2L17A

An arsenate reductase in the reduced state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title (1)H, (13)C and (15)N resonance assignments of the arsenate reductase from Synechocystis sp. strain PCC 6803
pubmed doi rcsb
source organism Synechocystis
molecule tags Oxidoreductase
molecule keywords Arsenate reductase
total genus 47
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2l17A00
3GT7A 3SM9A 4ZYLA 1IIBA 5F64A 4G0OA 4YLEA 4RWEA 5JNSA 3EDCA 4S04A 2IOYA 3O1IC 4MGEA 1A04A 1GUBA 4W5QA 3RVNA 4N41A 5KQGA 3N0WA 2PE5A 1J56A 3ILHA 3JPWA 4G86A 5JS1A 1NXPA 4D6XA 4MRMB 1DCKA 5IC5A 2IYNA 4L85A 5T3YA 2GKGA 3OO0A 1DBQA 3RVJA 3K9CA 3HXMA 1YMVA 3OO1A 1RPJA 3HDGA 4MR9A 4RXUA 3W9SA 4E7OA 5BQ3A 3OQNA 1OXBB 1RNLA 5PNTA 5TPWA 4YRZA 1R8JA 3M9XA 3EQ2A 2LIVA 1PEAA 1TMYA 3H5OA 1Z2EA 4HYEA 4MS3B 4MAAA 1JYFA 4MS1B 2L2QA 3JVIA 5DTEA 3N0XA 2WY2D 3DZDA 3KG2A 3H5TA 1KRXA 2LP4Y 1BDHA 4Z4EA 2FEWB 1JH9A 1ISRA 3C97A 4KQ9A 4LRQA 1T34A 5KWSA 2JBAA 4PYRA 1DP4A 1XHEA 1Z12A 3QLUA 4XARA 3C3WA 4RK6A 1GCGA 3KHTA 3EAFA 1M2EA 2FTKE 3LUKA 1ABFA 4WWHA 4XLTA 2PUGA 4Z4FA 3UKJA 3HK2A 3HUUA 3N0RA 2MYUA 4XXHA 3BREA 3T95A 4W5NA 4ML3A 3I42A 5FWXA 2QR3A 3H6GA 2L18A 3LMKA 3QEMA 4LDZA 3QLTA 2AYZA 2E4YA 4UHJA 1YVUA 1ZVVA 2JVJA 4OG2A 1NATA 4ZPJA 4GNRA 3T8YA 4YWHA 2HQOA 5I4CA 2MYPA 1ZESA 3SY8A 3NHZA 2J48A 3OLZA 2QW1A 4KQCA 4G0YA 1LBHA 3SNKA 4G97A 1BVHA 4RY9A 3IDOA 3P9YA 4Z4IA 2NT3A 1DC8A 3N75A 6CHYA 2HSGA 2GI4A 5TQ2A 3LKBA 3N53A 4G0MA 4EGSA 4MR8B 1A2OA 3MM4A 1CEYA 3IP7A 4P1ZA 5TQJA 5JNRA 4JA2A 2WWVD 5TQ0A 4LX8A 4MYRA 1USKA 4W5RA 7ABPA 3A10A 1EAYA 3Q7TA 1ZDMA 1SRRA 2DRIA 4RXMA 2FN8A 2FSPA 1C4WA 2KYRA 3KLOA 5C5CA 4W5TA 3Q15C 4KREA 3LTEA 3JS5A 3A0UA 4JAVC 2QXYA 3DLHA 2P4UA 3DGEC 4FE7A 3UUGA 3RVOA 2FMIA 2FQWA 3ILYA 3URMA 3I45A 4O5AA 1SD5A 3HSYA 4YR7A 5IBQA 3EQZA 3HJFA 5IUNC 1AB5A 2V0NA 5DLEA 5TE9A 3H6HA 2PMCA 4OTZA 3RVKA 3A0RB 2NZUG 4MQFA 2YHAA 3MMNA 4QYMA 2QZJA 4HNSA 1QO0A 2FN9A 2FEPA 1JF8A 3LUCA 4RS3A 4Z4CA 5IUJC 4LE0A 5FWYA 3H5LA 2PUBA 1K66A 2VUIB 1OXKB 1S8NA 3IP9A 3MIZA 1D5WA 2QV0A 2LBPA 1KGSA 4H3HB 4RK5A 4EVRA 1H9CA 1JBEA 5TPWB 2IPAB 2FQYA 3H5VA 3NBMA 3KYIB 4Y9TA 4RDCA 1LBIA 1KMIY 3RVSA 4Z4GA 1BDJA 3DGFC 1QO0D 5JNTA 4UHKA 4WUTA 4XFKA 3H1FA 4WT7A 3MYYA 1CHNA 4EUKA 3SAJA 3MQ4A 4ZMRA 2QSJA 1D2AA 4HNRA 5CNKA 2PAFA 1E2BA 5IEJA 3FFXA 1AB6A 4NICA 4RZSA 1LJUA 3ROFA 2MSKA 3SQNA 2PLNA 5DKFA 5DCLA 5CNMA 3CG0A 4D6YA 4RV5A 3K4HA 3HUTA 3N6VA 2P9HA 1NXOA 2MYTA 3RH0A 4CBVA 2FLWA 3KS9A 6ABPA 1W25A 1TLFA 2VYCA 4RK4A 3CLKA 4XAQA 4B09A 2MSWA 2PUEA 3IP5A 5D2CA 4Z99A 2MYNA 2W42A 3OLXA 1RZRA 2A9OA 4DN6A 2M98A 3F73A 1L5ZA 2ZAYA 4KRFA 4XASA 5BRJA 2TMYA 5EWLB 5JNWA 4DQDA 1FSPA 3O21A 1VRVA 1VPWA 1APBA 3M6MD 3CFYA 3VNAA 1DRJA 1YMUA 1M2FA 2E4UA 3O1HB 1QP7A 2CD7A 3GL9A 3MF4A 3OLYA 4JASB 3N8IA 1SXHA 1ZH2A 2PJUA 3CZCA 4IMJB 1NXWA 2F8TA 1U2PA 2GWRA 3Q7RA 4OBBA 3NNNA 1ISSA 5TPZD 5IEBA 3HM9A 4MS4A 2FKAA 3FFWA 3GA5A 4IGAA 4TLLB 5BRAA 1YK1A 4MRMA 4Z0NA 1I3CA 4JOQA 4N0PA 3VNBA 3QEKA 2R48A 3EODA 4KK3A 4PZ0A 3FMVA 4IF4A 3CG4A 3CNBA 2M1ZA 3QK7A 4M88A 8ABPA 1RXEA 1MB0A 1DC7A 1U04A 2JVIA 4IRXA 3BRSA 4MR8A 3O2QB 1PNRA 1XWWA 2OQRA 1USGA 4Z4HA 3FDFA 3SG0A 3EJWA 4KFCA 1ZGZA 3OQMA 4ZMSA 4NQRA 1U2QA 3HZHA 4G0PA 4WXMA 2I6FA 2Q5CA 4WXEA 2BGGA 3HDVA 2JRLA 3GYBA 3LUDA 4RK0A 1ZGGA 3CS3A 1U8TA 2N9UA 4YCSA 1MAVA 1EWTA 1GCAA 1Z13A 2HPHA 2E4WA 5FWXB 4PEVA 1ZITA 5EWLA 2RDMA 1MVOA 1M5TA 1D1QA 3JPYA 1QQAA 1GUDA 2MSLA 1E6LA 3O74A 3EGCA 3QLUC 1JX6A 4EYKA 1DCFA 1BAPA 3BRQA 4LE2A 3H1GA 2RGYA 1DZ3A 1EFAA 2ID9A 2OENG 3CTPA 4Z9BA 3DLBA 1JHZA 3A3KA 5FWYB 1B00A 2FVYA 1A0OA 1URPA 1D1PA 3H5WA 5CNIA 5TPZA 3LUGA 5EWMA 1TM2A 4KNYA 5TQ0B 3OMXA 1EWVA 3O1JC 1NXTA 3TO5A 5HKOA 5KC9A 4S05A 1ZN2A 5JS2A 3G85A 2NUBA 1YIOA 4Q7EA 1QP4A 4QICA 4G0ZA 3O2SB 1E6MA 3T6KA 4EYQA 2H3HA 3OM0A 2CHEA 2WRZA 4JB2A 5KQLA 4IILA 1MB3A 3C3MA 4E7PA 3E61A 3KTOA 3GV0A 3CHYA 5FBKA 3JVDA 3KCNA 3KLNA 1RZRD 3GBVA 3GRCA 4RK7A 3QELA 3RVLA 5IULC 1YS7A 1DCMA 2O20A 4KV7A 2IPLA 4NCAA 3QX8A 3BILA 2PUDA 5T7BA 2E4VA 1QNLA 4RU1A 4EVQA 1QPZA 1Y1LA 5JNUA 3CRNA 1JDPA 5JNVA 3L6UA 4LZLA 3HCWA 4MR7A 1BDIA 3Q7SA 5CHYA 1W9HA 3NNSA 2NZVG 4ETNA 2L19A 3R0JA 4MS4B 4RY8A 4PE5B 3IP6A 2HQBA 3Q9SA 2LPMA 5EWJA 3RVQA 2JBAB 4MQEB 2FMFA 1CYEA 2VUHB 1JL3A 3OLVA 4D74A 2F8SA 1FFGA 3E3MA 1ZY2A 2PUAA 3L49A 1FFSA 1Z15A 5HQJA 4WZZA 5FBHA 3D02A 4ZJPA 3B2NA 4JP1A 1P6UA 3O75A 2CHFA 4L4UA 5DGCA 3LOPA 2WB4A 5ED4A 1P2FA 4W5OA 4NV3A 3CKMA 4TLMB 2ID7A 2GBPA 1PNTA 1HEYA 1NY5A 1U0SY 4KMRA 4N76A 4N0QA 2B4AA 1Z2DA 4RSMA 2FW0A 3FGZA 1ZHHA 1MIHA 1DBWA 2LUOA 3QLVA 2R4QA 2RJNA 4ETMA 3JTEA 3HO1A 4G0QA 3TX6A 3C6QA 4YP9A 3TMYA 4FE4A 2PL1A 3HS3A 1LK0A 4MS1A 4QYWA 4OLAA 1M5UA 1P8AA 4FB4A 2PUCA 1VLZA 3RVRA 5ABPA 4MLDA 3O2JA 1DG9A 4NCBA 3H75A 5KQMA 3TB6A 4KK4A 3HEBA 1F51E 4RKRA 4EYOA 3LUFA 4YV7A 2FXIA 3C3KA 2IPNA 1ZAYA 3LUHA 3TD9A 4KZKA 3HVRA 2PUFA 2ZWMA 4LE1A 2R47A 4JB0A 2GX6A 5GOTA 1SXIA 1Z17A 3CU5A 1EHCA 2QU7A 3RVPA 1USIA 2PKXA 3F6PA 2JVKA 3UK0A 4RKQA 1YTUA 3QEMB 2WJAA 4O1IA 1ZH4A 4ETIA 5GQSA 4EYGA 4GPAA 3KSMA 3QLVC 5EWMB 3NHMA 3KKEA 2HQRA 4OLBA 4MR9B 4IMIB 4RXTA 2FMHA 4Q6WA 1JYEA 1RXIA 4F06A 2PL9A 5B3JC 4F3TA 3G1WA 3Q41A 4Z9AA 3RVMA 1JWLA 2A9QA 4MS3A 2YHBA 5C5EA 5TQ2B 4EY3A 4F8JA 2H0AA 3LUJA 1YK0A 1SXGA 1JFVA 2FMKA 2JK1A 2IPMA 2JCGA 1PEYA 3QX9A 2FLKA 3JY6A 3EULA 4Q6BA 3T38A 3RQIA 1L5YA 4EVSA 1WETA 4N47A 3CZ5A 5IUKC 2XDYA 4YS6A 4O1HA 1BA2A 1DBPA 5KC8A 3F7NA 4G0XA 1FQWA 4MPTA 4PICA 2FQXA 3F6CA 3OQOA 2X7XA 2CWDA 4QPJC 5E3JA 1NXXA 1NXSA 2HJ9A 2L17A 3DBIA 1UDRA 3NNDA 4LDAA 4MLCA 3ROTA 1NTRA 3LUAA 1JFSA 4MQEA 1DRKA 3FFTA 2R25B 1KRWA 5BR1A 4H3KB 1JLKA 2FEKA 5B3JA 2RJOA 2A9PA 4KVFA 2IDMA 5KI6A 4MQFB 1GLGA 3S99A 5HM6A 2B1JA 1FFWA 1TJYA 4F11A 1TVMA 2QVGA 1JFTA 2E4XA 9ABPA 3LKVA 1F4VA 1NXVA 1Z25A 2NT4A 3KJXA 1QQBA 1Z18A 4N03A 1Z26A 2E4ZA 3OM1A 4TN5A 4YO7A 5HSGA 4HNQA 5KQPA 3KYJB 1VKRA 2QVCA 4OATA 4RY0A 1PUXA 1QMPA 3QELB 4F12A 2WJWA 3MA0A 3I09A 4YGXB 1K68A 1YS6A 3BBLA 4H60A 1C0EA 2A9RA 1EWKA 2VK2A 3GWGA 3M9WA 4TMYA 1PHRA 4P98A 3D8UA 3HV2A 5CNJA 1LJLA 4KPYA 1QP0A 4MR7B 1XHFA 2JB9A 3H5IA 2IKSA 2WMYA 1JDNA 1D4ZA 1E6KA 1Z16A 3OMWA 5IX8A 1ABEA 4DADA 3OLWA 1QKKA 3IPCA 3LFTA 1P6QA 5EWJB 1DJMA 3H1EA 2AYXA 3I5AA 4RK1A 3GBPA 3IPAA
chains in the Genus database with same CATH superfamily
2JFYA 1L0BA 4JENA 3SM9A 3Q3GE 4ZYLA 4WN3A 4L5IA 3SFZA 1UMCB 3FVTA 4YLEA 1EDOA 1PYOA 3QI2A 4NG5A 4CNQA 1B42A 2WM8A 1G16A 4XPIA 2GEVA 4OXXA 2VDJA 3PGA1 1WEKA 4LMBA 1U3FA 4TXMA 4X45A 3V2UA 4ZEVA 3BVPA 2CNWA 2I4MA 1G63A 1TT7A 4ARZB 1O6ZA 5GM1A 5J4HA 2PSHA 1M6VA 4Z0TA 1KJQA 4DWVA 2B8EA 1EVKA 3A4YA 1WCXA 5EI5A 4Z3DA 3SS7X 3W6ZA 4W99A 1KVTA 3OO0A 4NWIA 5A71A 5REQB 3WRVA 2IK8A 4Z51A 5KKAA 2O9JA 5AESA 1O94D 4DHWA 3EVTA 1D8AA 4M9RA 3VU3A 2HSEA 2FZ5A 2ZTUA 3C3AA 3DTVA 5EYPB 4BZQA 3TZCA 3EQ2A 3GJYA 4KPGA 1TZKA 3NG1A 4UARA 1YTLA 1ORWA 1O94C 1QYXA 1ULHA 1XDZA 2GEKA 4X61A 2NQ8A 2ZBRA 2WY2D 3JVIA 1NOJA 1PZGA 2VJYA 4OL0A 4UTXA 3FCXA 1ZMBA 1BIFA 1FXWA 2EVWX 4KR0A 1P17A 3R9KA 2G7MC 4AZ3A 1E7MA 5HS4A 1ECGA 4FOLA 1SIBE 2O2XA 5KWSA 5AI6A 1Q5PA 3NKVA 4D9JA 4TVSA 3LS2A 3ZDQA 2R68A 4DDUA 4ZGGA 4WBNA 3BTVA 2Y1CA 1A50B 3AEKB 1ESCA 4MWTA 4MZXA 4PSCA 2EZTA 3QNWA 2R87A 2VXYA 2WD7A 3C3WA 4KBGA 4KIGA 1PCXA 3DAGA 3A70A 4M9ZA 2YHUA 1ABFA 1E7WA 5JSYA 4F45A 1JDJA 1EK2A 1ONPA 1NKVA 1PGQA 2BFOA 2P7HA 2Z5LA 1ZIXA 2NO5A 2WTAA 5JWOA 3ZK7A 2PHZA 3QV2A 3F67A 2CK3A 3L8GA 3JQGA 4TTAA 5CA1A 3BXGA 3QEMA 4Q5IA 5E1DA 2HF7A 1JU4A 1YS9A 1JI3A 4DA8A 5CEEA 4MPDA 2LVBA 4JMPA 2G40A 2YL2A 3P0IA 3DZGA 5H59A 3WS7A 1QU2A 3KYDB 2PGJA 5HKLA 1AOXA 4NEGA 3ZJ4A 1GARA 2HT6A 5KDLA 2J48A 1OTHA 2ZSKA 3OLZA 3VH1A 4E5UA 1O87A 2IYFA 2ZW9A 4P84A 3ORSA 3Q1KA 2OXTA 3UXMA 4E6EA 5A03A 1TU3A 1PNQA 3EGXB 2Z3WA 4KIJA 1X77A 1IK4A 4PPGA 2E37A 3U1VA 4QU8A 2XBMA 1RYBA 3KR2A 2WWVD 5CW1A 1U98A 3GI1A 3L8HA 1RHMA 3C8DA 2VC2B 2V54A 1JPJA 3W5UA 1ZLXA 2VHQA 3DXYA 3MQFA 1SRRA 1DELA 2BMJA 2QTLA 3CZPA 4X63A 2PTGA 5AM1A 4E1VA 2FN8A 5BOSB 5JS7A 4PNHA 1C9KA 1NBME 1QYCA 3KXPA 3MTAA 4IPTA 3TRHA 4URVR 3L7DA 1KEEB 4FVTA 3LX8A 2CF5A 3SEZA 1K3FA 1S7GA 4G81A 1IIRA 1TVCA 3UJDA 2ICAA 4O5AA 4EQZA 5IT0A 4XEHA 1LGYA 4AMVA 3TFWA 3OTWA 4BP9A 2XUFA 1D9ZA 5FD8A 4CR6A 4CF7A 3DEFA 3BMNA 4MKXA 1L4LA 2XGOA 4ZT6A 3SDBA 2I91A 3HJFA 1C29B 2PSEA 1HQYE 2V0NA 3KCQA 2G8NA 4P4LA 1IHDA 1MABB 5EP3A 2B61A 3S68A 3X3HA 3DBVO 3B89A 3I04M 5IM5A 4ESOA 1RBQA 1XTKA 1YULA 1OSNA 2QZJA 2VAXA 1MXFA 4AF8A 2NO9A 1YUBA 2JW5A 1ZU5A 1T2AA 2P5SA 3COWA 3PXAA 4PYNA 4ZZ1A 4NXNB 2IDJA 4GBED 1NVFA 5I9MA 4YXWA 3WDSA 1EZ4A 4M46A 5JCXA 2VDMB 1XNHA 3C39A 3G2PA 4XWWA 3MIZA 1U9CA 1EDBA 4E5PA 1FFXB 1HUQA 4RK5A 3CVXA 1CY8A 4D4GA 3KTAA 3BZWA 4QIHA 1A5BB 4N54A 3DKIA 3SJUA 3ZHYA 3BK2A 1RI4A 2GN9A 3JYOA 4KKVA 3IPRA 5A3RA 5SZIA 2O8FA 1OBOA 4WVLA 2WHEA 2KI5A 2VK8A 1OJLA 1SPXA 4NX2A 2ZS8A 3LX4A 3UEOA 3HY6A 1LV8A 1Z0SA 2PSDA 1H0SA 2FK8A 3LPCA 1AS2A 4C1BA 1NE7A 1QZ3A 2IUFA 3QXXA 1ZRMA 1ZVJA 2PVSA 4EECA 4FMDB 4QDJA 3YASA 4DLRA 1NVTA 2C9BA 5CA0B 3R6TA 3EGDB 2P77A 4F5DA 1VRCA 2WWTA 5L7TA 3U61B 2B82A 1CLEA 1ZI8A 2QD4A 4XWOA 2V6MA 5KNCH 2I4LA 2QTTA 1M75A 4DSNA 3NHKA 4X1IB 4LI0A 4AIIA 3PD0A 4JL5A 3ANSA 4Q1BA 5DKFA 5FDFA 3PFGA 5LXTB 1NYTA 4D6YA 2ECKA 3ZKWB 2AZXA 3JRXA 2G88A 4GKBA 2QZ9A 4YRMA 4AS1A 5DW3A 4M0KA 1DZIA 1CQJA 3BEOA 4WBSA 1A8IA 2O4UX 5DM4A 1J8QA 1PSDA 4HRXA 5B53A 1F6DA 1NSYA 2J3IA 4AJNA 3UF0A 1MZVA 1WDMA 2EP8A 3A6ZA 3SR0A 4GM0A 1N2CA 4CQMB 3KELA 3R5FA 3F73A 1L5ZA 2ZAYA 4M55A 4BNDB 4DMHA 4P58A 1NF8A 2V5UA 3HCOA 4DUYB 2IT1A 1AKEA 3JQDA 2HDHA 3N8GA 3B1VA 3I2FA 2QMYA 1RE0A 4P08A 1N33B 2VWHA 3HFRA 1H2ZA 2IEAA 1N2JA 4WBXC 3EVEA 3G8DA 4F46A 4JASB 3JD2A 4OXNA 2B0JA 3AJAA 1MLDA 1DFGA 1H5NA 1UM9B 3E9CA 2HSDA 4OI2A 1FDUA 3TR0A 3L7JA 3VNRA 2ZUWA 1XCPA 3KLMX 3NNNA 2OE2A 1QTRA 1PP4A 2XADA 1FK8A 1W581 4IDBA 2DWQA 5EMJA 5BY2A 1X3LA 4ND1A 3KEFA 4U8HA 5CIQA 1WBBA 5BRAA 2RH4A 1ODKA 1P1HA 4L51A 5HQTA 5ILGA 1WCIB 1WUTA 4XOIA 1C7EA 4DSUA 1QRUA 1AV6A 2BZSA 3EODA 1Q0UA 1SD1A 3AF5A 2UVQA 1I3NA 3DTVB 1TLLA 4ZEWA 1EP1B 3OKPA 3TCNA 2CFOA 3S1SA 1ZH8A 4G8JA 5EQJB 1ECJA 1TZ2A 2PS0A 1G20E 2ORVA 4RKWA 1PFYA 1YCFA 2DHQA 2G1KA 3FUXA 1I6KA 1RU3A 2AN1A 2NU7A 2O2GA 3I9V6 4ZAZA 3VUEA 1OI4A 3WTCA 4MEBA 4E31A 2YYSA 3T9EA 3B12A 1YVRA 2R6FA 2M2IA 2B6HA 3NHSA 4NQRA 5CDUA 2EX0A 3PRKE 2GBLC 4U7HA 4XH9B 1W4AA 4DREA 4RQBA 5ARBA 1Z4IA 4M9SA 3EEIA 5DI3B 2QA5A 4RK0A 3MT8A 1M1YA 4HNVA 5KWVA 1A1VA 1W88A 3NRJA 5JBQA 4B4KA 3KDSE 3ZU2A 1Z9BA 8AT1A 1J97A 4C7MA 3KPWA 1HL7A 4BN5A 1EX7A 1RRKA 3PNSA 3U7RA 2BJVA 1JEJA 3O74A 5JCZA 3HDJA 3MCAA 3GFRA 3L7AA 3N05A 2FN7A 2PGOA 4U5QA 1Y82A 4PLYA 1EFLA 1E9CA 5KQSA 3S28A 3T4PA 1G8KA 1G64A 1QRRA 4Z9BA 3RC9A 4DBLE 4DY4A 1HT1E 2C4NA 1SQ5A 2G04A 5C35A 4D0NA 4D96A 3O95A 1JQ3A 1URPA 4NAUA 4WCFA 3U16A 4FDLA 4KNYA 4IIVA 1IN7A 1Z0FA 2YMLA 3KM0A 3ABZA 4HB0A 5F12A 2NUBA 1DXOA 1UBUS 2QTVB 3NBYC 1PL6A 1OYVA 2ABWA 4IWNA 4B3FX 1MIOA 2ECFA 3QFCA 2QTWB 1X19A 3A26A 2OBMA 5JDIC 3CE6A 3RLFA 1DWPA 5EFZA 2CHEA 3H5NA 3G5TA 2O1SA 4G4GA 4HEA1 5AKKA 4YUVA 3QEJA 4QUEA 1WDLA 3JRNA 4BFLA 1HPLA 3ZJUA 4MUNA 2XMGA 3KCNA 1U7ZA 1Q7BA 3JYNA 4B8ZA 2EP5A 3C98A 3V8EA 2PGLA 1CDOA 4I3GA 4TLAA 3B53X 3OM9A 3L8DA 2IHBA 4KG7A 1N5DA 4PGFA 4HDMA 2ZKLA 2X4GA 5BMVF 2B7LA 3WRWA 4JN6B 2BI7A 3MMXA 3M4JA 1ZVKA 3AUJB 2W6PA 4J1TA 4A73A 4CUKA 2GILA 5J4YA 2Y0CA 1R5JA 2GLUA 2GYVA 2OR3A 2GJSA 1OVMA 4P80A 5JWHA 4BX0A 4ETNA 2DQKA 3IBSA 4REOA 3P19A 4RY8A 2R7KA 3S4YA 1JG7A 3RVQA 1AXRA 2BUAA 3D8RA 2JBAB 3KAQA 1ODCA 4PBTA 4DIDA 4FGSA 4KHZA 1LQUA 1CWUA 4JR1A 2O59A 3T3PB 1JEDA 1XVVA 3AVWA 4KB5A 1N6RA 1P6UA 4IUDS 1UAGA 4M0MA 3UXYA 1W36B 5HJ5A 5KVSA 3HY3A 1W85B 1EKXA 2F1HA 2WLTA 1VPDA 2WB4A 4O2BF 1F60A 4AY5A 4TL7A 3DD1A 1A71A 2FEXA 3V1LA 3EBOA 4GVPA 3G0BA 3L7CA 2JFXA 4NULA 2GXSA 4PY2A 1POXA 3UAGA 2HD4A 3WKDA 1N8SA 3U4AA 2B4AA 4XVHA 3INTA 3WVNA 3FGZA 1FB5A 2F3UA 1TQ2A 1CJUC 1DBWA 1NFFA 1PV2A 4NZYA 4XD2A 1SC3A 4R5MA 5K0NA 1UKVY 3H1TA 1GADO 1CUDA 3O8LA 1MP0A 2Z8ZA 3IV6A 4Y6GB 3QYFA 2W6JD 1XMIA 4MS1A 3UV3A 5AUPB 2IYRA 1RQNA 3PJGA 1GVHA 1LY1A 4N5HX 5JMTA 1SUPA 5BR4A 1CUJA 4MLDA 3O2JA 4YXWD 5EJ4A 1Z74A 3MGGA 4JT4A 4UPVA 4UM9B 3SJBA 5INTA 5CCXA 2SKCA 1G8HA 4KK4A 1AKMA 3UJ6A 4BNFA 5I45A 1AMOA 5KVCA 4O25A 4EJSB 1A9TA 2AEEA 2P3SA 4RPKA 4BNKA 4EQ6A 4LE1A 4BLOA 3ML1A 4JGBA 4JB0A 2GX6A 2R8BA 2FW7A 1LU9A 3EMDA 4G63A 3R3YA 2FOXA 3V4RA 4JI7B 3H9BA 1WZUA 4W9NC 1DKOA 4PTYA 2Q21A 3K2BA 4RCYA 3W9UA 3HSSA 4AYTA 3GPLA 2ODTX 1YB1A 1ZA1A 4WCFC 3C0KA 3TRFA 1XDSA 2AG6A 3QLVC 2Y2VA 2QG9A 1U90A 1W0JA 1P33A 3VZBA 3OJWA 1CQPA 3HZZA 5CX1A 3I6QA 3A1VA 4RFSA 1SBIA 1DJNA 3TWOA 3LECA 3LF1A 3NKFA 3BT7A 2GKSA 4RKFA 5KX5F 2BONA 2QN9A 3PNVA 4RELA 4ZOAA 4B46A 1R16A 3I5MA 2OECA 3KTDA 1L1EA 4X1YA 4PGMA 2ZE7A 3RC3A 5K0FA 5BVHA 1L5YA 3SXJA 2AWNA 4N9WA 1PJAA 1RVV1 3QUSA 4D4KA 2IIPA 3I01M 3V1MA 5JV5A 3R0ZA 1T3LA 4IV8A 1H2FA 2I1WA 4TV8F 2FUNB 1Y33E 2JLQA 2DWOA 1CR6A 3WLSA 4QFCA 5M5BA 4INZA 3H5RA 1X7ZA 3S1LA 2QTFA 4IV5A 4N5MA 2X1MA 1HLDA 3IXMA 5E3JA 1ZISA 1R64A 1JAZA 2ZB7A 3T5GA 3M83A 2VR1A 3AFNA 3IXLA 1YJAA 1XEXB 2R5NA 3JQAB 3EUEA 1I33A 1ZCAA 1G0OA 1LWOA 3JD3A 4Y7CA 4BVFA 4GKJB 3QW2A 1L8XA 1W59A 5G1OA 2QM3A 3S99A 3R5JA 1O1YA 5D5HA 3FI0A 5HM6A 1ZEMA 1BFKA 2CLKB 5KYYA 1O95A 4FJ0A 5FBQB 4WESB 4P31A 3UOAB 2WUVA 3LX6A 2QVGA 2AUTA 3GP5A 1W88B 1T3ZA 3D8SA 4DV2B 2FOLA 3DULA 4YRDA 2E1RA 3UGQA 1KIAA 2XGJA 4FGJA 2UYCA 3OT5A 1T35A 1KAGA 1R0LA 2C2MA 1YQUA 3DZKA 4BKMA 2QMEA 4ASUA 1Y6ZA 1JXAA 3FBWA 2QVBA 4Q34A 4REMA 4LJ4A 4URXR 5I6DA 1TEVA 4Y2TA 1DS6A 2Z1MA 1C0EA 2ZRIA 3L5KA 3AFMA 2VHEA 2XQFA 5KNDH 2EEPA 1L1RA 2C07A 1DFHA 3TLBA 4FHZA 3RVBA 4MR7B 3X1XA 1YJBA 4Z9XA 1W7AA 4C7BA 5FBWB 3ZWXA 2CBXA 5THQA 3CWZA 4URYR 2DY1A 1GG2A 1Y4AE 2J6CA 4OH7A 3G8AA 3OJLA 4KVGA 4P4UA 1JSCA 3JRWA 3LYLA 3VOBA 2F4VB 1KVQA 2RFLA 4TXJA 1JZSA 2VDOB 3NT2A 4E5YA 5FLEX 3MOSA 3GMSA 4ND6A 3GT7A 4B32A 3I9OA 2XKJE 3KYDA 4KWIA 4DMUB 1BDHA 2RK6A 2R7MA 3EDCA 4L0DA 3MWDA 4KQ1A 3E70C 3DBHA 1MIOB 4RLQA 3K70C 2ZQZA 4CDRA 1DNPA 2I22A 2ZAMA 4RDIA 2O07A 2A78A 5ITZA 2ZYAA 1ADYA 3HO8A 3CH7A 2UYHA 3F4LA 2VDRB 3MVEA 5IC5A 2YV2A 4M83A 1FVFA 1ETHA 2N46A 2I4NA 1XTBA 3G9UA 4NMWA 3GRUA 1YMVA 2FAXA 2WJ4A 4ZQGA 4OI1A 2VSOA 4XIIA 3BFPA 4C6TB 1OXBB 1RNLA 4HN4B 3TRIA 3WLKX 2AUNA 4E22A 1IEVA 2FF5A 4BRUA 4RTNA 1DTSA 1XWIA 5K0GA 3NBXX 2ORED 2VJKA 2WJ6A 4RHUA 4ZK2A 1PZXA 4O4LB 5CBPA 1KP9A 2B8NA 1DARA 5ICMA 4YDHB 5F73A 3VZCA 1HLPA 3MFQA 3GUUA 3NWBA 2HV9A 5EESA 1R12A 1NFRA 5D85A 3C97A 4MUAA 3W5AA 1E1LA 3GZJA 1NMYA 1Q1NA 3A3OA 4G23A 3ZE6A 4K0KB 1SCBA 1EA5A 1XVIA 1RTKA 1DAEA 3LUKA 2GTIA 4PIPA 1ND5A 3LC0A 3UKJA 3BB3A 1MJNA 1SCQA 2GF0A 1KY2A 2PMKA 1GZVA 2YOHA 1NLZA 3OF2A 5I9LA 2J0SA 4ND8B 2DGDA 3FJYA 2OBXA 1WA5A 3LMKA 1HM5A 2O0KA 4DKJA 2R86A 4UEOA 4MI1A 1GZ3A 4HY3A 1KFJB 1V8OA 1YZNA 1U2GA 2IOHA 3H4MA 3NTLA 4HFJA 3WA6A 4ZQIA 3UUFA 2O14A 1N6PA 1ZSVA 2TMGA 2J59A 1M2KA 1U4SA 3Q3HA 3ROGA 3IDOA 4TTJA 3DTYA 1DC8A 4KYIB 4UQPA 2F1RA 3WV5A 4MQBA 3UJ8A 1NF9A 2Z9DA 4N6NA 5KOYA 3RYCA 4B33A 2PJDA 3GEBA 1ZIYA 3C8ZA 3LW7A 1HA3A 3R3ZA 2EQBA 5CYGA 5ICFA 4CLEA 1QTNA 3C43A 4S1NA 1EFHA 2FPPA 2GZDA 3LQYA 3X0DA 4JQZA 1IJBA 1S9DA 3CSDA 3WWDA 1ZDMA 3RBVA 3FWHA 1YHYA 2V6JA 4NL4H 5TARA 4ENSA 1AZTA 3RRYA 3SC2B 2H1OA 1XCJA 3JU3A 3QTBA 2M6KA 3WK4A 2CDAA 2H9AA 3Q15C 4AUEA 3ME5A 4H7KA 2JLYA 4LGCA 2OQVA 13PKA 4ZFNA 3ZNQA 4HAOA 3JAWA 1WPRA 2GB4A 4G9BA 2HMAA 3OZ7A 4TZ6A 4JKOA 2P3LA 4QLBA 2R8EA 3HBJA 4WKCA 4YCBA 2PT7A 5DLEA 5EPUA 1SG6A 4FN5A 1P7YA 2JJ8A 3A4TA 5TE9A 2ZUVA 1Y1TA 3ZGZA 3D4OA 3MMNA 3ZHTA 2EKBA 4NYIR 3KFLA 3BHMA 3DE5X 5DNWA 4WERA 3HJCA 1JF8A 2AN5A 5IKXA 3OSZA 3BG5A 3GA0A 3GRPA 5F7JA 4D3DA 2UV8A 1KDRA 2ZREA 4WCFB 1ULTA 1A8HA 2WMNB 5JZBA 4D25A 1VE5A 4XGKA 4DLNA 5CFRA 2QSZA 2TMKA 3NXSA 4Q19A 2XB8A 3L93A 2F9MA 4BNVA 4F86A 4PLGA 3AESB 1Y34E 3C45A 2DP4E 1A5AB 1M6WA 3BJZA 3K7EA 4NNOA 1NJ1A 3TZ6A 3EH1A 3L0ZA 3R6LA 4DZTA 3SHTA 4AKTA 3JASB 2BFDA 1ONOA 2FMUA 4DWOA 1XCLA 3QKTA 2XF2A 1PD1A 3FSGD 3H2IA 3PXXA 1R4NB 4BGIA 4JY7A 1WBDA 3IBGA 1RAAA 3E53A 2DTDA 1ISPA 3DSRA 1UBCA 4XVQA 5DOVA 4A4DA 1PKEA 3VVBA 1L4FA 2VTKA 4JBIA 5AJUA 1E69A 4BNJA 4JJZA 1Q77A 1Q57A 4F3TA 5AK6A 2FR8C 2PT5A 3VKHA 1QFMA 3E0XA 5DTMA 3AP3A 5FUYA 1SUWA 3RJMA 2QI9C 1L1QA 4RESA 4FE3A 5HGJA 3AEQA 1XELA 1FMTA 2XUIA 1D6MA 1T91A 2AFIB 3OC6A 4ZT7A 5BW8A 4C5BA 4E88A 3T5CA 1B16A 3I4FA 3WYAA 1V95A 1G8JA 2HYDA 2IZOA 4D02A 4C0AC 2OORC 2BC9A 3D2AA 3E7DA 3OG9A 4I5IA 3IHTA 3KYCA 2QPAA 2Q41A 4UBOA 5JFOA 5K9ZA 2CVHA 4XCVA 3W05A 1U2GC 1Y81A 3HWSA 2BGLA 2GYUA 1JR4A 1WMSA 1MGPA 1P0QA 3JQBC 2JKVA 2VF5X 4HDKA 1P8JA 5UKDA 3WQSB 4CUZA 4JT8A 4ETWA 1M2HA 5FOTA 2NYUA 4RZ3A 2PUEA 1ZUHA 2X8BA 4B40A 1W85A 4NYMQ 4B34A 4I1PA 1PFQA 4RVDA 1BRMA 5L4NA 1MV8A 4IJWA 3JYQA 1AC5A 5B4VA 3WX0A 1CB7A 2GDJA 1D7AA 4ITUA 5B1HA 1DB3A 1T36B 2WYIA 4DIMA 5JYEA 1JR3A 3NC1C 3OIGA 3UAOA 2AR9A 1VL5A 3IUNA 3LDUA 3N7AA 1E59A 3QU9A 4WDQA 2J6IA 4B48A 3KFXA 3FPSA 3OQVA 3O21A 1CPYA 3ICWA 4GOMD 5DHAA 5JYBA 1T3SA 1RAGA 3CFYA 2FPMA 3UANA 8LDHA 1VLMA 2CHQA 1PNVA 2EIHA 3TL3A 2V4ZA 2BFBA 1YR2A 4NFLA 3M70A 4H0FA 4WINA 1L7XA 3VYWA 1JS1X 1J99A 3AKDA 3CZCA 3OU6A 3RHSA 4PAQA 3T5TA 1I2AA 4D1YA 5CB8A 5EJMA 3G9TA 3QVVA 4GMGA 4ARCA 1MDBA 4EG0A 3KJIA 1GUFA 4ITRC 4WV3A 1V47A 3AG6A 1SCDA 2H2HA 4O4JF 5AVSA 1MFZA 4TLLB 1EJBA 4B73A 3VMFA 4UU8A 1RM0A 4Y6LA 5BYJA 2QYOA 2O0MA 4IO1A 4X9XA 4YDRA 4CMHA 4QJIA 5DYNA 4YUWA 1X1RA 3PE4A 1U0JA 3R74A 4IF4A 1G6HA 2YN0A 3P9SA 2XZTA 3ZCXA 3DG9A 3A9UA 2JIZD 2C3PA 1PTJC 4G56A 1EVYA 5L45A 1JILA 1OAKA 4O6VA 5CVJA 4EM6A 1CIPA 1U6IA 3X1JA 4N82A 1YC5A 1WABA 2QAIA 3JZIA 3O93A 4BBJA 3GG9A 3D81A 2J8ZA 3O31A 4U2CA 4CMCA 3V00A 3FKSA 5ILOA 3NTRA 5C31A 3SG0A 3UK7A 3WIUA 4PZCA 3C48A 3U3ZA 3O47A 1Z2CA 4I99A 3ZCSA 1YQTA 4WXMA 3EHEA 1SKQA 2MJLA 4N4AA 4QRHA 1SGWA 1HYGA 2PXXA 4MUMA 3L7KA 1V8PA 2WHPB 3TTSA 3CS3A 4WMLA 3FNRA 1CVLA 4X5OA 3WDMA 1U8TA 4DQ0A 4MUYA 5CBKA 3U44A 2VJCA 1FYEA 2BY4A 2EBFX 3EWAA 3PDUA 5AXDA 1KR5A 1F14A 2HJSA 1MC4A 1MAAA 5BT8A 4GLOA 1Y37A 4IDNA 3N2KB 4G5XA 4FYXA 3K3PA 4UTZA 4B8YA 4C29A 1PUIA 4CF3A 1L4YA 2Q1XA 5E2AA 1E6LA 5FL7A 3G8BA 4Y6OA 4DQLA 5CVCA 4K6KA 1OY1A 1QTQA 5BR7A 1CY7A 2CD9A 3O3OB 3IAAA 4BJ1A 1PZMA 5D6OA 1RM3A 3KSDO 3PEFA 1X87A 4RJ2A 1CDZA 4DFDA 1B00A 3OPXA 2PRKA 2RMKA 1C9DB 2L0XA 1H1TA 3DDNA 4PBRA 4RF4A 1I9GA 1XE3A 2DWCA 3L7LA 3UK2A 3FCUB 1HE8B 2R6AA 3G85A 3AV0B 4M6WA 4ZDKA 3QBJA 1OFUA 1NTOA 4D45A 3LUPA 4Q9IA 4NJEA 3VRHA 2ZTVA 4PLWA 4IIHA 1M2VA 2VO1A 3P9CA 2OHFA 1YRHA 1Z22A 3OM0A 4PHGA 2WRZA 1SUDA 4QBFA 1JHMA 2VJDA 4CXMA 4M8IA 3B3FA 4ZHQF 4UDNA 4CMIA 3VHXB 2ZP1A 3UT6A 3SF0A 3EG9B 4NR0A 2PK3A 4WXPA 1U8ZA 5DGHA 2OYRA 2Q3MA 3LY5A 4C4YA 1S02A 2J9GA 5E7JA 1Z6PA 4NARA 5H0IA 4CKEA 5H83A 2C78A 4D2IA 1EGQA 1OFGA 3GJ7A 4XSHA 5ALOA 3QXSA 2GAFA 4ABYA 4D41A 4FYIA 1FQKA 3C6XA 2IVZA 5DHRA 3Q85A 3UM9A 3E2PA 2O19A 3I9FA 3JV7A 5HFJA 5ALNA 2QN1A 5JNVA 1W75A 3UUEA 3LO8A 1TD1A 1PZNA 1XMJA 1Z0UA 4DZZA 1GP2A 2G9VA 4DDVA 1P80A 2HQBA 3E9QA 2G36A 4V2UA 2I65A 3U0BA 4B9AA 4F1KA 3HDYA 1ZIPA 4AY6A 4WBNB 3KQKA 2EZUA 2RHHA 3SXPA 4DIEA 3ENWA 2VUTA 3FROA 3QSGA 1TQDA 1ZL0A 2EKDA 3L1HA 5HQJA 3RFFA 4FCWA 2P67A 2ZM5A 1TUBB 4ENUA 3GJ6A 4C4TA 3O75A 2BSQA 3RADC 2MTBA 2QTMA 3QKSA 2TRSB 4NMXB 1ZFNA 2ERXA 2HGSA 3GGCA 5LLDA 3S2SA 3EY9A 3NPMA 3ZWPA 4WXYB 2HBZA 1P3Y1 1IDOA 2CUNA 3A9SA 2G83A 4MITA 2JIZA 2XCLA 3QITA 3S81A 4R2KA 1YJQA 4HUJA 4M7OA 1ZOLA 1T0JB 1L5VA 3PL5A 1MD9A 3H3FA 4BNZA 3UENA 1SBTA 3DAOA 1OU4A 2AWOA 3ZHXA 1LFAA 4B7ZA 4HQOA 2XYPA 4EEZA 2FZCA 4UQLA 1DAHA 3MTQA 1F20A 1EP9A 3ZX5A 1NNEA 3BGWA 5KNCD 1XK7A 2XRFA 1ADBA 5IKEA 1VLZA 3I52A 3GLGE 3F49S 2QD1A 2HB6A 3ES9A 2HBRA 3GZNA 3WGUA 1OXSC 2J4DA 1VL1A 1Z0JA 2P2CA 3FHCB 4RKRA 1QJCA 4NMHA 2XAAA 3ABOB 3AIMA 3C74A 2F9FA 4OHFA 3JQFA 2BEVB 1LS6A 2OHVA 2WP0A 3D3WB 2OO5C 4MWEA 4Q3BA 3COSA 3VKVA 1R0BA 1U7DA 2JC3A 1LFDB 1A8UA 2ZJBA 3JAKA 4MUHA 4CCAA 1RXVA 5E6RA 1CERA 4W7SA 3HNPA 1YB7A 1ULUA 3ZJVA 4RTSA 3EZ9A 3SS8A 1Q91A 5JG7A 1MFPA 4KQMA 1BGXT 4NCIA 2R66A 4AZTA 4ETIA 1ONBA 2CDCA 1AQIA 1L4HA 5BSEA 2G67A 3NAZA 4C5CA 4BL5A 2VCYA 4ATNA 5JAPA 3TXXA 1PV4A 2V3VA 5REQA 2YVUA 1BOFA 4E4TA 4QSHA 2P75A 4P82A 3AERB 1UFQA 3BKWA 1O5TA 2FH5B 3OQIB 3U7GA 4TZKA 1C7JA 1XRQA 1LX6A 3U37A 4B80A 5C51B 4JC0A 4Z86A 1MNAA 1O96A 4Z9AA 1ZN8A 1JWLA 2O2JA 1P4HA 5C5EA 3K31A 1LEHA 1GYRA 4F8JA 2E6UX 1NUUA 4S04A 1Z7YA 3JZFA 5FIUA 4U00A 2UXCB 4X1OA 4IDPA 4XJVA 5CLJA 3RE1A 2ZETA 3PD7A 3S1AB 3QYJA 5FLYA 3D7LA 4WLOA 4YH1A 4WZAB 4H1UA 5L51A 3HJTA 1Y42X 4M22A 4D3XA 3UJNA 3KQMA 2LGJA 3MC1A 4MW1A 3VI4B 2FFQA 3KNZA 4YAFA 1RXYA 2ZJZA 5AOCA 4BX9A 4DYDA 2ZUFA 1P2UA 1NG1A 4WECA 1TMKA 2Q3JA 3IMEA 3WL6A 1NUSA 3BH0A 2RG7A 4N7MA 2HL6A 4P38A 5JISA 1N6NA 1COWD 1O6FA 2QR2A 3FUWA 4CM4A 3OQOA 2PUWA 1ZL2A 4CIXA 4RA9A 3A6LA 2RHLA 3GRVA 2R60A 3GOHA 4MCJA 4WDRA 3RIEA 1YCDA 3IFSA 3UNXA 2HWWA 2PX2A 3JZMA 2Q8QA 4MMXB 5C7LO 1GNLA 5EKSA 5LCXA 4OF4A 1MBZA 3AUUA 4FGUA 4D9HA 4MDFA 5JXWA 4N7RA 5KAMA 4KOEC 3CLSD 2BR5A 2PGNA 3BUSA 3FYHA 4JA0A 4BCCA 3H2HA 2YS7A 2DFNA 1E5DA 2WJJA 3G0HA 3L1KA 1SQSA 1WZIA 3E1KA 1K6IA 4R2XA 5T8KA 3ZOKA 9ABPA 4UMFA 2NT4A 4BO2A 3RREA 1KHHA 1ZNYA 3MAAC 1Z2AA 1VXRA 4RMHA 3IX7A 3I12A 1COZA 5FLXA 1BHJA 4M0FA 3L6EA 4HQKA 3IPYA 3QELB 3TMAA 2B8WA 2B3DA 3HP7A 5CCDA 4P2BA 3W2GA 4IXWA 4OY3A 3VDQA 3HE3A 2RHCA 1C7QA 2W6CX 5ARCA 5CCEA 2VK2A 4BV9A 2CJWB 2ZUEA 3FRIA 3L02A 4MUBA 1KGDA 4KQHA 5BUCA 2D6FA 1O57A 1D09A 5FQNA 3CUVA 3DZFA 4C3ZA 4DF3A 1GAEO 2OAP1 1L7NA 2A88A 2NU8B 3OZEA 3KUDA 4LZWA 4ND8A 5KCMA 1YASA 1A9SA 2WNHA 3NZEA 1T4CB 4BNWA 2NYVA 4BQFA 4MGYR 5CCBA 1QCZA 1VP3A 1L5LA 4MW7A 5C1IA 2W2VA 2YNMA 3F4KA 3K9LA 3WB2A 1CTQA 5F64A 1IY0A 3TFOA 1QR6A 3ZDYB 3VYVA 4NCJA 4UZFA 4WCDA 3RCBA 1ZOSA 1R4AA 2H92A 1XOIA 2JBHA 1QH8A 3DOJA 3HZRA 3KVVA 3COVA 1XTTA 3QXJA 1I13A 1MQ8B 4JEUA 3CX6A 5JH7F 4TLDA 2PANA 2YBDA 3T94A 5LP6A 2GHTA 3JPWA 1PTKA 1R7RA 3L49A 3BE5A 3M1IA 4REQB 4S35A 4D6XA 1C0LA 4MGKR 3GLGA 3CLRD 4UNIA 4RVHA 3FDZA 2QTBA 3WLJA 3UW1A 2WJGA 4P2GA 4TQ9A 5JO0A 4I1YA 2BGTA 1TVEA 4FMBB 4CN8A 5BQFA 1QH9A 1Q1QA 3AHDA 1FU4A 3M9XA 4TN1A 4LZAA 3ULKA 4L72A 4PLPA 1EVJA 4AP5A 4EPVA 3Q8MA 2SNIE 1GFIA 1L9KA 3NIGB 2ZG6A 4H35A 5ED0A 3TSOA 3N2NA 4Q47A 1HDIA 4WJKB 1NW6A 1XO1A 5AOVA 3GELA 1ISFA 2IJGX 4CM5A 1BNCA 1RI3A 2C5EA 3IAEA 5B7NA 4LK3A 5IJ9A 4HX9A 3A2MA 2V96A 4UKDA 4IIGA 4LSWA 4YJGA 4KRYA 1MB4A 1MX3A 4V0ME 1FS4A 1KDOA 2OGTA 2ZBEA 1GCGA 4I9UA 3A9WA 3KHTA 2I66A 3KC2A 4GAEA 2R3SA 4Z4FA 1VPVA 1IZ0A 2YWCA 3IQXA 4Z9FA 5IK2D 3GPBA 2QTAA 3T95A 1YUNA 3DTVD 3JWIA 4X1IA 1TC1A 2QL9A 5LZ4A 2AXPA 1XPUA 5G0WA 1V1MB 1O0CA 2WVGA 4WN9B 3AM3A 4HG2A 1CR1A 3A1DA 5AKIA 4NBSA 5I9SA 4NYIQ 3ZWAA 1RLIA 1ADJA 1GKYA 3AW9A 3CH4B 5CTAA 5D6NA 5FULA 3W5BA 4G0WA 3DEHA 4G09A 1FOEB 3G5LA 3NX4A 2P35A 2EJWA 5GV7A 4EBBA 4U2DA 1WPGA 2NSHA 4O02B 2Q3CA 2WFLA 2YWEA 5ECYA 4ZRDA 1N6OA 1DIBA 4B3TB 4JZYA 5FWAA 2HMTA 2CLOB 5IAGA 1USKA 1L5QA 4MH0R 4KR6A 4FS3A 4JLAA 3EA5A 3E81A 3HKBA 4M4SA 3UWPA 3B6KA 3U7FB 1X7YA 2P8SA 3HHPA 2YV5A 5KTSA 2KYRA 3KLOA 5DGDA 1W93A 2GERA 5CVTA 2HXYA 1YDMA 2IY8A 2YINC 3AIOA 2HREA 2CGEA 2BFNA 3B7GA 2JIMA 3H16A 4JR2A 4RVOA 3TW8B 3DLHA 2LZ0A 1B3BA 1QQ5A 3MJFA 4PRKA 3GXBA 1AE1A 3FHJA 4IR7A 3TUZC 5J2UF 2NZWA 4NLLA 5DF1A 4L9WA 1K5DA 3DOFA 1CXZA 4I9GA 4CLRB 2J9XB 1TZCA 1VBFA 2PL3A 4OTZA 4MQFA 3RVKA 1AQJA 4GI2A 1YDEA 3THSA 4DR1B 2A5GA 2I03A 3K16A 3D0OA 2GHQA 1AM4D 1IHUA 4L5JA 3UMGA 2P6OA 1AGNA 2PQ2A 2C1EA 4KXWA 1GAQA 4LE0A 3ECSA 4BNXA 4C9BA 5LQNA 4BFUA 2DFDA 1BN7A 1DAPA 1S2NA 4ARIA 2LV8A 4FGLA 1JKJB 4ZOLF 3RLIA 3CF4A 4IH9A 1FU7A 1UT6A 4F2GA 5HJ2A 4YV0A 1IFXA 5B3KA 1KGSA 2XX3A 3SOZA 2I7CA 1XAIA 3HB9A 1C81A 3G1UA 3ONEA 3U5ZB 4MIOA 3FF1A 4EMBA 4NJEB 4IVQA 5DVZA 2WABA 3T61A 1ID1A 2IQ5A 3CJTA 1ODJA 1R6AA 1XAJA 3G7NA 2NAPA 3NUGA 3NOXA 3FZGA 1EUDA 3E22A 3TDMA 4EG8A 3KXDA 4LYYA 4HWRA 1KYQA 5WRFA 1WUHS 2AUMA 3KUCA 2YFKA 2Z2JA 3U80A 2YHIA 5KKCA 3A2LA 5JNTA 4WZBA 5EJFA 3F3YA 5B4TA 4WUTA 4GG1A 2ERYA 1KI6B 1Z36A 4QUBA 4XFKA 4AWXA 3OZCA 1NQWA 4JJKA 1IONA 2XUAA 1L7EA 2B4QA 4B85A 3MQ4A 4JXXA 1C0PA 3FYDA 1UEJA 3SC3A 2XA2A 4EFDA 4K8OA 1LLQA 4AM8A 2FFBA 1MO3A 1CULC 2I80A 4K40A 5IAKA 1ZN9A 3PJDA 2PLWA 4L8YA 4R9NA 3TLJA 5F35A 1CUZA 3THYA 2X3FA 3UT5A 3M49A 3CNNA 1XV5A 2P40A 4CBVA 4LHSA 4UUMA 3AEZA 1P4GA 2P6PA 4Q4DA 2WUEA 5KEIA 2E0IA 3IP5A 1B0ZA 2C58A 2EGUA 2WWXA 2O7VA 2PKQO 4ZA2A 2W42A 3GGDA 2GYWA 3ZJ5A 4ZO9A 3NHYA 1ZI9A 4YJ3F 2B4TO 1T8WA 1JB9A 3IA2A 3PXGA 3MG9A 4B9EA 5JNWA 3HBAA 3VR5A 1J0AA 1SHZA 3IQEA 4QJ3A 4US2R 3FGNA 4E5VA 5DNCA 3M6MD 2A58A 1IBRA 4MDHA 4X7PA 5BUQA 3O1HB 3H2JA 4MV8A 2K7ZA 1LS1A 4I66A 2PGDA 4K6HA 1KZHA 3T5BA 3N8IA 4YHBA 4IMJB 3AIIA 3OA0A 1XPOA 5ADUS 4HO1X 1OTXA 1NVDA 4XIYA 5TPZD 4M0PA 2GD0A 1WZCA 1B14A 1UAAA 4B3DA 1P7CA 5IAOA 1UBKS 1XZBA 4QQ8A 2FKAA 1JG4A 5CH3A 4DCOA 4ZN6A 5DTRA 3BMQB 1NIPA 4Z0NA 4P3PA 7YASA 1IWPB 3RUEA 4RTRA 1THZA 3IR7A 2C98A 4BWYA 5LMCA 1XYYA 3G79A 3SHWA 1K89A 3BS4A 4BFVA 1K06A 4CG0A 1QC5A 3HFGA 4M88A 1QRAA 2TYSB 4UUAA 1GL7A 4C76A 1DC7A 4HADA 2B83A 4DCMA 2YVLA 3ANYB 1PNRA 5A4IS 2VP4A 4RD0A 4UNNA 1BCSB 2BEUA 1W1WA 2OCKA 4BC1A 2RHOA 1VLVA 3ZXSA 2PX3A 2HMYB 2NNWB 3U4QB 1ZGZA 1TFRA 4JUCA 4JVNA 2LKCA 4JI3B 1OWOA 2XYQA 1T6XA 2D06A 2Z5GA 4A1OA 4PN7A 1AV7A 2JRLA 2BGGA 3OJ0A 5EJ5A 1C3LA 2J3DA 3UXEA 3L04A 4UOEA 3FDIA 4D92A 4J03A 2P68A 2OZEA 1A5ZA 1B26A 1M1UA 2QXTA 5A0FA 1E6WA 3O9MA 3TEMA 3VR6A 5A5VA 1E77A 3R7FA 4BTEA 3NHJA 4J76A 2E4WA 4K9RA 5FWXB 3I6YA 5L40A 3OBIA 4ZU1X 2Q5FA 4PC3A 3GPCA 3EIXA 3IDZA 4B6PA 1KK1A 2IIQA 3D7RA 2XWBF 4WN9A 5J43A 2WJPA 3MBKA 4N49A 1OGJA 4F21A 1ZA2A 2D0PB 3KOMA 4LHYA 4E3ZA 3MOIA 3I5UA 4RABA 4X00A 4CGZA 3ZW7A 2H5IA 1E8NA 1E8MA 3C5VA 3ETHA 2YZ7A 1TECE 4GSYA 5FB3A 3DLBA 1ZQ9A 2FB9A 2FVYA 4M87A 1GKIA 1GG8A 1LW6E 2D59A 4FR5A 4MLPA 2Q5LA 1TCVA 3RAGA 1GFZA 2WU0A 5A62A 2CZCA 1MO6A 2HH9A 1B0UA 1DEHA 1YI1A 3G9QA 3O1JC 4MV0A 2UXBB 4J3JA 1ZCJA 4D0GA 1O4VA 1HQDA 4W82A 3KSUA 1TK3A 4HAWA 1RXCA 3GMTA 2RHWA 2DKOA 4ZOCA 4A9AA 4F3KA 2DETA 1KJYA 2IHZA 4IL5A 1WBJB 2H4JA 4L8GA 2Q9CA 5ITZB 1U7UA 1CQZA 4UVEA 1EXDA 4DV5B 2IY7A 3TRKA 2GXAA 4CM8B 2X58A 3M5CA 4DJAA 3C3MA 2RK3A 2Q5JA 2O7QA 2X0FA 2ZRAA 3KYBA 4IVPA 2A7XA 4MUEA 3GZNB 5DPMA 2C94A 2H51A 1IY1A 1DEXA 1OJ7A 5TIIA 1MHTA 4TYQA 3QELA 2ZDQA 4L50A 5AKXA 1QFYA 5FHRA 1VMKA 1X74A 1DRUA 4HDQB 2XXAA 1C30B 3ZN2A 2B25A 2P2GA 3MBIA 2NQ2C 5T7BA 2F9LA 4FWBA 2E4VA 4IEIA 4AFNA 1J9GA 4TVOA 2EWVA 4W7IA 1XG5A 4PRLA 1MEEA 5G1PA 1N6KA 1Y1QA 2PGIA 2HMVA 4HVAA 3S70A 1CE8A 3OD5A 3K0FA 3L1IA 4IFBA 5CITA 4TWIA 4G1UC 4C3UA 2DR3A 2NV6A 3HVUA 3DLCA 3K0EA 4MS4B 1TU0A 3IP6A 4X6YA 3A1TA 5EIBC 5K3CA 3TZLA 1ND6A 1GPLA 4OAPA 3AGPA 2NUTB 4HX5A 2ISSD 3OCUA 1FFGA 4ZC8A 3IAM1 2VH2A 4RZIA 4WZZA 2HLDD 1A4RA 1G6KA 1NU8A 5AVUA 2A1IA 3CURA 1UZMA 3AU8A 2CHFA 4GBMA 1V5IA 3HLTA 3ST7A 1RZUA 3O90A 1OKKD 3PWZA 3IAFA 5AKYA 1HE2A 2YR0A 3GLRA 1MX9A 1QFZA 2HK7A 1TCCA 2E87A 1AQYA 4GF5A 2D5IA 2O3QA 2HIMA 1VGVA 3OQ6A 1P62B 5IAJA 3S40A 3A14A 3VZQA 1QLJA 4B45A 4UULA 5IBCA 3PRHA 1GXSB 1PT6A 2JGJA 1HNZB 1DKMA 2O2DA 4K87A 1P0CA 1VBMA 1E3MA 5SY4A 4L07A 2F8MA 1LBEA 2PM8A 4Q1VA 3RU2A 5ALDA 4OBEA 1KI6A 5BW5A 4BO9A 3IOYA 1IXYA 5M3BA 4AUKA 2QJFA 4IJQA 1O6CA 1D07A 4ZYWA 4I4IA 4FB4A 4P7FA 2BKXA 4LC1A 3C87A 3OC0A 2FN4A 1OGYA 4K9OA 3PLAE 3D6TB 4P3XA 4E4RA 3L8ZA 2XLBA 3GDHA 3FCYA 1MO4A 1T2NA 4I50B 5GMOA 1YDFA 2PZMA 1HLFA 4X20A 4NBRA 1OH5A 2YJGA 1JFFA 3HN7A 3LUHA 2CKMA 3FLMA 3W5SA 1KSJA 2J9FB 5KHOC 4HWSA 3Q2OA 5EZSA 2VT2A 3F8TA 1Y8QB 3IGFA 4GI5A 4JIGA 5JAHA 1ICEA 1J22A 4KTTE 1EFKA 1K6MA 5JLJA 1TCUA 1QAOA 4R98A 3VNVA 2FDCA 1HQKA 1ZD5A 1C1XA 1PW5A 2P27A 3GRAA 2FEOA 1N75A 2QVYX 3NP7A 4U9IS 1PVDA 2P2LA 5IU6A 4LXUA 5FRDA 3KSMA 1JIUA 1IN8A 2I99A 5FEMA 3KKEA 1B93A 3ESZA 2PQ6A 1KPGA 4NV1A 2BF7A 4G1FA 4HXEB 4ECAA 4L4XA 2JGDB 4TS3A 3U9SA 5FOQA 3E82A 2J1LA 4HH1A 2OLKA 1QPGA 1CKEA 3BD8A 5TQ2B 4GX5A 5JD6A 1C4XA 1XQ6A 2O8DA 3A3YA 5CM9C 3M3DA 3B2QA 3OJEA 3AB7A 4TKLA 2IPMA 4CQMD 2Q6OA 4PV7A 3WRXA 4DCSA 3TE7A 3CUYA 2JGEA 3PDIA 4XIJA 5MN4A 2BP7B 1VM6A 3MINB 3SZLA 1NDQA 3EEOA 2HLPA 2YC2C 3KZCA 4L6AA 3UB4A 1I7PA 2XQIA 3I58A 4R1QA 2WUGA 1RWVA 3COJA 2C96A 2FE4A 1KMMA 4P53A 2EAUA 3HO6A 5JXJA 4Y2JA 5ALTA 1X7WA 3RR2A 2WIFA 5AXAA 5I01A 4W4TA 3RU9A 5BN5A 1D2HA 3ADCA 4GM1A 1BVYF 1FVXA 2VTVA 3SMVA 4AQDA 1FNSA 1QIEA 3CA8A 3FMOB 3WYEA 2BM1A 4LFCB 5ALXA 3FX2A 2R25B 1T1RA 1LRJA 3TCXB 4UC0A 2VUSA 3I9MA 3MJTA 2A9PA 3WNVA 5LUAA 4JXKA 1POWA 2ZRJA 1YOBA 2XYGA 1QH1B 2H2GA 4NRDA 2Z57A 2OXCA 3EW7A 2JHPA 2C4VA 4LXQA 3ZXIA 1IHOA 2JJ1A 4NBWA 2E4XA 1ZKDA 1LJ8A 4FNGA 4MB0A 1QQTA 2WAOA 3K0KA 4CT0A 4DJDC 4ZVTA 4EA7A 2R11A 5CURA 1SKYB 4JBHA 3ZIUA 3ICOA 1JJBA 3MB5A 3UJCA 3N1UA 5D3QA 4X24A 4WXRA 3ROQA 5IDXA 2P9TA 4HXYA 2WWIA 2Y27A 4QYIA 5LU8A 1N0VC 4D56A 2Q46A 3IE2A 4E5KA 2AL7A 2Y2UA 5KO2A 2IXTA 1L9XA 1AQ6A 4XQ9A 3W4IA 5BSMA 4QJ4A 1GIAA 1J49A 4ZVVA 4Q1CA 3D6MA 2ILVA 3EAQA 1UOEA 3NHFA 3DBLB 3CO0S 3E3NA 3GU3A 2FE1A 3Q2KA 4IUBS 5HHTA 3UJ9A 2NVUA 4JR0A 4RJKA 3ROXA 4PG8A 4H6XA 3O4JA 3QFSA 4EK9A 1V48A 3ESXA 2ZRLA 4LHEA 4C6SA 3RC1A 1KI9A 3VV2A 2RGRA 3EE6A 3MCUA 1SC6A 2VHXA 1Z0DA 4HNHA 1WW2A 4PC6A 4B5KA 2LCIA 1TM7E 4HD8A 3MUNA 5TVGA 1WSDA 3WK7A 2ISQA 2XF8A 3OIDA 1L1FA 1KWGA 2YUIA 5BYAA 4MQ6A 3FUTA 3G23A 4QXMA 4UUNA 5FHQA 5TS2A 3TINA 1I2CA 1S2LA 4LZZA 4RXUA 2VNJA 5A7HA 4JLOA 3WMGA 4DMMA 4F3RA 3OQNA 4BU0A 1L2TA 5PNTA 1BE1A 5H68A 2AE1A 4YREA 2WDZA 4ZCPA 3M6FA 4XOUA 3WLHA 5H5JA 1R4MA 2QRNA 3N9IA 3MRTA 3FLEA 3KOYA 4MS3B 2XCTB 3RYHA 2CHVA 3CW8X 3PQ2A 3SDSA 2IH2A 2L2QA 4BO5A 1H66A 2AG5A 2Q9BA 2H3EA 4DJ5X 4DG8A 4I9NA 1TA0A 4YUYA 2R1VB 2KE5A 4WY8A 5EXSA 1L5NA 2IHKA 1Z6YA 3G7UA 1V1RA 5T41A 4UTNA 3SK0A 3QWFA 3GLFE 3FTEA 3QH4A 2ACWA 3VX4A 3U3RA 2GJKA 4YDQA 3KXIA 3K94A 1H2BA 1ELOA 1ZG3A 4K9SA 3ZWBA 1PFVA 1HYBA 3TNLA 4Y2XA 2BF4A 4RC9A 1K08A 3C3EA 3QE0A 4XLTA 5GZ6A 4WWHA 1S2DA 3HK2A 2G9QA 4CE6A 1GLNA 4WA7A 3I6MA 1Q7GA 7AT1A 1WS6A 1K27A 3PGKA 2NUPB 4ZDWA 1RACA 2PL5A 3KHKA 1JEYB 4GVLA 4U7DA 1YL6A 1NYRA 3LW8A 2E4YA 2NPOA 1YVUA 2AW3A 2GQ0A 2R6CA 3C14C 3QLTA 3SYKA 1P31A 2JVJA 3ZZ0A 3DYBA 4ACBA 2XCQA 1P4JA 2CVQA 2C7GA 2JJ2D 3H2YA 2X1HA 3KT0A 4R54A 3ABRB 3T99A 5LZ8A 4QFDA 2CSXA 3WLLA 1LBHA 4KUEA 4QXQA 1LSUA 4RY9A 3EIFA 1LVGA 4XYGA 4DLAA 1R66A 6CHYA 4IIJB 2ZZMA 1OX4B 2C7VA 2OYSA 2PYDA 1PZHA 1M73E 4G0MA 4ZT3A 3S2GA 2YN2A 4R7TA 2YMMA 5KTRA 1VE1A 1W8DA 1WF6A 3ROMA 1OX6A 1NQVA 4C43A 4DLXA 1A7AA 1UK9A 4NBUA 5CA0A 4OL9A 1VI2A 1TXGA 1X1EA 3D0RA 5DTIA 4XWYA 1ODFA 4ABTA 1SCKA 4OU5A 2BFAA 3IAS1 3QPCA 3VH3A 4XQCA 5FAKA 1PL0A 1JSZA 3EXIB 4K9MA 5FA8A 4BMCA 4D80A 3QGMA 3DGEC 3NO4A 3V4SA 1VG0B 5C8DA 4MW6A 3NOOA 3QF4B 2Z9CA 4WW0A 1QV6A 4DJFC 2ZTMA 4PGHA 4R5HA 1J1ZA 1JSXA 2WU4A 4FONA 3NLLA 1ULBA 1SOAA 4CEIB 5IUNC 1DUVG 4KRXA 4XGQA 4BQEA 3BDAA 3WLNA 5A7GA 1IPEA 4KLRA 3VVLA 1YR3A 2D1SA 3WL5A 4C01A 2Z09A 4ZQEA 1G5HA 4TRMA 5MFPA 1Q1ZA 1VKJA 1E2FA 2RH9B 4P22A 4M0DA 4BNNA 1CR2A 4F5WA 1D3AA 1DIOB 4ZGBA 1W6RA 5DCWA 1TI7A 1EB9A 4X54A 4A23A 2FZEA 3FH0A 4DLVA 3HLYA 3O3MB 4L08A 4DDHA 1CCWA 2Q2OA 4CLHA 4EATA 4M1OA 4IFEA 4D4LA 4TYYA 1GAJA 1HT3A 3HSKA 1M1YE 4FIDA 4OJMX 3A37A 1X1TA 3QA3E 4WH0A 4GBJA 3AETA 1PW7A 2FCAA 3PB3A 5LA6B 2AMLA 2IZ6A 1PT8A 3Q9UA 4XR4A 4C05A 3NFYA 1GZ7A 3ZV5A 3EGXA 4UAGA 1DLJA 3RS7A 3AT1A 4MGZR 3D4PA 1Z6GA 3V4VB 5BNWA 3TQOA 1I7SB 1Z75A 4MRNA 1KMIY 2JA2A 3FCSB 1YR6A 1PR6A 1GTMA 2PSJA 4BIIA 4RTOA 1NUAA 1OQAA 3FNBA 3E5NA 4AJIA 3W8DA 1YCHA 2WMDA 1JQEA 2A33A 2FN3A 4WT7A 2CMKA 1HQCA 2ZB8A 4PZ9A 2I54A 3ZJYA 1Z5PA 3AUKA 3CMCO 5EC8A 2CNBA 1X39A 4EHHA 5ADWA 1QHHB 4HNRA 4AZSA 1VBNA 2FPOA 2ZSHA 4M1TA 3K6SB 2DBQA 1BJTA 2JEYA 3DUFA 2XWPA 4EITA 4PG7A 3R24A 4KLCA 4E11A 4KH1A 4NENB 4CCYB 2NU7B 1DQPA 2V7QD 3WMEA 4CM3A 1DEAA 3H8SA 3C5WP 3F46A 4X41A 3WA7A 3BKXA 1BYUA 4U2BA 4RV5A 1PJCA 1I4LD 2L69A 3KD2A 3PDWA 4KACA 4Q7MB 3V4ZA 5LVAA 3RS4A 2ZJ4A 1R5BA 4IHJA 2G0AA 1Q0SA 2WIGA 4UUPA 3CZQA 1HE1C 5LSAA 2QZSA 4GFDA 1J33A 3Q12A 3KQLA 4II2A 5I7HA 3ZVNA 3JZDA 4PYIA 1VSTA 2VATA 3ZIDA 1DKRA 3PJFA 4G1VA 1TJNA 5BRJA 5YASA 3ZGYA 1EINA 4YRTA 5EWLB 1UBGA 5DLDA 4J9UE 3AERA 1MX5A 2WD8A 3CF2A 2ZAIA 3ORRA 4H7JA 3R7DA 3H18A 4KI7A 4DR2B 1SPBS 4X8HA 4CCSA 1UBMS 3MWJA 1DAOA 1W5SA 3DEYX 1D1SA 5A02A 1CZLA 2OORA 1ZSNA 3FNQA 4S1WA 1NXWA 4B44A 2J0QA 1U2PA 2R8PA 3DCJA 3SF8A 2YQ5A 2QUBA 3AMVA 3P27A 4UW9A 4OJKA 1R5OA 4R9RA 3T9DA 1K97A 1R10A 3HYNA 1YXMA 2JGAA 3D2CA 4MRMA 4JD5A 1B0AA 1FQOA 2NYAA 3FZYA 3AINA 4UD6A 1R9JA 2IYYA 1GTVA 1WDKA 4LJ6A 4ADSG 2E48A 2H2AA 3DUWA 3GC6A 1QQ6A 1EBFA 1EX1A 1VDMA 2JGKA 3EJ6A 5BSFA 1B8OA 2OD7A 2YVQA 3OF5A 3PGXA 3QK7A 4LDNA 3TLMA 1TU4A 4CM4B 2F2TA 3MQ2A 4CJXA 2P5TB 1EX9A 4ALLA 3P9NA 1L8LA 3O94A 5HIIA 3WLMA 1CUIA 5DX0A 3NAMA 1REQB 4BO0A 1XWWA 4M1KA 4DJEC 2JHCA 1XPRA 4XX1A 4E70A 2AR0A 4DSOA 1M1NA 3FDFA 1VMDA 1XQ9A 1XRMA 4QARA 4YRSA 3K2QA 2XZOA 4EI9A 2ZVJA 3H19A 1DBRA 4CTNA 3WLOA 1LNSA 4HDMB 4I50F 4KXMA 4BQIA 4OUKX 2XQVA 1W0JD 1ISHA 1FBNA 2X3YA 3K0CA 4MQLA 5EJ7A 1KQPA 4RDXA 1YE3A 2EIXA 2O0LA 1VBKA 1OH7A 2PJRA 3F5DA 1UKCA 2GUWA 5CT4A 1F9AA 4E0BA 1TZMA 5F4ZA 3D0QA 3RFVA 4HH0A 1HSOA 3R3WA 5EEHA 4ZKEA 3WY9A 2Z3VA 1J21A 1M5TA 1WUIS 2CFSA 3C24A 3JPYA 3W7BA 2D3TA 4JI2B 2OFXA 2HC9A 2X0RA 3ISVA 3CONA 1ESEA 3P4XA 4RPIA 2JLBA 2QROA 3UAWA 2BGUA 3ZE9A 4IVRA 4YJDA 3A7DA 2ADMA 3HB5X 2J9RA 1MQSA 3M2TA 3TNDA 3TVDA 4V1CI 3IHLA 3UH1A 2XDQB 4D8WA 2VDWB 3RO7A 4Q9AA 5FXMA 2YASA 3QV1A 3ZUPA 3LDAA 5J4VA 3BWBA 3FBGA 3OECA 2AJCA 2BBTA 3DDOA 1NFQA 2I67A 4GWGA 2NACA 1YJXA 2VRWA 1N7IA 4Y7DA 2NV2B 3BFVA 4UEWA 1D1PA 3H5WA 4LNUB 3RROA 5CNIA 3TZEA 2OYCA 2PXCA 4D98A 1ML3A 1NXTA 3P0RA 2ZXFA 4EB0A 3TIVA 1E0JA 3PFNA 3HCAA 1FSSA 2NZJA 4M8LA 3ZCPA 2HA2A 4HRYA 3DVAB 4YT4A 4M9QA 1AKWA 4G26A 5DHPA 2DF8A 3QFHA 1PSZA 1C0IA 2EG5A 3GUCA 3L3BA 3T6KA 4AN0A 1OE0A 1JIKA 1ESZA 1GNTA 1GPWB 1C1DB 2J41A 4FFMA 5EPOA 2G4CA 4GX0A 1IK6A 1G3QA 2J3EA 3GJ0A 5BWBA 2OVBA 1HR0B 2CCKA 2IYSA 3E61A 3FE2A 3KTOA 4Q7KA 3OJOA 3REOA 1I5EA 2ZITA 4PNEA 4WKGA 3ZEAA 3GGSA 4S1PA 3GRCA 4DLYA 4DLZA 3QJGA 1M0EA 1XK6A 5IULC 1C3OA 3UJHA 3OT4A 1XA4A 4YALA 4HPJB 1CUUA 2GPBA 1G55A 4EJSA 2OCXA 1F9EA 4EVQA 3RIYA 2X0EA 2ZJ2A 1M0TA 1JDPA 1F48A 2C4KA 5U4XA 4K7JA 3RG2A 1SUAA 4TKMA 4L9AA 2G63A 3GT3A 4Q3KA 4EDHA 3N2EA 3ZI4A 3E23A 2WWYA 2OM2A 3Q5GA 1BYIA 1QX3A 3Q9SA 5IJ9B 4XVRA 4UHDA 1KJ9A 5DWQA 4BZXA 2WSSA 4HDRB 4R8KA 4ZV4A 3OLVA 4B4DA 4KR2A 4KWCA 1T1JA 1FBTA 1EGHA 1ZJYA 2EXXA 4P32A 2PUAA 1WUKS 1GD1O 1GL3A 1GO2A 3AB3A 3GEIA 1FDTA 1UKEA 3J7TA 1GSOA 4QU5A 4X3CA 3F9RA 4LGMA 5LA6A 4LF8B 2VYNA 4GRAA 4MVYA 1UPXA 4RD3A 4CG1A 2XKAA 5LM3A 5AYVA 5JZVA 2IITA 3DJYA 3URKA 2UVPB 5JRZA 3UGKA 1UT8A 5AKEA 3QVUA 1DBSA 2B36A 2JJQA 1QVWA 3GJSA 3WGTA 4UDXX 2ZBDA 3I6BA 4MDYA 4XM0A 5HBRA 3EPLA 2NXEA 4GM4A 5CH8A 5BOVA 1N32B 1ZD3A 2HI0A 2R6JA 3SIWA 3ESBA 1P2VA 2HZBA 3F6YA 5AKLA 4OLAA 1X7WB 3PF8A 1PWHA 3W9BA 2CUTA 4R8LA 4E5NA 3CTMA 4JEHA 2UUBB 2PWPA 1MH1A 2BDUA 1K98A 2BGMA 2JDID 3AP2A 4WGGA 1B8UA 3I9JA 5ALEA 4L15A 2JD1A 3IJ5A 4KO4S 4DMCA 1X13A 4RV4A 1PSWA 4OQLA 2C20A 4JVSB 5EUQB 1S3SA 2HMWA 4V1CA 1CYDA 4N0MA 5AVJA 4X93A 4UVGA 2CC2A 1KIMA 2F1JA 3E15A 1D2GA 1GTG1 4KMMA 2XUKA 3WKBA 1JHRA 3BXOA 2NUPA 5CDSA 4G5RA 2ZBGA 1PLLA 4HLQB 1ZH4A 5GQSA 4Z3OA 3JATB 3PE6A 2AQKA 2K6GA 1R4ZA 2VTEA 2WTXA 5U9CA 3A6KA 2OXEA 1R8QA 4LWOA 1DEKA 3W0LB 2CN1A 3L46A 3WOVA 3DZCA 3SVZA 4WLFA 2FHSA 3PXUA 4EA9A 1RXIA 1U6KA 1I24A 2Z8YA 4V0MA 4F06A 4EYSA 4YRFA 5T57A 5JAOA 1C8KA 721PA 2OCDA 4J7CA 3TLAA 3AHCA 3I05A 3FDJA 1PR2A 1OPXA 1NULA 1Z5UA 3JWHA 1NJ2A 1M8PA 1ZPDA 2ZDGA 3CXRA 3KU4A 3PPXA 4V0NA 4XD7A 1M1XB 4Q0MA 4XZ3A 2QLMA 3OUZA 1EUCA 1PIWA 1KYTA 2GLTA 4C07A 2VPWA 5L4SA 2HA0A 4R1MA 1Z8FA 1BMFA 3ZI0A 5K09A 4F4DA 2VP5A 2QLTA 2XE4A 3K30A 4MROA 3BH7A 4MKZA 1ONNA 3TN7A 4FNMA 2FQQA 2GUGA 4FMCB 2WA1A 2AX3A 4H0CA 3N8KA 1D0IA 3T1YB 3ZIAD 4UTVA 1U2RA 3H4VA 1VKZA 3V1NA 2QJRA 3DMHA 1UDRA 3E22B 3RRFA 1MNQA 3RKUA 4TOIA 4Z53A 3CPHA 4XVCA 1VDZA 4OXKA 1Z6AA 5AP9A 4P86A 1QHEA 1TQ8A 2RJOA 1BXKA 2W22A 4KCGA 4LPKA 1TIKA 4YASA 4IIJF 2FYTA 1J0EA 1J39A 5LOVB 2EC5A 3ZE2B 3USCS 2SECE 2VBIA 2P6NA 4TT3A 1JSRA 2BGRA 3E2IA 4G07A 4FLEA 5DK4A 1TJYA 2HXSA 5I4BA 2FPWA 1T8TA 4KXYA 1SELA 4Q05A 1Z25A 2ZEJA 5CFMA 3LCJA 1X15A 5CB4A 1N8TA 4WLVA 1YFKA 4OATA 2PGAA 1PUXA 2IBSA 1F12A 4QOIA 3WBBA 3BGDA 2RH8A 3KEGA 1P1RA 4I46A 4WPGA 3T06B 4N65A 4YLYA 1ZK2A 3PQ3A 3N2ZB 1KZ6A 3LXUX 4GL4A 3QKRA 2MT9A 3LXXA 4HPXB 2W2PA 3HPRA 3TSAA 4BVJA 1XHFA 2VJLA 1SVIA 3A9RA 4DGSA 1EK0A 4Z8XA 1EVEA 1SZJG 1SWVA 2E49A 2ENWA 2R44A 3OMWA 5DIZA 1N36B 5G0UA 3IPCA 4ZI5A 4MZDA 4Y0NA 1E6EA 2YWXA 3QUQA 4XLLA 4D79A 4M53A 4QG7A 5H80A 1VE3A 1DOZA 3NVDA 4ZCTA 3O82A 3LIPA 5ANRB 1MJGA 1FNDA 1CUXA 1KU0A 1WM1A 3AZPA 3IPAA 4OYLA 1OV6A 2YQ4A 1WDWB 3QHQA 3AY7A 4LKRA 3KEOA 3MHTA 4M7WA 3ZS8A 3FWZA 4J4TA 1ESDA 1GDHA 2DVMA 1U8CB 5M34A 3O1IC 5H02A 1XGKA 1Q12A 1UFVA 2O6HA 3DUFB 3WJ2A 3VR5H 2OA0A 4D3ZA 3I9NA 2PQMA 1I5OA 1LLFA 4EYEA 3TG8A 4LRYA 3NW9A 5FOUA 3HKEA 4OHYA 1N2ZA 3W5IA 1OZFA 4FS8A 2Q9UA 2VJQA 3D8NA 1G2QA 3OFND 5LBIA 3ZCRA 3FYTA 3DPIA 2FPPB 4HC4A 3HH8A 3QJ5A 1T1IA 2GD6A 1GCUA 2R84A 3RUIA 4IHJB 1CIVA 2OHXA 3E18A 3G3EA 4K2AA 4MAFA 4Q3EA 1XZCA 5BWNA 5DHQA 4X60A 3PHCA 2OCGA 1XPJA 4ZCMA 1LSOA 5E8RA 1M6HA 5K99A 5DTEA 2ZYIA 2XGSA 2IYTA 2P69A 3G82C 1QLHA 3EQ7A 3N6XA 4BNLA 3FVWA 4EABA 1OKKA 3V80A 4BATA 2B34A 1QVAA 1SZCA 3PXEA 1K1EA 4FYMA 4BX3A 1RP7A 1N2OA 4TWJA 3K9FC 1Q7EA 5C3UA 2H2IA 2WUFA 2IRWA 1IOZA 2YN4A 3ET4A 3H4TA 4J90A 4JP2A 4OYRA 3HI6A 4CIVA 5CFNA 4RK6A 2BM0A 2KLBA 2NSJA 3OU7A 5HIAA 4YIHA 4RH3A 3L7NA 1G18A 2X7JA 1DMRA 1WP9A 1FUEA 4GUDA 4RSHA 5AKJA 4JUAA 3PFBA 5EZ6B 4BV2A 3WZMA 1L5GB 3NM6B 1ZK3A 1D9XA 2L18A 3OJFA 1WJGA 2H31A 4M89A 2UXDB 3QPDA 1UJ4A 1F6WA 1PFUA 4GNRA 4JB3A 3Q5EA 3PICA 2XMDA 2XUGA 1O0SA 5T4BA 2HSZA 4Y2GA 5CT6A 4B3SB 4F56A 2RAUA 2QW1A 4LGYA 3MTBA 4G0YA 2VQFB 1IQ0A 4CM6A 4Z4IA 4ZAWA 3DXZA 2X4DA 3EIEA 3RS9A 1LI5A 2ZOSA 1M8FA 1F8XA 1D2CA 2Q2VA 2ZSDA 3EN0A 1WB6A 2IUUA 1G7SA 1JU3A 1HXHA 1RWQA 5TQJA 3E7PA 4KKXB 3QXGA 3PQ6A 2Y77A 1Z7EA 4G2TA 5FNVF 3H8VA 4F4CA 1E58A 2IE0A 2NVBA 1LPPA 4IZOA 4ZVKA 5EJ8A 4CZ2A 4W5RA 5JXIA 1EAYA 2HKIA 4YB8A 2DRIA 2GSDA 3HJUA 4YVFA 1RWOA 5CG2A 3P5BA 5C5CA 2BMWA 3IDAA 5MFZA 1TDJA 4DC0A 1BD4A 2HNKA 4TTRA 3ELBA 1OLXA 1QV7A 1NYLA 1R5NA 4OK5A 1NL3A 1A88A 3DB2A 2GEUA 4E2YA 1J2TA 1ZGCA 9LDBA 3FWKA 3OCVA 1DIAA 2GPTA 4L3OA 2ZYHA 4KP7A 5CU7A 4KHPB 2IBTA 3TZHA 1QU3A 2PMCA 1TEHA 1VE6A 4H6PA 5AQ1A 2NZUG 3RNOA 5ECGC 1FDSA 2X13A 4EH1A 1B8NA 5LJIA 3AILA 4XPIB 5LQJA 4WVFA 4ER3A 3K0FB 3EZ2A 1OH6A 2PR2A 2AXEA 8ATCA 1QNFA 1MC8A 5E6SB 2UYYA 3U3XA 4DHEA 3PWKA 1YGYA 5B58T 2PUBA 1K66A 1EUCB 1DU4A 4QODA 5LZ5A 3F3SA 4RTLA 3PQEA 4FW9A 5K20A 3I61A 5FYDA 4ENQA 5JASA 5E3HA 1JBEA 1H9CA 3BJEA 1SUBA 3IMGA 2RHDA 3ZHVA 2VXOA 4J49A 4I3HA 2FQYA 2QN7A 3VR2D 4I36A 4ERNA 1BXRA 5JT1A 2C5HA 3RRZA 1E9AA 1O0BA 4IKOA 2JFPA 2Z4RA 3M1YA 1UOOA 4BV8A 5C5IA 2CHUA 3IKVA 3TEFA 1XXHB 2VOJA 5H4GA 3D5TA 3QHAA 4RD2A 5DHSA 3U1TA 3BSSA 3LQ4A 5CPBA 4ZODA 1P7WA 4UVIA 4EG4A 3JYPA 2FZVA 2O50A 2JLAA 1C3OB 1ZWLA 3AUAA 2ZTHA 5K1ZA 2ZJ3A 2NZXA 2R1TB 3BH6A 3TLCA 2HU5A 1KERA 4YFVA 1QZUA 3TW6A 4J94A 4ILKA 4B4VA 3N70A 3PG5A 4OFWA 1W4ZA 3OZUA 2IH4A 4JLKA 4X85A 2CYCA 4J3NA 5EIBD 1E3IA 2QRZA 4IHKA 5CT9A 3KZOA 1E2BA 5IEJA 2FWNA 3EAGA 4HB3A 5A7FA 1RS0A 5ELMA 1XAGA 1RYNA 4FCCA 3CG0A 3G13A 4Q1DA 5EG5A 1WQ1R 4K6CA 4PIVA 4JLUA 1XN1A 3UHOA 2DECA 3VXKA 4J7UA 3CLKA 4XAQA 3TKAA 1R6TA 1F1BA 2CUZA 2QYSA 4MARA 3L4JA 3LQKA 4RGQA 3TQIA 2SCUA 3VC3A 1G6OA 4YRLA 2XNSA 4AL4A 1OBHA 2ATVA 1RP1A 1VZ3A 2V7GA 1NX9A 4TUYA 2BUCA 3OOJA 3RSFA 3P2IA 2AX4A 4RQTA 5D5PA 1UC4B 3N2LA 1GRCA 1ORDA 2FSHA 1BQ4A 3KAJA 3WGYA 4D0SA 3R8FA 5F2KA 2PZ8A 4NQZA 1FSPA 3ZY3A 4C0BA 4J7AA 2QUZA 4RCZA 1DRJA 4HDNB 4Q03A 1KK3A 3GPIA 5FAXA 2TECE 4QFMA 2AGVA 1NHWA 1KSGA 5A6VA 3IPXA 1EG2A 5GINE 4D0RA 1P4SA 2C3YA 5IKPA 2QVZX 3OZSA 5IWCA 1N5RA 4UBKA 4EY7A 3DHWC 4ZI7B 3WIVA 2EL9A 2X23A 4X0EA 1YZLA 3H2GA 2P2SA 4PQYA 3AWDA 1AKTA 2IEBA 4JB8A 5H70A 4JT2A 1JG3A 3A8TA 2C2GA 3EH2A 4JHXA 3OOSA 1UPCA 3PR3A 2Q7OE 2NUTA 2P1RA 4C08A 1WY7A 4HNGA 1GR1A 2YXDA 5D7NA 3I37X 4EARA 1AMUA 2XGGA 1H2EA 4NU6A 4NP6A 2AFIA 4J43A 5B37A 4DNXA 5K0TA 3QBTA 2SICE 5ALMA 1PS9A 4PR3A 1MB0A 3T3OA 1M2VB 3GJQA 3RTAA 5C8YF 1CNMA 4DEVA 2CFIA 2JK0A 4CMIB 1R37A 4J4BA 3SM3A 4Z4HA 1J06A 4U2KA 4ZWNA 2OWEA 1FNCA 1NR5A 3SD7A 1HC7A 2HK9A 3HZHA 2J45A 3VU9A 1Z37A 1PR4A 4G67A 3MGKA 3C6YA 2M32A 5J5VA 1NP6A 4WOJA 2I3BA 1K5HA 3NALA 3DOUA 3JQ7B 1ZMTA 1C9MA 3IXQA 1YVPA 1WD7A 1YBVA 2C92A 3ANMA 2WILA 3F2VA 1PK9A 1BXZA 5AVVA 1IL0A 5BWLA 4LXIA 1CQWA 1Z8DA 2V1XA 1S1CA 1H3NA 6NULA 2W0SA 1YS4A 1JDBC 1XZPA 4V38A 3T3EA 3J80A 4QELA 4WCVA 5LP1A 2E3JA 4E46A 2R8RA 4Q4HB 4X1KA 3UWDA 1RRPA 5CLIA 2QBYB 2OCAA 4OHMA 4WD3A 1H1LA 4A0QA 5K3FB 2SKDA 3AG5A 3BRQA 5G53C 3VISA 1DZ3A 3EBLA 2WFMA 3ITNA 3FXAA 5DHTA 5F2OA 2ZJ5A 1DLIA 1C1XB 2BMDA 3MILA 1SBHA 4O2BA 2Q07A 5FR1A 2Q45A 4HQ6A 4Q7LA 1UBOS 1CD5A 1KJNA 1V4BA 2QAGA 1I32A<