2L17A

An arsenate reductase in the reduced state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
b'MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate reductase
publication title (1)H, (13)C and (15)N resonance assignments of the arsenate reductase from Synechocystis sp. strain PCC 6803
pubmed doi rcsb
source organism Synechocystis
molecule tags Oxidoreductase
total genus 47
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2l17A00
4KQCA 3KHTA 5BR1A 3LKVA 3CTPA 4MS4B 4ZJPA 1JF8A 2QU7A 3SQNA 3H5IA 3KS9A 3QLVC 4Y9TA 3NHMA 5BQ3A 1KRXA 3OO0A 1S8NA 2PKXA 5F64A 3EGCA 1PNRA 3L6UA 1DJMA 4FE7A 4XLTA 2IPLA 3HS3A 2N9UA 1ISRA 5TQ0A 2FN9A 3W9SA 4EUKA 3KYJB 2MSWA 3MYYA 5D2CA 2JVKA 5EWJA 3N6VA 4D74A 3O2SB 4TLLB 5TPZA 3I42A 1E6MA 1BVHA 2J48A 4ETMA 1ZGZA 5DCLA 3LOPA 1RXEA 4KMRA 5FBHA 3BBLA 2R47A 3NNNA 2P4UA 4EYQA 4S04A 1FQWA 4G0OA 4N0QA 4FE4A 4RXMA 2ID9A 3DGEC 2YHBA 2FVYA 3C97A 3FDFA 3KLNA 2VUIB 3VNBA 1KGSA 4IILA 4Z9AA 5CNJA 4MS4A 2E4WA 2PUEA 5TPWB 4F12A 3L49A 4HYEA 4ZMSA 4MR8B 4UHKA 4NICA 1L5ZA 5BRJA 2A9OA 4KNYA 3TO5A 2CWDA 4G0MA 2JK1A 2LUOA 1XWWA 3OO1A 1UDRA 3LUHA 1NXVA 5JNRA 4Z4GA 5DLEA 3OLWA 2FN8A 1PEYA 3H1GA 3A0UA 1P2FA 1Z15A 4H3HB 5DKFA 1CEYA 2P9HA 3LUCA 3IP6A 2PL9A 2FTKE 4MR7B 1LBHA 2JVIA 2WMYA 4XASA 4MAAA 1ZAYA 3GV0A 3K9CA 3RVMA 1IIBA 2RJOA 3O75A 2GKGA 3SAJA 3CNBA 1QO0A 3OLVA 3OLYA 1PHRA 4ZPJA 5DGCA 1EFAA 2PMCA 5TPWA 1APBA 3LTEA 3GYBA 2PE5A 2NZVG 5IULC 5EWLB 1MIHA 4L4UA 4MR8A 5JS2A 2WRZA 1JFTA 3LUKA 4MR9B 3GWGA 5CNMA 4ETIA 1C4WA 1P8AA 1BA2A 1MVOA 3H6HA 1JFVA 1DC8A 4RY0A 4O1HA 1A04A 4RV5A 2FQXA 3F73A 4RK5A 1DC7A 1ZDMA 4RKQA 5C5CA 1ZITA 3H5WA 2QW1A 4O1IA 1ZESA 4JB0A 1JHZA 2E4ZA 3Q7SA 4QPJC 1QPZA 1JYEA 2OQRA 3M9WA 4MR7A 4ML3A 1RNLA 4G0PA 2JB9A 2IPMA 3DBIA 2GWRA 3D8UA 1HEYA 1P6QA 1TM2A 2RDMA 3FGZA 3QEKA 5DTEA 1QP7A 2PUAA 3JVIA 4WZZA 7ABPA 2FLKA 3Q15C 2HQOA 4DADA 5B3JA 1KRWA 5KC9A 3HSYA 3NNSA 3HDGA 5EWLA 2QV0A 1NXXA 3KLOA 3ILYA 1P6UA 3H5OA 4MR9A 3S99A 9ABPA 3O74A 1EWVA 1YS7A 2E4XA 3JS5A 2HPHA 2PUGA 1QQAA 2QR3A 2A9RA 4LRQA 5B3JC 5IX8A 1K68A 3FFWA 4WUTA 5KQGA 2WJAA 3CFYA 4IMIB 3SG0A 3KYIB 3QX9A 3GT7A 3H1FA 2H3HA 5CNKA 3Q41A 4RY9A 3SM9A 3E61A 4KRFA 4NV3A 1GCAA 4EYOA 2NT4A 3RVJA 2NT3A 1ZGGA 5IBQA 4MQEB 3OM1A 2V0NA 3A3KA 1E2BA 1YMVA 2NZUG 1U2QA 3C3KA 1Z25A 3FFXA 3H5VA 3N75A 3EQZA 3NBMA 5JNTA 1NXPA 2HSGA 3HK2A 3QEMB 2DRIA 4KK3A 5FWYB 4EVSA 1QQBA 3P9YA 4PZ0A 3LMKA 3RVKA 2QZJA 4EYGA 1U04A 4F3TA 3OQNA 4Z9BA 4H3KB 4MRMB 1M2FA 4Z4FA 4RKRA 3O1HB 6CHYA 3A0RB 3LUDA 3URMA 1ZY2A 2B1JA 4S05A 4RXUA 1DP4A 1Z26A 4YS6A 2FXIA 5BRAA 3HJFA 4Z4CA 1USKA 1NY5A 4IRXA 4CBVA 5IUNC 1DBQA 2ZWMA 4MQEA 2QXYA 5T7BA 4EVRA 4KREA 2F8TA 3BILA 3N0RA 1SRRA 2AYXA 3SNKA 1AB5A 1TJYA 1YK0A 2E4VA 1U8TA 4PEVA 3E3MA 3QEMA 5KI6A 2LP4Y 2KYRA 2FEWB 3CZ5A 4HNRA 5FWYA 3OM0A 3LUGA 3N8IA 3ROFA 2RJNA 4RK7A 3TMYA 5IC5A 3T6KA 3C3WA 3GBPA 4RS3A 4IMJB 1I3CA 2IPAB 4W5RA 3VNAA 1D2AA 1D4ZA 5I4CA 3O21A 4P98A 4PE5B 4WXEA 5KWSA 1F4VA 3Q7RA 5HKOA 2PUDA 1FSPA 3HDVA 4MS1B 4MRMA 4P1ZA 4FB4A 5IUJC 2FMIA 3FFTA 3H1EA 3LFTA 1ZVVA 4N76A 4UHJA 3BRSA 2FW0A 4LX8A 3H75A 4ZMRA 4L85A 3JY6A 4Z0NA 1Z2EA 4EVQA 3QLUA 4NCAA 2QVGA 1NXTA 2CHEA 4W5QA 2FKAA 4GPAA 3ROTA 2JVJA 3RVOA 2QVCA 4E7PA 1VKRA 2PAFA 3HO1A 1JWLA 3O1IC 4E7OA 3BREA 1DRKA 3DZDA 1LJUA 1YMUA 2R4QA 3KKEA 2FQYA 3KTOA 5JS1A 3G1WA 2FMKA 3HZHA 4KV7A 4YP9A 3T95A 3UUGA 1PNTA 1H9CA 3BRQA 3CKMA 2LPMA 3QLUC 4YLEA 4YV7A 1U0SY 1GLGA 4YGXB 1FFGA 1RXIA 3I45A 3RVNA 4B09A 4F06A 1R8JA 3CLKA 2PUBA 5CNIA 1ZHHA 4MS1A 2PJUA 1M5TA 3N53A 3O2QB 4HNSA 2FEKA 5ABPA 3I09A 1EAYA 3JTEA 3OLXA 5ED4A 5HSGA 4OBBA 1Z16A 3EAFA 1A2OA 3M6MD 5JNVA 3JPYA 4G97A 4YR7A 4EY3A 1Z12A 2LBPA 2Q5CA 4N03A 3HCWA 1JLKA 4JA2A 3RVLA 8ABPA 4N0PA 3DLBA 1JX6A 1XHFA 3OMXA 1JDPA 1LJLA 4RXTA 4XXHA 4N41A 1U2PA 3MQ4A 3C3MA 4XAQA 2X7XA 5EWMB 3HM9A 2MYPA 1ABEA 3MIZA 4D6YA 1Z2DA 1M2EA 3JPWA 3QK7A 1LBIA 4RK6A 2BGGA 1Z17A 3CHYA 5T3YA 1B00A 1URPA 1PEAA 4IF4A 4TLMB 3FMVA 4G0YA 2ZAYA 4HNQA 1GCGA 2PUCA 5JNWA 2IPNA 5FWXA 4Z4IA 3GA5A 1DCFA 1GUDA 2VYCA 1QKKA 3OQOA 1WETA 3NHZA 4XFKA 1YK1A 5GQSA 2ID7A 1Y1LA 3O2JA 3M9XA 3HVRA 4MS3B 4G0QA 2CD7A 3MF4A 3IP9A 3DLHA 2HQRA 3H5TA 3QLTA 3QELB 5KQMA 1BDIA 3H5LA 2JBAB 5HQJA 5C5EA 5IEJA 5TQ2B 4PYRA 2WJWA 4G86A 5EWMA 3IPCA 1BDJA 1TMYA 4W5OA 1DZ3A 1FFSA 2GBPA 3RVSA 3B2NA 4Z4HA 4LE0A 2WB4A 1ZN2A 2H0AA 1K66A 2O20A 4MLCA 2R48A 2QSJA 5GOTA 3D02A 3O1JC 3TB6A 1EWKA 2E4UA 4YRZA 2RGYA 1SD5A 4DQDA 1CYEA 4WWHA 4Q7EA 2PUFA 4RK1A 1D1QA 3HEBA 1VLZA 4YO7A 4EYKA 4RK4A 4WXMA 4MLDA 2YHAA 3Q7TA 1DBWA 4MS3A 1FFWA 2L2QA 1ISSA 5TPZD 4RU1A 4OATA 1T34A 4LDZA 4RK0A 1JH9A 1OXBB 1D1PA 1GUBA 3C6QA 3QELA 2JBAA 4OTZA 2TMYA 3A10A 5TQ2A 3IPAA 4LE1A 4OLBA 4OG2A 1JL3A 4D6XA 1D5WA 1QNLA 2HJ9A 4O5AA 3KSMA 1BDHA 1YTUA 3H6GA 3IP7A 3Q9SA 3RVQA 5KQPA 5IEBA 2IYNA 2FMHA 2FLWA 4MPTA 2A9QA 4XARA 4LDAA 1W25A 1VPWA 1RZRD 4RY8A 3OLZA 5PNTA 3GBVA 4TMYA 3DGFC 3KJXA 4H60A 1MB3A 3SY8A 2IKSA 2MYUA 1RZRA 2OENG 1JFSA 4RDCA 3LUJA 1QP4A 3UKJA 2MYTA 5JNSA 1VRVA 1NATA 2IDMA 4KFCA 3EDCA 4JASB 4JB2A 3MA0A 3KG2A 2FMFA 4G0XA 3TD9A 2MSKA 1YS6A 2F8SA 4QYWA 3T8YA 3K4HA 4YWHA 5IUKC 1ZH2A 1EWTA 3G85A 2AYZA 4MQFB 3F6CA 4KK4A 3F6PA 1SXGA 2VUHB 2JCGA 3N0XA 4ZYLA 1SXHA 3CS3A 3CZCA 1QO0D 2MYNA 3HXMA 1E6KA 1MB0A 1EHCA 2IOYA 1JBEA 4IGAA 4NQRA 4Q6BA 4WT7A 2FSPA 3LUAA 4KVFA 5JNUA 4F8JA 3CU5A 5FWXB 5E3JA 1DRJA 2MSLA 4TN5A 1RPJA 2LIVA 1J56A 4LZLA 1DBPA 2A9PA 4JOQA 4DN6A 3I5AA 4MGEA 1MAVA 4KQ9A 5KC8A 1NTRA 3QX8A 3OQMA 3F7NA 4YCSA 2PL1A 2M98A 2GX6A 3NNDA 4GNRA 2WY2D 2L18A 4RWEA 3EULA 3HV2A 4G0ZA 5KQLA 1DG9A 4PICA 1Z18A 4OLAA 1DCKA 2WWVD 4MQFA 4MYRA 1NXSA 2CHFA 2L19A 3MM4A 2HQBA 3N0WA 2PLNA 4LE2A 1ZH4A 3UK0A 1CHNA 3GL9A 5FBKA 3RVPA 2B4AA 2JRLA 1Z13A 1NXWA 3JVDA 3KCNA 1USGA 2I6FA 3ILHA 4EGSA 2R25B 3TX6A 4M88A 1JYFA 3CG4A 2E4YA 1XHEA 1PUXA 4JAVC 1L5YA 3IP5A 5TE9A 4QICA 1C0EA 1JDNA 1ABFA 1M5UA 2VK2A 5HM6A 1SXIA 1DCMA 3EODA 3HUTA 3IDOA 3RH0A 5TQ0B 1QMPA 2FQWA 3EQ2A 3HUUA 4RZSA 4ETNA 1A0OA 4N47A 3GRCA 2W42A 1BAPA 4F11A 4W5TA 4JP1A 5EWJB 3LUFA 1TVMA 4QYMA 4RSMA 1KMIY 1W9HA 6ABPA 2XDYA 4Q6WA 1NXOA 2GI4A 4Z4EA 2M1ZA 3LKBA 3RQIA 2NUBA 1YVUA 4Z99A 1LK0A 2L17A 3CG0A 3RVRA 1OXKB 3OMWA 3T38A 3EJWA 4NCBA 1YIOA 1TLFA 3QLVA 3R0JA 1USIA 5CHYA 1F51E 3MMNA 5TQJA 4KZKA 2FEPA 1AB6A 1QP0A 4KPYA 4W5NA 1E6LA 3CRNA
chains in the Genus database with same CATH superfamily
1HKHA 1XMXA 4EF5A 3CTPA 4OXNA 3TZCA 4ZJPA 4ARVA 3IA2A 2CW5A 4IWNA 5ER9A 5JW6A 2B3DA 2IX3A 4RVCA 1AA6A 1TQ8A 4ZOEA 1MRNA 1CUDA 4LRTB 4D9BA 3FZQA 4X71A 3L6UA 5I8WA 2FP4A 4XLTA 1SCBA 4C06A 5CBPA 4G0VA 2VVTA 1KMCA 3V1NA 4B34A 4MUBA 4AVYA 1JG3A 2Y6VA 5IMBA 3UOGA 1CU1A 3O84A 1PUIA 4LI3X 5ALHA 1A82A 2W9XA 4TLLB 3ZXIA 3HBLA 4LVCA 3B52X 1U81A 1RFGE 3JQGB 2FR8C 5ERXA 3IBSA 3PFHA 4XD2A 3LOPA 2AKYA 4PX9A 3WGJA 1RXEA 4KMRA 4E70A 4HLUC 5AVYA 4GKKB 4JCCA 4M1MA 1Y1RA 4Z9FA 3HR8A 3JCZA 3WNDA 4B32A 1FNSA 3PI7A 3GLHA 5JXGA 3ABZA 4FCVA 4N0QA 1MAHA 4UNQA 3SC3A 1JEYB 2HDWA 3AJRA 3NYRA 1UANA 3GYGA 5DBGA 2OYRA 4CV3A 4JLOA 5A62A 2J9YB 4IILA 4LRSB 3T4XA 1RRGA 1KMNA 1OWPA 4RF4A 3U3MA 3MTGA 2JIOA 2Q5QA 2ZT7A 5REQA 4EG0A 4JV5B 1LSUA 2H4XA 2O4CA 3VO1A 1UJBA 2FI1A 5LQUA 1PG2A 3CE6A 1FSSA 1X38A 4KOEC 1CQJA 3RKRA 2AF3C 1SCAA 1SCQA 1XU7A 4FJ0A 4HDAA 5CPFA 3TFQA 3U7FB 2I22A 4GZ5A 4MROA 2YY6A 2QUZA 4ZC8A 2ZRNA 3LK6A 4ND1A 1ZMBA 1H0RA 3ZGXA 4I99A 4NK5A 4DXHA 5B58C 2RHHA 3A0UA 3T0GA 2J32A 4ZGWA 2GESA 1FX0B 4X6UA 4CM1A 3TOCA 3QEBZ 3BYZA 3OT1A 3PHBE 1BCSB 1SK9A 3QOYA 3ZU4A 2FTKE 2VZ8A 4H3VA 1TKRA 2AOXA 1ID1A 4K6KA 2GS9A 1CY4A 5CH3A 3BK2A 1AS0A 3SLRA 5LU9A 1PV4A 4WN9B 4AZVA 1RM3A 1A8SA 4BO0A 3IPYA 3LRTA 1DWQA 2REBA 4HLNA 4W5JA 3C1UA 2A0XA 4HGRA 1ODSA 1ZCAA 4P8RA 3S1AA 1T3HA 2PE5A 4IHJA 1GTZA 1HDYA 2QI9F 5FBLB 2H1OA 1TMKA 2HIHA 1EFVB 3OHMA 3Q7PA 1AH2A 3GWGA 2WG1A 2VG8A 3P5SA 4IHAA 2NU6B 5CNMA 5HTOA 4WKNA 1NW3A 4BHTA 3LT1A 5FDFA 3IURA 3JASA 3G5TA 4R81A 1UZNA 2Z8YM 2I34A 1FQJA 4RV5A 2GA8A 4GI2A 4QJBA 1WCIA 3QXJA 4D5GA 4D25A 2BHLA 3VHLB 3FOWA 4TTPA 5BNWA 3WIDA 3DV2A 4TZKA 2GSDA 2HX1A 2FQQA 4KE6A 4QNMA 5EYPA 1ZMRA 1MX5A 2DKNA 2X0FA 1KGDA 2VP6A 4UE3S 2AFIE 3M9WA 4DR7B 1RFLA 2VHYA 4PHGA 2GCPA 1CNMA 2JB9A 1Q44A 4KV9A 5K0SA 2YJ5A 5KTMA 2GJ9A 4NDAA 1PS0A 4WZZA 2IJGX 3HWX1 5CP8A 7ABPA 3D7LA 2AN1A 4BLSA 2B5VA 2Q5HA 1SBTA 5I9NA 4M1EA 2A5JA 4QUBA 3U13A 1GXSB 4OMCA 5FOXA 2XE8A 4A2QA 4PQGA 1TX4B 3VPCA 2C9YA 4AIIA 3AOEC 2BL4A 1KVQA 1R3UA 3BE8A 4I55A 4TKUA 4D4MA 1AZSC 4BNVA 2K6GA 3EBOA 1UT6A 4LRQA 1NBOA 2D5BA 1T8TA 3E5NA 1EDZA 4RF2A 5DM0A 4AX4A 4G5GA 2DHQA 4U2KA 4DA4A 1IUKA 1QB7A 1GR1A 2JIPA 1U3DA 4FW9A 2FG7C 3W5JA 1RMTA 4A23A 3FDZB 2B7CA 4ZT3A 3IAHA 3H7AA 4YRFA 5F9FA 3NOQA 1RJ9A 3OIVA 4IDHA 5HKLA 3FDXA 3UMCA 3N8DA 4I50A 3K8YA 4PAGA 4NZZA 2IYFA 1GCAA 4CV2A 2VJDA 1Y6QA 4L51A 2GN1A 4L5JA 1ZR2A 4D96A 4NECA 3SHWA 4CLXA 3AZQA 2R6R1 3PA8A 2IQIA 2FGKA 1IATA 4U7GA 3I4LA 3W3AH 4MCIA 2VBCA 5K05A 3QPCA 1R0LA 1EWYA 3ONNA 2YXEA 1XTTA 1ZOPA 2CZQA 3VC1A 4RCZA 4NZYA 4Y2JA 3MCVA 4C87A 2PKCA 3PNLA 3RGWS 3DQQA 4DJJA 1T9CA 1H23A 1TAHA 2PS0A 1UK8A 4KMOA 4MTCA 1SBQA 4XOIA 2OR3A 4L4YA 1NYLA 4NABA 1SQGA 5SZHB 1M83A 5KSPA 3S5JA 4BTEA 5FH9A 4Q7JB 1EX1A 1EK2A 3L4SO 4MV5A 4R05A 1KHHA 2GD1O 5JAZA 3TM4A 1U04A 5SY9A 1ZWLA 4KL8S 2NADA 6CHYA 3MQ2A 4EAAA 1JYSA 3URMA 5CLGA 4CDRA 2QIPA 2CFTA 1NJ1A 5DGTA 3UEOA 3WZ2A 3KQLA 1XU9A 2AOVA 2FSHA 5DH9A 3VR0A 2BGWA 5KJ1A 3N2ZB 3KVNA 1OAOC 2IZ0A 2JIQA 1R4MA 3PNOA 3MJDA 3VH1A 3SVZA 4FWBA 3R2JA 5AP9A 4LIPD 2HDNB 3ILXA 4XRRA 5K6AA 4DM4A 3UHFA 4WZAB 5TVGA 2IEAA 4DSTA 2ZBGA 5TMPA 1BXKA 3ZYZA 2N75A 1OFVA 1O95A 4TXHA 2ZZMA 5C7OO 2SICE 1HSOA 4CMKA 2AJTA 3LUGA 2HXYA 2C5EA 3HO6A 1CJSA 2H4HA 2J3QA 4YAOA 1GQYA 4OM7A 2NO6A 5GONB 4RS3A 5IC5A 1JQAA 3EW9A 4YRGA 1LSOA 4KDFA 1HT3A 3WWDA 5JOQA 3IKMB 1VSVA 2QAGB 1HDRA 4ZYZA 4DPKA 3NDBB 3U3DA 2FSVA 4LSMA 5HZKA 3AF2A 1H94A 3SBOA 2E6UX 4DRXA 5L8VA 3V7WA 4N76A 1Q6YA 1QVAA 1JDZA 1SC6A 3H75A 5TIIA 2VRCD 4JI2B 3DB1A 5E6RB 1NZJA 4B6OA 5ELXA 2UKDA 4QREA 2V58A 1UXOA 1CUEA 1ZINA 3WMWA 5IZCC 4JI7B 4GPAA 3ST7A 3FDJA 4D02A 1M8JA 2EQBA 3LYAA 1TTTA 4B6QA 5KJCA 3AVYA 1DRKA 1BXRA 1OXUA 1RRFA 2BF4A 2Y1FA 5CAEA 1FVFA 4HSEA 1PNTA 2RHDA 3D0RA 1FLNA 2P2CA 3WYFA 4HEA6 4DTIA 4E1BA 3NIFB 3EK2A 4YJ3A 5LMCA 3EBPA 5A0TA 4OA8A 2FPMA 1I4OA 1KAEA 4UD2A 4F06A 4C4AA 3AJ9A 4QXMA 4QT0A 2X8BA 3PPWA 3V1UA 4F4DA 2UUPA 6PFKA 5TEWA 2FCAA 4TM8A 1SBIA 3ZCVA 3I5MA 2RSLA 5AUQA 5KHAA 4Y0AA 3N7AA 3GI1A 1TJ4A 3CLRD 1XKXA 2VC2B 4TTTS 4A92A 5HRAA 2HCBA 4BAGA 3OLXA 4Z1OA 3MB5A 3GGOA 4FBGA 3O8OB 3GCZA 3TLCA 1R4ZA 2PH3A 3AUYA 5B2ZA 4RPLA 4JOCA 4G97A 2M6LA 3ZZUA 5IABA 5JCZA 1PR9A 1COZA 5C52B 1D1SA 1MDFA 2LBPA 4N03A 2QSZA 2I7CA 4MI3A 4R0MA 6LDHA 4BASA 2Q1XA 1K5GA 1AQNA 1QJCA 5IBCA 2NZYA 5A3VA 1DOHA 4HGNA 4ZQFA 1ONSA 5F5NA 1VE1A 2P4QA 4N8EA 1Y1SA 2QOEA 1A77A 2BFFB 2AG1A 1T1SA 3IUNA 1RVDA 1FXWF 3FYDA 3N8KA 4GUAA 3W5HA 1DIGA 2Y66A 3PUXA 3UXYA 5K5EA 2R7NA 1IG3A 2HY7A 1Z17A 3RIXA 1P1HA 2F59A 2QDXA 1I9GA 4MGIR 5K4AA 4C43A 4OKSA 4B3JA 3FMVA 4M8IA 4F4CA 4KUGA 2IPNA 1U4NA 4YAFA 4Z4IA 1OTYA 1AZLA 1X94A 2R96A 1ORHA 1QKKA 5E6SA 1VTKA 3EGWA 4NE2A 5C80A 4HQFA 4IQ8A 1OYWA 3C5WP 1UWKA 3RQSA 1X3LA 2YS7A 1TUEA 1KO7A 1P4AA 1R5NA 1SCKA 1Z4JA 1ZCBA 1QG0A 2QX6A 2ZIXB 3L7CA 4MMZB 3UUEA 3PXUA 2VYVD 4FMCF 4HTFA 4JQOA 3BH0A 2ONJA 2XECA 3TBKA 2QTVB 3RIMA 4AKSA 2CDRA 4E51A 1QIGA 1QE5A 1Z0FA 2GYWA 3GHHA 3RUCA 4A8JB 1CR4A 1FFYA 4A16A 3EXG1 1DZ3A 3IDSA 3PC3A 1RWKA 5EQFA 3WFIA 2XNDD 1EK6A 1MOSA 3Q85A 2H0AA 1H6CA 2CYAA 2QSJA 2DBVO 4TXNA 4LCEA 2HFKA 3SHFA 3C8DA 3X0DA 2FN7A 4DRZA 3BOSA 3NDPA 3OIGA 1MJ5A 4FGUA 3OZDA 5DMHA 4AY4A 5E2BA 4BVAA 1NJ2A 1KBZA 1DTWB 2X0KA 2AC4A 4W1SA 1F8GA 3V4LA 3VR6A 1M2OB 3GRPA 2X8AA 5HBGA 3SFTA 4FIZA 2QPTA 4BE7B 3GT3A 4EH1A 1V16B 2JZNA 1STOA 3I05A 2RHTA 3N9IA 2GRJA 4U0JA 2ODNA 5DMXA 6AT1A 5LN1A 3DTVA 4G0UA 4L5BA 4WOBA 3ZDCA 2XOEA 1IB6A 1ENOA 2AMYA 5CT4A 1ZONA 5K3FB 2Z6VA 5F1OA 2PMEA 3FPEA 3LF1A 1TECE 5EMMA 1PX2A 2JHFA 3W2TA 4DMGA 3WSWA 4JU8A 1WJGA 5FUQA 4F2WA 4AICA 3A6GA 2G9ZA 3DE4X 3FYUC 1WRBA 3CUTA 4NH4A 4OUKX 4JUBA 3D1JA 2DWPA 4H2DA 4M7PA 4MPTA 4ZI2A 2B0CA 4O0LA 5FCDA 5ADHA 3DD1A 3AWDA 3F98A 1RTTA 3KPWA 3QY0A 4IDEA 3E7FA 2VT2A 3G9UA 3GLKA 4N7BA 2IKQA 3VJMA 2MSEB 1H6BA 1ZICA 3NHRA 4OL9A 4QNRA 2W90A 3O31A 3GD5A 5F78A 1SVMA 1OLUB 3WMXA 2IKSA 2O5RA 2R2AA 4PLHA 5G41A 1UXKA 4EHNA 5CA1B 1TZ2A 4XX1A 2PD4A 3GDGA 2WKPA 3D6AA 5FEMA 2AJLI 2IGTA 4NU5A 4WFQA 5ULLA 1NR7A 2C00A 1CQZA 3IQFA 3LQKA 1IRXA 3KG2A 4G0XA 4LOJA 3VNUA 2C92A 2GYYA 2HJRA 1R10A 1N6LA 2P5SA 2FWJA 4YPFA 1XEAA 4YMGA 5A4AA 2VH2A 4B3IA 1X1TA 4C0WA 2J8ZA 3G85A 4G65A 2IZOA 2AYZA 1XCLA 2DTDA 3GJZA 1JE1A 3MNFA 5GAJA 4DJEC 4CEHA 5AKHA 4NOMA 4YGYA 4JI4B 4DDHA 1G64A 3LGSA 1KDVA 5FBWB 2OGWA 3SJZA 4CT4B 1G1AA 1SXHA 3CS3A 4TROA 1NSTA 1V1RA 5BSMA 4Z53A 3QWIA 2FGJA 3FMPB 1YR3A 1AS2A 3ICPA 4L74A 4R2KA 1JBEA 3R20A 1U2ZA 3DBHA 4R54A 4RFVA 5DW0A 5IDVA 5HF5A 4UKDA 4DKXA 1QANA 2GZSA 3WBFA 4N65A 1G7TA 4E07A 3Q8WA 5MHTA 4L8WB 1YDWA 2Y77A 5BMOA 3HMKA 3M7IA 1VYUA 1ZHFA 3MOIA 4LXYA 1M33A 3S70A 4EO7A 1PEDA 1E6EA 1PWEA 3STTA 2GAJA 3FMFA 1O1YA 3U4QA 2EFDB 2VYND 3T5DA 3ZKWA 4L9WA 5J2UB 3QX8A 5GOZA 1W75A 1CJVC 1HLPA 1YZKA 2DQZA 4J7XA 3CEPB 3PZBA 1Z8NA 4S2UA 2RKOA 1TDJA 2DWOA 3CLTD 4R9VA 2E2WA 3FFBA 3EULA 1C2TA 1QR6A 3F0TA 5EUQB 2BKEA 2GZRA 3C5EA 3X1WA 3L92A 2MR5A 2H06A 3ZY4A 5B1YA 1UJNA 5JPIA 1Z18A 5HEKA 3R3XA 4ZQEA 3AHFA 3C70A 3N2KB 4FFPA 4JEUA 2OD2A 4MQFA 4WK0B 1JIQA 1GYPA 1NF2A 3NEYA 1YJ5A 4MEJA 4RTLA 2EKZA 4K5QA 4E31A 4Q7MB 2ZM6B 4LFBB 1ULHA 3GCGA 4P0QB 1DJOA 4D3SA 3KKOA 1EI9A 2A86A 4DJDC 3L7OA 5AUNB 1QLJA 1TF5A 3KSUA 1D8TA 4JP5A 1KXZA 1SN7A 4CQLA 1LW6E 1JJVA 2W8BA 3JALB 3P0FA 4FDAA 1K27A 4KR7A 4KR6A 3S2ZA 1O4WA 2R7MA 3TL6A 2FW9A 2YWDA 4CFYA 2V0GA 1QC5A 3EODA 3AVXA 4L27A 4N0MA 4OI2A 1TC1A 1EFPA 1ELOA 1SCJA 3VYWA 1Z4QA 3RSFA 2OQIA 2DFVA 2FQWA 1NONA 1X74A 2RK3A 2KSQA 2DY1A 3EA0A 1KR2A 3R6TA 3PIRA 4P9NA 4YMSA 1R6AA 5KNLA 5AOBA 2W42A 3CW2A 3IQHX 4EO9A 1J2TA 4CDMA 5JPCA 4E15A 1EE2A 2GA9A 4LJ7A 3I2JA 5CX1A 3RQIA 3V4FA 2ODEA 2ZJ3A 1N5OX 4YJ2F 4QGHA 4BLQA 3CN9A 1QYXA 2YZKA 5CHYA 3PGKA 3FI0A 2RGEA 3PXBA 4JBYA 4GM0A 4MB0A 1EEHA 3N2YA 4KZKA 1QHIA 5AKKA 3FPCA 3U81A 2CE2X 3H83A 4KPYA 5JXWA 3ESAA 1O0BA 5BR1A 3BIWA 3LKVA 2OV1A 5JAMA 5J2TA 4MVJP 1YJXA 1EM8A 1QHHB 3MTQA 4ZCTA 1KI4A 2EKQA 4RSGA 4PXYA 2I4TA 1F60A 1H6AA 2VDNB 1A9XB 1DJMA 4GDFA 1FEZA 1ZUIA 3TW6A 1PJSA 2OYCA 3ULKA 5FR2A 5TF0A 4UUMA 3ZE9A 2MSWA 3GJTA 1JHYA 5J63A 2AG6A 1JVSA 5DJ5A 1KZ9A 5I8PA 5IBRA 3ZXSA 2O57A 5AK6A 1T2DA 1CYDA 4FQ8A 3Q8MA 4DLZA 3I04M 1D7AA 2YBEA 2Q1SA 4YRSA 3LPMA 3WK4A 1TZCA 3FCEA 5DYYA 4DIKA 1IK6A 2BZGA 1EZZA 1D3AA 4GLFA 1RAGA 3TVYA 2CJWB 1FQWA 2I3BA 5MF6A 1WUHS 1WB4A 2M1XA 3O47A 5EKXA 2QTCA 3OTOB 4ENPA 5JFGA 3ZDYB 2SBTA 3BULA 1BQ3A 2FVYA 4FVTA 1E58A 3K4PA 1L5HA 4B84A 3HJCA 3A9RA 2WFLB 1SM4A 1SOUA 1YVRA 4IGEA 4LJSA 5TPWB 3TSAA 1TFRA 3ITEA 5LOVF 2VUUA 1PZXA 2Z5LA 4E5PA 1KI6B 1L9KA 4I4TF 1OOEA 2J5KA 3IAUA 3T52A 3AERA 3D2BA 3ETGA 5HJ2A 5FBZA 3V3TA 5CLQA 4PYJA 3FUUA 4BO5A 1UK9A 2O1SA 4WERA 1UBUS 5FO0A 4ZXPA 1V3QE 3BQ9A 5BQ5A 5SY6A 3REOA 2EWWA 3N0VA 4MCHA 4D3XA 1ZYUA 4TRJA 3N07A 4B87A 1I6LA 1BFUA 2B35A 1U7PA 2ZJ6A 3OCJA 3M1LA 4JGGA 3T9DA 1AV7A 1EFUA 5CA0F 3ZIAD 3OF5A 1UEXC 3DKKA 1FDTA 4F38A 5C81A 4EKNB 3PLAE 1XAIA 5DEIA 5M5BA 1FDVA 4ZQHA 1BYIA 5I8ZA 1EGHA 4Y9UA 2BGUA 1A2KC 2H2IA 1R0ZA 3V6LA 1DV2A 3K9CA 2BN4A 3CRVA 4B4WA 3SAJA 4B71A 3CC8A 3OLYA 1HNXB 3IMGA 1CS0A 2CUNA 3BXPA 3DO8A 4DSOA 4RCVA 4EHAA 2AJ8A 2C84A 4MLPA 4MR8A 1TCAA 6Q21A 3AL2A 3G0OA 1G20B 3TQTA 4KITB 3QU9A 4ETIA 4TVSA 4FIDA 4HMQA 4FYXA 3M6VA 4P35A 2R6FA 3ZV6A 5A1JA 2OWEA 3BK7A 4BVBA 5IW8A 3O83A 1EVIA 2CUTA 5IVDA 3JVUA 3OTQA 5ILGA 3P20A 4EZIA 4GEGA 3SQDA 1OT5A 3I2YX 4MQ6A 5AXBA 1NF8A 1LBQA 1F06A 1DQYA 5H7XA 3X1MA 5KU7A 5K45A 3PENA 3FWYA 2J4FA 3B1JA 3K0KA 3N5KA 4I1IA 1R0BA 1G5RA 1ORTA 2H1VA 2HJSA 3HZRA 3ZU5A 2W2TA 1JYEA 1K7SN 2Q4RA 3A4TA 4H1VA 3LBIA 4XR4A 2RAUA 3ETLA 1X1CA 3QU2A 4FDUA 2AJCA 5H80A 4KE9A 1C1YA 3OQVA 3SXUA 2B34A 4DMKA 2QG4A 3G2OA 2XMGA 2OV3A 3UK2A 1BWSA 1CJCA 4QGGA 3UAVA 2NO5A 3HEAA 3EWAA 1GGJA 3K96A 3QI2A 4L22A 1UMBA 1XD2A 3P2IA 1RXCA 2BFNA 1N0WA 3RTAA 2IK8A 5BRNA 1GNSA 3Q6MA 3H5OA 3EHDA 2BFAA 1YS7A 3CNEA 5IARA 1RXWA 4BMPB 4ZARA 5FNVA 1EFCA 3OU2A 2I1WA 3CR7A 3EVNA 2AEFA 4BMSA 4CFZA 2XXAA 4IMRA 4LMAA 2I4IA 2Y92A 1W36B 3AI2A 1KPHA 3JQ6A 4Q19A 4UMEA 1F8UA 2G5CA 4TWAA 1HTBA 1JAHA 3M4JA 1JDBC 2H3EA 3UHOA 4A5SA 4ZO9A 4K26A 2OB2A 3SDZA 5CYOA 1QRAA 2J7PD 4KRFA 3ESXA 2NYVA 4GOXA 1GSIA 2FPIA 1CUAA 1I0IA 1X9GA 2TMKA 4IXMA 3WK8A 1G16A 1CFJA 1KJJA 1MFPA 5C8DA 1TKCA 1WXDA 1XZLA 4I1SA 3M6LA 3KETA 4EL5A 3ICQB 1P9RA 2VOEA 4FR2A 2DECA 2DFLA 5EQTA 5ICFA 1XYVA 4RO0A 4AU1A 1Y3CE 1T26A 1T5LA 1YMVA 2NZUG 3EIEA 4YI3A 4BX8A 3PHIA 4AY3A 5JDCC 1JT9A 1NKSA 2NVUA 3GFTA 1XZPA 4HO1X 3FNQA 4CGYA 3UF0A 3HBFA 4EQ6B 1A5TA 1N5DA 3DL4A 3PF8A 4L5YA 3PR1A 5FULA 4EB3A 3M33A 3OZTA 1G66A 3L06A 4ZVMA 1B3BA 4D42A 4EBFA 4JBGA 5EUCA 4MIYA 3K92A 5ERGB 3OOYA 3OEED 4CT5A 4XJXA 1SCUB 3O0DA 5FB3A 5J9FA 3A2KA 1MD9A 2I6GA 1M2FA 4JR0A 1OGYA 1P91A 2IHKA 3OE5A 3T0FA 3C7TA 4IIGA 4A26A 3ADDA 5A5GA 2B1JA 5AD1A 3FE2A 3VR2A 1ULZA 5FUYA 4Q1CA 4C0XA 4PYMA 5CDSA 1DKQA 1PWXA 3QVGB 2QUBA 1SPBS 5T7BA 3GT0A 2RGRA 1RKUA 3S28A 4BMZA 4NY1A 3H5RA 2QRJA 3RK4A 2FAXA 2XMDA 3RSQA 2CFIA 1VHDA 5JZMA 5LQNA 1LDBA 3UPTA 13PKA 4QHTA 5AHOA 1H2YA 1N3LA 3VGPA 1P2GA 2X5XA 3P0RA 4TQUS 1SC3A 4B9EA 2E85A 5AVTA 1G0NA 1P77A 2KB0A 5B1HA 1AHHA 4HV4A 5JALA 3G9TA 5FKJA 4B31A 1WCYA 1XU4A 2NZ2A 4Z3OA 4NXMB 1D2AA 3KFVA 4YK7A 2JDIA 4P53A 5G0SA 2C97A 1G17A 4WZAE 3IJPA 3NR2A 4P98A 3Q7RA 4AY6A 4ZI7A 2PHZA 4JYMA 1UPCA 3CVVA 2JLRA 2I6TA 1I2ZA 1EUYA 1WUKS 8ADHA 5FHRA 4UE2A 3EDRA 3ILVA 5HW0A 4QRIA 3FTDA 3AVUA 1T25A 2X4LA 3MUEA 5AK3A 1CUVA 4MH0R 2WQ6A 1ISPA 2B1IA 1M76A 5J1TB 1B0AA 4EB6B 1L5OA 1XTIA 2YIVX 4GI1A 3ERCA 3W4KA 5A4MS 1KH2A 3FF1A 3COPA 3OD1A 3U40A 3ABIA 3INYA 4WRRA 5H1YA 1I24A 4F92B 1GZ4A 1ZNYA 2QM8A 1EM6A 2B5OA 3LZDA 4FOTA 3TLGA 1ZZGA 4CM7A 4FC7A 3NDIA 1OH8A 1M0EA 3HO1A 4WKGA 3R6LA 3KTOA 4KSYA 1YMUA 4G25A 1RR6A 2FMKA 4AZ0B 5AW9A 4Z5XA 1P17A 1QFZA 2EZ8A 5JJKA 3H3JA 1ZMOA 2K2QB 4BBZA 1Y6RA 4YQFA 4JSYA 4C2AA 2FJPA 1ULAA 5BW6B 1F17A 4NL4H 3TOVA 1JFRA 2JGLA 3T7RA 3V2UA 3TRHA 1C3LA 4J8PA 1U5AA 2Q7XA 1FY2A 2W6MA 1IBRA 3AKYA 1DBRA 3JV7A 1IEWA 4EW6A 2JEYA 3T94A 4EKGA 1R9GA 4KYTA 4JC4A 1TCBA 5FYQA 3P45A 3A3YA 1IHOA 1Z82A 1QU3A 1DJPA 2ZSFA 1S2OA 4P80A 2Q4DA 2Y0CA 2O8DB 4M1ZA 4CNBA 3T5PA 2PBRA 1ZEJA 1XMQB 3F7MA 3H9JA 1U80A 1ZW1A 3UJBA 1IVSA 3LWNA 3FRIA 3T5CA 5J4HA 3JYPA 4PLTA 4IEFB 2HC9A 4ZVTA 1RU3A 2DH6A 2HHHB 4HMPA 1CZNA 3JPWA 3NRCA 3UJPA 1KFJB 1GG5A 2OFWA 4BLWA 3R3HA 2BGGA 2O54A 2VPXA 2BMEA 1G8MA 4NIMA 1YJCA 1BMFD 1M7GA 5L3SA 3C7CB 1JEQB 1MR3F 4YCDA 4F5YA 4MJ7A 1XQVA 3Q2OA 2CL5A 3IBFA 5BN5B 3WLOA 4BEJA 5CUQA 3R24A 4TLDA 4ZRDA 2IHZA 4DANA 5GM2A 2Q6OA 2JBWA 5CB8A 4AKTA 1XVLA 4UULA 1O08A 1MJGM 1Y1LA 3H65A 1TIPA 1ZHOA 3NW9A 2ZIWB 4H1UA 4D9NA 3NBUA 1MORA 2F43B 4ZDIA 1R0KA 1N6IA 1XZNA 3CNQS 1EG2A 1UZAA 2YNMA 3MERA 5C5EA 5KQMA 4LUCA 2Q0HA 4AJPA 1F2VA 1MC4A 1U5BA 3P9KA 2I7TA 2J5XA 5ES3A 3TMKA 1M2WA 4EOGA 1G21A 1WP9A 4UARA 1Q12A 1DOZA 4V0MA 1KQGA 4W5OA 1TUGA 1FFCA 2NG1A 2W6OA 3JQFA 5EMNA 1JBQA 3T9CA 1BS1A 2WB4A 2YFHA 5C1PA 4FLMA 2OLJA 5DI3A 1C9DB 2MWMA 1DEKA 1HE2A 2PGJA 1Q84A 2NO0A 1RAIA 2FKNA 1GSHA 3K9BA 2E4UA 2EBUA 3IC5A 4G5HA 1SD5A 2I4RA 3EXIB 2VNIA 3OT5A 2CZCA 2BFDB 3RPEA 3C5VA 3LHIA 2ERCA 3H11A 2VEOA 1LZLA 5JAOA 1D8AA 3AI3A 1MRZA 2GZDA 3LXUX 3NVDA 2XWSA 2NPFA 4AMBA 1TUIA 1X42A 3BZBA 4MS3A 1FFWA 4PZ9A 5TPZD 4OK5A 4EFMA 1QFYA 5CM8B 2UVDA 1UQUA 2ZK7A 3C87A 3JQ9C 4BO6A 1F7UA 4PRLA 3G5AA 2JK0A 1F6DA 3K5PA 3RSCA 1J42A 3GT4A 4BV3A 4HP8A 1YS4A 2IXBA 1T2UA 1Q0HA 1UQTA 4BCCA 3H6GA 3R5KA 4QDTA 2ZIFA 3E23A 4EEZA 3K09A 4Y98A 3RT7A 1GL7A 4CMGA 5KQPA 1LNSA 1KIAA 2QJRA 3E1GA 4GBMA 3IAFA 1QOPB 2KM1A 2C4TA 1P80A 3BKWA 1N1EA 3PHLA 3CB2A 4LVOA 3UKOA 1PYDA 1W25A 4IHQA 3G2HA 3W5AA 3MT8A 4RJKA 4QO8A 4H35A 2UYHA 3EGIA 3H2BA 3U17A 1Y1TA 3BRCA 4ZDJA 1U0BB 1ZW6A 1T1IA 2P1ZA 2PTGA 2WDZA 3E53A 3WS7A 1JFSA 1S01A 4HEQA 1QUEA 3LUJA 3K0HA 3UKJA 4J49A 2PWBA 5CH5A 2Q0SA 3DULA 1KEEA 1V8FA 4K9SA 4LYAA 4XIFA 5I7HA 2AOTA 2J4CA 2QZZA 2WD8A 4BB9A 3EXFB 4G01B 1WD5A 3C8ZA 1M6WA 1XXHA 2MDTA 3FZYA 9LDBA 1B0UA 4MW9A 5JVDA 3VO2A 3A8TA 1B7GO 3CLUD 4N39A 4C4TA 4EUFA 2FPXA 2O3SA 5IXJA 1KYZA 1WXWA 3S8EA 5E3IA 1GEGA 3BEDA 1YRHA 2HSZA 4ESOA 2P1RA 4IX9A 4O4IB 2GARA 2Q2NA 4ZYLA 2XCRB 4KH0A 4OK3A 4WNAA 3FVVA 2P7IA 1E61A 2IZ7A 2FDCA 1JEYA 1DWOA 1E2MA 4KACA 3T35A 2EF1A 4REOA 2B99A 2OBNA 5F23A 4WOJA 1PJ3A 3BICA 3Q3IA 4MVJA 3DUFA 3REQA 4NBVA 1NDHA 3QTTA 4NZPA 2JGEA 1R8SA 2CLSA 4D4IA 4QZVA 4MGEA 1SUAA 3HGMA 5L9AA 1K7CA 3I28A 1J23A 4XUCA 2R6ZA 1UOOA 1YR6A 4Y0NA 3ELUA 2Z8YA 3QKRB 1WBBA 5KBYA 2H1RA 1X80B 5T6BA 1NLZA 1VL2A 4G0ZA 2C5HA 3JXEA 5LVAA 3IOBA 2R1VB 2X8JB 5D3ZA 1E60A 4LBYA 1FSZA 4Q01A 4U6SA 3ZR4B 1E8MA 4P5EA 1RMQA 2NZWA 3E3OA 2QAJA 4FSHA 2YVAA 2YXLA 4IJKA 3UT5B 3GL9A 3B6EA 2I0FA 1Z6AA 2RGCA 1JHQA 2P67A 5AW6A 1O9GA 1IN6A 2FFJA 3B7PA 1GUFA 4PN7A 1LDYA 3FTQA 2PO7A 3K5HA 4GQIA 1NVXQ 1JLSA 1DUSA 4IQFA 2IX9A 1JYFA 4C6RA 3RSOA 4RKYA 3DF9A 4N6OA 4C29A 4UM9D 3VHRA 1FUKA 2XSZA 5IC4A 1L5YA 4ALIA 3AVWA 1IN8A 3IQXA 4RENA 4E2YA 4HGYA 2ZIGA 1AQ6A 2ZPAA 1VIVA 3K73O 1ABBA 1MDBA 3IDOA 2FSIA 1H3FA 4ZQBA 2YIMA 3EQ2A 3MSXA 1I4TD 3I0ZA 3GPDG 3OPVA 4XW2A 1E2JA 4IY1A 3N2NA 1N2OA 1BYUA 2JANA 2YDYA 1KZYC 2XDYA 3E70C 3GARA 4Q6WA 4XM0A 4XGNA 6ABPA 3INNA 4CLHA 3TXXA 1U28C 3RVRA 3FNIA 1XA0A 5ALPA 2QA5A 3MZ0A 3WB1A 3WO0A 3IHTA 4XB6B 4TWZA 3Q5EA 1XMPA 4BNWA 3RSGA 1TTQB 4C22A 3MMNA 1U98A 4DV7B 1E3DA 4NJEB 5IWCA 2ISCA 1KU6A 2HTEA 2FEPA 3U7RA 2ZVDA 4D44A 2Z08A 1QF6A 1SC9A 3DJFA 1EIWA 3ONWA 3KAJA 3UV7A 1XELA 3GEGA 4U2GA 5G0TA 3FB1A 1QP0A 1KYTA 5FHQA 2O8FA 1Y5NA 1DO8A 2CL0X 3QFRA 4WZBA 4C6HA 2HXSA 1SU4A 4E5VA 5KTOA 3IAS1 4HGZA 3O95A 3W6ZA 4RH0A 1JPVA 4DLKA 4V02A 5A0VA 2DPXA 2CF5A 4MPPA 1IWBB 3WMGA 1Y81A 2YHIB 2GHQA 2G40A 2GDZA 1HLDA 3EF1A 3AR7A 4U7TB 3BIXA 1DQZA 3HADA 4RGVA 4CKEB 1U7XA 3QKTA 1Z29A 3E3AA 3S0JA 4CL2A 2ZXEA 1Y8CA 3K9GA 4BGDA 3SKYA 2VSFA 1TT7A 4E30A 2O7VA 3U56A 1EUDB 1CUSA 4PIVA 4EMSA 4OXXA 4HAOA 1GADO 1GZ6A 2BKAA 3INGA 3Q9LA 4LQ4A 1KE2A 5JHHB 1C0LA 1CVIA 2C78A 5CVJA 4P5PA 1WVIA 1JKJB 4KQJA 3JAWB 2DYKA 4NARA 3CV3A 1C2YA 1X13A 3AW8A 2AUNA 5DCYA 3NNNA 5BSUA 1YE3A 1NVDA 2JEOA 4FYKA 2Y27A 1S2IA 1RIFA 2QTAA 4P82A 3AJ8A 3L4BA 3E7DA 1HL3A 2WVHA 5AVOA 3LO5A 3TH5A 3W2GA 1MVNA 1L5NA 3EXG2 2CXTA 2JAHA 4FE4A 1EK1A 4NMMA 2WLSA 1JRLA 5DT9A 3ECSA 1DKMA 4IDFA 1P74A 2XOKA 4U7WA 4RZHA 2Y0BA 1KORA 1UR5A 3WGQA 3LQ4A 1FTQA 1ZX1A 3FHLA 3LDHA 3O7MA 4UOZA 1PL8A 4HBZA 2F1OA 4NICA 4RTRA 4OB6A 5EI5A 5K0LA 2DPHA 3M70A 3DHVA 4QPNA 4BFWA 4UM5A 1PL6A 4ER7A 4IO1A 2FPWA 3K2BA 3NV7A 3LUHA 4X1YB 5JCPA 1A95A 2RHMA 3B53X 3EZGA 4ZJUA 2QTMA 1WNFA 1EDEA 1PEYA 2FOXA 4FXOA 3ISTA 3DBVO 3HYCA 2CWWA 1Q1ZA 3PQ3A 4RH3A 2HK7A 2A9KA 2JVIA 1I3LA 1L7VC 3BKXA 5L3QB 4B3BA 3FMIA 4BMNA 3KQPA 1XMIA 2HZBA 3FAZA 2RJOA 5D85A 2FFHA 2QEQA 5U4QA 2NXJA 2E49A 1PSWA 1E62A 1GFZA 1R27A 5LXTB 4ZPJA 3HB9A 1H1LA 2G83A 5JADA 2ZU6A 5EWLB 4H1HA 3M3DA 3DBLA 4BU1A 4OMDA 3GIWA 1GGMA 2H2FA 1QDUA 2PCJA 1OZAA 2UVPB 3K1JA 4QTTB 1P2DA 1EFRA 1ZMTA 2XEXA 4MI1A 1LF5A 2D7JA 5JS6A 1E5XA 1WQ1R 3LPLA 5AW5A 1P4JA 3EIXA 1UEJA 2GK4A 4O1HA 3BT7A 1ZSYA 2FWPA 3IERA 4H6WA 5HNKA 5CR9A 5DP1A 3RO7A 1V8PA 3GJSA 1MU0A 4URWR 2QKYA 1ZC4A 3SJBA 1EA5A 1G20E 1VG9B 2RK6A 3CEMA 4RDXA 4E13A 4N5DA 1SKMA 5C1IA 1UPXA 2QRHA 4X7BA 4HTAA 1O97D 3C8UA 5K3DA 4A8TA 4PBSA 5CA1F 1NBWB 1TM2A 1W5BA 4JL8A 5DI9A 5L7YA 2CNWA 4UZFA 4ILEA 3U1TA 4F5WA 1DC3A 4RVSA 2C8VA 1GZ5A 1DO0A 2JJ1D 1XPJA 2WWWA 4P4GA 3I3SR 2G82A 3ZC3A 4TWBA 3W6PA 4CXMA 2W0MA 2JH8A 4PS0A 5HDQA 1R6BX 4OU4A 3UVEA 3U26A 4DLSA 2F4NA 4YHBA 5DK4A 1E3QA 2PX3A 2P75A 3GQVA 1VCMA 2JH3A 3DLPX 3JS5A 1R8XA 1Z7WA 3ANSA 3ECAA 3ENNA 4ZI5A 1K6EA 2QR3A 4GGPA 1SA0A 1XA4A 1IPFA 1CB0A 2NPIA 1HXHA 4HDCA 3CFYA 4R41A 4NPCA 2XWBF 3ZDZB 1OU0A 2IU0A 2R5FA 1RLMA 3DMYA 1AC5A 1NE7A 1RRVA 1FW6A 1N0VC 4RTPA 2A7XA 4FFNA 1VL6A 3QSGA 3KOZA 4JJKA 4FB5A 3FRJA 1O96A 1YBAA 3O8OA 2NT3A 4GYYA 3ITNA 2HWUA 2CLIB 4L9AA 5SZKB 3K1AB 1T15A 4OHCA 1JEAA 2YJNA 4X9XA 2V0NA 3X1KA 4HNVA 2CV1A 4US2R 4F96A 4GS5A 2AW5A 1J2UA 1RADA 1U0JA 2V7VA 3QUCA 5C8YB 1W9MA 1YSCA 1Z25A 1KI9A 4UZSA 2UYCA 4X8LA 1NULA 4LXTA 3SJAA 2GPNA 3ZHRA 1JI3A 1G5TA 1W35A 3ONDA 4U4AA 1GIAA 4WCDA 4G67A 7ADHA 1K8YB 5IG2A 3RIHA 1QAOA 1T9BA 1X7XA 2J45A 1NN1A 1P3DA 1ZN7A 1GRVA 2FSGA 2WOOA 3ONFA 2P69A 3RCBA 5CD9A 3GG2A 1ZCJA 3A26A 2QTNA 3FVQA 3MXTA 3B1ZA 2PPVA 4BMXA 4TPKA 4DDVA 2JIRA 1CR1A 2NN3C 2OZEA 1LXCA 4DJTA 5BXYA 3RS7A 2BMJA 3ZI4A 2G1UA 4J9VA 3INTA 5FR1A 2HGZA 1K6MA 1YB4A 2AZDA 1WB5A 1I9CA 2FN4A 2PKQO 2VDWA 3T1YB 2O7QA 3CPEA 5CCXA 3KV3O 5KVVA 2B0JA 3V9AA 2PDAA 1OI4A 2I80A 1VI2A 5B1DA 3SEQA 1NTOA 3V4PB 5IM4F 3ZEAA 3Q40A 2DE0X 1P1IA 4IGKA 5F9HA 4IOJA 2HF2A 3FSRA 1W581 1M1YA 3G8DA 1T8SA 3QP9A 4AF8A 5KCZA 3CZPA 4B6GA 1C8BA 1CE8A 1GP2A 1PT5A 1E2KA 1KKUA 3GDWA 4HDNA 3AR3A 3BX1A 5DWQA 1DIBA 2O0MA 2PM8A 4QD3A 3ZQ4A 4CQJA 2IH2A 4EL0A 1KMMA 2AMVA 3GJXC 4OHWA 1N7GA 2DU8A 1CUBA 4MV8A 5EE0A 3SHQA 1LTQA 1Q74A 1D0VA 3C3WA 4TLCA 4ZREA 1HDXA 4DGSA 4ZEVA 2D1YA 2DFNA 1DJLA 4ZANA 3OVMA 1TYDE 3CW8X 3ES9A 5BP7A 1ZK1A 3EUEA 4TT3D 4FFDA 3WTBA 4H0FA 4YHHB 1FSPA 2HCFA 3WB2A 3HBAA 1JPJA 1WSDA 1Z56C 1HM5A 2VWGA 5IDXA 3KPVA 1JDVA 1YI0A 3LFTA 1NNUA 3D4PA 3LH5A 5CYFA 4DG9A 3R7DA 1A4RA 3BRSA 5KYYA 2C9MA 1Z2EA 4CM4B 3BXZA 4MUMA 4KRGA 3CZ9A 3LPAA 5IT4A 1CX9B 1RHQA 3AP2A 2XGMA 1YR7A 3EZLA 3ROTA 1DKPA 1SQSA 2O0HA 3MGCA 3MB8A 2XUAA 1TMOA 2VJPA 3E7PA 1LJUA 5HF8A 4UFNA 5TSDA 3H0EA 1DWPA 3OZAA 4PSCA 3V97A 2JKZA 3A25A 4OXQA 2C58A 4KWEA 1BSVA 5DN6A 3VSAA 2IS4A 1LVGA 1QZZA 1U2GC 1CERA 1IOZA 1NLFA 3HL4A 4PLZA 4KIGA 1JTEA 1XRNA 4LYFA 4KI7A 3HBMA 2HJVA 3IP8A 5GZ6A 4F8YA 2OGTA 1AXRA 1O94D 4GKVA 4Q3KA 4TZ0A 2D2EA 1V48A 3KX2A 1JQ5A 1MNAA 2J6CA 4WY5A 5CJJA 2BCGY 1JA9A 5FORA 4ASUD 1MG5A 4QM7A 2R65A 4RAOA 2WU4A 4JY7A 1NLUA 1GPLA 1ZWKA 3AEKB 2BTQA 2A5DA 3JTEA 4Y2XA 3TZLA 2HU7A 1E1QA 3EAFA 1GSOA 1VE5A 3Q3HA 1BO6A 2EVWX 4NYJQ 4CCSA 4UMFA 1YO6A 5BN4A 1NSYA 4JA2A 4JS0A 4QLOA 4N0PA 2FPLA 3NTQA 2QMYA 3KNZA 1F3LA 4DOMA 3VDNB 1T2NA 3MQ4A 3C3MA 1O3YA 5CXUA 2DGDA 2CFRA 1HG0A 1DEAA 2OXRA 2PV0A 1H2EA 3HJRA 1P7WA 1QZXA 2ZRAA 4I5EA 4ZCRA 5DLDA 3PNQA 2OLEA 3ZUGA 5J4KA 4CCWA 1M67A 3LD9A 5CLFA 1Y6ZA 4JNKA 1AO3A 4OUDB 4CQMD 1RJDA 5T3YA 4BNJA 5LKRA 1XTVA 1URPA 4F45A 1QYIA 4BKQA 4WACA 3ABQB 3OP1A 4HI0E 1PV2A 4OSOA 1E0SA 3QU5A 3T3GA 1CUJA 4ZVUA 1RHUA 4L50A 4PO9A 4BQOA 3GH1A 3IHKA 1PZNA 2YHSA 1KP9A 1COWA 2C20A 2Q5OA 1NP6A 2ZUSA 2DLCX 2WP8J 2O2EA 3JQ8A 1U0HC 3A4VA 5CLLA 3NKVA 3QUAA 4Z86A 5HIIA 3K70C 2VA8A 1N0IA 4G5FA 1YQUA 5KNDD 1Q1BA 2Z95A 4IIJB 5TGTA 3RLFA 4A2PA 1Z83A 2WWIA 3GOQA 3QELB 4V2IA 3GVHA 221PA 2W70A 3RYHB 4P3OA 4JLAA 4CHTA 2ENWA 2YV1A 1GGVA 1S96A 3OUTA 4MVJG 4FZVA 2F9FA 5AKLA 5JS7A 4DWWA 1TMYA 2C4KA 1POXA 3I72A 1QFSA 3FCYA 3PD1A 3WIEA 1ZN2A 4D43A 4DCUA 2IELA 1X7YB 4WDQA 4GF5A 1QQ7A 4KXVA 4V0NA 4LVUA 2Y4OA 2CDBA 3LCMA 3OTWA 4R8RA 4Q4HA 3EEQA 1ESMA 1UC8A 2PRZA 2PZFA 2ZJZA 4EGJA 1ONOA 2A5GA 1FLVA 5I5EA 2BISA 3B36A 4TV8F 1Z2AA 5EFOA 1T5TA 2C59A 2HEIA 2REXB 4WKOA 5EPOA 3A3OA 2PWYA 2GPWA 3F7OA 4P58A 4W7IA 4R1OA 4XQEA 5TT0A 5L7WA 1RYZA 4U00A 3C6QA 2KWIA 1DX6A 4MAMA 1BCRA 1T43A 5TQ2A 4IKOA 4GLLA 3I04A 1XE3A 3LNCA 2YN4A 4JR1A 5CHEA 2NAPA 5BUCA 2P9QA 3AT1A 4B7ZA 4FYMA 4ECEA 2CN1A 3JD3A 3FA2A 1SVSA 1LLQA 4DNFA 2BZ0A 2Y71A 3BF7A 3AM1A 1XWFA 4M1QA 1MO3A 2W2PA 4YV2A 3QXXA 2G4LA 4CLRB 1J0CA 2FMXA 2QG9A 1L4LA 5EJMA 4TMYA 2B6NA 2CBGA 2NLOA 4B0PA 3O8CA 1SU6A 4H4DA 5C51B 3G9ZA 1I2CA 1ZQ9A 4TKMA 5EUBA 1RRCA 1HF3A 4RW0A 1JAXA 4EHFA 4N18A 3GRAA 3IUYA 4R8VA 1R0YA 1BWPA 2RIPA 5GADl 2H8KA 5BOVA 3QQPA 3W2FA 1D2EA 4DPLA 2GAAA 3MA0A 3RVBA 1OLSA 1NFFA 2AQHA 2H1LA 2R7LA 1CEQA 1BE0A 1SU8A 1ONBA 4DABA 1NUTA 4I3GA 3FHJA 4G5QA 3PIIA 1Q3KA 3OJCA 3W6OA 3IMCA 1GRRA 2I2AA 1XMJA 1C9MA 2C2OA 3VQTA 3VZCA 2VZLA 4RTSA 1YNSA 3CVWA 1QMGA 2PJRA 4FI3C 3OZCA 4IZHA 8ATCA 3GFOA 4R2HA 3STVA 4BMYA 2IXEA 5E3HA 2O59A 1BRMA 3FPAA 3IVAA 4ZU1X 1QG4A 2XUPA 4B8WA 3LP6A 4QYIB 4OQLA 4WT7A 2XMRA 1TVCA 1FK8A 2FJUA 1VZ2A 1EZ1A 3LYUA 3F4BA 2LKDA 5FWXB 2Z43A 1HYQA 1OZHA 4KXYA 1RPJA 2QTWB 2XV1A 5JXHA 5LUBA 3G6WA 1DBPA 1ICEA 1VKOA 1GUAA 3HUDA 4P4SB 3LXXA 1JEJA 4R9UC 2ZREA 3IQGX 3S68A 5B6JA 5HCNA 5IT9A 1K92A 3ETDA 2OFXA 3L82B 3VR3D 1P5FA 2WF7A 5A3QA 4MV4A 5BY2A 3HKEB 6REQA 3TUZC 1U2TA 1H93A 4ZT7A 5JU6A 1SPXA 1A8QA 2VR1A 3MWDA 1MNQA 1FQOA 1QHFA 1I3NA 1XN1A 1PJRA 1RRMA 1IY9A 4CG1A 1NYRA 1Z5NA 2I65A 3CN7A 4TSFA 3FTPA 5DX0A 1Z0JA 3DKIA 4BU0A 5BN1A 1HRKA 3TBHA 1BJRE 3NOXA 1Y4SA 3A70A 4MP3A 5I7UA 2B7BA 3HI4A 5FL3A 3EC2A 1FFHA 1OW3B 1RI4A 4FDMA 5K09A 2IS1A 2GBLA 4X3OA 1ZISA 5H3LA 1GUZA 4H77A 4Q3NA 3IT0A 1C0EA 1ABFA 1VL5A 3PXEA 1YVPA 3DMFA 3N2EA 2B30A 2BFOA 1SGWA 3ENZA 3HUTA 1E5VA 2WMNB 2R8EA 1RKQA 3KZ1E 3UT6A 3OJWA 3ID6C 2DFTA 2PX8A 2G0NA 1ZMXA 3HB0A 5FX2A 3G13A 4F1JA 4KQ6A 4QQKA 1SWWA 4US1R 1ZM3A 5ELMA 1AK1A 4MWOA 3T4PA 3C4VA 3IILA 4XTRA 4B2LA 1LK0A 2L17A 1JZTA 3A4LA 4GRAA 4HXFB 1X14A 3IGFA 3E9DA 3EDOA 1TLFA 1QCZA 2GVZC 1YUBA 1VA4A 1Z7BA 2PSFA 1XVAA 3KEOA 4FFWA 4IDNA 4EA6A 2YCBA 1ZGCA 3H4TA 2J31A 4XKJA 4F3YA 4A1OA 4F56A 3K0AA 1I6MA 3OQJA 2AVDA 5B3KA 2P5UA 4TSRA 1Z9BA 2CK3D 2QU7A 4C3ZA 3NIWA 3CUUA 4UAVA 2VP3A 1MAWA 1AE1A 1GG9A 1KEZA 2JI4A 4XFJA 4J3JA 5F64A 4M98A 2H2WA 5D84A 3VPBA 1KYWA 1ITZA 4HAXA 2N9UA 5CEFA 1YBHA 2DHDA 4KG7A 1IBCA 1UOPA 3OP4A 2WIJA 4GM4A 3AVTA 3OT4A 2Z9DA 1ESCA 4Q12A 2ZBVA 4QNNA 1N8SA 1QK5A 1YQQA 1QGZA 3DHNA 5JLAA 3WNBA 1CUCA 1NW4A 3S2EA 3TLJA 5KVCA 3BUSA 5CIQA 3KQWA 1TJ5A 3MS7A 1LVHA 3B3JA 5FBHA 2OHXA 1FDUA 2GAIA 4DC9A 1M74A 2Q1UA 2VNAA 4S04A 1Z35A 1CRPA 4Q37A 3QFSA 4G09A 2A8YA 1UODA 2Z83A 3M1IA 3D3WA 1VRCA 5DNWA 4F21A 4LN1A 4YVFA 3V8BA 3GRYA 4BUJA 3ZV7A 1AK9A 2PEZA 3DFIA 2R8BA 1RZVA 5ALFA 1K7EB 2C9CA 4BX3A 1VJ1A 1O95D 1EXDA 4K6OA 1KI3A 4ZTBA 1QRTA 3N8GA 3R6DA 1V4BA 3EZNA 4FT4A 4GFDA 3FR7A 5EVJA 2EJCA 3ND7A 1SUBA 5DNEA 1YZVA 3TO5A 2BHRA 3SSMA 1QE0A 1BWRA 2CWDA 2M9MA 2V03A 3OO1A 1DTEA 4PC7A 3SZRA 1II9A 1BKYA 3TIVA 1XJWA 2UYOA 3D2CA 3UW1A 4AUNA 5HR5A 2C99A 1I94B 2PJDA 4RHXA 2IXFA 4G8JA 4EY5A 1SZCA 1GN8A 1C7ZA 3NHFA 2SCUB 1VHQA 1SCUA 1XN4A 4LMBA 4QBIA 1NUQA 3LUCA 2JZOA 3DVAA 2NV2B 3M8KA 4UEOA 2DKFA 1XC7A 3R3JA 1LBHA 2D0DA 1ZUD1 1U7HA 4XWAA 3VTAA 2HHJA 4HYQA 3U19A 1MX1A 3TN7A 1JG6A 4KI0A 1Z4OA 4KQEA 4YBRA 2G72A 3KLPX 1UBHS 1KRHA 1PZHA 2AFVA 2G8NA 1J0DA 1EJBA 3OSUA 5DGCA 3VKHA 3K6JA 3Q1LA 4XEHA 1WD7A 3GYBA 2NZVG 3RODA 4L8YA 1TT5B 1UBLS 1ZVJA 2RBKA 3BWYA 4K6HA 2O07A 3W8DA 5A06A 1QLWA 2Z2KA 3D5EA 3USZA 4DY4A 2HWXA 4S0ZA 2G08A 4BIMA 1DC8A 2EL7A 2QX4A 4HUTA 3C2QA 2OILA 4DCVA 4OQZA 1ZH0A 2AXPA 1N25A 2GZ2A 3RAJA 3T4UA 3VSBA 4Y2GA 5EJGA 1OF1A 3GNSA 4QUIA 4JB0A 2I6UA 3EWIA 2FWIA 2ZCUA 3GFVA 3L7NA 2O2IA 3N5CA 2D7DA 3H6KA 3TXYA 4G0PA 4LMPA 3WRXA 5C5IA 1PWHA 3D43A 2QRPA 4DHEA 4ZVLA 1AKWA 2JGKA 1BU8A 1B0PA 3Q15C 4CG0A 5JI3E 2ZAIA 3HFGA 1C14A 4L75A 4OB8A 3SYKA 3TQSA 5HGJA 4HLCA 3O26A 4C7KA 2HLNA 2NXCA 4KE8A 3SE0A 4ZVKA 4D41A 4YT2A 2G09A 2XYRA 3PQ2A 1H6DA 1SQFA 2L69A 4IYJA 2OCIA 3C98A 1RWBA 2CB9A 4K9DA 3AR9A 4NBKA 3HN2A 1R64A 5TGZA 2A3NA 1Q3TA 3I83A 2I99A 3OOWA 4R2WA 3UGJA 3F8WA 4ZO4A 2G6TA 1ORRA 1HYBA 1SCIA 4AJ9A 4AJIA 3UGQA 1N6HA 3COWA 1GCUA 3E5RA 2R1TB 3A6EA 1K68A 4G07A 4O4IF 3ZNOA 3LIIA 1JB1A 4DDUA 1GTG1 1H69A 2N1BA 2XCLA 2XZTA 1B73A 3KYIB 4GYWA 4UAJA 4D9GA 4DV6B 2IBTA 2BBWA 2D5LA 2VP0A 2O7SA 3ICEA 1DC6A 4BMDA 3K5WA 4D8UA 3T3OA 2FF5A 4MUFA 4WI1A 3L7DA 1MJGA 3ENVA 1U11A 3B1FA 3IKJA 4R1TA 3N39C 5EZYA 3WADA 4EZBA 1EHYA 2EWVA 4J1NA 4NMXB 1RWVA 2WR8A 1X9HA 3WKCA 3ZCUA 5KHLB 4EIWA 5JSZA 1XDUA 3FWPA 4FFOA 4BO7A 3MW8A 5LR6A 3EPPA 1V25A 1Z5GA 1R0SA 1WHSB 1YHNA 4OD0A 2RB5A 4EDHA 2ZYDA 3UENA 3ZLVA 1WXGA 1DU4A 1T6XA 3I2GA 4Q3LA 4AYTA 2BELA 4DJ5X 5DRYA 4AROA 2C5FA 1NPDA 2QD5A 2P9EA 1XSEA 1YZLA 1ZOLA 4EG5A 2QUAA 1KIFA 3AVPA 3GLFA 3UCXA 1YV9A 3C6YA 4F3NA 2ZJAA 3DZCA 1G8GA 1OHHA 3S29A 3VR6D 3WLJA 1JEQA 1F7VA 4HNHA 1B0ZA 2ZBDA 2ON6A 1XT6A 5EVCA 2AR0A 3II6X 4C6SA 3U37A 1E7RA 4PGHA 2ACWA 2ZROA 3DTVD 4S3MA 4S05A 3E3NA 1FU4A 4DIOA 3SIXA 4E32A 4IEEA 4PZZA 4YS6A 2AC7A 1G19A 2IYLD 3W3AA 2OFFA 3T12A 1XPOA 4X7MA 4M7RA 2O50A 1OU4A 2EYUA 3KSAC 3DYVA 3GZNB 3LPDA 4H7EA 4OCZA 1T6ZA 4G8DA 2AHOA 2JFPA 2XZPA 4DIMA 3NRBA 1NRXA 1Z5PA 2IDKA 4GO1A 3KYDB 1WEKA 3ZDRA 1VKJA 4LJAA 3RYFB 3TS1A 5FUMA 5A7HA 3WQQA 4RZ2A 3RS0A 3GLGB 3E9YA 3AG5A 4F71A 1YL5A 4OGKA 5F12A 2Y1OA 1R9MA 1QYRA 1GRCA 2AD1A 2GJAA 1P75A 3L0OA 4IIUA 2HUPA 4PV7A 2EBWA 3VZQA 5FWYA 3TIXB 2WFMA 1JQBA 3NVKI 1CHDA 3Q9NA 2RJNA 1G41A 3HU3A 3Q98A 4IF6A 3WKAA 3DEZA 4IMJB 4WEOA 4W5RA 2BEWA 1ZP6A 1FW8A 2ICAA 2IHUA 3P94A 2QTZA 3Q10A 1BE8A 1RYYA 2QVXX 5EMJA 1K06A 3EOBI 3PFCA 4RVUA 3UK0A 3ZXYA 5BSEA 3K8QA 3G7NA 2AK3A 3O82A 4PAQA 2H0RA 4P1ZA 2CHQA 1DX9A 1EQ2A 3DXXA 4XJVA 3ZD7A 4B46A 1E2EA 3GHYA 1QB8A 5A05A 1SO8A 2VP9A 2G9RA 2QP9X 2XQKA 3QG1A 4GBED 4MKXA 5EOVA 1K89A 1KY5A 4MKRA 4N82A 1YD7A 2ODPA 2ADOA 4RD1A 3O93A 4S1TA 2CHEA 1H5UA 3QBVA 4PIPA 3V8VA 5L95A 2ISQA 1HFEL 2FKAA 2JNWA 3BXFA 1RPZA 3P9NA 4Q24A 5KOHB 4FZJA 4AUKA 2JJ2A 3B13B 2XNCA 4V1CI 3CUSA 3RFCA 4BMCA 1X1QA 3RFTA 1E18A 4ON9A 3LDAA 4MMYB 4U2DA 3NASA 2MINB 4IDAA 4N5NA 1HEIA 1WR8A 3CSUA 3D0KA 3QLUC 3CT4A 4UATA 3CVJA 1G9XA 2QBYB 1FXWA 4JHLA 1TKAA 3KDAA 1UJCA 1CPYA 1TU4A 1PNVA 1ZHHA 1XD8A 2LR0A 2BEUA 1NAHA 4C4RA 2FRVA 3L04A 4HAUA 4X85A 5KTSA 3ICVA 1VLQA 3HYRA 4PHCA 1YE8A 3RAFC 3WJ7A 5D6OA 2D7CA 2G6BA 2WYHA 2CNDA 3LBNA 3LP8A 3R8FA 4EY3A 4C4ZA 3WLPA 3TG2A 1OWOA 1VMIA 3RREA 2FK8A 1RD4A 5IZ4A 4YCNA 4PFSA 4HDKB 3CISA 1R16A 4XXHA 5K51A 4N41A 1XLVA 2ZWAA 3JATB 4MQ4A 4YRAA 4H4CA 3ER8A 1E1RA 4JHXA 5HK8A 4QQNA 1ABEA 2IYUA 2VQSA 1F5SA 3A3PA 4IFIA 2C57A 3WHLA 1W8IA 1Z2DA 2YYYA 2VPQA 3MRVA 4O2BF 1LBIA 1GQOA 1E2DA 1FRQA 1K08A 3CPSA 3O8QB 3RC8A 3WFJA 4ARSA 4BC0A 1PD1A 3GNTA 1IEXA 3Q3EA 5FLEX 4HPWA 4EKEA 3NAQA 1G3UA 1Z0SA 1TUBA 2JCXA 4HRYA 3NTOA 1UKCA 2IDZA 3PX7A 3SZUA 1YK1A 1RXSA 2XKAA 5LXTF 1XMOB 2IHBA 3ZWNA 1Q22A 2WA2A 4B47A 2BDTA 3OJOA 4MGKR 3QKRA 1R4NB 2QRNA 4GKBA 1U4SA 3KOUA 3MTIA 2FPUA 2A1IA 2HDHA 3QMMA 2WF5A 5NULA 5LQRA 2HK9A 5BV0A 3FI9A 2KPOA 1RYEA 3EFHA 3V1LA 1LS1A 3PB3A 3IPCA 1VCIA 3EXHC 3KOYA 3EEYA 4WNYA 5D3KA 2ZUEA 4D9HA 3ZY6A 3G2QA 1C80A 1ZVKA 5KNBH 4E12A 3F47A 1C0IA 2HH9A 1M9NA 1U8FO 1YRAA 4UTNA 2R48A 1FNNA 3IXMA 3BEOA 1NRJB 1NZDA 2QVBA 3BD8A 3KR1A 4DV4B 3FRHA 1ZUHA 2X41A 3HCDA 3S6JA 1DPGA 2X14A 1D1QA 4HCJA 1DHTA 4L8GA 1RBMA 1UUFA 2JFFA 3MFQA 4GH5A 3SHOA 3VAYA 3KRTA 1G59A 1W47A 3B5JA 1AHIA 3GY0A 3HBNA 3LFHA 4OF4A 4P33A 5B12A 3KQNA 1TM4E 3UPUA 2B9VA 1H8EA 5SYMA 2VDJA 2JBAA 4TVBA 3R76A 1RBYA 1H42A 2Z2YA 3RU3A 3EGEA 1RMYA 1OX4B 5AI5A 1ADJA 3P1JA 1QO7A 5TVKA 4Z54A 2Y1XA 3IBCA 1RI3A 3SQLA 3C3YA 4LHEA 4CKCB 5H8WA 4LJYA 1DFHA 1PNQA 5G4KA 2HB6A 1NVVR 3PUJA 3BG5A 2JZCA 3N3AC 2FPGA 4GM1A 5J4VA 4CIBA 3NX4A 5IAGA 1U1GA 3ZV3A 3EX7C 4BRZA 5E1BA 1AGYA 3ZQUA 1RWPA 3WLRA 4OAOA 3EARA 2ZETA 1LLFA 4IFBA 2IYYA 2C4WA 1AXGA 3GQBB 3WL6A 4KQHA 2BFPA 1PLLA 2IA5A 3I76A 2I9PA 2YHIA 3TTSA 4U5QA 3BH6A 4FNGA 2QG6A 4URYR 1IIRA 5FQOA 2VZEA 3PWTA 4AL4A 3HHPA 3TD9A 1E3WA 2F8SA 3RU7A 4EMUA 1GN9A 4L7VA 1KC3A 5ALNA 1B41A 4D3ZA 2V7EA 3FM9A 2K7ZA 2BBSA 2W6ZA 3EGXB 3M6XA 4M86A 3ZVKA 1GDTA 4N0EA 4Y6OA 4PQRA 5FLYA 4D5EA 3W79A 1JKJA 3D0OA 1EH5A 4UAUA 5HIMA 5HKKA 4XM1A 3UM9A 4WD3A 5ES4B 2XRZA 1LVUA 1T6YA 4YV0A 2AXEA 4MJ3A 3WE7A 1EGVB 1KK1A 2EX1A 4LC9A 4TVKA 3DM5A 4RPCA 1LC3A 3FJYA 5AKIA 1OIVA 1F8YA 3PWZA 1UKYA 4R1MA 3E22A 1LD3A 3A4NA 1E59A 4HYYA 1YJQA 3I9LA 4K1LA 1KXJA 4KTTE 4WADA 4I4CA 3S2UA 2A9JA 3JQ7B 4JOQA 5BSRA 3RR2A 1OVMA 3FPHA 2GX6A 1C3OB 1SD2A 1WPQA 3QYPA 5JD4A 3C6ZA 4BO3A 2HRQA 1E1DA 4ZAFA 1RHKA 1ZKDA 2F48A 3HV2A 2F4VB 1B8UA 2VK1A 2R4TA 4OPMA 2IBMA 2AZ4A 1L1FA 2ESRA 3WG9A 2CSXA 3W5DA 4A0QA 3FDIA 4BV2A 2OV8A 1DCKA 4GVPA 4MHSA 1XLUA 3B5IA 3D8HA 3IBGA 1T8UA 3NOVA 1UBEA 3A11A 1ORIA 1TYAE 1WXEA 2ATVA 2BGJA 5MN5A 1GAWA 3QJGA 1YZYA 4RZQA 4B3XA 4N12A 4DY6A 1UFKA 1S2MA 2XRMA 1SKQA 3JVDA 4FJ1A 3RRYA 4AXXA 3GDFA 3LCVB 3OQIA 1BXGA 1RYBA 2Y0PA 5T5QA 1VG1A 1BD3A 4H7PA 5KAMA 1REQA 1F8XA 1FLDA 3HA3A 1LKZA 1K9VF 3U80A 3M4NA 4M1WA 5CVTA 1E69A 3E05A 1EK0A 2D2FA 4UC0A 1NVAA 1RT9A 4MCJA 3ANTA 1P39A 1RIIA 2GCGA 3ZX5A 1P2VA 3RH0A 3LWDA 5FFMA 5CXQA 3FMOB 1C5KA 2PIDA 2UVPA 2ZSDA 4KDRA 4KPUB 3EGDA 3VDQA 4AFNA 4CM8A 1P2SA 3AINA 1QRSA 1OC2A 1ZD1A 4MITA 3UA3A 2PXAA 2ZATA 2GF0A 1N9GB 4QBFA 1G7RA 1EX6A 5EJFA 1LX7A 4UTRA 3RFFA 1W5FA 3BJMA 4GC5A 2Z04A 4HQOA 1VHTA 2XCOA 4UQPA 2YZ2A 2JF0A 1CLUA 2JBHA 4Z8YA 5KB3A 1ZJ5A 3OF3A 1NNSA 3WGKA 3QJ5A 2GZAA 3FCCA 1X1BA 2YWFA 1U7OA 1GDDA 2FZVA 2SKEA 3I9KA 4GR4A 5AKJA 3HWSA 5BNIA 2O4UX 1T91A 2YNMC 2XZDA 3LAWA 4UEJA 2B83A 2JFWA 2X9QA 4QASA 1O58A 4QBGB 1I14A 4BY9E 4UJ5A 4ADSG 1F9AA 2XOXA 2PVSA 1DAIA 2O8EA 1YRYE 4ZCPA 3KSRA 2WHXA 4UOQA 3KZCA 1DJQA 4DLYA 3JQFC 3GLIA 1JFFA 3VDXA 4F9FA 3WLNA 1SY7A 3VJKA 4REMA 2ZRDA 3EWNA 5LOVA 5TQ0A 1C8KA 3CBGA 4I4TA 4PW0A 4OHKA 5HQ3B 3W04A 3HPQA 4BMOB 2PRSA 4HN2A 3W4IA 2QGFA 4CW7A 4D0RA 4EY7A 1A4UA 2PMDA 3CTMA 3MAJA 3LE8A 3ZI7A 4WCFC 3UFXB 1GKIA 3WGZA 1V8DA 3ZJTA 2H2HA 3QHQA 4ZOCA 1SVKA 3VR2D 5ITZB 5ICSA 4FYVA 3DAYA 1YDHA 5CA0A 4J3FA 3ZWYA 2V8BA 3CYFA 3KEFA 4QSMA 3EVZA 1QDLB 1VBNA 4WMLA 3AM4A 1EVJA 4JWKA 3DGEC 1GKLA 4Y6SA 4DG5A 2XNKA 4IVNA 3AUUA 3EUAA 4RCYA 2CJPA 3QXGA 5FV7A 3WNZA 2OCKA 5HQTA 3K09C 5EHQA 4WBNA 4K46A 3BE6A 4IIJF 4IJWA 5C8YA 2GO1A 2P9CA 2Z5FA 2G25A 2CEAA 4OQEA 3FWHA 4RGQA 4Z0HO 3R5HA 3UTDA 5BOSA 3PHJA 3GFFA 4U9UA 4ZYTA 3N87A 4XWGA 4B6RA 2JK1A 3IT2A 2JDID 3RRJA 1R3DA 3Q7QA 1V71A 1PGOA 4B6JA 1EXNA 3DDSA 4I8DA 3RYIB 4DW8A 1GQSA 3ZZ0A 4TKVB 5IU6A 1W0JA 1OXSC 5CDGA 1THGA 1RWWA 2QXTA 4HDSA 4M9RA 1D2RA 4RV9A 2Q9UA 1KFEB 4CM9D 3IP6A 2C3UA 2ILVA 1T9HA 2HV9A 4HMOA 3V00A 4KX3A 1OT3A 4DV5B 1VYTA 2FUKA 3WWOA 2AD5A 3CZ4A 5EESA 4GDMA 4OFXA 3MJHA 4RMHA 4BQPA 5I7EA 3ZTYA 1PR4A 4PPGA 1LDMA 2W71A 3U44B 1EVLA 1ZK3A 1LWOA 3MJCA 3DP9A 4MKFA 4OBWA 2W2NA 4RHFA 1M2GA 2PMCA 1AKYA 1GPDG 2ZRMA 1UDWA 3LJKA 1QK3A 4HQNA 4AYWA 4P7KA 5LLDA 2F3PA 2BH2A 1P0PA 5JS2A 4UVDA 4UM9B 2XCTB 3ODGA 2HA6A 1GQRA 1JR3A 1CUXA 1H2XA 5FTWA 3DR3A 1KI2A 3ZJVA 4RESA 1X8KA 4P3XA 1ZD9A 5HILA 3TCKA 3UMBA 3ZWXA 3R44A 2A57A 3OIFA 4D8WA 1FCJA 1DC7A 3N58A 4N9QA 5C5CA 3QVMA 2E7ZA 4WKCA 1IJEA 2D8AA 3IALA 2AL7A 1YIDA 4ND8A 5CFNA 4RBNA 3HCEA 1QPZA 3R1IA 3OHSX 1QUFA 3FZNA 3DKVA 4JJEA 2UUBB 2PIAA 1P6QA 1V5FA 2RDMA 2OPHA 4B33A 4A6EA 4ZU3A 4XI9A 1X2EA 2BI4A 5B64A 2P0YA 5CFPA 3CSSA 5K0GA 2KE5A 1JIVA 4TMFA 5JSQA 4BKUA 4P83A 4CG3A 1B6TA 1LUAA 3AEQB 2BM9A 2OORA 5JASA 1XFDA 1RI5A 2VNSA 2TECE 2FW6A 1P6UA 5AJTA 2BFCB 3BSFA 3F74A 1OI2A 1T3LA 2E4XA 1IB0A 2EL9A 3QUSA 3ZEIA 1ZIYA 3WGYA 4KPEC 3RYCA 5FTMA 1T0JB 4BQSA 2G9UA 4TL7A 4ZOLF 4NAUA 3OCYA 2XCQA 4L0MA 2IY9A 3S2IA 1Q7BA 1K7YA 4R7TA 3CGWA 3MMZA 3AYXB 5HA5A 2QVZX 3FUVA 4KOAA 1Z8FA 2DWUA 2NUPB 2W6CX 3B6ZA 1GA6A 3REGA 1NVEA 5KUTA 2WTUA 5CB6A 4NBNA 3MRTA 1ZGGA 1S7GA 5CTJA 1KJIA 4K6GA 3GZ4A 1XNJA 4RGBA 3RYTC 1JPUA 3N2GB 3V48A 2G8LA 2YINC 4O5OA 1G4HA 4MV7A 3UMVA 2EYQA 1ZXLA 3JQPA 1Q1NA 3KWLA 2NU8A 3BAFA 2XF8A 4G4SP 4J16A 3BHMA 3K0FB 5TS3A 3AFIA 1NXPA 4ZT4A 2V4MA 5K0NA 4NQZA 4W5WA 3TGLA 3HK2A 1NMEA 4Q47A 4Y3UA 1M1NB 5ALYA 1JLLB 1Y4ZA 3QFCA 1TJPB 2ZJ0A 5I9IA 4IUDS 4MVXA 2YHUA 3I4FA 5G1PA 3E03A 1S2GA 4EUNA 4LA4A 4A27A 1JQEA 5A3RA 4QWWA 4F3TA 2CNOA 5F98A 2OFOA 4Z9BA 4MRMB 3HCBA 5CDHA 4BLUA 1YMQA 4QEDA 3P9SA 3UHJA 5LL6P 4QTUB 2Z56A 4YCCA 2F62A 3I62A 1Z26A 1E2LA 3OUUA 1AQYA 1LPOA 3EVEA 4GR5A 1TADA 2I76A 4J0CA 1BGVA 3H2KA 3HJFA 2BI8A 4G36A 3RAGA 3WGOA 2H17A 1CDZA 1T5DX 1VGVA 1K6XA 2G67A 3VKUA 3ZU2A 4W9NA 1F2TA 4EMTA 4BGIA 4Y6LA 1PGJA 4IIHA 1PZGA 3WGUA 3EA5A 1LK5A 4RZ3A 2DSTA 4ZO7A 3ZE8A 5LQSA 4CQNA 4PEVA 3ZDQA 2XUGA 4ZCMA 4LF9B 2UDPA 1FYWA 1QIFA 2ZS7A 4RVGA 3WLAA 4ENTA 1HDIA 1QG2A 4O1MA 1RDFA 5K3BA 3ETHA 1FRFS 2PSEA 3DZ8A 4FGZA 1Q92A 3SKVA 1B3RA 2HMTA 1PD0A 4TL8A 1F4LA 1G63A 2CVPA 5I4CA 3GLGE 4UNIA 3GGGA 2FDRA 3EH1A 3INRA 1L4BA 2A1TR 1FP2A 5FFFA 4ENWA 3D64A 4RANA 4TS4A 4DUYB 2BBOA 2EX4A 1J99A 3VH3A 7MDHA 3EFBA 4O4JB 1BDBA 1PG0A 2C4VA 4B44A 3ZDEA 1IHDA 2HSWA 5CGZA 5HJEA 3H2JA 4ZOAA 2Q28A 3KOXA 1PR5A 2IP2A 2YJ4A 3HACA 3PUWA 1NKTA 3DDNA 3F8TA 4OXYA 4R4JA 5DASA 2WFAA 5HIKA 1IEVA 3GPIA 5CU7A 4Z9XA 5I7VA 3VPFA 1P9LA 2JVJA 2JHGA 2QVCA 3FPFA 3NCTA 4MV3A 3TB4A 1NV9A 3UWKA 2IY8A 3DT6A 1OI3A 1T5IA 5BV2P 5LPNA 3AOGA 3KKEA 4WW0A 4NE9A 1JH8A 2G1PA 1CRQA 4ERNA 4B3TB 3UUGA 4ZKEA 3AHDA 1CCWA 2PLRA 3PDHA 4HYTA 5L45A 3C16C 2VNHA 4PXSA 3BAZA 4IAOA 3LG2A 4WUVA 4YV7A 4C0AC 4IOKA 1O7JA 4MVJD 1AIPA 1BH6A 3B12A 4R5MA 3QKWA 5ALDA 4YRLA 1J8YF 2BKUA 2CLCX 3MFYA 5CNIA 4B48A 2PJUA 4Z1MA 3KVYA 1L5MA 1OXTA 4HNSA 4BZWA 2NTYC 3BORA 1RM5A 4B74A 1EAYA 5SV2A 1ONPA 5DLYA 5A6SB 1DTSA 4JXZA