2L1AA

Solution nmr structure of the n-terminal gtpase-like domain of dictyostelium discoideum fomin c
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GAHMGGSMKIRVELINGNEHRTSSTPQQPQQNPSVSHIFDGETAVKDHIKVLLTHFKIPVDKVSSYALQNPFTLAYVEDSFLTPERLVEAEKSYFILRMKPHAIADR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formin-C
publication title Structure, dynamics, lipid binding, and physiological relevance of the putative GTPase-binding domain of Dictyostelium formin C.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin binding protein
total genus 22
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2010-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.530 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2l1aA00
2L1AA
chains in the Genus database with same CATH superfamily
3AE2B 3MC0B 3RCZA 1U4AA 3VRAB 1J19A 1DGJA 4KGRA 3P4SB 3ZIMA 4IM2A 2O6VB 3W9CB 1S1QB 3PVLA 3DVGX 1AARA 1HEZE 1QT9A 2G3QB 4PK1A 1GOZA 3AE7B 2KWVB 2ZJDA 2AQ2B 1TY2A 3PTFC 2NBVB 4OVUA 1YN3A 2ZNVB 2LWPA 2LGDA 2L0TA 2FIDA 3VUXA 1D6EC 3QHTA 2JSVX 2IPKD 1LO5D 3V05A 2Z0EB 2JZZA 4OW0A 1TTNA 3A9KB 3MC8A 2L32A 4W9JA 1H4RA 4NPNA 5TR5A 4ANVA 2XNAC 4KSLC 4BKTA 3QX1A 2KWDA 3A4SC 1SE2A 4KDIC 5D94A 3R7RA 1CK1A 5BYSA 3BZDB 2MJDA 5J18A 5FR3A 2O2VA 5C23A 3B1LX 4NY0A 2WXOA 3RT3B 1E90A 1Y56A 2R2QA 1GB4A 4HDQA 4IKGA 3N9YC 2W3RA 1MHXA 1M94A 4WJPA 1F2RI 3RMKC 1J0GA 5LNK1 4HJKA 1YQBA 3GZNI 3V6CB 4TMAB 4E3CA 2M8SA 1R7SA 3IAS1 1WJ6A 3KW5B 2LD9A 4NJCA 4GDLA 2JWUA 4TV3A 4K3CA 2JXTA 3AEEB 1ZE3D 4HKZE 3Q8EA 2XEWA 1JQ4A 2GMIC 3Q6BA 1BMLC 3ML8A 3BVZA 1PGAA 5C1ZA 4GGQA 2B76B 1AYFA 1WJUA 2KANA 5L95C 1Q5WB 3AH7A 2KLCA 1WX7A 3A33B 1I42A 1J7AA 4BOSC 2JRIB 3A1QA 1KLUD 3CMMB 3P4PB 3B08A 4EEWA 3NVWA 2BTEA 3KH0A 4KZCA 1VR9A 3QIJA 2LEKA 1DOIA 3V61A 2CR5A 3WAPA 3WANA 2DAFA 4ANUA 2IYDB 4CYEA 4FHJA 3KUDB 3ML9A 1J7CA 3ZQ4A 2M17A 1TS3A 3L54A 2DYOA 1JMLA 5KHQA 3PSEB 3OG5A 2FCMA 3BK1A 5IA7A 2WXLA 1E7VA 2C5LC 5H8YE 5FR6A 1N6ZA 4RGMA 3KVFB 3U4EG 2WXFA 1F1HA 3BYTB 3DVNU 4MJSB 3M3JA 5EE3A 1XF5L 1E8WA 4GOCA 3EA6A 2PLPA 2LASA 4GMVA 1OFFA 1WMHB 2G1EA 2WU5B 2X38A 4GU2A 2TSSA 4XZ4A 1R4NB 1PYWD 1N61A 4ARIA 1WI0A 2CJOA 1UWXA 3Q3MC 1JROA 3JSVB 1LXDA 3FILA 4GIVA 3SHQA 3Q2AC 3WCQA 2K8CA 3P4QB 4EFOA 4XWTA 1OQQA 4W9KA 5BO4B 1L2NA 4DHZE 1TS4A 2SEBD 3NG0A 4EZLA 2QEJC 4TKNA 4A3OA 3IT4B 2DWQA 2RMMA 1PUTA 1SJED 1TKYA 3PO0A 4AQ7A 2MBOA 4MDKE 1QZEA 4C00A 1ET9A 2DZJA 1WF9A 4RM9A 4WURA 3ZJTA 4BAXA 4FA6A 2PVGC 2FE8A 1K51A 1WE7A 1T6BX 5HG2A 1L5PA 1VZ8A 1KF6B 2FCNA 4RH6A 2KFJA 4W9EA 2MQJA 2INPE 2WDVB 1FCCC 1WGRA 5FKAC 3IT6B 3NJTA 4HKQA 2GBJA 5DCNA 1WZ3A 3QCAA 1UGJA 2IGGA 2KDEB 3HUIA 3RNAC 2LVQA 3OJ4B 2Z59B 3VTWA 3QAQA 3PT2B 2HTHA 2L05A 3MC9A 4W9HA 4W9DA 3PREA 4G0NB 2BF8B 2KQ7A 1MG8A 3B9JA 1F9JA 4C4VB 4A20A 1NYQA 1P9DU 2MLBA 1TYGB 2CU3A 4KZ0A 2LVOA 4GSWA 3A4RA 3L17A 1WYGA 2HJ1A 4LLGM 3AE4B 4ZDVA 3ZNZB 1MI0A 1YOVB 3PPAA 3NZUA 2W55A 3MTNB 4ACFA 2J52A 2M1MA 4XYCA 1OQRA 3T3OA 2IDYA 2MP2A 4MT5A 2D3CA 3U7DA 2ZW1A 5E6PA 5EDSA 1I4HA 1YMHE 1XCQL 1KTKA 1Q1OA 2N9LA 3N1ZC 3W1SA 3C19A 4HPLB 4IM0A 2ACZB 2H89B 1E9MA 4W9LA 5JH5C 3V6EB 1T0SC 1FFUA 2WDQB 1JWUD 1YQ3B 4IOIE 5CHWA 4I6LB 3W1YA 3TJPA 3RULA 4NJ7A 2KTRB 2KTFA 2BYFA 3RNFC 4NZLB 2KDMA 1YN5A 4YSYB 3AE5B 2GBKA 1WXMA 3QQ8B 2G45B 3K9OB 2JQRB 4YT0B 3RI7C 2FNJB 4F1SA 2PE6B 4RMAA 1BT0A 2Z0DB 1SE9A 5BYRA 4MGZE 1WXVA 2WXKA 2IGHA 2K8BA 1YJIA 3KQ4A 2WHIA 4LTUA 1UUPA 4P16A 3K9PB 1WJNA 1V97A 4ZYNA 5DPWA 1L4DB 2KVRA 4A9AA 5AZFA 2IJ0A 1WX9A 3N1XC 2D5GA 3NUHB 4YTNB 2KOXA 3PRPB 3EFUA 1K8RB 1ENFA 5CHFA 3SDLC 3IFWB 2WWZA 3SR6A 1HXYD 3AE9B 3T9LA 3UGBB 2HDEA 4BVUC 4HK2A 2KFKA 2RPVA 4EOYA 3ZTCA 2IO2B 1UWMA 1YIWA 2LUMA 3P63A 4MSQB 4AP4C 3U30A 5DPRA 2LUEA 1HZ6A 3RNEC 4CQNA 3T3NA 2DAJA 2K8HA 1AN8A 3RFZB 4UDUC 1OTRB 1KJTA 3WAOA 2LGYA 2WU2B 4K81A 3R3MA 3L0WB 1MHHE 5L83A 1T0RC 4HEA1 2FUHB 3HVZA 4JL9A 1PDXA 4A55A 1P1AA 3ECIA 3EHVA 1DYQA 1KRHA 5TSSA 4KVGB 4EUTA 1TIFA 2A5UA 3R8BA 1C4CA 4TQ0A 2L76A 3DBRI 4BFRA 2L52A 2MRPA 2MWSB 1UZXB 1V81A 4ZRPA 2GB1A 3BVMA 4BKGA 3GB1A 1UGMA 1Y8RC 1R4MB 3SD5A 1ROEA 1L4ZB 1C76A 3AM9A 3NVVA 4W9IA 3VQIA 2OOBB 4M0WA 1L6VA 4K7UA 3BVGA 1FXIA 1TS5A 4M01A 2PJHA 2Z8LA 3ABVB 1ZUD2 2IZVB 1E7PB 4PYUA 2RPQA 4ICUA 2KMMA 4XX5A 1J7BA 1MFWA 2KN5A 2JX5A 3Q3FA 3ZRCA 3PV1A 3VUWA 2ZZPB 2REXA 4ZYSA 4XDCA 2Y3AA 3GP7A 2HJ8A 4WQMA 2O6VA 3LYYA 3MHZA 4P6VF 2R61A 4KSKC 1ESFA 3N3KB 4MGIE 2MBHA 3DQVA 3DWGC 3AN1A 4WIPA 2LMCA 1ZGUB 2N9EB 1E10A 4DDID 3LDZE 3UIOB 3IXSA 1RRBA 3TEWA 4BBNC 3CWIA 2QIEB 1L6UA 3NVZA 1ZP0B 2HTME 4ZRKA 1LQBA 3MJ5A 3R2TA 5J2RA 1V1PA 1VCBA 1QOAA 2V3NA 2GLSA 1WFYA 2NR2A 1C1YB 3J9CA 4KKJA 3AE8B 4Q2JA 2I2YA 3VH4B 2WLBA 1Z5SB 1IBXA 2JY6A 1YN4A 2V4IB 2CS4A 3Q14C 2BB6A 4QAYA 1Z2MA 3N32A 4ZHPA 3LXFA 3KYDD 4WWPA 2L0FA 1QKZA 1L0XB 4G3XB 4NAWA 3L08A 2D3GA 1FMAD 4WWOA 1WXAA 4GN1A 1FRRA 1WWTA 4HCNB 2PKOA 3DVNV 2K6QA 4BOZB 3PS6A 3HVDA 3R2IA 4ANWA 3DBSA 5AZHA 1L7YA 1IP9A 2ASQA 3TEZA 2RR9A 2MA9B 3FC4A 1F52A 3ZNGC 3M63B 3L16A 4O1NA 3TEXA 1A5RA 2HE7A 1C79A 3BYYB 2B3AA 2ZNVC 1ZW7A 3R7QA 3SEBA 4KGSA 2MJ3A 2MW5A 2MCNB 1TT5B 2D10A 2N9PC 3W2DA 1T0YA 4OVVA 1N62A 2NBWB 4MACA 4RF0A 2QC8A 3FKYA 2MBEA 2O2VB 1GC6A 2RSUA 4RM8A 1QOBA 2L83A 4WJQA 1UD7A 5IKCM 3AEDB 1JRPA 1R4MI 3X23A 4XE0A 3CF6E 1RFAA 4LJOB 2KWUB 2E3TA 2DNFA 2KC2A 2R2OA 4P1BC 2IGDA 2LRUA 3A9JA 4FJYA 3ENEA 4HRSA 1UBQA 2KO3A 3CIRB 4HDOA 3NHEB 2W54A 2NTSA 4KIKA 5G5HA 4F8CB 4J3OD 3VAWA 3U7ZA 2ON8A 3NRZA 3N1YC 1KOTA 5MPOA 4NAMA 2EKEC 1ZDXA 4NQLB 4PYZA 4B6WA 2AX5A 2OHFA 2WP9B 3AMZA 3TUOA 2LJ5A 2CJNA 1J8CA 2IO3B 1L0YB 4HPMB 3RN9C 3HIZA 2L7RA 3C0RB 4LDTD 4JWUC 1EU3A 3IG3A 3X0WA 2KJRA 2BS2B 3GS2A 3WAMA 1CQVA 2N7EA 1HA5A 4DQOC 2M0XA 3A1QB 4FJVB 4YTMB 2UU7A 1WM2A 4NQKE 2DX5B 2C9WB 5IOIA 2N0SB 2INNE 2M4NA 3HM3A 4C80A 4ZOHC 1UBIA 5IN7A 1BUIC 1I35A 1FNVA 1MG4A 2ZW0A 2LVPA 1FNUA 2PPHA 2J4XA 4K1RB 3ZNHB 2KHWB 1IGDA 3T8MA 1C78A 1WM3A 3OAWA 1Q0WB 3Q8CA 2BYTA 2WNMA 1SBBB 5G5GA 3VXWA 2WDTB 3L13A 1JCKB 3PZDA 1YJ1A 1HQRD 1N5WA 1TZOA 1GAQB 4TUUA 2V0GA 1V9JA 1X1MA 2FIFA 2BGFA 2NPTA 4TSSA 1HE8A 1OQYA 3W5VB 4G50A 3GOEA 5HKHA 3VR8B 4II2B 4M02A 2NMQA 1UNSA 5E6OA 1D3ZA 1XT9B 3FILB 3TL5A 4GDKB 2KXJA 1NDDA 2AL6A 4N59A 3R66C 4A90A 2INDC 2DYBA 2WXJA 2KX0A 1C4AA 2BWFA 5AUIA 4IUMB 2AYOB 2N9KA 3IAM1 3H7PA 3SU8X 3Q69A 3VTVA 4L2YA 1FFVA 2BPSA 4EKUA 1VD2A 3O65B 1C3TA 3HK0A 1K50A 3B2FA 4I6NB 1YX5B 2KT7A 2BQQA 2KAJA 3VH3B 1H8CA 1FXTB 2KMCA 1XCTL 1V6EA 4CHKA 1TJEA 3AU4A 4LCDE 1JRUA 2CU1A 2ZCCA 4LJPB 5BYQA 2RD0A 5H92C 1RLFA 1T0QC 3ALBA 3O13A 2JF5A 3LB8C 2DZMA 2FBWB 2V3PA 3EFCA 2KZRA 3I9V1 4M00A 1TGZB 2L3ZA 2IY0B 2QSDA 4BKSA 3PZ8A 3GE3C 2MBQA 4ZRIA 3V62A 2KDIA 5JZEB 2NCNA 3FAHA 4RGOS 3ZTDA 3KUCB 1LGRA 1QLBB 3H7SA 1ZDVA 4YL8A 2HD5B 4XDDA 2M19A 2KJHB 4OHJA 1FCLA 2MHJA 1XD3B 3CSTA 3MP9A 4RGNA 4JX1C 1PFDA 2J0JA 3DHGC 4FADA 1PQSA 4DBGA 2MX2A 4FJZA 4HJGE 2FUG1 1RAXA 4AJWA 2XK5A 1C77A 4REZA 5LXIB 1E8YA 1XLQA 2BVCA 5CX3A 5C2TB 1OGWA 1YNTE 2MSED 4LNNA 1XLNA 2KDFB 2BS4B 5D6JB 3QK0A 3KWVA 4MSMB 3ZGZA 2NS5A 3MFGA 1V86A 4KV2A 1R4NI 2DBYA 2QDFA 3C8YA 4X57B 1EUVB 4B0MA 4L1BA 2M0AA 2W3SA 1WGDA 2DYMA 5T8IA 5AUKA 2PEAA 4MELA 4US9A 4NNJB 2JT4B 1NI2A 3URYA 5D3IB 1EF1A 4M8NA 3EC8A 2V9HA 2JXXA 2ONQA 3DBHB 4DHJB 2W9NA 4GB9A 3DBLB 2CHXA 3ZLZA 1S3SG 1ZKHA 2QCZA 4W9CA 2K3UA 3TSSA 1PGBA 2N9XA 2MH7A 4DK5A 4JQWC 2G4DB 2K39A 2KMAA 4S17A 2H88B 4YTPB 2MBBB 2EKIA 2J0KA 1SE3A 3APFA 3RNCC 4EE2A 4WH4A 1TBEA 4ANXA 2XBBC 1P7EA 4YSZB 4DXAB 1GG3A 3H1UA 2Y5PA 1EF5A 2K6DB 4IWOA 1WGKA 2JZPA 4KKIA 4HVBA 1OEYA 2LI5A 1MVKA 2EMTA 2KC1A 3WA0A 2RDBC 3U2SC 2V3SA 1TY0A 1ISNA 3HHMA 2NVUI 1C9FA 1WR6E 1VJKA 3NOBA 4MM3A 2I1KA 4BZAA 1WRDB 4ZRQA 3TEYA 2KD0A 3ZUNA 2NTTA 3AXCA 2L1AA 1XXGA 4A3PA 2W82A 3P1MA 2C60A 1XEEA 1RFKA 3BIID 1FEHA 2GBNA 1E8XA 1ZOYB 3MHSD 2ZPYA 2MEKA 3KUZA 3UQAA 3Q3NC 2EELA 4FHKA 2YLMA 1GNUA 2GI9A 4B95A 3RYTA 2AEHA 3H9DA 1HZ5A 4LNKA 3UINB 3WIMA 2DHZA 3CSFA 3Q8BA 4BBNF 1EWYC 3B2GA 4MH8A 1V49A 1T5XD 3OLMD 1CZPA 1QOGA 2CHZA 5AZGA 1EM7A 4PS3A 4FLHA 3TBLD 1N63A 2LJIA 4HCPB 3DCGA 1JWBD 1NI3A 4AS1A 5G55A 1NVID 4N6EB 4USAA 3WALA 2DLBA 3OJ3A 2ZVOA 1AWDA 1FNWA 1KH0A 3TIXA 1WXSA 3DWMA 4OZBA 1MJDA 3NVYA 2PE9A 1D5MC 4K7WA 1N60A 3I5JC 4IWPA 5HI1A 1EWCA 1YJJA 1G6JA 4WWMA 2A4ZA 4LDTB 1SEBD 4AOFA 2QMTA 4LNIA 4DHJD 2FAZA 4JGHB 1ZXHA 2L8JA 2WXQA 1TS2A 2WXHA 4AJYB 3IBEA 3A9KA 2M56B 3P42A 1ZXIA 2LHEA 1WE6A 3I57A 4G11A 3AEBB 2VZKD 4EZKA 1HTOA 1FPYA 3DHHC 3DBHI 2Y5CA 3QARA 3DBLI 5G2NA 4WJNA 4MGYE 2IO0B 3RNGC 4A8XC 3KYCD 3RZWC 1V1PB 4FULA 3VDZA 2XN9C 2GBRA 2WXNA 3RPFC 4HROA 4S0RA 3L4PA 1IBXB 1K53A 2DENB 4IG7B 2OJWA 4RFBA 4ZRJA 3VUYA 2YEPB 2I1JA 2WXGA 3QJZA 1ZPSA 1B9RA 3Q3JA 3H6NA 2YEPF 1E7UA 3VVWB 1D4BA 2K22A 2E6XA 2WXMA 4GXBA 3ZNID 1E6EB 1SJHD 4NAWB 3RUIB 4JPSA 4IDIA 2ICIA 3BINA 1SF0A 5I4DA 3HRDD 2KQSA 1I7HA 2VH1A 2LGXA 1UH6A 1WGYA 1P0RA 3AE3B 5EE0A 2VRRB 2BB5A 4WJOA 2Y5BB 1JW9D 2G9HD 4F7ZA 1D5ZC 2CKHB 2BYEA 1VDVA 2EMSA 1WX8A 1STEA 3RNBC 1UF0A 4N58A 1GPXA 2AL3A 4OZCA 4ICVA 5EE1A 4DWFA 3ZYYX 1NBFC 2AQ3B 3ZXVA 3I63C 4PS7A 1V80A 5BMIA 1TZ1A 5D7GA 3EUB2 1YD8U 4W9FA 4GDLB 1JWAD 4E71A 2KKCA 2WX1A 4AWJA 2WQYB 1EU4A 4XC2A 4M8MA 3AE6B 3I3TB 2GBMA 2WGSA 3QC8B 1WR1A 1VLBA 4ZHOA 3N30A 5D3DA 1FIQA 4II3B 5DPTA 1GJZA 5AEKB 2Q5WD 3Q3OC 1KLVA 2JU6X 4US8A 2PW9A 1JALA 4FBJB 1TKEA 4W9GA 1C4PA 1IGCA 4J6IA 3A9JB 2KWCA 2J42A 4MJSA 4LNFA 5IO9A 2O6VD 2LXCA 3ZJVA 1FRDA 4B0EA 4KIKB 3E9SA 4AUQC 1P3QU 2GRIA 4C7ZA 1N5XA 1P98A 3TCAA 2SAKA 4JE3B 1I4RA 1WMHA 3DHIC 3EGRA 4WQOB 2JYEA 2WYQA 2J0MA 4ARCA 3B0AA 3NS8A 3JSVA 4ASWC 2X8XX 4N9F4 1B1ZA 2NBUA 4C7YA 1WH3A 3ZVVA 4K3BA 4TQ1A 1FXAA 2KLGA 2PVOD 3P4RB 1VZ6A 4JWSC 3S2AA 1YQ4B 3IVFA 4MH0E 2ZVNA 2KX3A 4GLSC 2V1YA 1CMXB 2RDHA 1SXTA 4PT5A 3N20C 3VRBB 1V5OA 2C7NB 1WZ0A 4WAFA 4GDKA 2D3BA 2PTLA 1GB1A 2ZEQA 3DDCB 3ZRFA 2LHDA 4PS8A 1D5XC 1M4VA 2K1FA 2UWQA 2GOWA 3NZ3A 4K7SA 2BBCA 3BWUD 4DHZB 5FK9C 3PRZA 1MPEA 1FM0D 4DDGD 5IAAC 3ZDMC 1NENB 1XLPA 3EECA 2JZ3B 4KX6B 4P1CC 5GXGB 4WWNA 3PZ7A 5KHOA 2ZCBA 4IM3A 4E74A 1WJ4A 3ZDTA 2K25A 4YXDB 2NPTB 3SFEB 3MJWA 5GMVA 3BK2A 4C4VA 4KGTA 3JW0X 3AB5A 1XQQA 3PHWB 1WYWB 1KFYB 1F0ZA 2JWZA 1ACCA 1KM7A 3APCA 3AEFB 2INCC 2OEDA 3V60A 4IW0A 2D2QA 4URKA 3PHXB 1PGXA 3UF8A 3UIPB 4RGTA 1GC7A 2PMVA 5DPSA 3H7PB 1QF6A 1I4GA 3AU5A 1AW7A 2D07B 1E5WA 3DBRB 2I38A 2LFIA 5BMGA 3H8HA 3AULA 1XLOA 4DXFA 1TKGA 1E0ZA 2DZKA 2WS3B 5BMHA 2MJEA 4L23A 1JWMD 2C7MB 2CHWA 2KK8A 4D2KA 5LXHA 4IC7B 2ZPNA 2BS3B 2BKFA 2LXAA 4FXCA 1QILA 2LZ6A 4XWWA 4C56C 4LNOA 3ZKJC 4A6QA 2RDGA 3Q8AA 1IYFA 1JWSD 2BYVE 1RYJA 5JHAA 3AECB 1IPGA 2KTRA 3NY5A 3VHTC 5JXVA 3ZJUA 1YX6B 1K52A 2KNBA 2K5PA 2LGIA 3NS1A 4YWGG 3KWLA 2UYZB 2KDBA 1DOXA 3LJ3A 3IHPC 2MP2B 3AEAB 3RD2A 1NYRA 4YSXB 3DPDA 2QILA 2K9XA 2WXIA 2JYTA 1WY8A 5D2MB 4FN2A 1WRIA 3PLVA 3GE8C 2JRHA 4CO7A 1LM8B 1T3QA 1DOYA 4H2AA 3VR9B 2LGSA 2D11A 2KVZA 3M95A 1V2YA 2C7HA 2J53A 3PLUA 2V4LA 2J7QB 3ZXRA 2XK5B 1NEKB 2JUOA 1VZ7A 1QOFA 4JIOU 2AQ1B 1L0VB 1WIAA 3AEGB 4HLEA 1QQRA 2FCQA 4MEMA 1RM6C 2WDRB 2YVCA 1I4PA 4NJ6A 4RNAA 1A70A 2VH2A 3JYUA 2N4FA 2VZKB 3SFDB 4B9KA 1E8ZA 1WSPA 3U52E 2KN4A 2N7JA 4OVZA 4HWIB 2BKRB 2JVCA 1V5TA 3U8ZA 5CHVC 1UELA 4I6PA 4OZAA 5J17A 3ZO5B 2L00B 4WAAA 1SIFA 1I4XA 3W1SC 5HHDG 3QWZB 5LLIA 3UQBA 5IP4D 1CJEA 2D3AA 4RF1A 4LK0M 3AE1B 2FCSA 2JPHA 4XGAB 5C3JB 3W5UB 4EZJA 3M62B 2IO1B 1P7FA 4P7IA 2KFKB 2K0PA 1OEYJ 1XO3A 2BW2A 3RZFA 2WXRA 5E6NA 4R3DA 1IUEA 4HPPA 3E56A 2AWTA 3PRMB 3DVGY 2PIAA 2WXPA 2RGFA 3ONSA 3L10B 4IWQA 3GZNB 1VRAB 2QHOA 3PGEA 2KJ6A 3P2BA 1I4QA 3VFKA 3AI5A 2IY1B 2LRWA 5HFYA 1FO4A 2WX0A 3TMPB 1LFDA 2IBIB 4ITKA 3D32A 3QA8A 1BXTA 5CTRC 2OJRA 1Q10A 1SB3C 3NZSA 1WXQA 2KYWA 2DZIA 3AV8A 4BKSD 1FD6A 3HM6X 4MM3B 3V3XA 5EE9A 2N1WA 4HXDA 2BWES 2KQ4X 1WGGA 3BY4B 1KLGD 2BT6A 2N1VA 3Q8FA 3ZW3A 1V1OA 1SSNA 4KDLB 3DOWA 3APDA 5JHBA 1SGHA 3JVZX 1SE4A 3VTUA 1EO6A 3UI3A 3ETRA 1HTQA 2G4SA 5E6JA 1V8CA 4M0WB 4MGKE 4DXGA 1F2RC 1ET6A 4JLCA 2QJLA 1SIJA 3OWEB 1WGHA 2KACA 1GUAB 1F77A 3KLSX 4RCOA 2N7DA 1RWSA
chains in the Genus database with same CATH topology
3AE2B 3MC0B 1L4DB 3IAM1 4A9AA 2IJ0A 3Q69A 2D5GA 4L2YA 1FFVA 4GDLB 1JWAD 1K50A 3NUHB 3VRAB 3B2FA 1DGJA 4YTNB 2WQYB 1EU4A 4KGRA 3P4SB 1ENFA 3AE6B 2KAJA 3SR6A 3W9CB 1VLBA 1HXYD 4ZHOA 1XCTL 3AE9B 1TJEA 5D3DA 1HEZE 1QT9A 1FIQA 2Q5WD 2JU6X 2HDEA 2PW9A 1JALA 5BYQA 4US8A 1TKEA 1GOZA 3AE7B 5H92C 2RPVA 1C4PA 3O13A 1IGCA 2AQ2B 1TY2A 2J42A 3LB8C 1YN3A 1UWMA 2FBWB 3P63A 2LUMA 3ZJVA 2V3PA 1FRDA 3I9V1 4B0EA 1HZ6A 3E9SA 4CQNA 2GRIA 4C7ZA 2QSDA 1N5XA 1D6EC 3T3NA 2JSVX 2IPKD 1I4RA 1AN8A 2SAKA 4JE3B 3PZ8A 3RFZB 1LO5D 4UDUC 3EGRA 3V05A 2JYEA 2WU2B 4OW0A 1MHHE 4ARCA 3FAHA 4RGOS 2L32A 4HEA1 3HVZA 1PDXA 1QLBB 1B1ZA 2XNAC 4A55A 4C7YA 1ZDVA 1DYQA 1KRHA 4XDDA 2M19A 4TQ1A 1FXAA 5TSSA 2PVOD 4OHJA 1FCLA 3P4RB 3MP9A 4RGNA 3R8BA 1C4CA 4TQ0A 4JX1C 2KWDA 1VZ6A 4JWSC 1YQ4B 1SE2A 1PFDA 2L52A 4GLSC 1CK1A 5BYSA 2RDHA 3BZDB 2MJDA 1SXTA 4PT5A 4ZRPA 2GB1A 3BVMA 3VRBB 4HJGE 2FUG1 5FR3A 3GB1A 2WXOA 3EUB2 1ROEA 1Y56A 1L4ZB 1C76A 1C77A 3AM9A 3NVVA 1GB4A 4IKGA 3N9YC 4WAFA 3VQIA 2W3RA 4M0WA 1L6VA 4REZA 1MHXA 2PTLA 3BVGA 1GB1A 1FXIA 1TS5A 1F2RI 2LHDA 1XLQA 2Z8LA 1D5XC 3ABVB 1ZUD2 1YNTE 5C2TB 5LNK1 1M4VA 1XLNA 2BS4B 4TMAB 3NZ3A 2BBCA 3BWUD 1E7PB 3KWVA 3ZGZA 5FK9C 1MPEA 3MFGA 1R7SA 2KMMA 1FM0D 3IAS1 1J7BA 3C8YA 2DBYA 2JX5A 4B0MA 4L1BA 2M0AA 1NENB 2W3SA 1XLPA 4NJCA 2DYMA 2JWUA 4KX6B 5T8IA 4ZYSA 5GXGB 4XDCA 2Y3AA 3PZ7A 5AUKA 3GP7A 4US9A 2JXTA 3AEEB 4WQMA 1ZE3D 4HKZE 3Q8EA 3LYYA 3MHZA 4YXDB 1JQ4A 3URYA 5D3IB 4P6VF 2R61A 3SFEB 1BMLC 3BVZA 1PGAA 1ESFA 2ONQA 3DWGC 2B76B 3AN1A 1AYFA 3BK2A 4WIPA 4KGTA 3AB5A 2LMCA 1E10A 3AH7A 1KFYB 1F0ZA 2K3UA 3IXSA 3TEWA 3TSSA 1PGBA 3CWIA 2MH7A 1J7AA 1KLUD 2QIEB 1L6UA 3NVZA 1ZP0B 1ACCA 3P4PB 2H88B 4YTPB 3NVWA 2HTME 2EKIA 2BTEA 1SE3A 3AEFB 2OEDA 4EE2A 3MJ5A 3R2TA 4WH4A 1V1PA 1VR9A 1QOAA 2V3NA 1PGXA 4KKJA 3J9CA 2LEKA 1P7EA 4YSZB 1DOIA 4RGTA 3AE8B 4Q2JA 2PMVA 1QF6A 1I4GA 2I2YA 2WLBA 1IBXA 2Y5PA 1YN4A 1AW7A 2V4IB 2I38A 2LFIA 5BMGA 1WGKA 1J7CA 3H8HA 2BB6A 3ZQ4A 1TS3A 2JZPA 2DYOA 4ZHPA 1XLOA 4DXFA 1JMLA 1TKGA 3LXFA 4KKIA 1E0ZA 2WS3B 5BMHA 1MVKA 2MJEA 4L23A 3BK1A 1JWMD 1QKZA 2WXLA 4D2KA 1L0XB 3U2SC 5H8YE 1TY0A 2BS3B 1FMAD 4RGMA 3U4EG 1C9FA 4FXCA 1QILA 1FRRA 1VJKA 1WWTA 4C56C 2WXFA 4XWWA 2PKOA 3BYTB 4ZRQA 3TEYA 4A6QA 2NTTA 2RDGA 5EE3A 3Q8AA 1JWSD 1XF5L 1XXGA 2L1AA 3HVDA 3R2IA 1RYJA 2W82A 3EA6A 3P1MA 2PLPA 3AECB 1XEEA 1OFFA 1RFKA 3TEZA 2G1EA 2WU5B 5JXVA 2X38A 3ZJUA 3FC4A 2TSSA 3BIID 1K52A 1FEHA 2K5PA 1PYWD 2LGIA 3NS1A 1N61A 4ARIA 1ZOYB 4YWGG 2CJOA 1UWXA 2MEKA 4O1NA 3KWLA 1JROA 3FILA 3TEXA 1DOXA 2EELA 3AEAB 1C79A 3BYYB 3WCQA 3P4QB 1NYRA 2GI9A 4XWTA 4YSXB 1OQQA 2QILA 1HZ5A 1TS4A 2K9XA 2SEBD 2WXIA 2QEJC 2JYTA 3IT4B 3SEBA 2DWQA 3Q8BA 2RMMA 4KGSA 1PUTA 1WRIA 1SJED 2MJ3A 1EWYC 1TKYA 3B2GA 4MH8A 1T5XD 3PO0A 4AQ7A 1CZPA 1QOGA 1T3QA 1DOYA 4H2AA 3VR9B 1ET9A 3W2DA 1N62A 4MACA 4RF0A 1EM7A 4WURA 3ZJTA 2J53A 1N63A 2LJIA 1QOBA 2PVGC 2FE8A 2L83A 1NEKB 1K51A 1JWBD 1QOFA 1NI3A 1T6BX 1L5PA 1VZ7A 5HG2A 4AS1A 1NVID 2AQ1B 4N6EB 3AEDB 4USAA 1VZ8A 1KF6B 4RH6A 1L0VB 3AEGB 1JRPA 1QQRA 2DLBA 4XE0A 1AWDA 1FNWA 1KH0A 1RM6C 2INPE 2E3TA 2WDVB 1FCCC 3DWMA 4OZBA 2WDRB 1I4PA 2IGDA 5FKAC 4RNAA 4HRSA 3NVYA 3IT6B 3CIRB 1A70A 1D5MC 2W54A 4HKQA 2NTSA 1N60A 5HI1A 1EWCA 1YJJA 2VZKB 3SFDB 4WWMA 5G5HA 1SEBD 2QMTA 1WSPA 4J3OD 3U52E 3U7ZA 2KN4A 2N7JA 2ON8A 4OVZA 1UGJA 2IGGA 1ZXHA 2WXQA 3HUIA 1TS2A 3NRZA 2WXHA 5MPOA 4NAMA 1ZDXA 2AX5A 2OHFA 2WP9B 3AMZA 4OZAA 3TUOA 2CJNA 1L0YB 3B9JA 1I4XA 2M56B 3P42A 1ZXIA 2LHEA 3I57A 5HHDG 3AEBB 2VZKD 1NYQA 4JWUC 1EU3A 1CJEA 1TYGB 2CU3A 2BS2B 3GS2A 4RF1A 4LK0M 1WYGA 1CQVA 3AE1B 2Y5CA 1HA5A 4LLGM 5C3JB 3AE4B 4DQOC 1MI0A 3W5UB 2W55A 1P7FA 4YTMB 4A8XC 2J52A 2K0PA 1XO3A 2BW2A 2N0SB 2WXRA 4R3DA 1IUEA 1V1PB 3E56A 2INNE 1OQRA 2PIAA 2XN9C 4C80A 4ZOHC 2WXPA 3T3OA 2WXNA 3RPFC 4HROA 1BUIC 3L4PA 1IBXB 1K53A 1FNVA 2IDYA 2ZW0A 1VRAB 4MT5A 2ZW1A 4RFBA 1FNUA 2YEPB 1I4HA 1YMHE 2J4XA 1I4QA 2WXGA 1B9RA 1ZPSA 1XCQL 1KTKA 1FO4A 5HFYA 2YEPF 2N9LA 3W1SA 1D4BA 2K22A 1IGDA 2E6XA 2WXMA 1C78A 4ITKA 1E6EB 1SJHD 1BXTA 4NAWB 3Q8CA 2ACZB 2WNMA 1SBBB 2BYTA 1Q10A 1SB3C 1E9MA 2H89B 4JPSA 1WXQA 5G5GA 4IDIA 2ICIA 3AV8A 1JCKB 1FD6A 4MM3B 1FFUA 3V3XA 1SF0A 5I4DA 2WDQB 5EE9A 1JWUD 1HQRD 1N5WA 1TZOA 1GAQB 1YQ3B 3HRDD 4IOIE 2V0GA 1I7HA 2KQ4X 1KLGD 3AE3B 2BT6A 4TSSA 3Q8FA 1V1OA 5EE0A 1SSNA 4NZLB 2KDMA 1YN5A 4YSYB 3AE5B 3W5VB 2JQRB 2BB5A 3VR8B 2NMQA 1JW9D 1SE4A 4YT0B 1UNSA 2G9HD 3UI3A 3ETRA 1D5ZC 3FILB 1VDVA 1V8CA 5E6JA 4GDKB 1STEA 5BYRA 4DXGA 4N58A 1F2RC 1GPXA 4OZCA 1ET6A 4N59A 4A90A 2QJLA 2WXKA 1SIJA 2IGHA 5EE1A 2WXJA 1YJIA 2KACA 3KQ4A 3OWEB 3ZYYX 1F77A 1C4AA 2AQ3B 4LTUA 3KLSX 1UUPA 4P16A 4RCOA 5AUIA 1V97A 5BMIA 1RWSA 5D7GA 2N9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1A A; 
#chains in the Genus database with same CATH topology
 3AE2 B;  3MC0 B;  3RCZ A;  1U4A A;  3VRA B;  1J19 A;  1DGJ A;  4KGR A;  3P4S B;  3ZIM A;  4IM2 A;  2O6V B;  3W9C B;  1S1Q B;  3PVL A;  3DVG X;  1AAR A;  1HEZ E;  1QT9 A;  2G3Q B;  4PK1 A;  1GOZ A;  3AE7 B;  2KWV B;  2ZJD A;  2AQ2 B;  1TY2 A;  3PTF C;  2NBV B;  4OVU A;  1YN3 A;  2ZNV B;  2LWP A;  2LGD A;  2L0T A;  2FID A;  3VUX A;  1D6E C;  3QHT A;  2JSV X;  2IPK D;  1LO5 D;  3V05 A;  2Z0E B;  2JZZ A;  4OW0 A;  1TTN A;  3A9K B;  3MC8 A;  2L32 A;  4W9J A;  1H4R A;  4NPN A;  5TR5 A;  4ANV A;  2XNA C;  4KSL C;  4BKT A;  3QX1 A;  2KWD A;  3A4S C;  1SE2 A;  4KDI C;  5D94 A;  3R7R A;  1CK1 A;  5BYS A;  3BZD B;  2MJD A;  5J18 A;  5FR3 A;  2O2V A;  5C23 A;  3B1L X;  4NY0 A;  2WXO A;  3RT3 B;  1E90 A;  1Y56 A;  2R2Q A;  1GB4 A;  4HDQ A;  4IKG A;  3N9Y C;  2W3R A;  1MHX A;  1M94 A;  4WJP A;  1F2R I;  3RMK C;  1J0G A;  5LNK 1;  4HJK A;  1YQB A;  3GZN I;  3V6C B;  4TMA B;  4E3C A;  2M8S A;  1R7S A;  3IAS 1;  1WJ6 A;  3KW5 B;  2LD9 A;  4NJC A;  4GDL A;  2JWU A;  4TV3 A;  4K3C A;  2JXT A;  3AEE B;  1ZE3 D;  4HKZ E;  3Q8E A;  2XEW A;  1JQ4 A;  2GMI C;  3Q6B A;  1BML C;  3ML8 A;  3BVZ A;  1PGA A;  5C1Z A;  4GGQ A;  2B76 B;  1AYF A;  1WJU A;  2KAN A;  5L95 C;  1Q5W B;  3AH7 A;  2KLC A;  1WX7 A;  3A33 B;  1I42 A;  1J7A A;  4BOS C;  2JRI B;  3A1Q A;  1KLU D;  3CMM B;  3P4P B;  3B08 A;  4EEW A;  3NVW A;  2BTE A;  3KH0 A;  4KZC A;  1VR9 A;  3QIJ A;  2LEK A;  1DOI A;  3V61 A;  2CR5 A;  3WAP A;  3WAN A;  2DAF A;  4ANU A;  2IYD B;  4CYE A;  4FHJ A;  3KUD B;  3ML9 A;  1J7C A;  3ZQ4 A;  2M17 A;  1TS3 A;  3L54 A;  2DYO A;  1JML A;  5KHQ A;  3PSE B;  3OG5 A;  2FCM A;  3BK1 A;  5IA7 A;  2WXL A;  1E7V A;  2C5L C;  5H8Y E;  5FR6 A;  1N6Z A;  4RGM A;  3KVF B;  3U4E G;  2WXF A;  1F1H A;  3BYT B;  3DVN U;  4MJS B;  3M3J A;  5EE3 A;  1XF5 L;  1E8W A;  4GOC A;  3EA6 A;  2PLP A;  2LAS A;  4GMV A;  1OFF A;  1WMH B;  2G1E A;  2WU5 B;  2X38 A;  4GU2 A;  2TSS A;  4XZ4 A;  1R4N B;  1PYW D;  1N61 A;  4ARI A;  1WI0 A;  2CJO A;  1UWX A;  3Q3M C;  1JRO A;  3JSV B;  1LXD A;  3FIL A;  4GIV A;  3SHQ A;  3Q2A C;  3WCQ A;  2K8C A;  3P4Q B;  4EFO A;  4XWT A;  1OQQ A;  4W9K A;  5BO4 B;  1L2N A;  4DHZ E;  1TS4 A;  2SEB D;  3NG0 A;  4EZL A;  2QEJ C;  4TKN A;  4A3O A;  3IT4 B;  2DWQ A;  2RMM A;  1PUT A;  1SJE D;  1TKY A;  3PO0 A;  4AQ7 A;  2MBO A;  4MDK E;  1QZE A;  4C00 A;  1ET9 A;  2DZJ A;  1WF9 A;  4RM9 A;  4WUR A;  3ZJT A;  4BAX A;  4FA6 A;  2PVG C;  2FE8 A;  1K51 A;  1WE7 A;  1T6B X;  5HG2 A;  1L5P A;  1VZ8 A;  1KF6 B;  2FCN A;  4RH6 A;  2KFJ A;  4W9E A;  2MQJ A;  2INP E;  2WDV B;  1FCC C;  1WGR A;  5FKA C;  3IT6 B;  3NJT A;  4HKQ A;  2GBJ A;  5DCN A;  1WZ3 A;  3QCA A;  1UGJ A;  2IGG A;  2KDE B;  3HUI A;  3RNA C;  2LVQ A;  3OJ4 B;  2Z59 B;  3VTW A;  3QAQ A;  3PT2 B;  2HTH A;  2L05 A;  3MC9 A;  4W9H A;  4W9D A;  3PRE A;  4G0N B;  2BF8 B;  2KQ7 A;  1MG8 A;  3B9J A;  1F9J A;  4C4V B;  4A20 A;  1NYQ A;  1P9D U;  2MLB A;  1TYG B;  2CU3 A;  4KZ0 A;  2LVO A;  4GSW A;  3A4R A;  3L17 A;  1WYG A;  2HJ1 A;  4LLG M;  3AE4 B;  4ZDV A;  3ZNZ B;  1MI0 A;  1YOV B;  3PPA A;  3NZU A;  2W55 A;  3MTN B;  4ACF A;  2J52 A;  2M1M A;  4XYC A;  1OQR A;  3T3O A;  2IDY A;  2MP2 A;  4MT5 A;  2D3C A;  3U7D A;  2ZW1 A;  5E6P A;  5EDS A;  1I4H A;  1YMH E;  1XCQ L;  1KTK A;  1Q1O A;  2N9L A;  3N1Z C;  3W1S A;  3C19 A;  4HPL B;  4IM0 A;  2ACZ B;  2H89 B;  1E9M A;  4W9L A;  5JH5 C;  3V6E B;  1T0S C;  1FFU A;  2WDQ B;  1JWU D;  1YQ3 B;  4IOI E;  5CHW A;  4I6L B;  3W1Y A;  3TJP A;  3RUL A;  4NJ7 A;  2KTR B;  2KTF A;  2BYF A;  3RNF C;  4NZL B;  2KDM A;  1YN5 A;  4YSY B;  3AE5 B;  2GBK A;  1WXM A;  3QQ8 B;  2G45 B;  3K9O B;  2JQR B;  4YT0 B;  3RI7 C;  2FNJ B;  4F1S A;  2PE6 B;  4RMA A;  1BT0 A;  2Z0D B;  1SE9 A;  5BYR A;  4MGZ E;  1WXV A;  2WXK A;  2IGH A;  2K8B A;  1YJI A;  3KQ4 A;  2WHI A;  4LTU A;  1UUP A;  4P16 A;  3K9P B;  1WJN A;  1V97 A;  4ZYN A;  5DPW A;  1L4D B;  2KVR A;  4A9A A;  5AZF A;  2IJ0 A;  1WX9 A;  3N1X C;  2D5G A;  3NUH B;  4YTN B;  2KOX A;  3PRP B;  3EFU A;  1K8R B;  1ENF A;  5CHF A;  3SDL C;  3IFW B;  2WWZ A;  3SR6 A;  1HXY D;  3AE9 B;  3T9L A;  3UGB B;  2HDE A;  4BVU C;  4HK2 A;  2KFK A;  2RPV A;  4EOY A;  3ZTC A;  2IO2 B;  1UWM A;  1YIW A;  2LUM A;  3P63 A;  4MSQ B;  4AP4 C;  3U30 A;  5DPR A;  2LUE A;  1HZ6 A;  3RNE C;  4CQN A;  3T3N A;  2DAJ A;  2K8H A;  1AN8 A;  3RFZ B;  4UDU C;  1OTR B;  1KJT A;  3WAO A;  2LGY A;  2WU2 B;  4K81 A;  3R3M A;  3L0W B;  1MHH E;  5L83 A;  1T0R C;  4HEA 1;  2FUH B;  3HVZ A;  4JL9 A;  1PDX A;  4A55 A;  1P1A A;  3ECI A;  3EHV A;  1DYQ A;  1KRH A;  5TSS A;  4KVG B;  4EUT A;  1TIF A;  2A5U A;  3R8B A;  1C4C A;  4TQ0 A;  2L76 A;  3DBR I;  4BFR A;  2L52 A;  2MRP A;  2MWS B;  1UZX B;  1V81 A;  4ZRP A;  2GB1 A;  3BVM A;  4BKG A;  3GB1 A;  1UGM A;  1Y8R C;  1R4M B;  3SD5 A;  1ROE A;  1L4Z B;  1C76 A;  3AM9 A;  3NVV A;  4W9I A;  3VQI A;  2OOB B;  4M0W A;  1L6V A;  4K7U A;  3BVG A;  1FXI A;  1TS5 A;  4M01 A;  2PJH A;  2Z8L A;  3ABV B;  1ZUD 2;  2IZV B;  1E7P B;  4PYU A;  2RPQ A;  4ICU A;  2KMM A;  4XX5 A;  1J7B A;  1MFW A;  2KN5 A;  2JX5 A;  3Q3F A;  3ZRC A;  3PV1 A;  3VUW A;  2ZZP B;  2REX A;  4ZYS A;  4XDC A;  2Y3A A;  3GP7 A;  2HJ8 A;  4WQM A;  2O6V A;  3LYY A;  3MHZ A;  4P6V F;  2R61 A;  4KSK C;  1ESF A;  3N3K B;  4MGI E;  2MBH A;  3DQV A;  3DWG C;  3AN1 A;  4WIP A;  2LMC A;  1ZGU B;  2N9E B;  1E10 A;  4DDI D;  3LDZ E;  3UIO B;  3IXS A;  1RRB A;  3TEW A;  4BBN C;  3CWI A;  2QIE B;  1L6U A;  3NVZ A;  1ZP0 B;  2HTM E;  4ZRK A;  1LQB A;  3MJ5 A;  3R2T A;  5J2R A;  1V1P A;  1VCB A;  1QOA A;  2V3N A;  2GLS A;  1WFY A;  2NR2 A;  1C1Y B;  3J9C A;  4KKJ A;  3AE8 B;  4Q2J A;  2I2Y A;  3VH4 B;  2WLB A;  1Z5S B;  1IBX A;  2JY6 A;  1YN4 A;  2V4I B;  2CS4 A;  3Q14 C;  2BB6 A;  4QAY A;  1Z2M A;  3N32 A;  4ZHP A;  3LXF A;  3KYD D;  4WWP A;  2L0F A;  1QKZ A;  1L0X B;  4G3X B;  4NAW A;  3L08 A;  2D3G A;  1FMA D;  4WWO A;  1WXA A;  4GN1 A;  1FRR A;  1WWT A;  4HCN B;  2PKO A;  3DVN V;  2K6Q A;  4BOZ B;  3PS6 A;  3HVD A;  3R2I A;  4ANW A;  3DBS A;  5AZH A;  1L7Y A;  1IP9 A;  2ASQ A;  3TEZ A;  2RR9 A;  2MA9 B;  3FC4 A;  1F52 A;  3ZNG C;  3M63 B;  3L16 A;  4O1N A;  3TEX A;  1A5R A;  2HE7 A;  1C79 A;  3BYY B;  2B3A A;  2ZNV C;  1ZW7 A;  3R7Q A;  3SEB A;  4KGS A;  2MJ3 A;  2MW5 A;  2MCN B;  1TT5 B;  2D10 A;  2N9P C;  3W2D A;  1T0Y A;  4OVV A;  1N62 A;  2NBW B;  4MAC A;  4RF0 A;  2QC8 A;  3FKY A;  2MBE A;  2O2V B;  1GC6 A;  2RSU A;  4RM8 A;  1QOB A;  2L83 A;  4WJQ A;  1UD7 A;  5IKC M;  3AED B;  1JRP A;  1R4M I;  3X23 A;  4XE0 A;  3CF6 E;  1RFA A;  4LJO B;  2KWU B;  2E3T A;  2DNF A;  2KC2 A;  2R2O A;  4P1B C;  2IGD A;  2LRU A;  3A9J A;  4FJY A;  3ENE A;  4HRS A;  1UBQ A;  2KO3 A;  3CIR B;  4HDO A;  3NHE B;  2W54 A;  2NTS A;  4KIK A;  5G5H A;  4F8C B;  4J3O D;  3VAW A;  3U7Z A;  2ON8 A;  3NRZ A;  3N1Y C;  1KOT A;  5MPO A;  4NAM A;  2EKE C;  1ZDX A;  4NQL B;  4PYZ A;  4B6W A;  2AX5 A;  2OHF A;  2WP9 B;  3AMZ A;  3TUO A;  2LJ5 A;  2CJN A;  1J8C A;  2IO3 B;  1L0Y B;  4HPM B;  3RN9 C;  3HIZ A;  2L7R A;  3C0R B;  4LDT D;  4JWU C;  1EU3 A;  3IG3 A;  3X0W A;  2KJR A;  2BS2 B;  3GS2 A;  3WAM A;  1CQV A;  2N7E A;  1HA5 A;  4DQO C;  2M0X A;  3A1Q B;  4FJV B;  4YTM B;  2UU7 A;  1WM2 A;  4NQK E;  2DX5 B;  2C9W B;  5IOI A;  2N0S B;  2INN E;  2M4N A;  3HM3 A;  4C80 A;  4ZOH C;  1UBI A;  5IN7 A;  1BUI C;  1I35 A;  1FNV A;  1MG4 A;  2ZW0 A;  2LVP A;  1FNU A;  2PPH A;  2J4X A;  4K1R B;  3ZNH B;  2KHW B;  1IGD A;  3T8M A;  1C78 A;  1WM3 A;  3OAW A;  1Q0W B;  3Q8C A;  2BYT A;  2WNM A;  1SBB B;  5G5G A;  3VXW A;  2WDT B;  3L13 A;  1JCK B;  3PZD A;  1YJ1 A;  1HQR D;  1N5W A;  1TZO A;  1GAQ B;  4TUU A;  2V0G A;  1V9J A;  1X1M A;  2FIF A;  2BGF A;  2NPT A;  4TSS A;  1HE8 A;  1OQY A;  3W5V B;  4G50 A;  3GOE A;  5HKH A;  3VR8 B;  4II2 B;  4M02 A;  2NMQ A;  1UNS A;  5E6O A;  1D3Z A;  1XT9 B;  3FIL B;  3TL5 A;  4GDK B;  2KXJ A;  1NDD A;  2AL6 A;  4N59 A;  3R66 C;  4A90 A;  2IND C;  2DYB A;  2WXJ A;  2KX0 A;  1C4A A;  2BWF A;  5AUI A;  4IUM B;  2AYO B;  2N9K A;  3IAM 1;  3H7P A;  3SU8 X;  3Q69 A;  3VTV A;  4L2Y A;  1FFV A;  2BPS A;  4EKU A;  1VD2 A;  3O65 B;  1C3T A;  3HK0 A;  1K50 A;  3B2F A;  4I6N B;  1YX5 B;  2KT7 A;  2BQQ A;  2KAJ A;  3VH3 B;  1H8C A;  1FXT B;  2KMC A;  1XCT L;  1V6E A;  4CHK A;  1TJE A;  3AU4 A;  4LCD E;  1JRU A;  2CU1 A;  2ZCC A;  4LJP B;  5BYQ A;  2RD0 A;  5H92 C;  1RLF A;  1T0Q C;  3ALB A;  3O13 A;  2JF5 A;  3LB8 C;  2DZM A;  2FBW B;  2V3P A;  3EFC A;  2KZR A;  3I9V 1;  4M00 A;  1TGZ B;  2L3Z A;  2IY0 B;  2QSD A;  4BKS A;  3PZ8 A;  3GE3 C;  2MBQ A;  4ZRI A;  3V62 A;  2KDI A;  5JZE B;  2NCN A;  3FAH A;  4RGO S;  3ZTD A;  3KUC B;  1LGR A;  1QLB B;  3H7S A;  1ZDV A;  4YL8 A;  2HD5 B;  4XDD A;  2M19 A;  2KJH B;  4OHJ A;  1FCL A;  2MHJ A;  1XD3 B;  3CST A;  3MP9 A;  4RGN A;  4JX1 C;  1PFD A;  2J0J A;  3DHG C;  4FAD A;  1PQS A;  4DBG A;  2MX2 A;  4FJZ A;  4HJG E;  2FUG 1;  1RAX A;  4AJW A;  2XK5 A;  1C77 A;  4REZ A;  5LXI B;  1E8Y A;  1XLQ A;  2BVC A;  5CX3 A;  5C2T B;  1OGW A;  1YNT E;  2MSE D;  4LNN A;  1XLN A;  2KDF B;  2BS4 B;  5D6J B;  3QK0 A;  3KWV A;  4MSM B;  3ZGZ A;  2NS5 A;  3MFG A;  1V86 A;  4KV2 A;  1R4N I;  2DBY A;  2QDF A;  3C8Y A;  4X57 B;  1EUV B;  4B0M A;  4L1B A;  2M0A A;  2W3S A;  1WGD A;  2DYM A;  5T8I A;  5AUK A;  2PEA A;  4MEL A;  4US9 A;  4NNJ B;  2JT4 B;  1NI2 A;  3URY A;  5D3I B;  1EF1 A;  4M8N A;  3EC8 A;  2V9H A;  2JXX A;  2ONQ A;  3DBH B;  4DHJ B;  2W9N A;  4GB9 A;  3DBL B;  2CHX A;  3ZLZ A;  1S3S G;  1ZKH A;  2QCZ A;  4W9C A;  2K3U A;  3TSS A;  1PGB A;  2N9X A;  2MH7 A;  4DK5 A;  4JQW C;  2G4D B;  2K39 A;  2KMA A;  4S17 A;  2H88 B;  4YTP B;  2MBB B;  2EKI A;  2J0K A;  1SE3 A;  3APF A;  3RNC C;  4EE2 A;  4WH4 A;  1TBE A;  4ANX A;  2XBB C;  1P7E A;  4YSZ B;  4DXA B;  1GG3 A;  3H1U A;  2Y5P A;  1EF5 A;  2K6D B;  4IWO A;  1WGK A;  2JZP A;  4KKI A;  4HVB A;  1OEY A;  2LI5 A;  1MVK A;  2EMT A;  2KC1 A;  3WA0 A;  2RDB C;  3U2S C;  2V3S A;  1TY0 A;  1ISN A;  3HHM A;  2NVU I;  1C9F A;  1WR6 E;  1VJK A;  3NOB A;  4MM3 A;  2I1K A;  4BZA A;  1WRD B;  4ZRQ A;  3TEY A;  2KD0 A;  3ZUN A;  2NTT A;  3AXC A;  2L1A A;  1XXG A;  4A3P A;  2W82 A;  3P1M A;  2C60 A;  1XEE A;  1RFK A;  3BII D;  1FEH A;  2GBN A;  1E8X A;  1ZOY B;  3MHS D;  2ZPY A;  2MEK A;  3KUZ A;  3UQA A;  3Q3N C;  2EEL A;  4FHK A;  2YLM A;  1GNU A;  2GI9 A;  4B95 A;  3RYT A;  2AEH A;  3H9D A;  1HZ5 A;  4LNK A;  3UIN B;  3WIM A;  2DHZ A;  3CSF A;  3Q8B A;  4BBN F;  1EWY C;  3B2G A;  4MH8 A;  1V49 A;  1T5X D;  3OLM D;  1CZP A;  1QOG A;  2CHZ A;  5AZG A;  1EM7 A;  4PS3 A;  4FLH A;  3TBL D;  1N63 A;  2LJI A;  4HCP B;  3DCG A;  1JWB D;  1NI3 A;  4AS1 A;  5G55 A;  1NVI D;  4N6E B;  4USA A;  3WAL A;  2DLB A;  3OJ3 A;  2ZVO A;  1AWD A;  1FNW A;  1KH0 A;  3TIX A;  1WXS A;  3DWM A;  4OZB A;  1MJD A;  3NVY A;  2PE9 A;  1D5M C;  4K7W A;  1N60 A;  3I5J C;  4IWP A;  5HI1 A;  1EWC A;  1YJJ A;  1G6J A;  4WWM A;  2A4Z A;  4LDT B;  1SEB D;  4AOF A;  2QMT A;  4LNI A;  4DHJ D;  2FAZ A;  4JGH B;  1ZXH A;  2L8J A;  2WXQ A;  1TS2 A;  2WXH A;  4AJY B;  3IBE A;  3A9K A;  2M56 B;  3P42 A;  1ZXI A;  2LHE A;  1WE6 A;  3I57 A;  4G11 A;  3AEB B;  2VZK D;  4EZK A;  1HTO A;  1FPY A;  3DHH C;  3DBH I;  2Y5C A;  3QAR A;  3DBL I;  5G2N A;  4WJN A;  4MGY E;  2IO0 B;  3RNG C;  4A8X C;  3KYC D;  3RZW C;  1V1P B;  4FUL A;  3VDZ A;  2XN9 C;  2GBR A;  2WXN A;  3RPF C;  4HRO A;  4S0R A;  3L4P A;  1IBX B;  1K53 A;  2DEN B;  4IG7 B;  2OJW A;  4RFB A;  4ZRJ A;  3VUY A;  2YEP B;  2I1J A;  2WXG A;  3QJZ A;  1ZPS A;  1B9R A;  3Q3J A;  3H6N A;  2YEP F;  1E7U A;  3VVW B;  1D4B A;  2K22 A;  2E6X A;  2WXM A;  4GXB A;  3ZNI D;  1E6E B;  1SJH D;  4NAW B;  3RUI B;  4JPS A;  4IDI A;  2ICI A;  3BIN A;  1SF0 A;  5I4D A;  3HRD D;  2KQS A;  1I7H A;  2VH1 A;  2LGX A;  1UH6 A;  1WGY A;  1P0R A;  3AE3 B;  5EE0 A;  2VRR B;  2BB5 A;  4WJO A;  2Y5B B;  1JW9 D;  2G9H D;  4F7Z A;  1D5Z C;  2CKH B;  2BYE A;  1VDV A;  2EMS A;  1WX8 A;  1STE A;  3RNB C;  1UF0 A;  4N58 A;  1GPX A;  2AL3 A;  4OZC A;  4ICV A;  5EE1 A;  4DWF A;  3ZYY X;  1NBF C;  2AQ3 B;  3ZXV A;  3I63 C;  4PS7 A;  1V80 A;  5BMI A;  1TZ1 A;  5D7G A;  3EUB 2;  1YD8 U;  4W9F A;  4GDL B;  1JWA D;  4E71 A;  2KKC A;  2WX1 A;  4AWJ A;  2WQY B;  1EU4 A;  4XC2 A;  4M8M A;  3AE6 B;  3I3T B;  2GBM A;  2WGS A;  3QC8 B;  1WR1 A;  1VLB A;  4ZHO A;  3N30 A;  5D3D A;  1FIQ A;  4II3 B;  5DPT A;  1GJZ A;  5AEK B;  2Q5W D;  3Q3O C;  1KLV A;  2JU6 X;  4US8 A;  2PW9 A;  1JAL A;  4FBJ B;  1TKE A;  4W9G A;  1C4P A;  1IGC A;  4J6I A;  3A9J B;  2KWC A;  2J42 A;  4MJS A;  4LNF A;  5IO9 A;  2O6V D;  2LXC A;  3ZJV A;  1FRD A;  4B0E A;  4KIK B;  3E9S A;  4AUQ C;  1P3Q U;  2GRI A;  4C7Z A;  1N5X A;  1P98 A;  3TCA A;  2SAK A;  4JE3 B;  1I4R A;  1WMH A;  3DHI C;  3EGR A;  4WQO B;  2JYE A;  2WYQ A;  2J0M A;  4ARC A;  3B0A A;  3NS8 A;  3JSV A;  4ASW C;  2X8X X;  4N9F 4;  1B1Z A;  2NBU A;  4C7Y A;  1WH3 A;  3ZVV A;  4K3B A;  4TQ1 A;  1FXA A;  2KLG A;  2PVO D;  3P4R B;  1VZ6 A;  4JWS C;  3S2A A;  1YQ4 B;  3IVF A;  4MH0 E;  2ZVN A;  2KX3 A;  4GLS C;  2V1Y A;  1CMX B;  2RDH A;  1SXT A;  4PT5 A;  3N20 C;  3VRB B;  1V5O A;  2C7N B;  1WZ0 A;  4WAF A;  4GDK A;  2D3B A;  2PTL A;  1GB1 A;  2ZEQ A;  3DDC B;  3ZRF A;  2LHD A;  4PS8 A;  1D5X C;  1M4V A;  2K1F A;  2UWQ A;  2GOW A;  3NZ3 A;  4K7S A;  2BBC A;  3BWU D;  4DHZ B;  5FK9 C;  3PRZ A;  1MPE A;  1FM0 D;  4DDG D;  5IAA C;  3ZDM C;  1NEN B;  1XLP A;  3EEC A;  2JZ3 B;  4KX6 B;  4P1C C;  5GXG B;  4WWN A;  3PZ7 A;  5KHO A;  2ZCB A;  4IM3 A;  4E74 A;  1WJ4 A;  3ZDT A;  2K25 A;  4YXD B;  2NPT B;  3SFE B;  3MJW A;  5GMV A;  3BK2 A;  4C4V A;  4KGT A;  3JW0 X;  3AB5 A;  1XQQ A;  3PHW B;  1WYW B;  1KFY B;  1F0Z A;  2JWZ A;  1ACC A;  1KM7 A;  3APC A;  3AEF B;  2INC C;  2OED A;  3V60 A;  4IW0 A;  2D2Q A;  4URK A;  3PHX B;  1PGX A;  3UF8 A;  3UIP B;  4RGT A;  1GC7 A;  2PMV A;  5DPS A;  3H7P B;  1QF6 A;  1I4G A;  3AU5 A;  1AW7 A;  2D07 B;  1E5W A;  3DBR B;  2I38 A;  2LFI A;  5BMG A;  3H8H A;  3AUL A;  1XLO A;  4DXF A;  1TKG A;  1E0Z A;  2DZK A;  2WS3 B;  5BMH A;  2MJE A;  4L23 A;  1JWM D;  2C7M B;  2CHW A;  2KK8 A;  4D2K A;  5LXH A;  4IC7 B;  2ZPN A;  2BS3 B;  2BKF A;  2LXA A;  4FXC A;  1QIL A;  2LZ6 A;  4XWW A;  4C56 C;  4LNO A;  3ZKJ C;  4A6Q A;  2RDG A;  3Q8A A;  1IYF A;  1JWS D;  2BYV E;  1RYJ A;  5JHA A;  3AEC B;  1IPG A;  2KTR A;  3NY5 A;  3VHT C;  5JXV A;  3ZJU A;  1YX6 B;  1K52 A;  2KNB A;  2K5P A;  2LGI A;  3NS1 A;  4YWG G;  3KWL A;  2UYZ B;  2KDB A;  1DOX A;  3LJ3 A;  3IHP C;  2MP2 B;  3AEA B;  3RD2 A;  1NYR A;  4YSX B;  3DPD A;  2QIL A;  2K9X A;  2WXI A;  2JYT A;  1WY8 A;  5D2M B;  4FN2 A;  1WRI A;  3PLV A;  3GE8 C;  2JRH A;  4CO7 A;  1LM8 B;  1T3Q A;  1DOY A;  4H2A A;  3VR9 B;  2LGS A;  2D11 A;  2KVZ A;  3M95 A;  1V2Y A;  2C7H A;  2J53 A;  3PLU A;  2V4L A;  2J7Q B;  3ZXR A;  2XK5 B;  1NEK B;  2JUO A;  1VZ7 A;  1QOF A;  4JIO U;  2AQ1 B;  1L0V B;  1WIA A;  3AEG B;  4HLE A;  1QQR A;  2FCQ A;  4MEM A;  1RM6 C;  2WDR B;  2YVC A;  1I4P A;  4NJ6 A;  4RNA A;  1A70 A;  2VH2 A;  3JYU A;  2N4F A;  2VZK B;  3SFD B;  4B9K A;  1E8Z A;  1WSP A;  3U52 E;  2KN4 A;  2N7J A;  4OVZ A;  4HWI B;  2BKR B;  2JVC A;  1V5T A;  3U8Z A;  5CHV C;  1UEL A;  4I6P A;  4OZA A;  5J17 A;  3ZO5 B;  2L00 B;  4WAA A;  1SIF A;  1I4X A;  3W1S C;  5HHD G;  3QWZ B;  5LLI A;  3UQB A;  5IP4 D;  1CJE A;  2D3A A;  4RF1 A;  4LK0 M;  3AE1 B;  2FCS A;  2JPH A;  4XGA B;  5C3J B;  3W5U B;  4EZJ A;  3M62 B;  2IO1 B;  1P7F A;  4P7I A;  2KFK B;  2K0P A;  1OEY J;  1XO3 A;  2BW2 A;  3RZF A;  2WXR A;  5E6N A;  4R3D A;  1IUE A;  4HPP A;  3E56 A;  2AWT A;  3PRM B;  3DVG Y;  2PIA A;  2WXP A;  2RGF A;  3ONS A;  3L10 B;  4IWQ A;  3GZN B;  1VRA B;  2QHO A;  3PGE A;  2KJ6 A;  3P2B A;  1I4Q A;  3VFK A;  3AI5 A;  2IY1 B;  2LRW A;  5HFY A;  1FO4 A;  2WX0 A;  3TMP B;  1LFD A;  2IBI B;  4ITK A;  3D32 A;  3QA8 A;  1BXT A;  5CTR C;  2OJR A;  1Q10 A;  1SB3 C;  3NZS A;  1WXQ A;  2KYW A;  2DZI A;  3AV8 A;  4BKS D;  1FD6 A;  3HM6 X;  4MM3 B;  3V3X A;  5EE9 A;  2N1W A;  4HXD A;  2BWE S;  2KQ4 X;  1WGG A;  3BY4 B;  1KLG D;  2BT6 A;  2N1V A;  3Q8F A;  3ZW3 A;  1V1O A;  1SSN A;  4KDL B;  3DOW A;  3APD A;  5JHB A;  1SGH A;  3JVZ X;  1SE4 A;  3VTU A;  1EO6 A;  3UI3 A;  3ETR A;  1HTQ A;  2G4S A;  5E6J A;  1V8C A;  4M0W B;  4MGK E;  4DXG A;  1F2R C;  1ET6 A;  4JLC A;  2QJL A;  1SIJ A;  3OWE B;  1WGH A;  2KAC A;  1GUA B;  1F77 A;  3KLS X;  4RCO A;  2N7D A;  1RWS A; 
#chains in the Genus database with same CATH homology
 3AE2 B;  3MC0 B;  1L4D B;  3IAM 1;  4A9A A;  2IJ0 A;  3Q69 A;  2D5G A;  4L2Y A;  1FFV A;  4GDL B;  1JWA D;  1K50 A;  3NUH B;  3VRA B;  3B2F A;  1DGJ A;  4YTN B;  2WQY B;  1EU4 A;  4KGR A;  3P4S B;  1ENF A;  3AE6 B;  2KAJ A;  3SR6 A;  3W9C B;  1VLB A;  1HXY D;  4ZHO A;  1XCT L;  3AE9 B;  1TJE A;  5D3D A;  1HEZ E;  1QT9 A;  1FIQ A;  2Q5W D;  2JU6 X;  2HDE A;  2PW9 A;  1JAL A;  5BYQ A;  4US8 A;  1TKE A;  1GOZ A;  3AE7 B;  5H92 C;  2RPV A;  1C4P A;  3O13 A;  1IGC A;  2AQ2 B;  1TY2 A;  2J42 A;  3LB8 C;  1YN3 A;  1UWM A;  2FBW B;  3P63 A;  2LUM A;  3ZJV A;  2V3P A;  1FRD A;  3I9V 1;  4B0E A;  1HZ6 A;  3E9S A;  4CQN A;  2GRI A;  4C7Z A;  2QSD A;  1N5X A;  1D6E C;  3T3N A;  2JSV X;  2IPK D;  1I4R A;  1AN8 A;  2SAK A;  4JE3 B;  3PZ8 A;  3RFZ B;  1LO5 D;  4UDU C;  3EGR A;  3V05 A;  2JYE A;  2WU2 B;  4OW0 A;  1MHH E;  4ARC A;  3FAH A;  4RGO S;  2L32 A;  4HEA 1;  3HVZ A;  1PDX A;  1QLB B;  1B1Z A;  2XNA C;  4A55 A;  4C7Y A;  1ZDV A;  1DYQ A;  1KRH A;  4XDD A;  2M19 A;  4TQ1 A;  1FXA A;  5TSS A;  2PVO D;  4OHJ A;  1FCL A;  3P4R B;  3MP9 A;  4RGN A;  3R8B A;  1C4C A;  4TQ0 A;  4JX1 C;  2KWD A;  1VZ6 A;  4JWS C;  1YQ4 B;  1SE2 A;  1PFD A;  2L52 A;  4GLS C;  1CK1 A;  5BYS A;  2RDH A;  3BZD B;  2MJD A;  1SXT A;  4PT5 A;  4ZRP A;  2GB1 A;  3BVM A;  3VRB B;  4HJG E;  2FUG 1;  5FR3 A;  3GB1 A;  2WXO A;  3EUB 2;  1ROE A;  1Y56 A;  1L4Z B;  1C76 A;  1C77 A;  3AM9 A;  3NVV A;  1GB4 A;  4IKG A;  3N9Y C;  4WAF A;  3VQI A;  2W3R A;  4M0W A;  1L6V A;  4REZ A;  1MHX A;  2PTL A;  3BVG A;  1GB1 A;  1FXI A;  1TS5 A;  1F2R I;  2LHD A;  1XLQ A;  2Z8L A;  1D5X C;  3ABV B;  1ZUD 2;  1YNT E;  5C2T B;  5LNK 1;  1M4V A;  1XLN A;  2BS4 B;  4TMA B;  3NZ3 A;  2BBC A;  3BWU D;  1E7P B;  3KWV A;  3ZGZ A;  5FK9 C;  1MPE A;  3MFG A;  1R7S A;  2KMM A;  1FM0 D;  3IAS 1;  1J7B A;  3C8Y A;  2DBY A;  2JX5 A;  4B0M A;  4L1B A;  2M0A A;  1NEN B;  2W3S A;  1XLP A;  4NJC A;  2DYM A;  2JWU A;  4KX6 B;  5T8I A;  4ZYS A;  5GXG B;  4XDC A;  2Y3A A;  3PZ7 A;  5AUK A;  3GP7 A;  4US9 A;  2JXT A;  3AEE B;  4WQM A;  1ZE3 D;  4HKZ E;  3Q8E A;  3LYY A;  3MHZ A;  4YXD B;  1JQ4 A;  3URY A;  5D3I B;  4P6V F;  2R61 A;  3SFE B;  1BML C;  3BVZ A;  1PGA A;  1ESF A;  2ONQ A;  3DWG C;  2B76 B;  3AN1 A;  1AYF A;  3BK2 A;  4WIP A;  4KGT A;  3AB5 A;  2LMC A;  1E10 A;  3AH7 A;  1KFY B;  1F0Z A;  2K3U A;  3IXS A;  3TEW A;  3TSS A;  1PGB A;  3CWI A;  2MH7 A;  1J7A A;  1KLU D;  2QIE B;  1L6U A;  3NVZ A;  1ZP0 B;  1ACC A;  3P4P B;  2H88 B;  4YTP B;  3NVW A;  2HTM E;  2EKI A;  2BTE A;  1SE3 A;  3AEF B;  2OED A;  4EE2 A;  3MJ5 A;  3R2T A;  4WH4 A;  1V1P A;  1VR9 A;  1QOA A;  2V3N A;  1PGX A;  4KKJ A;  3J9C A;  2LEK A;  1P7E A;  4YSZ B;  1DOI A;  4RGT A;  3AE8 B;  4Q2J A;  2PMV A;  1QF6 A;  1I4G A;  2I2Y A;  2WLB A;  1IBX A;  2Y5P A;  1YN4 A;  1AW7 A;  2V4I B;  2I38 A;  2LFI A;  5BMG A;  1WGK A;  1J7C A;  3H8H A;  2BB6 A;  3ZQ4 A;  1TS3 A;  2JZP A;  2DYO A;  4ZHP A;  1XLO A;  4DXF A;  1JML A;  1TKG A;  3LXF A;  4KKI A;  1E0Z A;  2WS3 B;  5BMH A;  1MVK A;  2MJE A;  4L23 A;  3BK1 A;  1JWM D;  1QKZ A;  2WXL A;  4D2K A;  1L0X B;  3U2S C;  5H8Y E;  1TY0 A;  2BS3 B;  1FMA D;  4RGM A;  3U4E G;  1C9F A;  4FXC A;  1QIL A;  1FRR A;  1VJK A;  1WWT A;  4C56 C;  2WXF A;  4XWW A;  2PKO A;  3BYT B;  4ZRQ A;  3TEY A;  4A6Q A;  2NTT A;  2RDG A;  5EE3 A;  3Q8A A;  1JWS D;  1XF5 L;  1XXG A;  2L1A A;  3HVD A;  3R2I A;  1RYJ A;  2W82 A;  3EA6 A;  3P1M A;  2PLP A;  3AEC B;  1XEE A;  1OFF A;  1RFK A;  3TEZ A;  2G1E A;  2WU5 B;  5JXV A;  2X38 A;  3ZJU A;  3FC4 A;  2TSS A;  3BII D;  1K52 A;  1FEH A;  2K5P A;  1PYW D;  2LGI A;  3NS1 A;  1N61 A;  4ARI A;  1ZOY B;  4YWG G;  2CJO A;  1UWX A;  2MEK A;  4O1N A;  3KWL A;  1JRO A;  3FIL A;  3TEX A;  1DOX A;  2EEL A;  3AEA B;  1C79 A;  3BYY B;  3WCQ A;  3P4Q B;  1NYR A;  2GI9 A;  4XWT A;  4YSX B;  1OQQ A;  2QIL A;  1HZ5 A;  1TS4 A;  2K9X A;  2SEB D;  2WXI A;  2QEJ C;  2JYT A;  3IT4 B;  3SEB A;  2DWQ A;  3Q8B A;  2RMM A;  4KGS A;  1PUT A;  1WRI A;  1SJE D;  2MJ3 A;  1EWY C;  1TKY A;  3B2G A;  4MH8 A;  1T5X D;  3PO0 A;  4AQ7 A;  1CZP A;  1QOG A;  1T3Q A;  1DOY A;  4H2A A;  3VR9 B;  1ET9 A;  3W2D A;  1N62 A;  4MAC A;  4RF0 A;  1EM7 A;  4WUR A;  3ZJT A;  2J53 A;  1N63 A;  2LJI A;  1QOB A;  2PVG C;  2FE8 A;  2L83 A;  1NEK B;  1K51 A;  1JWB D;  1QOF A;  1NI3 A;  1T6B X;  1L5P A;  1VZ7 A;  5HG2 A;  4AS1 A;  1NVI D;  2AQ1 B;  4N6E B;  3AED B;  4USA A;  1VZ8 A;  1KF6 B;  4RH6 A;  1L0V B;  3AEG B;  1JRP A;  1QQR A;  2DLB A;  4XE0 A;  1AWD A;  1FNW A;  1KH0 A;  1RM6 C;  2INP E;  2E3T A;  2WDV B;  1FCC C;  3DWM A;  4OZB A;  2WDR B;  1I4P A;  2IGD A;  5FKA C;  4RNA A;  4HRS A;  3NVY A;  3IT6 B;  3CIR B;  1A70 A;  1D5M C;  2W54 A;  4HKQ A;  2NTS A;  1N60 A;  5HI1 A;  1EWC A;  1YJJ A;  2VZK B;  3SFD B;  4WWM A;  5G5H A;  1SEB D;  2QMT A;  1WSP A;  4J3O D;  3U52 E;  3U7Z A;  2KN4 A;  2N7J A;  2ON8 A;  4OVZ A;  1UGJ A;  2IGG A;  1ZXH A;  2WXQ A;  3HUI A;  1TS2 A;  3NRZ A;  2WXH A;  5MPO A;  4NAM A;  1ZDX A;  2AX5 A;  2OHF A;  2WP9 B;  3AMZ A;  4OZA A;  3TUO A;  2CJN A;  1L0Y B;  3B9J A;  1I4X A;  2M56 B;  3P42 A;  1ZXI A;  2LHE A;  3I57 A;  5HHD G;  3AEB B;  2VZK D;  1NYQ A;  4JWU C;  1EU3 A;  1CJE A;  1TYG B;  2CU3 A;  2BS2 B;  3GS2 A;  4RF1 A;  4LK0 M;  1WYG A;  1CQV A;  3AE1 B;  2Y5C A;  1HA5 A;  4LLG M;  5C3J B;  3AE4 B;  4DQO C;  1MI0 A;  3W5U B;  2W55 A;  1P7F A;  4YTM B;  4A8X C;  2J52 A;  2K0P A;  1XO3 A;  2BW2 A;  2N0S B;  2WXR A;  4R3D A;  1IUE A;  1V1P B;  3E56 A;  2INN E;  1OQR A;  2PIA A;  2XN9 C;  4C80 A;  4ZOH C;  2WXP A;  3T3O A;  2WXN A;  3RPF C;  4HRO A;  1BUI C;  3L4P A;  1IBX B;  1K53 A;  1FNV A;  2IDY A;  2ZW0 A;  1VRA B;  4MT5 A;  2ZW1 A;  4RFB A;  1FNU A;  2YEP B;  1I4H A;  1YMH E;  2J4X A;  1I4Q A;  2WXG A;  1B9R A;  1ZPS A;  1XCQ L;  1KTK A;  1FO4 A;  5HFY A;  2YEP F;  2N9L A;  3W1S A;  1D4B A;  2K22 A;  1IGD A;  2E6X A;  2WXM A;  1C78 A;  4ITK A;  1E6E B;  1SJH D;  1BXT A;  4NAW B;  3Q8C A;  2ACZ B;  2WNM A;  1SBB B;  2BYT A;  1Q10 A;  1SB3 C;  1E9M A;  2H89 B;  4JPS A;  1WXQ A;  5G5G A;  4IDI A;  2ICI A;  3AV8 A;  1JCK B;  1FD6 A;  4MM3 B;  1FFU A;  3V3X A;  1SF0 A;  5I4D A;  2WDQ B;  5EE9 A;  1JWU D;  1HQR D;  1N5W A;  1TZO A;  1GAQ B;  1YQ3 B;  3HRD D;  4IOI E;  2V0G A;  1I7H A;  2KQ4 X;  1KLG D;  3AE3 B;  2BT6 A;  4TSS A;  3Q8F A;  1V1O A;  5EE0 A;  1SSN A;  4NZL B;  2KDM A;  1YN5 A;  4YSY B;  3AE5 B;  3W5V B;  2JQR B;  2BB5 A;  3VR8 B;  2NMQ A;  1JW9 D;  1SE4 A;  4YT0 B;  1UNS A;  2G9H D;  3UI3 A;  3ETR A;  1D5Z C;  3FIL B;  1VDV A;  1V8C A;  5E6J A;  4GDK B;  1STE A;  5BYR A;  4DXG A;  4N58 A;  1F2R C;  1GPX A;  4OZC A;  1ET6 A;  4N59 A;  4A90 A;  2QJL A;  2WXK A;  1SIJ A;  2IGH A;  5EE1 A;  2WXJ A;  1YJI A;  2KAC A;  3KQ4 A;  3OWE B;  3ZYY X;  1F77 A;  1C4A A;  2AQ3 B;  4LTU A;  3KLS X;  1UUP A;  4P16 A;  4RCO A;  5AUI A;  1V97 A;  5BMI A;  1RWS A;  5D7G A;  2N9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...