HOVB 2A6ED 5M3FH 2AKWB 4JBWA 1BBUA 4CHTB 4A3JH 2H5XA 3URYA 5EKLA 4DR6L 3PCOB 4DR5Q 1F2MA 2BDNA 2ASBA 1B2TA 2DJFC 4OONA 4DV1L 4LF6Q 2WACA 2FMMA 3MTSA 4NB3A 1PH5A 2KENA 5C44H 3KYHC 3NELA 5KIXA 3KF6A 1HQMC 4J1MA 1UEBA 1EZ8A 1W2BA 4IFDJ 2A69D 2KHSA 2AMCB 2LMCB 3FKIB 1K3BC 5JEAG 1IYUA 2XWBB 3AFPA 3OTOL 5IT9L 2PYKA 4DR7Q 5JVG3 4JYAL 3CCVA 2VL6A 1HXYD 2B63H 4QIWB 1S5ED 1MSHA 1XPUA 3CQZB 1XXGA 3UDIA 1Q46A 2XN9C 1K83B 1TWHH 3NK9A 3JC66 1N36L 2UU9Q 4BY7B 4B9WA 3QO2A 1K8AC 1MJEA 3IAYA 2QKIC 4A3CG 3TBIB 3OW2A 5IYBG 4A3IH 2ZXOA 3SR1A 1CA6A 1KAAA 5M3MB 1F9QA 4NDXA 3J81i 3TSSA 2R92G 1TWCB 4ZAIA 3KFUA 2K04A 3J80c 5KRUA 2RDFA 4K5XA 2WKCA 1STHA 2ZT9C 1U4LA 4KTAA 2DY7A 2LSSA 2A74C 2EXDA 3EROA 3X3NA 4C3HH 1LTRD 1AE2A 1WCMB 1Y8NB 1NMGA 1PMRA 4JCVE 5IYBH 4NXML 1ICFB 2KEEA 1JOQA 1HZAA 4FF4A 3Q24A 3I4NH 1PVOA 3AB9A 2K5HA 4N8X1 3GV3A 1EOVA 2UXCL 1STYA 4JK1C 2F0EA 3C1FA 4GLXA 4DV2Q 3H3VC 2FINB 4OELB 3FRPB 1K3RA 3KJOA 1Q81C 3LWUA 3SEBA 1TWCH 3TREA 1Q86C 2ZTCA 1K8OA 3Q6SA 4DXGA 4LFAQ 1L0WA 4DV3L 2BA0A 1UE5A 1ZXTA 2D62A 4H13C 2F4VL 1QCBD 2R7ZB 1TS2A 2F0QA 1SJHD 3I4LA 2WIIB 3UI2A 1SR3A 2F0LA 3TZDA 5EBDA 4IUNA 2CVRA 1OO9B 2KCTA 4IFDH 2K5QA 5CV9A 1ESFA 4HN7A 2CFMA 2JSOA 3J81j 4LF4Q 1B9NA 2F3WA 3KDFA 4FVMA 1SRUA 1SSOA 2NVQB 4Y52H 2TMPA 2CCZA 1VQNA 4JI8Q 3VR6A 3OW7A 2JA7H 3HOZB 4C3IG 4HJ5A 1VQ4A 4A3MB 2AUKA 4KHVA 4A4IA 2JA5H 3GTJB 1ONLA 4JOIA 1OXVA 3K5OA 4I7ZC 5CV4A 4P71A 4GLAC 1N36Q 4BA1I 4JI1Q 5IGBA 3CW2C 1ZKOA 3A56A 3S15B 3I72A 2UUCQ 4JPBW 5JPNC 4DV0L 1C0AA 4OL7A 1PFNA 1TWGB 3Q0AA 2QW7A 5C4HA 1HNWL 1GKHA 4RMFA 1I50H 2M00A 3M4PA 4RH6A 3GV6A 1T9HA 5DNFA 3GTLH 4XQQA 4G57A 5M5XH 2NVTH 1SYDA 3NWSA 4PNYA 4OX9L 1TY0A 1EY4A 1YNXA 3A7AB 2EQSA 4IPGA 1XTCD 1EU3A 2JA6H 1BO0A 1RJTA 5C4ZA 4R4QA 2EY1A 1JJCB 1J9OA 1E1OA 3P1HA 5C4JH 3JAML 2KOLA 1A2UA 2BOSA 3SE0A 4C3HG 4RGNA 4A3DG 2QF7A 1I94Q 2Z0SA 1GO3E 3ND8A 4ID6A 3ULLA 3TMEA 1NNXA 3WOEA 1CZGA 3K59A 3DWQA 4RGTA 2A6HD 2UUBQ 1QZHA 2J4XA 1YVCA 2QCPX 3NEMA 4A93H 3H0GB 1VQHA 2JA8H 1FGBD 4CKBA 1SEBD 5ELNA 1LLRD 1F2LA 1SLJA 4A3DH 1D5MC 4GNXB 4QMGA 4A76A 3MC0B 1FNWA 4PZ7A 1PYWD 2X6LA 1E7ZA 4A3EB 4LF7Q 1JE4A 4L63B 4X6AH 2KQ3A 3OIQA 2JP1A 5IWAQ 3M4OB 1LTLA 2ZXRA 1XPRA 1IBML 2R6GA 2JQOA 1BR9A 1I6VC 4PV1C 2R92B 1SE4A 4BS9A 1CKMA 4JI0Q 2R61A 3BJUA 4P74A 1FL0A 1SMXA 1EU4A 3PF4A 5M5XB 1H95A 5C4XH 1MKHA 5E3FA 1K9MC 3EVQA 5CV8A 4DAMA 4CJ1B 3HOXG 1R9TH 4S3SA 2QDBA 3GTKH 3KF8B 2PZTA 1N34Q 1HA6A 1EIGA 1K8MA 2B39A 3GTMB 4YHHQ 1VQFA 4Z9CB 4RCOA 1HHVA 3KLRA 3HRZC 1AP0A 1G6PA 4LK1C 2MO1A 3W1GA 1WTRA 3E6ZX 3W1BA 1YJ9A 4C3IH 1S40A 3E0JA 4B3MQ 1F2ZA 2JA5G 4BY1G 1PRTB 4LFCL 3K5NA 1Y1VG 2LKVA 3AEVA 2Z6KC 1XNQQ 1SYCA 2E5LQ 4JV5Q 4JI2L 3RZDB 1VQGA 1EYDA 1LTGD 2IX1A 5FJ8H 4DUZL 3HS0C 1PZJD 1E2ZA 2QA4A 3SXHA 3E0EA 2RQXA 2CQAA 1KD1C 1X3FA 1WTPA 3VA7A 1D6EC 2CKZB 1JWMD 1U9RA 1NCVA 1JC7A 1HZCA 1IYJB 3EQLC 2NTTA 1IBLL 2CQOA 1QOHA 1EIFA 5L37A 3DWPA 1QJOA 4UP8A 3GTOH 1LT6D 2JA6G 4DK1A 5FJ8G 4I65A 2A1AA 4UAIA 1PDQA 1DOMA 1LTAD 1O7ZA 1SNQA 4OXPA 3CCRA 4KJOA 4P72A 3PQIA 3HOZH 1VQJA 1W3SA 4FP5D 2F03A 3DM1A 2JXMB 4DV5L 2Y0SG 3I4OA 5BR8L 1IW7D 1AZPA 4DV4L 4L8JA 3RNUA 2A69C 3D4RA 3NTHA 4ABNA 1JOOA 1STEA 3D3RA 1X9NA 1Q7YC 1HPCA 5C4XB 2WAQB 3KUPA 1J6QA 5K36G 3I4MG 1GD7A 4KHPL 3U4VA 1PH9A 2JA8G 2SNSA 4CDFC 2JN4A 1YITA 3S1QH 3RN2A 4LJZC 3SDZA 2B2UA 1D8LA 1PH3A 2H1EA 4JI6L 4IPHA 4XQJA 3D4DA 2UUCL 1TS5A 4APVA 2RA4A 1J5EQ 1UEAB 2Z4IA 3CCJA 1Y1WG 2N78A 4P2CB 5EJWA 4MNOA 1G291 1CI3M 1F9RA 2I07B 1HUMA 2VW9A 1DCZA 1VS0A 2MNAA 4XT3B 3PF5A 3NQIA 2YTXA 4UP7A 3O13A 1GM5A 5A35A 4QGUA 3BZDB 3KF8A 3GTGB 1B3QA 4RG1A 4X64Q 4IFDI 1KXLA 1TR5A 1Y1WH 5CYUA 2YYZA 1PLFA 1YHQA 1VQBA 4POGA 3CRLC 4K8JA 3V05A 1X32A 3F1ZA 1RDPD 4LF8Q 3CU7A 2OTJA 1HQRD 3I56A 1F9SA 2F52A 1E3PA 1WTXA 1DOLA 4F87A 3DLLA 3HOYG 3RN5A 1B3AA 1BQQT 1X3QA 3IFDA 4X3UA 3RLNA 2MFIA 1MSGA 2PW5A 1CT1D 3PO3H 4ZRZA 3AMUA 3STBD 2Q8TA 3CAMA 2E2HH 3CMEA 3BVZA 3KDFB 4M8AA 3UE0A 1KIXA 2NB0A 2JE6I 1RODA 2JA8B 3HOYH 4KY5A 3BVGA 3J80L 4X3KA 1DD2A 3PUXA 3E5SA 4FXKC 2LXJA 5IT9E 5HGQA 2AQ2B 1GOZA 4JW0A 2WFWA 4R4TA 1E2VA 4H7BA 1MBYA 3IFTA 1I4HA 3PIOA 1HNZQ 3L3OC 4Q0FA 1E24A 5IWAL 1Q1BA 3HKZE 3P7JA 4CBVA 5DM63 1JB7A 4AYBG 1PRTC 2BH2A 1SYGA 3RLOA 3BDLA 3OOCA 4HIOA 3H3VI 3S2HH 4IZ8A 3JAMc 1KABA 2QDLA 4RA8A 4O2DA 2HHHL 1TS4A 4NKLA 3HOVH 2KHJA 5A2QL 2XGTA 3Q22A 1IBMQ 2RHQB 2DJGC 3U9SA 3G4SA 3HOZG 2IHEA 5FO7B 1X55A 2KCCA 3AYHB 2J0TD 2E76C 3FP9A 2KBNA 1CM9A 2CWPA 1TWFH 2DN8A 3CP0A 3MXPA 4C3HB 4JVZA 1Z6HA 2UXDQ 4K0KL 2B2UC 3P20A 3OHXC 5K36H 1B44D 2IW3A 4PQXA 5C0XG 2PQEA 5IOCA 3BYYB 1LABA 2PQAA 1JORA 5J39A 3PUWA 1RIPA 4DR4L 4XQNA 3TP5A 3TEHB 3T51B 2XWJB 4G7ZC 4IALA 1YNJC 1BXTA 1LTSD 1YEZA 1BOSA 1VQOA 1Q8KA 1SNCA 1A3UA 2K75A 5IP9G 5HY6A 3BDOA 4MTNA 3GTPH 3K7AB 4IUPA 4QCLA 3K0YA 2RDHA 3ONAB 2EYLA 5LHY1 2A68C 3BDCA 3MFYA 1S5CD 1S4ZA 4BBRB 3UDFA 3L0OA 1FJGL 2RHSB 2HT1A 1L1OA 1SYBA 2G5DA 2RF4A 2M2LA 1NR4A 1BF4A 1NUCA 1YHAA 1X56A 1ZYRC 4LUVA 1VCIA 3KF6B 1H9JA 1WJJA 5F2DA 2TSSA 2R7DA 2GVAA 5EGTA 1SE2A 2L9HA 2XRQD 3QB3A 2QGQA 2OQKA 2F3IA 1PXUA 1YJWA 4DFAA 3LNNA 3NWTA 4LMQD 3RZOB 2PZUA 2UUAL 3PO3G 3RUZA 5IP7H 3GP7A 2O5IC 1LTTD 4DR1L 3MXNA 3R3OA 4E6IA 2B2TC 1NMFA 2K6AA 3BU2A 4PMWA 2D0PA 4CDCC 2FFKB 4KKUA 4BY7G 2RCFA 1A8VA 2EPBA 1KL9A 1Y1WB 4A3LH 1BDOA 4H0LC 3SHLA 1L0XB 2I5LX 4BBRH 4RGOS 1CKNB 2YU9H 4JG2A 5FOBB 1RKNA 4LF4L 5DM73 1OXTA 2EYPA 4DAYA 3RR5A 1CA5A 1VQ7A 1P16A 1HNXL 5LMUQ 4GNXC 1HZBA 1PA6A 3PV0A 2VUMB 3A7LA 1ET9A 1NR2A 2VB3X 5M5YH 1V8QA 1PRTD 3C46A 3DXJC 2OF1A 2DNCA 4RAUC 2PZWA 4HIDA 2EXZA 3S1MH 4JI1L 2Z6KA 5DAUA 1PRTF 2EOTA 3D4WA 2EVBA 3KJPA 2NZHA 5K5PA 1EZ6A 2NVYB 1OTCA 5CBAE 4L5SA 1X6OA 1WCMH 1HTLD 4Y7NH 1FGUA 2H4OA 2IJ0A 1B9MA 5IGEA 5IGCA 2OEOA 4I7AA 4OO1G 1AZQA 4K6DA 1IW7C 4C3JG 4IPCA 4LWCA 3QWNA 3HKSA 2WV6D 5M3MH 1BBWA 5JPMC 1WOCA 3DUZA 1FR3A 1WFQA 3A55A 3PIP3 4JI4L 1U4MA 4YCWA 4A3KB 4KK7A 5M3FG 1ML0D 3J7ZC 5C5MA 2NZOA 2FMCA 2KA7A 5M3FB 3OTOQ 3PSIA 1WTQA 2UXBQ 5FLXc 5I2YA 1JMCA 4TSSA 4OO1H 5CGKA 3M9BA 2EYFA 2F0UA 1SN8A 3BVMA 4EVOA 5IP9H 3QJYA 4G7HC 5FKAC 1PHJA 3TS2A 5JEAJ 1HNZL 3HOWH 5CV6A 5AJ3L 4V190 3LGJA 1SXTA 1YBYA 1HTPA 1II3A 4DF7A 2I46A 4X62Q 4P75A 1G8ZD 2XRSD 2NWGA 2DUDA 4KV6A 1BNZA 1QE6A 4NP5A 1EYAA 3K5LA 3A8IE 2F0SA 1MI2A 4DU9A 1CTMA 1O7YA 4V0BA 1OXXK 1D5XC 1QVFA 1WTVA 3CC4A 3F2UA 2E2HB 2SEBD 3FEWX 3ULJA 3GTKB 1F9PA 1XPOA 3TZUA 2PW7A 5IGDA 3K5MA 1MIUA 4KJNA 2PCFB 4A3IG 3DHQA 1Z7TA 1LT5D 2VQFQ 2K1BA 3NENA 1UE6A 3K7AH 2BE5C 3FHWA 3I73A 5CR3A 1KNEA 2C35B 1VQ8A 4FXGC 5JOBA 1VQEA 3NP8A 5CC4A 3VYRA 5KEEA 3GTQB 2LXKA 1QVGA 2A73B 1QNKA 4R4IA 2AHOB 2F0DA 4DR6Q 4HJ8A 1N8RC 1VQPA 3NTIA 3V2TA 4X62L 4FF1A 3CC7A 1S5BD 2G9HD 2GA4B 2NN6G 1DOKA 3G6JB 2K5WA 3I4NG 4OGQC 3DWAA 4ZKBB 4IQZA 1LYLA 4GN4B 2VY3A 3PIO3 3M4YA 5EPLA 3J7AF 2A5HA 1O7LA 2ZJQA 4IUQA 4X65L 4GLVB 4PG3A 2RVLA 3GTGH 5CV7A 1D7QA 3VR2A 1EFWA 1ASZA 4LUOA 1BCPF 1I6HH 2F0JA 1XNRL 1JCKB 1UE7A 3W2DA 1LT4D 3RZOH 2BH8A 5FLXE 1VQKA 1CKNA 2G9DA 5D3DA 2HIVA 4A3DB 5CMDA 5I2XA 4JI3L 1I4XA 2N8NA 4XYQA 1UNSA 1J5EL 4JI8L 4DXFA 2IT1A
chains in the Genus database with same CATH topology
3FPPA 1GUTA 2L55A 2B8GA 1D2BA 3K6OA 1ESRA 2SOBA 4WJWA 4R8IA 1HCZA 1I3QB 1A6XA 5EPKA 5HGTA 3I91A 1CHQD 5G3LD 5ELFA 3OSOA 2HDMA 1J8IA 3TP6A 2Z8LA 5C6AA 1LO5D 2F0MA 2O2LD 3CRKC 1SYFA 3P75A 4QB4A 1LACA 3A8KE 4K14A 2EDGA 5LL6S 3R2IA 1SJED 3MAQA 2HCCA 3RLFA 3KLSA 3IKJA 2SDFA 1SAPA 5M5YB 1HUNA 1I6HB 3MHBA 2E74C 1XX8A 4U68A 2JA5B 5M9OA 3JAME 4FF3A 5E4XA 2FHTA 4KKTA 3IL8A 1X3PA 2ID0A 3LWEA 1OXUA 5J1ZA 4A3GB 3T4AC 1LT3D 5BN4A 1CK1A 4KN4C 3OWFA 2EYHA 4X3TA 1G2SA 3R8BA 4RKLA 5I9OA 4TRDA 1TWHB 1PFMA 4BBSB 4KMUC 5KNDA 2N88A 2NN6H 3KBGA 4PMCA 2AWNA 1WD0A 4J6HA 2QEJC 1TWFB 2X6GA 4K5WA 4KHZA 2Y0SB 4KI0A 4OO1I 5TSSA 3M85A 2F4IA 3QG1A 1JB3A 1PTOH 4XYOA 3K58A 1AW7A 3FPUB 5IGFA 4KD3A 1CQVA 1DYQA 5BN3A 1WVLA 3HZXA 3DMUA 3HP3A 1H9SB 2Z1CA 1I4QA 1EWCA 2MHVA 1SYEA 2N55A 3DEPA 2KUMA 1MGSA 5C3EB 1Y69U 1QWYA 2ZXPA 3S2HB 2C9OA 1D1KA 1A3VA 1STGA 4HEDA 3V96A 5C3WA 3OIPA 3HG9A 5A2QE 2SNMA 2BE5D 5ELEA 1TS3A 4MN3A 2HUGA 2IWHA 1M4VA 2JA7B 1T5EA 2MP1A 2BA1A 2A68D 4O1NA 3MXUA 1PTOC 2F0HA 1T5XD 4UDUC 1AEXA 1WTWA 1Y8PB 3VA5A 1A3TA 1IKLA 3PMFA 1SNOA 5FO8B 3T53B 3TP7A 2E2DC 2CHBD 1FNUA 2F0PA 2WB1B 5I4DA 5ELCA 1W6KA 5C5LA 2D9UA 4K5VA 2YU9B 3NXWA 4OHJA 1A2TA 2L12A 2K05A 3HOYB 2A6HC 2NBFA 2KECA 3MA2B 4HCEA 1QNUA 5EPJA 3MEHA 2RKSA 5JVH3 1ZYRD 1B50A 1EY9A 3MFGA 3PO3B 3NHHA 3ERQA 5T1GA 3HOUB 2MPMA 1Q1EA 1U4RA 1EY0A 3S1NB 1STBA 1O80A 1H9KA 1LTBD 1C4QA 3GD7A 4XT1B 4IFDG 1C48A 4C1NK 2RBMA 5DEHA 3L7ZC 1ENAA 2IX0A 2KVMA 1XYIA 4Q5VA 2K7VA 4C3IB 1SFOB 1KDBA 1GHKA 1FD7D 3HKZB 4A3JB 2NVXB 2EYMA 2B2WA 3PUVA 3QOLA 3PO2B 2E2IB 4KN7C 2ENBA 4KY6A 4FNFA 2AQ3B 3VR3A 2EZVA 1R4PB 2JYOA 5C44B 5KNBA 1ZEQX 2F0FA 1KTKA 4HR7B 1DZ1A 2LS01 5T1IA 4ZK9B 4O42A 1GXDC 1RTOA 4DAPA 4EQPA 2OXPA 4RHSA 1GUSA 3GTOB 1ENCA 4LAAA 1STNA 4U673 4FXDA 4ILWA 3X3MA 3S16B 2L0CA 3VYTA 2V4DA 2L5TA 3J81L 1HRJA 1PTOF 3VYUA 5D14A 1TY2A 3LX0A 2Q8IB 3GQBA 4K2LA 4KD4A 3GO5A 2E2JB 4F88A 4RGMA 1RHPA 1B1ZA 5C0XI 2M9VA 4BY1B 1PFBA 1GUNA 3HGBA 1UUPA 2EJMA 1GUWA 2B2TA 1EY7A 1HFGA 4R9WA 4X3SA 4TQUS 4DN4M 3Q23A 1C8CA 3S14B 4B08A 3C3LA 2ICIA 3NBHA 4RHRA 3ND9A 3H91A 2VXWA 5NUCA 1VF5C 5KYLA 1YNNC 4IUUA 3WOFA 2KJXA 3DEOA 3RD4A 5C0XJ 1U4PA 3NTKA 3D31A 4BA2I 2NYZD 5FO9B 1WD1A 4K6LA 2BCOA 1JOKA 1SNMA 1RTNA 1F2YA 2CW0D 3D8GA 4YIJA 1XWEA 3J7AV 3HEJA 3QOJA 2HDLA 4ZYSA 1VMCA 3NQTA 5CORA 5D65A 1UAPA 2K32A 4MIUA 1MD2D 2WKDA 2AQ1B 4KY7A 3KK7A 2WP8J 2VNUD 2B63B 4ME5A 3S2DB 1QG7A 3NUCA 1JQYD 4AYBB 1Q8IA 1SNPA 5HURA 3N6RA 3KBXA 1VMPA 1BBXC 3VR4A 2JA6B 2AWOA 4CGYB 2EJGC 1VF7A 3HOXB 2OT2A 5EQ0A 4Y7NB 3QIAA 5BN5A 1EY8A 1Y8OB 3T13A 2K01A 5KGUA 1PTOD 3M7GA 4K2KA 3C2PA 2RDGA 2F0GA 5COYA 2D5DA 1IHZA 1EIHA 5EKIA 3J81E 2ICEC 4FO2A 4C56C 4XTCS 3BYTB 2K33A 2B2VC 1IYVA 3TDQA 4RWSC 5LL6X 1TKWB 3OWEB 4F7XA 1DXMA 4ZLTF 1LTID 3ZYYX 4HTHA 1ILQA 2IL8A 4TKOB 4CJ0B 5I6WA 3H6MA 4L6TB 4DNTB 3H09A 3NBIA 4F8MA 2WINB 3KLSX 5CV5A 2IX3A 1D5ZC 1AN8A 1I4PA 4MHEA 1V43A 4KKSA 1GHJA 3TP8A 1PTOB 5KYIA 1CFMA 2F1MA 1EQVA 1PZKD 4HSVA 3I4MB 2EY6A 2PPBC 2C5CA 5J22A 1DONA 3AU7A 3EJIA 3R93A 4K8IA 2XVSA 1AFPA 5ELDA 4EQNA 4WRDA 4CKEA 2NVTB 2HQEA 1I4GA 2DNEA 1NSNS 2R3ZA 4C2MB 2XSCA 3D6WA 5AFWA 5FLXL 1QB5D 4J8QA 1SE3A 1G91A 3WDNA 1O78A 1E2WA 3SK6A 1IL8A 2F0IA 3VYSA 3SK8A 4CJ2C 1E0BA 1TIID 1I4RA 1JR0D 1Q12A 1KLGD 4IUVA 5C4JB 1PZID 4DK0A 1SMYD 3I70A 5C0XH 3S1QB 1FNVA 3MVVA 3OMGA 2D2CC 2F0OA 3D6CA 4DA2A 2MJ8A 5G3LF 3CKIB 1SMYC 5JAVA 3GTLB 2KCNA 3GTPB 2K28A 4XDXA 2IPKD 2F0WA 3NSWA 2O4XA 1H9RA 2DY8A 3J80E 1TU2B 2O5JC 4H44C 1KDAA 3G7LA 4HAEA 3I4NB 2QILA 4RCNA 3OMCA 4EGVA 4IUTA 2EYOA 1YNND 4NMZA 1SBBB 1B4OA 3OPOA 4PMBA 5M5WB 2L4NA 2CW0C 3EA6A 4HCSA 1FYCA 3N52A 4ODGA 1GUGA 3U9OA 1EL0A 2JEBI 3I90A 1M8AA 1TT2A 4DGZA 4N9TA 2EJFC 1EEID 2NUCA 3A54A 4A3IB 2NTSA 1IKMA 2MGSA 4IN3A 1EWHA 2XIWA 2EY5A 3CHBD 4A93B 2A6EC 5FK9C 1L0YB 3MWYW 1Z47A 2K5DA 3S17B 1HA5A 1STAA 1BCPB 3W3AA 5EKKA 5C3XA 5CBEE 5IIFA 3S9WA 4GZYC 2LY7A 1TWAB 2JEAI 1B53A 1RCVD 3FMCA 1EQTA 1EYCA 3T16A 5ISRA 3NE5B 5E4WC 5JJZA 2NN6I 4ZKCB 3C1EA 3K57A 2PO4A 4FYDA 4NW2A 3EFXD 1EY5A 1CZWA 1CHPD 5E1FA 1ILPA 1YNJD 1F77A 4G7OC 1KDCA 2VB2X 1TQOA 1SNDA 2L1BA 2MUYA 5I6YA 3S1RB 3T56B 2B2WC 1BCPC 2PNRC 1H9SA 1JWUD 2B2YA 4XIGS 1Y1VB 5D3IB 1CQFA 3HOWB 3R2TA 3MZ5A 1Q3LA 1TVXA 5EBCA 4ZUIA 4ULLA 1JWSD 4HSPA 1I50B 5ELBA 4A3FB 3VR5A 1G6ZA 2BDOA 1GJXA 1RF2D 3BS1A 2LFNA 1JICA 1VDZA 4RFBA 1BUVT 2FJ2A 1BCPD 4QUFA 3SK4A 2F0VA 5JEAH 4N9PA 1D1IA 2HCIA 2XNAC 5IODA 3MXGA 3M7NA 1EFID 4M1UB 4WORA 3PUZA 4CKCA 1S5FD 4A3BB 4C3JB 1EY6A 4OIKA 2Q8RE 3I8ZA 4EQOA 1HFNA 5I9PA 4HMIA 1RD9D 4ZQ3A 3SVMA 4QF4A 2B2VA 1ET6A 2F0NA 1A15A 1NAPA 4ZUJA 2EYJA 1W6JA 4WFN3 4QUCA 3ITPA 1V1OA 3H94A 3RMHA 1LV9A 2L11A 1G2TA 2EY2A 3L9AX 3SK5A 1SDFA 3TN2A 2F0TA 2NZ1D 4FF2A 1R4QB 1DM0B 3FDTA 4IURA 2RSOA 4R8NA 3M3YB 4C1NI 4G4KA 1GUOA 2PMZB 1OXSC 1S5DD 2R93B 1Q90A 1QILA 1ENFA 1EOTA 2F3VA 1EEFD 4B9XA 4HMJA 1V1PB 1R9TB 2J7ZA 4BWGB 2B2YC 2EE1A 3J7YW 4DNRB 1KNAA 1ICWA 2K03A 2KEDA 3I3CA 3S1MB 2RSNA 1WTOA 1V1PA 1H9MA 3FVQA 4RKBA 2X69A 4XXEA 4OIJA 3PUYA 3NPPA 3A8JE 4DAVA 2Z4HA 5KNCA 2B8FA 2F0KA 5IGGA 3BG3A 1KLUD 1DJRD 2E75C 2AUJD 3HOVB 2A6ED 4JBWA 4CHTB 3URYA 5EKLA 1F2MA 2BDNA 1B2TA 2WACA 2FMMA 3MTSA 5KIXA 1HQMC 4J1MA 1EZ8A 4IFDJ 2A69D 2KHSA 2LMCB 3FKIB 5JEAG 1IYUA 2XWBB 5IT9L 2PYKA 5JVG3 1HXYD 4QIWB 1S5ED 1MSHA 3CQZB 1XXGA 2XN9C 1K83B 3NK9A 4BY7B 4B9WA 3QO2A 3IAYA 2QKIC 3TBIB 2ZXOA 1CA6A 3SR1A 1KAAA 5M3MB 1F9QA 4NDXA 3TSSA 1TWCB 4ZAIA 2K04A 5KRUA 2RDFA 4K5XA 2WKCA 1STHA 2ZT9C 1U4LA 4KTAA 2DY7A 2A74C 3EROA 3X3NA 1LTRD 1Y8NB 1WCMB 1PMRA 2KEEA 1JOQA 4FF4A 3Q24A 3AB9A 3GV3A 1STYA 4JK1C 2F0EA 3C1FA 3H3VC 2FINB 3FRPB 3LWUA 3SEBA 1K8OA 3Q6SA 4DXGA 2BA0A 1ZXTA 2D62A 4H13C 1QCBD 2R7ZB 1TS2A 2F0QA 1SJHD 3I4LA 2WIIB 3UI2A 2F0LA 3TZDA 5EBDA 4IUNA 2CVRA 1OO9B 4IFDH 2K5QA 5CV9A 1ESFA 4HN7A 2JSOA 1B9NA 2F3WA 4FVMA 1SSOA 2NVQB 2TMPA 3VR6A 3OW7A 3HOZB 4C3IG 4A3MB 2AUKA 4KHVA 3GTJB 1ONLA 1OXVA 3K5OA 4I7ZC 5CV4A 4BA1I 5IGBA 1ZKOA 3A56A 3S15B 3I72A 5JPNC 4OL7A 1PFNA 1TWGB 3Q0AA 5C4HA 2M00A 4RH6A 3GV6A 5DNFA 4XQQA 4G57A 1SYDA 3NWSA 4PNYA 1TY0A 1EY4A 3A7AB 1XTCD 1EU3A 1BO0A 1RJTA 5C4ZA 2EY1A 1J9OA 3P1HA 3JAML 2KOLA 1A2UA 2BOSA 3SE0A 4C3HG 4RGNA 2QF7A 3ND8A 4ID6A 3TMEA 3WOEA 1CZGA 3K59A 3DWQA 4RGTA 2A6HD 2J4XA 2QCPX 3H0GB 1FGBD 4CKBA 1SEBD 1LLRD 1F2LA 1D5MC 4QMGA 3MC0B 1FNWA 1PYWD 2X6LA 4A3EB 1JE4A 4L63B 2KQ3A 3OIQA 2JP1A 3M4OB 2ZXRA 2R6GA 1BR9A 1I6VC 4PV1C 2R92B 1SE4A 4BS9A 2R61A 1EU4A 5M5XB 5E3FA 3EVQA 5CV8A 4CJ1B 4S3SA 2QDBA 2PZTA 1HA6A 1EIGA 1K8MA 2B39A 3GTMB 4Z9CB 4RCOA 1HHVA 3KLRA 3HRZC 1AP0A 4LK1C 1WTRA 3E6ZX 3E0JA 1F2ZA 1PRTB 3K5NA 2LKVA 1SYCA 3RZDB 1EYDA 1LTGD 2IX1A 3HS0C 1PZJD 1E2ZA 3SXHA 2RQXA 2CQAA 1WTPA 3VA7A 1D6EC 1JWMD 1U9RA 1NCVA 1JC7A 3EQLC 2NTTA 1QOHA 3DWPA 1QJOA 1LT6D 4DK1A 4I65A 4UAIA 1PDQA 1DOMA 1LTAD 1O7ZA 1SNQA 4KJOA 2F03A 4FP5D 3DM1A 2JXMB 1IW7D 1AZPA 4L8JA 2A69C 3D4RA 3NTHA 4ABNA 1JOOA 1STEA 3D3RA 1HPCA 5C4XB 2WAQB 3KUPA 5K36G 2SNSA 4LJZC 3SDZA 2B2UA 2H1EA 4XQJA 3D4DA 1TS5A 2RA4A 1UEAB 2Z4IA 4P2CB 5EJWA 1G291 1CI3M 1F9RA 2I07B 1HUMA 1DCZA 4XT3B 3NQIA 3O13A 5A35A 3BZDB 3KF8A 3GTGB 4IFDI 1TR5A 5CYUA 2YYZA 1PLFA 3CRLC 4K8JA 3V05A 1X32A 1RDPD 3CU7A 1HQRD 1F9SA 1WTXA 1DOLA 4F87A 1B3AA 1BQQT 1X3QA 3IFDA 4X3UA 1MSGA 2PW5A 1CT1D 4ZRZA 3AMUA 2Q8TA 3BVZA 4M8AA 2NB0A 2JE6I 1RODA 2JA8B 4KY5A 3BVGA 3J80L 4X3KA 1DD2A 3PUXA 3E5SA 4FXKC 5IT9E 2AQ2B 1GOZA 1E2VA 4H7BA 1MBYA 3IFTA 1I4HA 3L3OC 4Q0FA 1Q1BA 3P7JA 4CBVA 5DM63 1PRTC 1SYGA 3BDLA 3OOCA 4IZ8A 1KABA 4RA8A 1TS4A 4NKLA 5A2QL 3Q22A 3U9SA 5FO7B 2KCCA 2J0TD 2E76C 1CM9A 2DN8A 3MXPA 4C3HB 1Z6HA 2B2UC 3P20A 3OHXC 5K36H 1B44D 2IW3A 5C0XG 4PQXA 2PQEA 5IOCA 3BYYB 1LABA 1JORA 5J39A 3PUWA 4XQNA 3TP5A 3T51B 2XWJB 4G7ZC 4IALA 1YNJC 1BXTA 1LTSD 1BOSA 1SNCA 1A3UA 3BDOA 3K7AB 4IUPA 4QCLA 3K0YA 2RDHA 3ONAB 2EYLA 5LHY1 2A68C 3BDCA 3MFYA 1S5CD 1S4ZA 4BBRB 1SYBA 2M2LA 1NR4A 1BF4A 1NUCA 1ZYRC 1VCIA 1H9JA 5F2DA 2TSSA 5EGTA 1SE2A 2L9HA 2XRQD 3QB3A 1PXUA 4DFAA 3LNNA 3NWTA 4LMQD 3RZOB 2PZUA 3RUZA 3GP7A 2O5IC 1LTTD 3MXNA 3R3OA 4E6IA 2B2TC 2K6AA 4PMWA 2FFKB 4KKUA 2EPBA 1Y1WB 1BDOA 4H0LC 3SHLA 1L0XB 4RGOS 5FOBB 1RKNA 5DM73 1OXTA 2EYPA 4DAYA 1CA5A 3PV0A 2VUMB 3A7LA 1ET9A 1NR2A 2VB3X 1V8QA 1PRTD 3C46A 3DXJC 2OF1A 2DNCA 4RAUC 2PZWA 2EXZA 5DAUA 1PRTF 2EOTA 3D4WA 2EVBA 5K5PA 1EZ6A 2NVYB 5CBAE 1HTLD 2IJ0A 2H4OA 1B9MA 5IGEA 5IGCA 2OEOA 4OO1G 1AZQA 4K6DA 1IW7C 4C3JG 3QWNA 2WV6D 5JPMC 3DUZA 1FR3A 3A55A 3PIP3 1U4MA 4A3KB 4KK7A 1ML0D 5C5MA 5M3FB 2FMCA 2KA7A 1WTQA 5I2YA 4TSSA 4OO1H 5CGKA 2EYFA 2F0UA 3BVMA 4EVOA 3QJYA 4G7HC 5FKAC 5JEAJ 5CV6A 4V190 1SXTA 1HTPA 1II3A 4DF7A 2I46A 1G8ZD 2XRSD 2NWGA 4KV6A 1BNZA 1QE6A 4NP5A 1EYAA 3K5LA 3A8IE 2F0SA 1MI2A 4DU9A 1CTMA 1O7YA 4V0BA 1OXXK 1D5XC 1WTVA 3F2UA 2E2HB 2SEBD 3FEWX 3GTKB 1F9PA 3TZUA 2PW7A 5IGDA 3K5MA 4KJNA 2PCFB 3DHQA 1Z7TA 1LT5D 2K1BA 2BE5C 3I73A 5CR3A 1KNEA 4FXGC 5JOBA 5CC4A 3NP8A 3VYRA 5KEEA 3GTQB 2A73B 1QNKA 2F0DA 3NTIA 3V2TA 4FF1A 1S5BD 2G9HD 2GA4B 2NN6G 1DOKA 3G6JB 2K5WA 4OGQC 3DWAA 4ZKBB 4IQZA 3PIO3 3M4YA 5EPLA 3J7AF 2A5HA 1O7LA 4IUQA 2RVLA 5CV7A 3VR2A 1BCPF 2F0JA 1JCKB 3W2DA 1LT4D 5FLXE 2G9DA 5D3DA 4A3DB 5CMDA 5I2XA 1I4XA 4XYQA 1UNSA 4DXFA 2IT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6G A;  4RWS C;  1O7Z A;  1ZXT A;  2Q8R E;  3I8Z A;  1B2T A;  4X3K A;  1U4P A;  1HFN A;  2JYO A;  1F2L A;  1WTW A;  2FMM A;  2L9H A;  3DM1 A;  1ESR A;  2NYZ D;  3MTS A;  1WD1 A;  1IKL A;  3SVM A;  3UI2 A;  1B53 A;  1AZP A;  4R8I A;  4ZLT F;  2B2V A;  2X6L A;  4LMQ D;  1DZ1 A;  1EQT A;  3TZD A;  2MJ8 A;  2CVR A;  5EPK A;  5T1I A;  1JE4 A;  2NWG A;  3I91 A;  4ZK9 B;  1ILQ A;  2IL8 A;  3P7J A;  1A15 A;  1NAP A;  1QE6 A;  1BNZ A;  4O42 A;  5E4W C;  4ZKC B;  1RTO A;  3KUP A;  5JJZ A;  1RTN A;  2B2T C;  2JP1 A;  1MI2 A;  4CJ0 B;  4QUC A;  1O7Y A;  4NW2 A;  2D9U A;  1SSO A;  4OIK A;  2HDM A;  1J8I A;  4RA8 A;  2K28 A;  4XDX A;  2HDL A;  1WTV A;  2FFK B;  1VMC A;  3F2U A;  3FPU B;  1ILP A;  1LV9 A;  5COR A;  1MSH A;  2EPB A;  2L11 A;  1G2T A;  5D65 A;  4MHE A;  2L12 A;  1SDF A;  3TN2 A;  1F9P A;  2B2U A;  2NZ1 D;  2K05 A;  2H1E A;  2L1B A;  3QO2 A;  2DY8 A;  3FDT A;  1HRJ A;  4IUR A;  2RSO A;  2KEC A;  2B2W C;  1CM9 A;  2K1B A;  5EPJ A;  1WVL A;  2RA4 A;  3HP3 A;  4HSV A;  1CA6 A;  1CA5 A;  1F9Q A;  1DON A;  4CJ1 B;  5EJW A;  2B2Y A;  5D14 A;  3G7L A;  1F9R A;  1KNE A;  2HCC A;  4ZAI A;  2K04 A;  2B2U C;  3R93 A;  1B50 A;  1HA6 A;  1EIG A;  1HUM A;  1EOT A;  4HAE A;  2SDF A;  2N55 A;  1PFN A;  3DEP A;  1NR2 A;  1U4L A;  1SAP A;  1QNK A;  2KUM A;  2DY7 A;  4IUT A;  4XT3 B;  1HHV A;  1HUN A;  1MGS A;  2J7Z A;  1AP0 A;  1RHP A;  1QG7 A;  2B2Y C;  2EE1 A;  4RAU C;  5T1G A;  1B4O A;  1KNA A;  1WTR A;  1Q3L A;  2MPM A;  1ICW A;  2K03 A;  2KED A;  2L4N A;  1XX8 A;  2EOT A;  1U4R A;  3GV6 A;  3I3C A;  1TVX A;  4HCS A;  5DNF A;  1PFB A;  2RSN A;  3N52 A;  4U68 A;  1WTO A;  3KBX A;  1DOK A;  1VMP A;  1BBX C;  2KEE A;  5CBA E;  5E4X A;  2FHT A;  4HED A;  1O80 A;  1PLF A;  2R3Z A;  2X69 A;  1EL0 A;  3I90 A;  3D6W A;  1M8A A;  3IL8 A;  4OIJ A;  1X3P A;  4XT1 B;  5AFW A;  4ZKB B;  1GUW A;  3LWE A;  2B2T A;  1HFG A;  1BO0 A;  4R9W A;  5EPL A;  1X32 A;  1RJT A;  4X3S A;  1G6Z A;  5EQ0 A;  4DN4 M;  4IUQ A;  1C8C A;  1J9O A;  1AZQ A;  1G91 A;  1F9S A;  3GV3 A;  1WTX A;  4IUP A;  1DOL A;  2RVL A;  3ONA B;  4X3T A;  1G2S A;  2KVM A;  2MGS A;  1IKM A;  1B3A A;  1JIC A;  2KOL A;  2XIW A;  1XYI A;  1X3Q A;  2K01 A;  4MN3 A;  2HUG A;  3H91 A;  2VXW A;  3IFD A;  4X3U A;  1PFM A;  1WTP A;  1U4M A;  1IL8 A;  1MSG A;  1S4Z A;  1DOM A;  2FJ2 A;  1ML0 D;  2FIN B;  5COY A;  4QUF A;  3MWY W;  4CJ2 C;  1NCV A;  2B2W A;  2N88 A;  5CMD A;  1EIH A;  1E0B A;  5EKI A;  1WTQ A;  4IUU A;  2Q8T A;  2MP1 A;  2HCI A;  2M2L A;  3DEO A;  1NR4 A;  1ROD A;  1BF4 A;  5CBE E;  3Q6S A;  1WD0 A;  2B2V C;  4UAI A;  1PDQ A;  2BDN A;  4IUV A; 
#chains in the Genus database with same CATH topology
 2VS1 A;  1GUT A;  2L55 A;  3ERS X;  3FPP A;  4A3G G;  2B8G A;  1D2B A;  1VQ5 A;  1M1K C;  3K6O A;  1KHI A;  1ESR A;  2SOB A;  4WJW A;  1QZG A;  2DGY A;  3BZK A;  4R8I A;  3T1Y Q;  1B7Y B;  1HCZ A;  4DV7 Q;  1HZ9 A;  1I3Q B;  3EBE A;  1A6X A;  5EPK A;  1XMQ Q;  5HGT A;  3I91 A;  4DV6 Q;  1MHW C;  4A75 A;  1CHQ D;  3Q8D A;  5G3L D;  3OYY A;  5ELF A;  3OSO A;  1DGS A;  1WTH A;  5EAY A;  4A3G H;  4MZ9 A;  1KAW A;  2HDM A;  1J8I A;  3HKZ G;  3TP6 A;  2CWA A;  2N49 A;  2Z8L A;  5C6A A;  4DR2 Q;  2QEX A;  1LO5 D;  2F0M A;  2O2L D;  3J80 i;  3CRK C;  1SYF A;  3P75 A;  4QB4 A;  1LAC A;  3A8K E;  3STB C;  4A3J G;  4K14 A;  2EDG A;  3M4Q A;  2WB1 E;  2WAQ E;  3S2D H;  4AIM A;  5LL6 S;  3R2I A;  1SJE D;  1JJ2 A;  3MAQ A;  2HCC A;  4X66 Q;  3RLF A;  3KLS A;  3IKJ A;  2SDF A;  2V1C C;  4PZ6 A;  1SAP A;  5M5Y B;  3CCU A;  1HUN A;  1I6H B;  4CDD C;  5E7N A;  3MHB A;  2E74 C;  5C44 G;  3CF5 A;  1XX8 A;  2JK8 A;  2ZM6 Q;  4GOP B;  4U68 A;  3GTJ H;  2JA5 B;  5M9O A;  4H02 A;  3JAM E;  4FF3 A;  1I3Q H;  1X3G A;  5E4X A;  2FHT A;  4KKT A;  3IL8 A;  4YWK A;  1X3P A;  2PQA B;  2ID0 A;  3LWE A;  2UUA Q;  1OXU A;  5J1Z A;  4A3G B;  2B63 G;  3T4A C;  1LT3 D;  5BN4 A;  2Q2H A;  1CK1 A;  4KN4 C;  3OWF A;  2EYH A;  4X3T A;  1G2S A;  4DR5 L;  2OWO A;  3R8B A;  1N33 L;  4RKL A;  5I9O A;  4TRD A;  1K83 H;  1TWH B;  1PFM A;  4BBS B;  1S72 A;  4KMU C;  5KND A;  5IYC G;  4A3C H;  2VUM H;  4LUZ A;  4LF6 L;  2E2J H;  2N88 A;  2NN6 H;  4ZCK A;  2R92 H;  2ZTD A;  3KBG A;  3CCM A;  1E1T A;  1IBK L;  4PMC A;  2AWN A;  4B3T L;  5DLQ E;  1WD0 A;  4J6H A;  1IBL Q;  2QEJ C;  3B6Y A;  1TWF B;  2X6G A;  4YWM A;  4K5W A;  4KHZ A;  2Z9H A;  2Y0S B;  4KI0 A;  1EIY B;  3MEF A;  4OO1 I;  2R7F A;  5TSS A;  1SFO H;  3M85 A;  1L2F A;  3PGZ A;  2F4I A;  3QG1 A;  1JB3 A;  4LF5 L;  3D0F A;  1PTO H;  4XYO A;  3F2C A;  4DUY L;  3E9H A;  3K58 A;  1B70 B;  1AW7 A;  1MJC A;  2K5V A;  3FPU B;  5IGF A;  4JI5 Q;  4EQ5 A;  4KD3 A;  4HJA A;  1CQV A;  1DYQ A;  3EN2 A;  5BN3 A;  3G71 A;  3ULP A;  1WVL A;  3HZX A;  3DMU A;  3HP3 A;  1I94 L;  1A62 A;  4UHV A;  1H9S B;  2Z1C A;  3PIP A;  4JC0 A;  1I4Q A;  2HD3 A;  1EWC A;  2MHV A;  2UUB L;  1SYE A;  2ZJR A;  1G51 A;  2N55 A;  3DEP A;  2KUM A;  1PH1 A;  1MGS A;  5C3E B;  1Y69 U;  1QWY A;  5LMN W;  4GNX A;  2ZXP A;  4JI7 L;  3S2H B;  4B3R L;  2C9O A;  4BY1 H;  1N32 Q;  1M90 C;  1D1K A;  1A3V A;  3CD6 A;  1STG A;  4HED A;  4QY7 A;  3V96 A;  5C3W A;  1NBW A;  2HIX A;  3OIP A;  4LF7 L;  4HIK A;  4LF9 L;  3HG9 A;  5A2Q E;  4DR1 Q;  5GAD C;  2JA9 A;  2NVQ H;  2SNM A;  2JA7 G;  2BE5 D;  5ELE A;  1N34 L;  1TS3 A;  4TVA B;  4MN3 A;  2HUG A;  4A3M H;  2IWH A;  1M4V A;  2JA7 B;  1XTD A;  4KHP Q;  5H1S E;  4JI0 L;  1T5E A;  2MP1 A;  2BA1 A;  2A68 D;  4O1N A;  1XJV A;  4IOA A;  3MXU A;  1PTO C;  3CCQ A;  3G48 A;  2F0H A;  1T5X D;  4UDU C;  1AEX A;  4B3R Q;  1FVI A;  1WTW A;  1N32 L;  4QIW E;  4YHH L;  1VQI A;  1Y8P B;  3VA5 A;  1A3T A;  1IKL A;  3TS0 A;  1QUQ A;  3PMF A;  2NVX H;  1SNO A;  5FO8 B;  1PFS A;  4GOP C;  3T53 B;  2FXQ A;  2VUM G;  3TP7 A;  2I5H A;  2E2D C;  3T1Y L;  2CHB D;  1FNU A;  2F0P A;  2WB1 B;  5I4D A;  5ELC A;  1W6K A;  3I4M H;  1XMQ L;  5C3E G;  3I7F A;  5C5L A;  3ZJY C;  1U5K A;  2D9U A;  4K5V A;  2YU9 B;  3NXW A;  2GN5 A;  4OHJ A;  5JJL A;  1A2T A;  4IO9 A;  1B8A A;  2I5M X;  2L12 A;  4J15 A;  2VQE L;  4JI5 L;  2K05 A;  3HOY B;  2A6H C;  4GN3 B;  2NBF A;  2KEC A;  3MA2 B;  1PH8 A;  4HCE A;  1QNU A;  5EPJ A;  4A93 G;  3MEH A;  3CPF A;  1A63 A;  2RKS A;  5JVH 3;  1ZYR D;  5M5W H;  1U0L A;  1B50 A;  1EY9 A;  3MFG A;  3PO3 B;  1LUZ A;  2UXD L;  3NHH A;  4BBS H;  3ERQ A;  3U58 A;  5T1G A;  3KOJ A;  1JJG A;  2HQL A;  2MPM A;  3HOU B;  1Q1E A;  1SRO A;  3JAM i;  1U4R A;  1EY0 A;  4L5T A;  3S1N B;  1STB A;  1X54 A;  4B3S Q;  1O80 A;  1H9K A;  1LTB D;  1C4Q A;  3GD7 A;  4XT1 B;  1K73 C;  1KC8 C;  4IFD G;  1C48 A;  4C1N K;  3GTM H;  4JBM A;  2RBM A;  5DEH A;  3M4O H;  5JJI A;  3L7Z C;  1ENA A;  1AE3 A;  2IX0 A;  2KVM A;  4DV7 L;  1YIJ A;  4LNQ A;  1XYI A;  4Q5V A;  2K7V A;  4C3I B;  1SFO B;  1KDB A;  1GHK A;  2YV5 A;  2Q2U A;  1N33 Q;  1FD7 D;  3HKZ B;  4A3J B;  2NVX B;  2EYM A;  2B2W A;  3PUV A;  3QOL A;  3PO2 B;  1O7I A;  2E2I B;  5IY0 A;  1IL2 A;  4KN7 C;  5J3B A;  3FKI G;  2WAQ G;  2ENB A;  2VQF L;  4KY6 A;  4FNF A;  3CC2 A;  2AQ3 B;  4L5Q A;  3VR3 A;  3T1H L;  2EZV A;  1R4P B;  2JYO A;  5C44 B;  5KNB A;  1ZEQ X;  2F0F A;  1KTK A;  2UXC Q;  2K50 A;  4HR7 B;  1DZ1 A;  2Q2T A;  2LS0 1;  3CPW A;  5T1I A;  3FKI H;  2ZM6 L;  4LF5 Q;  1YHB A;  4ZK9 B;  4DPG A;  4O42 A;  1GXD C;  1RTO A;  4DAP A;  4EQP A;  2K4K A;  2B29 A;  2OXP A;  1GUS A;  4RHS A;  4JOI C;  3GTO B;  1ENC A;  4LAA A;  3HOV G;  1STN A;  1HR0 W;  4U67 3;  2E8G A;  4X65 Q;  4FXD A;  4ILW A;  3X3M A;  3S16 B;  2L0C A;  3VYT A;  2V4D A;  2L5T A;  3J81 L;  1UWV A;  3J81 c;  1HRJ A;  1PTO F;  3QR8 A;  2NVY H;  3VYU A;  3NBH B;  4GKJ Q;  5D14 A;  3I2Z A;  3H0G H;  2P5Z X;  3E9I A;  1TY2 A;  3LX0 A;  5C3E H;  1Q82 C;  2Q8I B;  3GQB A;  4K2L A;  4KD4 A;  3GO5 A;  2OTL A;  2E2J B;  4F88 A;  4RGM A;  2E5L L;  1RHP A;  4IJL A;  1B1Z A;  5C0X I;  2M9V A;  3CXC A;  4BY1 B;  1PFB A;  1GUN A;  3HGB A;  1UUP A;  3H0G G;  2EJM A;  1GUW A;  2B2T A;  1EY7 A;  1HFG A;  4R9W A;  4X3S A;  4TQU S;  2IY5 B;  4DN4 M;  3Q23 A;  4UPA A;  5GAH C;  1C8C A;  2Q2I A;  1QUQ B;  3S14 B;  2ZTE A;  1PYB A;  4DKA C;  4B08 A;  3C3L A;  2ICI A;  4MTK A;  4BBS G;  3NBH A;  4RHR A;  3ND9 A;  3H91 A;  2VXW A;  2HHH Q;  3S16 H;  5NUC A;  3AQQ A;  1VF5 C;  2CH4 A;  2OCE A;  5KYL A;  1YNN C;  1TWA H;  4IUU A;  1ASY A;  3WOF A;  4C2M H;  2KJX A;  4DUZ Q;  3DEO A;  4DNI A;  3RD4 A;  1Z9F A;  2UXB L;  1HNW Q;  5C0X J;  1U4P A;  3NTK A;  1XMO L;  3D31 A;  3F8T A;  1C7Y A;  3G6E A;  4BA2 I;  2NYZ D;  2WB1 G;  5FO9 B;  2N3S A;  1WD1 A;  3CCE A;  4K6L A;  2BCO A;  5LMU L;  4DV2 L;  1JOK A;  1SNM A;  2PMZ E;  1CSQ A;  1RTN A;  3S24 A;  1F2Y A;  2CW0 D;  3D8G A;  4YIJ A;  1XWE A;  4EX5 A;  3J7A V;  3HEJ A;  3QOJ A;  4BY7 H;  2HDL A;  3F2D A;  4ZYS A;  1VMC A;  3S17 H;  4A3L G;  3NQT A;  5COR A;  3A0J A;  4OEM B;  5D65 A;  1UAP A;  4O0A A;  1PYS B;  2K32 A;  1EUJ A;  3S1N H;  4MIU A;  1MD2 D;  2WKD A;  5GQO A;  1YZ6 A;  1CKO A;  4LF9 Q;  2A8V A;  4GN5 A;  4DAY B;  2AQ1 B;  4KY7 A;  3KK7 A;  2WP8 J;  3S14 H;  1VQA A;  1EYG A;  2VNU D;  1XMO Q;  2B63 B;  4UP9 A;  2YTV A;  4ME5 A;  4AQY Q;  3S2D B;  1QG7 A;  3NUC A;  4OWT B;  1JQY D;  4AYB B;  1YI2 A;  1K0S A;  1Q8I A;  1SNP A;  5HUR A;  3N6R A;  3KBX A;  1VMP A;  1BBX C;  3VR4 A;  2JA6 B;  2AWO A;  4CGY B;  2EJG C;  1VF7 A;  3HOX B;  2OT2 A;  4B3S L;  5EQ0 A;  3H3V H;  4Y7N B;  1HR0 L;  3QIA A;  2MO0 A;  5BN5 A;  1EY8 A;  2ALY B;  1Y8O B;  3I55 A;  3T13 A;  4DR3 L;  4R1J A;  2K01 A;  5KGU A;  1PTO D;  3M7G A;  2ES2 A;  4K2K A;  3C2P A;  1AH9 A;  2RDG A;  3PO2 G;  2F0G A;  5COY A;  1RL2 A;  2D5D A;  1IHZ A;  1EIH A;  3UDX A;  3CQZ H;  5EKI A;  3J81 E;  2ICE C;  4FO2 A;  4C56 C;  4GKK Q;  4XTC S;  3BYT B;  2K33 A;  2B2V C;  1IYV A;  3TDQ A;  4RWS C;  5LL6 X;  2KHI A;  1TKW B;  4B3M L;  3OWE B;  1TXY A;  4WJ4 A;  4F7X A;  1DXM A;  1UE1 A;  4ZLT F;  2XTI A;  1LTI D;  1WYD A;  1N9W A;  3ZYY X;  4IJH A;  1YJN A;  4HTH A;  3HOU G;  1ILQ A;  2IL8 A;  4DV3 Q;  4TKO B;  1VQ9 A;  2RCN A;  4QJF A;  4CJ0 B;  5I6W A;  3H6M A;  4L6T B;  4GS3 A;  4KLK A;  4DNT B;  3ICE A;  2KCM A;  3H09 A;  3NBI A;  4AYB E;  4F8M A;  2WIN B;  3KLS X;  5CV5 A;  4LFB L;  2PNH A;  2IX3 A;  1D5Z C;  5IE8 A;  1AN8 A;  1I4P A;  2B3G A;  1JE5 A;  4MHE A;  2GVB A;  1V43 A;  4KKS A;  3VDY A;  4LFC Q;  1GHJ A;  3TP8 A;  1PTO B;  5KYI A;  1CFM A;  2F1M A;  4JV5 L;  1EQV A;  1PZK D;  4HSV A;  3I4M B;  2EY6 A;  2PPB C;  2C5C A;  5J22 A;  1X3E A;  1DON A;  5C4X G;  3L2P A;  3AU7 A;  3EJI A;  3R93 A;  1EQR A;  4K8I A;  2XVS A;  4N8F A;  3HOX H;  4DV1 Q;  1AFP A;  4HJ7 A;  5ELD A;  4EQN A;  4WRD A;  4CKE A;  4X66 L;  2NVT B;  1K0R A;  3T1H Q;  1IXR A;  3ER0 A;  2HQE A;  1I4G A;  2DNE A;  1KQS A;  1C9O A;  5AJ3 Q;  1NSN S;  4NXN Q;  5IT9 c;  2R3Z A;  4C2M B;  2XSC A;  3D6W A;  5AFW A;  3RZD H;  5FLX L;  1QB5 D;  4J8Q A;  3UE1 A;  4A3F H;  1Y1V H;  1SE3 A;  2K5N A;  2Y0S E;  1G91 A;  3WDN A;  3E3X A;  1O78 A;  1IBK Q;  1E2W A;  2A19 A;  2PI2 A;  3SK6 A;  4DV6 L;  1IL8 A;  2F0I A;  3VYS A;  3SK8 A;  2F4V Q;  1VQ6 A;  4CJ2 C;  1E0B A;  1KRS A;  1TII D;  1I4R A;  1JR0 D;  4A3F G;  3K8A A;  3F2B A;  4L5R C;  1Q12 A;  4A3B H;  1KLG D;  4HJ9 A;  4IUV A;  5C4J B;  4JI4 Q;  1PZI D;  3TQY A;  3CCL A;  4DK0 A;  1SMY D;  3M3Y H;  3I70 A;  5C0X H;  4JI6 Q;  4GKK L;  3S1Q B;  1FNV A;  3MVV A;  2VZA A;  3OMG A;  2D2C C;  2F0O A;  1VQD A;  4A3K H;  4YY3 L;  2E2I H;  3PO2 H;  3D6C A;  1EQQ A;  4DA2 A;  2MJ8 A;  3MXN B;  5G3L F;  3CKI B;  5IYD H;  1SMY C;  5JAV A;  3GTL B;  1V9P A;  2KCN A;  1WI5 A;  3GTP B;  1JT8 A;  2K28 A;  1X65 A;  4XDX A;  2IPK D;  2F0W A;  3TRZ A;  4OWX B;  3NSW A;  4LW1 A;  2O4X A;  5FLM G;  1H9R A;  4LFB Q;  2DY8 A;  2K14 A;  3J80 E;  1TU2 B;  4LF8 L;  2O5J C;  1IZ6 A;  4DV5 Q;  1L1O C;  4H44 C;  1QVC A;  1BVS A;  1KDA A;  3G7L A;  3HOU H;  4DV4 Q;  4AQY L;  4HAE A;  1NY4 A;  3I4N B;  2QIL A;  4RCN A;  3OMC A;  4EGV A;  1NE3 A;  3HFZ B;  4IUT A;  2EYO A;  3A74 A;  1YNN D;  4NMZ A;  1SBB B;  4NPS A;  1B4O A;  1PH6 A;  3OPO A;  4PMB A;  3BZC A;  5M5W B;  2L4N A;  4JYA Q;  2CW0 C;  3EA6 A;  4HCS A;  3J7A 5;  1KRT A;  5LMN Q;  1FYC A;  3N52 A;  4ODG A;  3CMA A;  4GOP A;  1GUG A;  1PV4 A;  2MQH A;  4ME3 A;  1XNQ L;  4BXX G;  4JI2 Q;  3U9O A;  1EL0 A;  2JEB I;  3I90 A;  1M8A A;  3WWV A;  1VQL A;  1TT2 A;  4DGZ A;  4YCV A;  4N9T A;  2EJF C;  2L15 A;  1EEI D;  2NUC A;  3A54 A;  4A3I B;  2Z6B A;  2CH4 W;  2NTS A;  3KLW A;  1IKM A;  2MGS A;  4IPD A;  4IN3 A;  1EWH A;  2XIW A;  2EY5 A;  3CHB D;  4A93 B;  5IYC H;  5GAG C;  2A6E C;  5FK9 C;  1HH2 P;  1L0Y B;  4BXX H;  4WJ3 M;  3MWY W;  1Z47 A;  1TWG H;  5GAE C;  4R4C A;  4DK6 C;  2K5D A;  3S17 B;  1HA5 A;  1STA A;  5ELO A;  4X64 L;  1BCP B;  3H15 A;  3W3A A;  5EKK A;  4OWW B;  2K52 A;  5C3X A;  5CBE E;  4DR2 L;  5IIF A;  3S9W A;  4GZY C;  2LY7 A;  5BR8 Q;  5LMN L;  1TWA B;  2JEA I;  1B53 A;  4OX9 Q;  1RCV D;  3FMC A;  1EQT A;  4YWL A;  1EYC A;  3T16 A;  3K80 C;  4HIM A;  5ISR A;  1WCM G;  3NE5 B;  5E4W C;  4ZKC B;  2NN6 I;  2YTY A;  3C1E A;  5JJZ A;  3K57 A;  2PO4 A;  4FYD A;  4NW2 A;  2PI2 E;  4DK3 C;  3EFX D;  1EY5 A;  4A3B G;  1CZW A;  1CHP D;  5E1F A;  1ILP A;  1P8L A;  1YNJ D;  4DR7 L;  1F77 A;  1NJI C;  4G7O C;  1KDC A;  2VB2 X;  1TQO A;  1SND A;  2L1B A;  2MUY A;  5I6Y A;  4AH6 A;  3S1R B;  3T56 B;  2B2W C;  1BCP C;  2PNR C;  2VQE Q;  1H9S A;  3UDG A;  4A3K G;  4QQB X;  1JWU D;  2B2Y A;  4XIG S;  1Y1V B;  5IYD G;  1GVP A;  5D3I B;  1CQF A;  4DR3 Q;  4JBK A;  3HOW B;  4P73 A;  3R2T A;  2EIF A;  3CCS A;  1FJG Q;  3MZ5 A;  4NXM Q;  1Q3L A;  4GKJ L;  1TVX A;  4NXN L;  4R4O A;  5FLM H;  3HOW G;  5EBC A;  4ZUI A;  4ULL A;  1HJP A;  1JWS D;  1CUK A;  4CDE C;  4HSP A;  1XNR Q;  1I50 B;  2JJQ A;  5ELB A;  1SE8 A;  4UY8 C;  2R93 G;  3VR5 A;  4A3F B;  1G6Z A;  2IHF A;  2BDO A;  1GJX A;  1RF2 D;  3BS1 A;  1HNX Q;  3S15 H;  2LFN A;  1JIC A;  1VDZ A;  4RFB A;  4A3M G;  4QL5 A;  1BUV T;  1NTG A;  1EWI A;  3S1R H;  1S3O A;  1LM0 A;  2FJ2 A;  1BCP D;  1VQC A;  4QUF A;  3EIV A;  1PH2 A;  5GRO A;  4DV0 Q;  4DR4 Q;  3SK4 A;  2F0V A;  2R93 H;  4DUY Q;  5JEA H;  4N9P A;  1L1O B;  1D1I A;  4LFA L;  3SGI A;  2HCI A;  3MXG A;  2XNA C;  1V1Q A;  5IOD A;  3M7N A;  1EFI D;  4M1U B;  4WOR A;  3PUZ A;  4CKC A;  1S5F D;  4A3B B;  4C3J B;  1EY6 A;  4OIK A;  4A3E G;  2Q8R E;  3I8Z A;  4EQO A;  3K7U C;  1HFN A;  5I9P A;  4HMI A;  1RD9 D;  4YY3 Q;  4ZQ3 A;  3SVM A;  4JI3 Q;  2R7Z G;  4QF4 A;  4JBJ A;  2I0Q A;  2B2V A;  1ET6 A;  4JI7 Q;  4B3T Q;  2OQ0 A;  3A5U A;  2F0N A;  1A15 A;  1NAP A;  4ZUJ A;  4PZ8 A;  2EYJ A;  1VQM A;  1W6J A;  5IP7 G;  1PH7 A;  4WFN 3;  4QUC A;  3ITP A;  4A3E H;  1V1O A;  3H94 A;  3U4Z A;  3U50 C;  3AFQ A;  3RMH A;  3GTQ H;  4FDB A;  1LV9 A;  4YCU A;  1HR0 Q;  2UU9 L;  3A5Z B;  1A0I A;  2L11 A;  2R7Z H;  1G2T A;  2EY2 A;  3L9A X;  3SK5 A;  1SDF A;  3TN2 A;  2F0T A;  2NZ1 D;  3K81 C;  4FF2 A;  1R4Q B;  3IRB A;  1DM0 B;  3FDT A;  4IUR A;  2RSO A;  4R8N A;  4BBR G;  3M3Y B;  4C1N I;  4G4K A;  1GUO A;  2PMZ B;  1OXS C;  4IOC A;  1S5D D;  2R93 B;  2D0O A;  1PH4 A;  1Q90 A;  1QIL A;  2ATW A;  1ENF A;  3W5O A;  1EOT A;  2F3V A;  1EEF D;  4B9X A;  1K8G A;  1K28 A;  4HMJ A;  1V1P B;  1R9T B;  2J7Z A;  2ZJP A;  4BWG B;  1CSP A;  2B2Y C;  2EE1 A;  3J7Y W;  5JJK A;  4DNR B;  1KNA A;  1ICW A;  2K03 A;  2KED A;  3I3C A;  3S1M B;  2RSN A;  1WTO A;  1V1P A;  4K0K Q;  1H9M A;  3FVQ A;  4RKB A;  2X69 A;  4XXE A;  4OIJ A;  3PUY A;  3K0X A;  3NPP A;  3A8J E;  4DAV A;  2Z4H A;  4ALP A;  1I5F A;  5KNC A;  3DM3 A;  2B8F A;  2F0K A;  5IGG A;  4POF A;  1E22 A;  3BG3 A;  4C3J H;  1KLU D;  1DJR D;  2E75 C;  5M3M G;  3GDE A;  2AUJ D;  1Y14 B;  1BKB A;  3HOV B;  2A6E D;  5M3F H;  2AKW B;  4JBW A;  1BBU A;  4CHT B;  4A3J H;  2H5X A;  3URY A;  5EKL A;  4DR6 L;  3PCO B;  4DR5 Q;  1F2M A;  2BDN A;  2ASB A;  1B2T A;  2DJF C;  4OON A;  4DV1 L;  4LF6 Q;  2WAC A;  2FMM A;  3MTS A;  4NB3 A;  1PH5 A;  2KEN A;  5C44 H;  3KYH C;  3NEL A;  5KIX A;  3KF6 A;  1HQM C;  4J1M A;  1UEB A;  1EZ8 A;  1W2B A;  4IFD J;  2A69 D;  2KHS A;  2AMC B;  2LMC B;  3FKI B;  1K3B C;  5JEA G;  1IYU A;  2XWB B;  3AFP A;  3OTO L;  5IT9 L;  2PYK A;  4DR7 Q;  5JVG 3;  4JYA L;  3CCV A;  2VL6 A;  1HXY D;  2B63 H;  4QIW B;  1S5E D;  1MSH A;  1XPU A;  3CQZ B;  1XXG A;  3UDI A;  1Q46 A;  2XN9 C;  1K83 B;  1TWH H;  3NK9 A;  3JC6 6;  1N36 L;  2UU9 Q;  4BY7 B;  4B9W A;  3QO2 A;  1K8A C;  1MJE A;  3IAY A;  2QKI C;  4A3C G;  3TBI B;  3OW2 A;  5IYB G;  4A3I H;  2ZXO A;  3SR1 A;  1CA6 A;  1KAA A;  5M3M B;  1F9Q A;  4NDX A;  3J81 i;  3TSS A;  2R92 G;  1TWC B;  4ZAI A;  3KFU A;  2K04 A;  3J80 c;  5KRU A;  2RDF A;  4K5X A;  2WKC A;  1STH A;  2ZT9 C;  1U4L A;  4KTA A;  2DY7 A;  2LSS A;  2A74 C;  2EXD A;  3ERO A;  3X3N A;  4C3H H;  1LTR D;  1AE2 A;  1WCM B;  1Y8N B;  1NMG A;  1PMR A;  4JCV E;  5IYB H;  4NXM L;  1ICF B;  2KEE A;  1JOQ A;  1HZA A;  4FF4 A;  3Q24 A;  3I4N H;  1PVO A;  3AB9 A;  2K5H A;  4N8X 1;  3GV3 A;  1EOV A;  2UXC L;  1STY A;  4JK1 C;  2F0E A;  3C1F A;  4GLX A;  4DV2 Q;  3H3V C;  2FIN B;  4OEL B;  3FRP B;  1K3R A;  3KJO A;  1Q81 C;  3LWU A;  3SEB A;  1TWC H;  3TRE A;  1Q86 C;  2ZTC A;  1K8O A;  3Q6S A;  4DXG A;  4LFA Q;  1L0W A;  4DV3 L;  2BA0 A;  1UE5 A;  1ZXT A;  2D62 A;  4H13 C;  2F4V L;  1QCB D;  2R7Z B;  1TS2 A;  2F0Q A;  1SJH D;  3I4L A;  2WII B;  3UI2 A;  1SR3 A;  2F0L A;  3TZD A;  5EBD A;  4IUN A;  2CVR A;  1OO9 B;  2KCT A;  4IFD H;  2K5Q A;  5CV9 A;  1ESF A;  4HN7 A;  2CFM A;  2JSO A;  3J81 j;  4LF4 Q;  1B9N A;  2F3W A;  3KDF A;  4FVM A;  1SRU A;  1SSO A;  2NVQ B;  4Y52 H;  2TMP A;  2CCZ A;  1VQN A;  4JI8 Q;  3VR6 A;  3OW7 A;  2JA7 H;  3HOZ B;  4C3I G;  4HJ5 A;  1VQ4 A;  4A3M B;  2AUK A;  4KHV A;  4A4I A;  2JA5 H;  3GTJ B;  1ONL A;  4JOI A;  1OXV A;  3K5O A;  4I7Z C;  5CV4 A;  4P71 A;  4GLA C;  1N36 Q;  4BA1 I;  4JI1 Q;  5IGB A;  3CW2 C;  1ZKO A;  3A56 A;  3S15 B;  3I72 A;  2UUC Q;  4JPB W;  5JPN C;  4DV0 L;  1C0A A;  4OL7 A;  1PFN A;  1TWG B;  3Q0A A;  2QW7 A;  5C4H A;  1HNW L;  1GKH A;  4RMF A;  1I50 H;  2M00 A;  3M4P A;  4RH6 A;  3GV6 A;  1T9H A;  5DNF A;  3GTL H;  4XQQ A;  4G57 A;  5M5X H;  2NVT H;  1SYD A;  3NWS A;  4PNY A;  4OX9 L;  1TY0 A;  1EY4 A;  1YNX A;  3A7A B;  2EQS A;  4IPG A;  1XTC D;  1EU3 A;  2JA6 H;  1BO0 A;  1RJT A;  5C4Z A;  4R4Q A;  2EY1 A;  1JJC B;  1J9O A;  1E1O A;  3P1H A;  5C4J H;  3JAM L;  2KOL A;  1A2U A;  2BOS A;  3SE0 A;  4C3H G;  4RGN A;  4A3D G;  2QF7 A;  1I94 Q;  2Z0S A;  1GO3 E;  3ND8 A;  4ID6 A;  3ULL A;  3TME A;  1NNX A;  3WOE A;  1CZG A;  3K59 A;  3DWQ A;  4RGT A;  2A6H D;  2UUB Q;  1QZH A;  2J4X A;  1YVC A;  2QCP X;  3NEM A;  4A93 H;  3H0G B;  1VQH A;  2JA8 H;  1FGB D;  4CKB A;  1SEB D;  5ELN A;  1LLR D;  1F2L A;  1SLJ A;  4A3D H;  1D5M C;  4GNX B;  4QMG A;  4A76 A;  3MC0 B;  1FNW A;  4PZ7 A;  1PYW D;  2X6L A;  1E7Z A;  4A3E B;  4LF7 Q;  1JE4 A;  4L63 B;  4X6A H;  2KQ3 A;  3OIQ A;  2JP1 A;  5IWA Q;  3M4O B;  1LTL A;  2ZXR A;  1XPR A;  1IBM L;  2R6G A;  2JQO A;  1BR9 A;  1I6V C;  4PV1 C;  2R92 B;  1SE4 A;  4BS9 A;  1CKM A;  4JI0 Q;  2R61 A;  3BJU A;  4P74 A;  1FL0 A;  1SMX A;  1EU4 A;  3PF4 A;  5M5X B;  1H95 A;  5C4X H;  1MKH A;  5E3F A;  1K9M C;  3EVQ A;  5CV8 A;  4DAM A;  4CJ1 B;  3HOX G;  1R9T H;  4S3S A;  2QDB A;  3GTK H;  3KF8 B;  2PZT A;  1N34 Q;  1HA6 A;  1EIG A;  1K8M A;  2B39 A;  3GTM B;  4YHH Q;  1VQF A;  4Z9C B;  4RCO A;  1HHV A;  3KLR A;  3HRZ C;  1AP0 A;  1G6P A;  4LK1 C;  2MO1 A;  3W1G A;  1WTR A;  3E6Z X;  3W1B A;  1YJ9 A;  4C3I H;  1S40 A;  3E0J A;  4B3M Q;  1F2Z A;  2JA5 G;  4BY1 G;  1PRT B;  4LFC L;  3K5N A;  1Y1V G;  2LKV A;  3AEV A;  2Z6K C;  1XNQ Q;  1SYC A;  2E5L Q;  4JV5 Q;  4JI2 L;  3RZD B;  1VQG A;  1EYD A;  1LTG D;  2IX1 A;  5FJ8 H;  4DUZ L;  3HS0 C;  1PZJ D;  1E2Z A;  2QA4 A;  3SXH A;  3E0E A;  2RQX A;  2CQA A;  1KD1 C;  1X3F A;  1WTP A;  3VA7 A;  1D6E C;  2CKZ B;  1JWM D;  1U9R A;  1NCV A;  1JC7 A;  1HZC A;  1IYJ B;  3EQL C;  2NTT A;  1IBL L;  2CQO A;  1QOH A;  1EIF A;  5L37 A;  3DWP A;  1QJO A;  4UP8 A;  3GTO H;  1LT6 D;  2JA6 G;  4DK1 A;  5FJ8 G;  4I65 A;  2A1A A;  4UAI A;  1PDQ A;  1DOM A;  1LTA D;  1O7Z A;  1SNQ A;  4OXP A;  3CCR A;  4KJO A;  4P72 A;  3PQI A;  3HOZ H;  1VQJ A;  1W3S A;  4FP5 D;  2F03 A;  3DM1 A;  2JXM B;  4DV5 L;  2Y0S G;  3I4O A;  5BR8 L;  1IW7 D;  1AZP A;  4DV4 L;  4L8J A;  3RNU A;  2A69 C;  3D4R A;  3NTH A;  4ABN A;  1JOO A;  1STE A;  3D3R A;  1X9N A;  1Q7Y C;  1HPC A;  5C4X B;  2WAQ B;  3KUP A;  1J6Q A;  5K36 G;  3I4M G;  1GD7 A;  4KHP L;  3U4V A;  1PH9 A;  2JA8 G;  2SNS A;  4CDF C;  2JN4 A;  1YIT A;  3S1Q H;  3RN2 A;  4LJZ C;  3SDZ A;  2B2U A;  1D8L A;  1PH3 A;  2H1E A;  4JI6 L;  4IPH A;  4XQJ A;  3D4D A;  2UUC L;  1TS5 A;  4APV A;  2RA4 A;  1J5E Q;  1UEA B;  2Z4I A;  3CCJ A;  1Y1W G;  2N78 A;  4P2C B;  5EJW A;  4MNO A;  1G29 1;  1CI3 M;  1F9R A;  2I07 B;  1HUM A;  2VW9 A;  1DCZ A;  1VS0 A;  2MNA A;  4XT3 B;  3PF5 A;  3NQI A;  2YTX A;  4UP7 A;  3O13 A;  1GM5 A;  5A35 A;  4QGU A;  3BZD B;  3KF8 A;  3GTG B;  1B3Q A;  4RG1 A;  4X64 Q;  4IFD I;  1KXL A;  1TR5 A;  1Y1W H;  5CYU A;  2YYZ A;  1PLF A;  1YHQ A;  1VQB A;  4POG A;  3CRL C;  4K8J A;  3V05 A;  1X32 A;  3F1Z A;  1RDP D;  4LF8 Q;  3CU7 A;  2OTJ A;  1HQR D;  3I56 A;  1F9S A;  2F52 A;  1E3P A;  1WTX A;  1DOL A;  4F87 A;  3DLL A;  3HOY G;  3RN5 A;  1B3A A;  1BQQ T;  1X3Q A;  3IFD A;  4X3U A;  3RLN A;  2MFI A;  1MSG A;  2PW5 A;  1CT1 D;  3PO3 H;  4ZRZ A;  3AMU A;  3STB D;  2Q8T A;  3CAM A;  2E2H H;  3CME A;  3BVZ A;  3KDF B;  4M8A A;  3UE0 A;  1KIX A;  2NB0 A;  2JE6 I;  1ROD A;  2JA8 B;  3HOY H;  4KY5 A;  3BVG A;  3J80 L;  4X3K A;  1DD2 A;  3PUX A;  3E5S A;  4FXK C;  2LXJ A;  5IT9 E;  5HGQ A;  2AQ2 B;  1GOZ A;  4JW0 A;  2WFW A;  4R4T A;  1E2V A;  4H7B A;  1MBY A;  3IFT A;  1I4H A;  3PIO A;  1HNZ Q;  3L3O C;  4Q0F A;  1E24 A;  5IWA L;  1Q1B A;  3HKZ E;  3P7J A;  4CBV A;  5DM6 3;  1JB7 A;  4AYB G;  1PRT C;  2BH2 A;  1SYG A;  3RLO A;  3BDL A;  3OOC A;  4HIO A;  3H3V I;  3S2H H;  4IZ8 A;  3JAM c;  1KAB A;  2QDL A;  4RA8 A;  4O2D A;  2HHH L;  1TS4 A;  4NKL A;  3HOV H;  2KHJ A;  5A2Q L;  2XGT A;  3Q22 A;  1IBM Q;  2RHQ B;  2DJG C;  3U9S A;  3G4S A;  3HOZ G;  2IHE A;  5FO7 B;  1X55 A;  2KCC A;  3AYH B;  2J0T D;  2E76 C;  3FP9 A;  2KBN A;  1CM9 A;  2CWP A;  1TWF H;  2DN8 A;  3CP0 A;  3MXP A;  4C3H B;  4JVZ A;  1Z6H A;  2UXD Q;  4K0K L;  2B2U C;  3P20 A;  3OHX C;  5K36 H;  1B44 D;  2IW3 A;  4PQX A;  5C0X G;  2PQE A;  5IOC A;  3BYY B;  1LAB A;  2PQA A;  1JOR A;  5J39 A;  3PUW A;  1RIP A;  4DR4 L;  4XQN A;  3TP5 A;  3TEH B;  3T51 B;  2XWJ B;  4G7Z C;  4IAL A;  1YNJ C;  1BXT A;  1LTS D;  1YEZ A;  1BOS A;  1VQO A;  1Q8K A;  1SNC A;  1A3U A;  2K75 A;  5IP9 G;  5HY6 A;  3BDO A;  4MTN A;  3GTP H;  3K7A B;  4IUP A;  4QCL A;  3K0Y A;  2RDH A;  3ONA B;  2EYL A;  5LHY 1;  2A68 C;  3BDC A;  3MFY A;  1S5C D;  1S4Z A;  4BBR B;  3UDF A;  3L0O A;  1FJG L;  2RHS B;  2HT1 A;  1L1O A;  1SYB A;  2G5D A;  2RF4 A;  2M2L A;  1NR4 A;  1BF4 A;  1NUC A;  1YHA A;  1X56 A;  1ZYR C;  4LUV A;  1VCI A;  3KF6 B;  1H9J A;  1WJJ A;  5F2D A;  2TSS A;  2R7D A;  2GVA A;  5EGT A;  1SE2 A;  2L9H A;  2XRQ D;  3QB3 A;  2QGQ A;  2OQK A;  2F3I A;  1PXU A;  1YJW A;  4DFA A;  3LNN A;  3NWT A;  4LMQ D;  3RZO B;  2PZU A;  2UUA L;  3PO3 G;  3RUZ A;  5IP7 H;  3GP7 A;  2O5I C;  1LTT D;  4DR1 L;  3MXN A;  3R3O A;  4E6I A;  2B2T C;  1NMF A;  2K6A A;  3BU2 A;  4PMW A;  2D0P A;  4CDC C;  2FFK B;  4KKU A;  4BY7 G;  2RCF A;  1A8V A;  2EPB A;  1KL9 A;  1Y1W B;  4A3L H;  1BDO A;  4H0L C;  3SHL A;  1L0X B;  2I5L X;  4BBR H;  4RGO S;  1CKN B;  2YU9 H;  4JG2 A;  5FOB B;  1RKN A;  4LF4 L;  5DM7 3;  1OXT A;  2EYP A;  4DAY A;  3RR5 A;  1CA5 A;  1VQ7 A;  1P16 A;  1HNX L;  5LMU Q;  4GNX C;  1HZB A;  1PA6 A;  3PV0 A;  2VUM B;  3A7L A;  1ET9 A;  1NR2 A;  2VB3 X;  5M5Y H;  1V8Q A;  1PRT D;  3C46 A;  3DXJ C;  2OF1 A;  2DNC A;  4RAU C;  2PZW A;  4HID A;  2EXZ A;  3S1M H;  4JI1 L;  2Z6K A;  5DAU A;  1PRT F;  2EOT A;  3D4W A;  2EVB A;  3KJP A;  2NZH A;  5K5P A;  1EZ6 A;  2NVY B;  1OTC A;  5CBA E;  4L5S A;  1X6O A;  1WCM H;  1HTL D;  4Y7N H;  1FGU A;  2H4O A;  2IJ0 A;  1B9M A;  5IGE A;  5IGC A;  2OEO A;  4I7A A;  4OO1 G;  1AZQ A;  4K6D A;  1IW7 C;  4C3J G;  4IPC A;  4LWC A;  3QWN A;  3HKS A;  2WV6 D;  5M3M H;  1BBW A;  5JPM C;  1WOC A;  3DUZ A;  1FR3 A;  1WFQ A;  3A55 A;  3PIP 3;  4JI4 L;  1U4M A;  4YCW A;  4A3K B;  4KK7 A;  5M3F G;  1ML0 D;  3J7Z C;  5C5M A;  2NZO A;  2FMC A;  2KA7 A;  5M3F B;  3OTO Q;  3PSI A;  1WTQ A;  2UXB Q;  5FLX c;  5I2Y A;  1JMC A;  4TSS A;  4OO1 H;  5CGK A;  3M9B A;  2EYF A;  2F0U A;  1SN8 A;  3BVM A;  4EVO A;  5IP9 H;  3QJY A;  4G7H C;  5FKA C;  1PHJ A;  3TS2 A;  5JEA J;  1HNZ L;  3HOW H;  5CV6 A;  5AJ3 L;  4V19 0;  3LGJ A;  1SXT A;  1YBY A;  1HTP A;  1II3 A;  4DF7 A;  2I46 A;  4X62 Q;  4P75 A;  1G8Z D;  2XRS D;  2NWG A;  2DUD A;  4KV6 A;  1BNZ A;  1QE6 A;  4NP5 A;  1EYA A;  3K5L A;  3A8I E;  2F0S A;  1MI2 A;  4DU9 A;  1CTM A;  1O7Y A;  4V0B A;  1OXX K;  1D5X C;  1QVF A;  1WTV A;  3CC4 A;  3F2U A;  2E2H B;  2SEB D;  3FEW X;  3ULJ A;  3GTK B;  1F9P A;  1XPO A;  3TZU A;  2PW7 A;  5IGD A;  3K5M A;  1MIU A;  4KJN A;  2PCF B;  4A3I G;  3DHQ A;  1Z7T A;  1LT5 D;  2VQF Q;  2K1B A;  3NEN A;  1UE6 A;  3K7A H;  2BE5 C;  3FHW A;  3I73 A;  5CR3 A;  1KNE A;  2C35 B;  1VQ8 A;  4FXG C;  5JOB A;  1VQE A;  3NP8 A;  5CC4 A;  3VYR A;  5KEE A;  3GTQ B;  2LXK A;  1QVG A;  2A73 B;  1QNK A;  4R4I A;  2AHO B;  2F0D A;  4DR6 Q;  4HJ8 A;  1N8R C;  1VQP A;  3NTI A;  3V2T A;  4X62 L;  4FF1 A;  3CC7 A;  1S5B D;  2G9H D;  2GA4 B;  2NN6 G;  1DOK A;  3G6J B;  2K5W A;  3I4N G;  4OGQ C;  3DWA A;  4ZKB B;  4IQZ A;  1LYL A;  4GN4 B;  2VY3 A;  3PIO 3;  3M4Y A;  5EPL A;  3J7A F;  2A5H A;  1O7L A;  2ZJQ A;  4IUQ A;  4X65 L;  4GLV B;  4PG3 A;  2RVL A;  3GTG H;  5CV7 A;  1D7Q A;  3VR2 A;  1EFW A;  1ASZ A;  4LUO A;  1BCP F;  1I6H H;  2F0J A;  1XNR L;  1JCK B;  1UE7 A;  3W2D A;  1LT4 D;  3RZO H;  2BH8 A;  5FLX E;  1VQK A;  1CKN A;  2G9D A;  5D3D A;  2HIV A;  4A3D B;  5CMD A;  5I2X A;  4JI3 L;  1I4X A;  2N8N A;  4XYQ A;  1UNS A;  1J5E L;  4JI8 L;  4DXF A;  2IT1 A; 
#chains in the Genus database with same CATH homology
 3FPP A;  1GUT A;  2L55 A;  2B8G A;  1D2B A;  3K6O A;  1ESR A;  2SOB A;  4WJW A;  4R8I A;  1HCZ A;  1I3Q B;  1A6X A;  5EPK A;  5HGT A;  3I91 A;  1CHQ D;  5G3L D;  5ELF A;  3OSO A;  2HDM A;  1J8I A;  3TP6 A;  2Z8L A;  5C6A A;  1LO5 D;  2F0M A;  2O2L D;  3CRK C;  1SYF A;  3P75 A;  4QB4 A;  1LAC A;  3A8K E;  4K14 A;  2EDG A;  5LL6 S;  3R2I A;  1SJE D;  3MAQ A;  2HCC A;  3RLF A;  3KLS A;  3IKJ A;  2SDF A;  1SAP A;  5M5Y B;  1HUN A;  1I6H B;  3MHB A;  2E74 C;  1XX8 A;  4U68 A;  2JA5 B;  5M9O A;  3JAM E;  4FF3 A;  5E4X A;  2FHT A;  4KKT A;  3IL8 A;  1X3P A;  2ID0 A;  3LWE A;  1OXU A;  5J1Z A;  4A3G B;  3T4A C;  1LT3 D;  5BN4 A;  1CK1 A;  4KN4 C;  3OWF A;  2EYH A;  4X3T A;  1G2S A;  3R8B A;  4RKL A;  5I9O A;  4TRD A;  1TWH B;  1PFM A;  4BBS B;  4KMU C;  5KND A;  2N88 A;  2NN6 H;  3KBG A;  4PMC A;  2AWN A;  1WD0 A;  4J6H A;  2QEJ C;  1TWF B;  2X6G A;  4K5W A;  4KHZ A;  2Y0S B;  4KI0 A;  4OO1 I;  5TSS A;  3M85 A;  2F4I A;  3QG1 A;  1JB3 A;  1PTO H;  4XYO A;  3K58 A;  1AW7 A;  3FPU B;  5IGF A;  4KD3 A;  1CQV A;  1DYQ A;  5BN3 A;  1WVL A;  3HZX A;  3DMU A;  3HP3 A;  1H9S B;  2Z1C A;  1I4Q A;  1EWC A;  2MHV A;  1SYE A;  2N55 A;  3DEP A;  2KUM A;  1MGS A;  5C3E B;  1Y69 U;  1QWY A;  2ZXP A;  3S2H B;  2C9O A;  1D1K A;  1A3V A;  1STG A;  4HED A;  3V96 A;  5C3W A;  3OIP A;  3HG9 A;  5A2Q E;  2SNM A;  2BE5 D;  5ELE A;  1TS3 A;  4MN3 A;  2HUG A;  2IWH A;  1M4V A;  2JA7 B;  1T5E A;  2MP1 A;  2BA1 A;  2A68 D;  4O1N A;  3MXU A;  1PTO C;  2F0H A;  1T5X D;  4UDU C;  1AEX A;  1WTW A;  1Y8P B;  3VA5 A;  1A3T A;  1IKL A;  3PMF A;  1SNO A;  5FO8 B;  3T53 B;  3TP7 A;  2E2D C;  2CHB D;  1FNU A;  2F0P A;  2WB1 B;  5I4D A;  5ELC A;  1W6K A;  5C5L A;  2D9U A;  4K5V A;  2YU9 B;  3NXW A;  4OHJ A;  1A2T A;  2L12 A;  2K05 A;  3HOY B;  2A6H C;  2NBF A;  2KEC A;  3MA2 B;  4HCE A;  1QNU A;  5EPJ A;  3MEH A;  2RKS A;  5JVH 3;  1ZYR D;  1B50 A;  1EY9 A;  3MFG A;  3PO3 B;  3NHH A;  3ERQ A;  5T1G A;  3HOU B;  2MPM A;  1Q1E A;  1U4R A;  1EY0 A;  3S1N B;  1STB A;  1O80 A;  1H9K A;  1LTB D;  1C4Q A;  3GD7 A;  4XT1 B;  4IFD G;  1C48 A;  4C1N K;  2RBM A;  5DEH A;  3L7Z C;  1ENA A;  2IX0 A;  2KVM A;  1XYI A;  4Q5V A;  2K7V A;  4C3I B;  1SFO B;  1KDB A;  1GHK A;  1FD7 D;  3HKZ B;  4A3J B;  2NVX B;  2EYM A;  2B2W A;  3PUV A;  3QOL A;  3PO2 B;  2E2I B;  4KN7 C;  2ENB A;  4KY6 A;  4FNF A;  2AQ3 B;  3VR3 A;  2EZV A;  1R4P B;  2JYO A;  5C44 B;  5KNB A;  1ZEQ X;  2F0F A;  1KTK A;  4HR7 B;  1DZ1 A;  2LS0 1;  5T1I A;  4ZK9 B;  4O42 A;  1GXD C;  1RTO A;  4DAP A;  4EQP A;  2OXP A;  4RHS A;  1GUS A;  3GTO B;  1ENC A;  4LAA A;  1STN A;  4U67 3;  4FXD A;  4ILW A;  3X3M A;  3S16 B;  2L0C A;  3VYT A;  2V4D A;  2L5T A;  3J81 L;  1HRJ A;  1PTO F;  3VYU A;  5D14 A;  1TY2 A;  3LX0 A;  2Q8I B;  3GQB A;  4K2L A;  4KD4 A;  3GO5 A;  2E2J B;  4F88 A;  4RGM A;  1RHP A;  1B1Z A;  5C0X I;  2M9V A;  4BY1 B;  1PFB A;  1GUN A;  3HGB A;  1UUP A;  2EJM A;  1GUW A;  2B2T A;  1EY7 A;  1HFG A;  4R9W A;  4X3S A;  4TQU S;  4DN4 M;  3Q23 A;  1C8C A;  3S14 B;  4B08 A;  3C3L A;  2ICI A;  3NBH A;  4RHR A;  3ND9 A;  3H91 A;  2VXW A;  5NUC A;  1VF5 C;  5KYL A;  1YNN C;  4IUU A;  3WOF A;  2KJX A;  3DEO A;  3RD4 A;  5C0X J;  1U4P A;  3NTK A;  3D31 A;  4BA2 I;  2NYZ D;  5FO9 B;  1WD1 A;  4K6L A;  2BCO A;  1JOK A;  1SNM A;  1RTN A;  1F2Y A;  2CW0 D;  3D8G A;  4YIJ A;  1XWE A;  3J7A V;  3HEJ A;  3QOJ A;  2HDL A;  4ZYS A;  1VMC A;  3NQT A;  5COR A;  5D65 A;  1UAP A;  2K32 A;  4MIU A;  1MD2 D;  2WKD A;  2AQ1 B;  4KY7 A;  3KK7 A;  2WP8 J;  2VNU D;  2B63 B;  4ME5 A;  3S2D B;  1QG7 A;  3NUC A;  1JQY D;  4AYB B;  1Q8I A;  1SNP A;  5HUR A;  3N6R A;  3KBX A;  1VMP A;  1BBX C;  3VR4 A;  2JA6 B;  2AWO A;  4CGY B;  2EJG C;  1VF7 A;  3HOX B;  2OT2 A;  5EQ0 A;  4Y7N B;  3QIA A;  5BN5 A;  1EY8 A;  1Y8O B;  3T13 A;  2K01 A;  5KGU A;  1PTO D;  3M7G A;  4K2K A;  3C2P A;  2RDG A;  2F0G A;  5COY A;  2D5D A;  1IHZ A;  1EIH A;  5EKI A;  3J81 E;  2ICE C;  4FO2 A;  4C56 C;  4XTC S;  3BYT B;  2K33 A;  2B2V C;  1IYV A;  3TDQ A;  4RWS C;  5LL6 X;  1TKW B;  3OWE B;  4F7X A;  1DXM A;  4ZLT F;  1LTI D;  3ZYY X;  4HTH A;  1ILQ A;  2IL8 A;  4TKO B;  4CJ0 B;  5I6W A;  3H6M A;  4L6T B;  4DNT B;  3H09 A;  3NBI A;  4F8M A;  2WIN B;  3KLS X;  5CV5 A;  2IX3 A;  1D5Z C;  1AN8 A;  1I4P A;  4MHE A;  1V43 A;  4KKS A;  1GHJ A;  3TP8 A;  1PTO B;  5KYI A;  1CFM A;  2F1M A;  1EQV A;  1PZK D;  4HSV A;  3I4M B;  2EY6 A;  2PPB C;  2C5C A;  5J22 A;  1DON A;  3AU7 A;  3EJI A;  3R93 A;  4K8I A;  2XVS A;  1AFP A;  5ELD A;  4EQN A;  4WRD A;  4CKE A;  2NVT B;  2HQE A;  1I4G A;  2DNE A;  1NSN S;  2R3Z A;  4C2M B;  2XSC A;  3D6W A;  5AFW A;  5FLX L;  1QB5 D;  4J8Q A;  1SE3 A;  1G91 A;  3WDN A;  1O78 A;  1E2W A;  3SK6 A;  1IL8 A;  2F0I A;  3VYS A;  3SK8 A;  4CJ2 C;  1E0B A;  1TII D;  1I4R A;  1JR0 D;  1Q12 A;  1KLG D;  4IUV A;  5C4J B;  1PZI D;  4DK0 A;  1SMY D;  3I70 A;  5C0X H;  3S1Q B;  1FNV A;  3MVV A;  3OMG A;  2D2C C;  2F0O A;  3D6C A;  4DA2 A;  2MJ8 A;  5G3L F;  3CKI B;  1SMY C;  5JAV A;  3GTL B;  2KCN A;  3GTP B;  2K28 A;  4XDX A;  2IPK D;  2F0W A;  3NSW A;  2O4X A;  1H9R A;  2DY8 A;  3J80 E;  1TU2 B;  2O5J C;  4H44 C;  1KDA A;  3G7L A;  4HAE A;  3I4N B;  2QIL A;  4RCN A;  3OMC A;  4EGV A;  4IUT A;  2EYO A;  1YNN D;  4NMZ A;  1SBB B;  1B4O A;  3OPO A;  4PMB A;  5M5W B;  2L4N A;  2CW0 C;  3EA6 A;  4HCS A;  1FYC A;  3N52 A;  4ODG A;  1GUG A;  3U9O A;  1EL0 A;  2JEB I;  3I90 A;  1M8A A;  1TT2 A;  4DGZ A;  4N9T A;  2EJF C;  1EEI D;  2NUC A;  3A54 A;  4A3I B;  2NTS A;  1IKM A;  2MGS A;  4IN3 A;  1EWH A;  2XIW A;  2EY5 A;  3CHB D;  4A93 B;  2A6E C;  5FK9 C;  1L0Y B;  3MWY W;  1Z47 A;  2K5D A;  3S17 B;  1HA5 A;  1STA A;  1BCP B;  3W3A A;  5EKK A;  5C3X A;  5CBE E;  5IIF A;  3S9W A;  4GZY C;  2LY7 A;  1TWA B;  2JEA I;  1B53 A;  1RCV D;  3FMC A;  1EQT A;  1EYC A;  3T16 A;  5ISR A;  3NE5 B;  5E4W C;  5JJZ A;  2NN6 I;  4ZKC B;  3C1E A;  3K57 A;  2PO4 A;  4FYD A;  4NW2 A;  3EFX D;  1EY5 A;  1CZW A;  1CHP D;  5E1F A;  1ILP A;  1YNJ D;  1F77 A;  4G7O C;  1KDC A;  2VB2 X;  1TQO A;  1SND A;  2L1B A;  2MUY A;  5I6Y A;  3S1R B;  3T56 B;  2B2W C;  1BCP C;  2PNR C;  1H9S A;  1JWU D;  2B2Y A;  4XIG S;  1Y1V B;  5D3I B;  1CQF A;  3HOW B;  3R2T A;  3MZ5 A;  1Q3L A;  1TVX A;  5EBC A;  4ZUI A;  4ULL A;  1JWS D;  4HSP A;  1I50 B;  5ELB A;  4A3F B;  3VR5 A;  1G6Z A;  2BDO A;  1GJX A;  1RF2 D;  3BS1 A;  2LFN A;  1JIC A;  1VDZ A;  4RFB A;  1BUV T;  2FJ2 A;  1BCP D;  4QUF A;  3SK4 A;  2F0V A;  5JEA H;  4N9P A;  1D1I A;  2HCI A;  2XNA C;  5IOD A;  3MXG A;  3M7N A;  1EFI D;  4M1U B;  4WOR A;  3PUZ A;  4CKC A;  1S5F D;  4A3B B;  4C3J B;  1EY6 A;  4OIK A;  2Q8R E;  3I8Z A;  4EQO A;  1HFN A;  5I9P A;  4HMI A;  1RD9 D;  4ZQ3 A;  3SVM A;  4QF4 A;  2B2V A;  1ET6 A;  2F0N A;  1A15 A;  1NAP A;  4ZUJ A;  2EYJ A;  1W6J A;  4WFN 3;  4QUC A;  3ITP A;  1V1O A;  3H94 A;  3RMH A;  1LV9 A;  2L11 A;  1G2T A;  2EY2 A;  3L9A X;  3SK5 A;  1SDF A;  3TN2 A;  2F0T A;  2NZ1 D;  4FF2 A;  1R4Q B;  1DM0 B;  3FDT A;  4IUR A;  2RSO A;  4R8N A;  3M3Y B;  4C1N I;  4G4K A;  1GUO A;  2PMZ B;  1OXS C;  1S5D D;  2R93 B;  1Q90 A;  1QIL A;  1ENF A;  1EOT A;  2F3V A;  1EEF D;  4B9X A;  4HMJ A;  1V1P B;  1R9T B;  2J7Z A;  4BWG B;  2B2Y C;  2EE1 A;  3J7Y W;  4DNR B;  1KNA A;  1ICW A;  2K03 A;  2KED A;  3I3C A;  3S1M B;  2RSN A;  1WTO A;  1V1P A;  1H9M A;  3FVQ A;  4RKB A;  2X69 A;  4XXE A;  4OIJ A;  3PUY A;  3NPP A;  3A8J E;  4DAV A;  2Z4H A;  5KNC A;  2B8F A;  2F0K A;  5IGG A;  3BG3 A;  1KLU D;  1DJR D;  2E75 C;  2AUJ D;  3HOV B;  2A6E D;  4JBW A;  4CHT B;  3URY A;  5EKL A;  1F2M A;  2BDN A;  1B2T A;  2WAC A;  2FMM A;  3MTS A;  5KIX A;  1HQM C;  4J1M A;  1EZ8 A;  4IFD J;  2A69 D;  2KHS A;  2LMC B;  3FKI B;  5JEA G;  1IYU A;  2XWB B;  5IT9 L;  2PYK A;  5JVG 3;  1HXY D;  4QIW B;  1S5E D;  1MSH A;  3CQZ B;  1XXG A;  2XN9 C;  1K83 B;  3NK9 A;  4BY7 B;  4B9W A;  3QO2 A;  3IAY A;  2QKI C;  3TBI B;  2ZXO A;  1CA6 A;  3SR1 A;  1KAA A;  5M3M B;  1F9Q A;  4NDX A;  3TSS A;  1TWC B;  4ZAI A;  2K04 A;  5KRU A;  2RDF A;  4K5X A;  2WKC A;  1STH A;  2ZT9 C;  1U4L A;  4KTA A;  2DY7 A;  2A74 C;  3ERO A;  3X3N A;  1LTR D;  1Y8N B;  1WCM B;  1PMR A;  2KEE A;  1JOQ A;  4FF4 A;  3Q24 A;  3AB9 A;  3GV3 A;  1STY A;  4JK1 C;  2F0E A;  3C1F A;  3H3V C;  2FIN B;  3FRP B;  3LWU A;  3SEB A;  1K8O A;  3Q6S A;  4DXG A;  2BA0 A;  1ZXT A;  2D62 A;  4H13 C;  1QCB D;  2R7Z B;  1TS2 A;  2F0Q A;  1SJH D;  3I4L A;  2WII B;  3UI2 A;  2F0L A;  3TZD A;  5EBD A;  4IUN A;  2CVR A;  1OO9 B;  4IFD H;  2K5Q A;  5CV9 A;  1ESF A;  4HN7 A;  2JSO A;  1B9N A;  2F3W A;  4FVM A;  1SSO A;  2NVQ B;  2TMP A;  3VR6 A;  3OW7 A;  3HOZ B;  4C3I G;  4A3M B;  2AUK A;  4KHV A;  3GTJ B;  1ONL A;  1OXV A;  3K5O A;  4I7Z C;  5CV4 A;  4BA1 I;  5IGB A;  1ZKO A;  3A56 A;  3S15 B;  3I72 A;  5JPN C;  4OL7 A;  1PFN A;  1TWG B;  3Q0A A;  5C4H A;  2M00 A;  4RH6 A;  3GV6 A;  5DNF A;  4XQQ A;  4G57 A;  1SYD A;  3NWS A;  4PNY A;  1TY0 A;  1EY4 A;  3A7A B;  1XTC D;  1EU3 A;  1BO0 A;  1RJT A;  5C4Z A;  2EY1 A;  1J9O A;  3P1H A;  3JAM L;  2KOL A;  1A2U A;  2BOS A;  3SE0 A;  4C3H G;  4RGN A;  2QF7 A;  3ND8 A;  4ID6 A;  3TME A;  3WOE A;  1CZG A;  3K59 A;  3DWQ A;  4RGT A;  2A6H D;  2J4X A;  2QCP X;  3H0G B;  1FGB D;  4CKB A;  1SEB D;  1LLR D;  1F2L A;  1D5M C;  4QMG A;  3MC0 B;  1FNW A;  1PYW D;  2X6L A;  4A3E B;  1JE4 A;  4L63 B;  2KQ3 A;  3OIQ A;  2JP1 A;  3M4O B;  2ZXR A;  2R6G A;  1BR9 A;  1I6V C;  4PV1 C;  2R92 B;  1SE4 A;  4BS9 A;  2R61 A;  1EU4 A;  5M5X B;  5E3F A;  3EVQ A;  5CV8 A;  4CJ1 B;  4S3S A;  2QDB A;  2PZT A;  1HA6 A;  1EIG A;  1K8M A;  2B39 A;  3GTM B;  4Z9C B;  4RCO A;  1HHV A;  3KLR A;  3HRZ C;  1AP0 A;  4LK1 C;  1WTR A;  3E6Z X;  3E0J A;  1F2Z A;  1PRT B;  3K5N A;  2LKV A;  1SYC A;  3RZD B;  1EYD A;  1LTG D;  2IX1 A;  3HS0 C;  1PZJ D;  1E2Z A;  3SXH A;  2RQX A;  2CQA A;  1WTP A;  3VA7 A;  1D6E C;  1JWM D;  1U9R A;  1NCV A;  1JC7 A;  3EQL C;  2NTT A;  1QOH A;  3DWP A;  1QJO A;  1LT6 D;  4DK1 A;  4I65 A;  4UAI A;  1PDQ A;  1DOM A;  1LTA D;  1O7Z A;  1SNQ A;  4KJO A;  2F03 A;  4FP5 D;  3DM1 A;  2JXM B;  1IW7 D;  1AZP A;  4L8J A;  2A69 C;  3D4R A;  3NTH A;  4ABN A;  1JOO A;  1STE A;  3D3R A;  1HPC A;  5C4X B;  2WAQ B;  3KUP A;  5K36 G;  2SNS A;  4LJZ C;  3SDZ A;  2B2U A;  2H1E A;  4XQJ A;  3D4D A;  1TS5 A;  2RA4 A;  1UEA B;  2Z4I A;  4P2C B;  5EJW A;  1G29 1;  1CI3 M;  1F9R A;  2I07 B;  1HUM A;  1DCZ A;  4XT3 B;  3NQI A;  3O13 A;  5A35 A;  3BZD B;  3KF8 A;  3GTG B;  4IFD I;  1TR5 A;  5CYU A;  2YYZ A;  1PLF A;  3CRL C;  4K8J A;  3V05 A;  1X32 A;  1RDP D;  3CU7 A;  1HQR D;  1F9S A;  1WTX A;  1DOL A;  4F87 A;  1B3A A;  1BQQ T;  1X3Q A;  3IFD A;  4X3U A;  1MSG A;  2PW5 A;  1CT1 D;  4ZRZ A;  3AMU A;  2Q8T A;  3BVZ A;  4M8A A;  2NB0 A;  2JE6 I;  1ROD A;  2JA8 B;  4KY5 A;  3BVG A;  3J80 L;  4X3K A;  1DD2 A;  3PUX A;  3E5S A;  4FXK C;  5IT9 E;  2AQ2 B;  1GOZ A;  1E2V A;  4H7B A;  1MBY A;  3IFT A;  1I4H A;  3L3O C;  4Q0F A;  1Q1B A;  3P7J A;  4CBV A;  5DM6 3;  1PRT C;  1SYG A;  3BDL A;  3OOC A;  4IZ8 A;  1KAB A;  4RA8 A;  1TS4 A;  4NKL A;  5A2Q L;  3Q22 A;  3U9S A;  5FO7 B;  2KCC A;  2J0T D;  2E76 C;  1CM9 A;  2DN8 A;  3MXP A;  4C3H B;  1Z6H A;  2B2U C;  3P20 A;  3OHX C;  5K36 H;  1B44 D;  2IW3 A;  5C0X G;  4PQX A;  2PQE A;  5IOC A;  3BYY B;  1LAB A;  1JOR A;  5J39 A;  3PUW A;  4XQN A;  3TP5 A;  3T51 B;  2XWJ B;  4G7Z C;  4IAL A;  1YNJ C;  1BXT A;  1LTS D;  1BOS A;  1SNC A;  1A3U A;  3BDO A;  3K7A B;  4IUP A;  4QCL A;  3K0Y A;  2RDH A;  3ONA B;  2EYL A;  5LHY 1;  2A68 C;  3BDC A;  3MFY A;  1S5C D;  1S4Z A;  4BBR B;  1SYB A;  2M2L A;  1NR4 A;  1BF4 A;  1NUC A;  1ZYR C;  1VCI A;  1H9J A;  5F2D A;  2TSS A;  5EGT A;  1SE2 A;  2L9H A;  2XRQ D;  3QB3 A;  1PXU A;  4DFA A;  3LNN A;  3NWT A;  4LMQ D;  3RZO B;  2PZU A;  3RUZ A;  3GP7 A;  2O5I C;  1LTT D;  3MXN A;  3R3O A;  4E6I A;  2B2T C;  2K6A A;  4PMW A;  2FFK B;  4KKU A;  2EPB A;  1Y1W B;  1BDO A;  4H0L C;  3SHL A;  1L0X B;  4RGO S;  5FOB B;  1RKN A;  5DM7 3;  1OXT A;  2EYP A;  4DAY A;  1CA5 A;  3PV0 A;  2VUM B;  3A7L A;  1ET9 A;  1NR2 A;  2VB3 X;  1V8Q A;  1PRT D;  3C46 A;  3DXJ C;  2OF1 A;  2DNC A;  4RAU C;  2PZW A;  2EXZ A;  5DAU A;  1PRT F;  2EOT A;  3D4W A;  2EVB A;  5K5P A;  1EZ6 A;  2NVY B;  5CBA E;  1HTL D;  2IJ0 A;  2H4O A;  1B9M A;  5IGE A;  5IGC A;  2OEO A;  4OO1 G;  1AZQ A;  4K6D A;  1IW7 C;  4C3J G;  3QWN A;  2WV6 D;  5JPM C;  3DUZ A;  1FR3 A;  3A55 A;  3PIP 3;  1U4M A;  4A3K B;  4KK7 A;  1ML0 D;  5C5M A;  5M3F B;  2FMC A;  2KA7 A;  1WTQ A;  5I2Y A;  4TSS A;  4OO1 H;  5CGK A;  2EYF A;  2F0U A;  3BVM A;  4EVO A;  3QJY A;  4G7H C;  5FKA C;  5JEA J;  5CV6 A;  4V19 0;  1SXT A;  1HTP A;  1II3 A;  4DF7 A;  2I46 A;  1G8Z D;  2XRS D;  2NWG A;  4KV6 A;  1BNZ A;  1QE6 A;  4NP5 A;  1EYA A;  3K5L A;  3A8I E;  2F0S A;  1MI2 A;  4DU9 A;  1CTM A;  1O7Y A;  4V0B A;  1OXX K;  1D5X C;  1WTV A;  3F2U A;  2E2H B;  2SEB D;  3FEW X;  3GTK B;  1F9P A;  3TZU A;  2PW7 A;  5IGD A;  3K5M A;  4KJN A;  2PCF B;  3DHQ A;  1Z7T A;  1LT5 D;  2K1B A;  2BE5 C;  3I73 A;  5CR3 A;  1KNE A;  4FXG C;  5JOB A;  5CC4 A;  3NP8 A;  3VYR A;  5KEE A;  3GTQ B;  2A73 B;  1QNK A;  2F0D A;  3NTI A;  3V2T A;  4FF1 A;  1S5B D;  2G9H D;  2GA4 B;  2NN6 G;  1DOK A;  3G6J B;  2K5W A;  4OGQ C;  3DWA A;  4ZKB B;  4IQZ A;  3PIO 3;  3M4Y A;  5EPL A;  3J7A F;  2A5H A;  1O7L A;  4IUQ A;  2RVL A;  5CV7 A;  3VR2 A;  1BCP F;  2F0J A;  1JCK B;  3W2D A;  1LT4 D;  5FLX E;  2G9D A;  5D3D A;  4A3D B;  5CMD A;  5I2X A;  1I4X A;  4XYQ A;  1UNS A;  4DXF A;  2IT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...