2L1BA

Solution nmr structure of the chromobox protein cbx7 with h3k27me3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l1bA00
1IKLA 1XX8A 1J8IA 3SVMA 2MP1A 1DOLA 3GV6A 4X3UA 2B2VC 3DM1A 2NYZD 1DOMA 4MN3A 3P7JA 4IUUA 5CMDA 2X6LA 1KNAA 4XT3B 1ZXTA 2JYOA 1RTNA 3R93A 2L1BA 3DEPA 3G7LA 1WTWA 1ICWA 2FJ2A 3GV3A 1C8CA 1MSGA 4RA8A 1RJTA 2HUGA 1PLFA 2RSNA 4DN4M 5E4XA 4ZKBB 1G6ZA 1BO0A 1O80A 2N55A 5D65A 4O42A 2Q8RE 1ML0D 3MTSA 1U4RA 2HCIA 1Q3LA 2EPBA 1JE4A 2FMMA 2D9UA 1G91A 1EL0A 2JP1A 2K1BA 1O7YA 2KECA 1EOTA 4RAUC 5T1GA 2Q8TA 5CBEE 1GUWA 3QO2A 1JICA 3LWEA 4IUTA 3KUPA 5T1IA 1S4ZA 2B2TA 1U4LA 2MPMA 3FDTA 5EJWA 1WTQA 1TVXA 1AP0A 5JJZA 1AZPA 1IL8A 4QUCA 3TN2A 1HUNA 1MSHA 2HCCA 1EIGA 1X3QA 1WVLA 4IUQA 2XIWA 1WD1A 1LV9A 2B2UC 1ILPA 5D14A 1U4MA 1F9QA 1QG7A 1M8AA 3D6WA 4HSVA 2FINB 4NW2A 1DOKA 2CVRA 1RTOA 1PFNA 5CBAE 1BF4A 1HHVA 4RWSC 5E4WC 1F9SA 1CM9A 2BDNA 2RVLA 2X69A 1X32A 4CJ1B 1SDFA 1WTXA 1BNZA 1DZ1A 4HCSA 2KVMA 3IL8A 4XT1B 2M2LA 1MI2A 2B2YC 4LMQD 5COYA 3I3CA 4OIKA 3UI2A 1X3PA 2H1EA 1PFMA 2MJ8A 4HAEA 1HFNA 3Q6SA 4IUPA 4X3TA 2L9HA 1F9PA 1B50A 2DY7A 1HUMA 2DY8A 3MWYW 1A15A 2RSOA 1O7ZA 4OIJA 1NAPA 2EE1A 1CA6A 4ZKCB 3I90A 2EOTA 2L12A 1IKMA 1HFGA 2B2VA 2B2WC 2KOLA 5CORA 4HEDA 3TZDA 4UAIA 5EPKA 4ZLTF 1B4OA 1B53A 2IL8A 3ONAB 1HRJA 1VMPA 3HP3A 2B2UA 1G2SA 3I8ZA 2L4NA 4X3SA 1F9RA 2SDFA 2RA4A 4XDXA 2KUMA 1EIHA 2B2TC 2KEEA 1CA5A 1QE6A 1AZQA 5EPJA 1U4PA 1PFBA 3IFDA 4MHEA 2MGSA 3F2UA 1NCVA 1WTOA 1G2TA 1EQTA 3H91A 1RHPA 1VMCA 2L11A 2K04A 4ZAIA 2B2YA 2NWGA 1QNKA 3I91A 2K03A 2KEDA 2K28A 1MGSA 1XYIA 2K05A 1HA6A 3DEOA 4R9WA 5AFWA 4IUVA 1BBXC 1B2TA 1ILQA 5EPLA 1SSOA 1ESRA 5EKIA 4CJ2C 3FPUB 2FHTA 1WTVA 2VXWA 1KNEA 5DNFA 4X3KA 3N52A 2N88A 2K01A 1DONA 2B2WA 1F2LA 4R8IA 2HDMA 4QUFA 3KBXA 1RODA 1NR4A 1B3AA 2HDLA 1WTPA 2R3ZA 1WD0A 1NR2A 2FFKB 4ZK9B 1WTRA 1SAPA 5EQ0A 4U68A 4CJ0B 1E0BA 1J9OA 4IURA 2NZ1D 2X6GA 2J7ZA 1PDQA
chains in the Genus database with same CATH superfamily
1IKLA 4A93H 2JK8A 1OXVA 3GTQH 4DK1A 1X3GA 1HNXL 4IUUA 2Z4IA 5CMDA 4XT3B 3DWQA 1H9MA 3G4SA 1J6QA 1H9SA 4I7ZC 4GKJL 3KDFA 1I6VC 1SE2A 1W3SA 1BO0A 3NSWA 4LFCL 4A3LH 2NZOA 4WFN3 2HCIA 3SK4A 2JXMB 3A8IE 2EPBA 1XNRL 4A76A 2QKIC 2MO0A 5DM73 4OWXB 2JP1A 4PMWA 2GVAA 2WAQE 2ZXPA 3ND9A 2QILA 4IUTA 3M85A 4A3FB 3Q22A 1QOHA 1AP0A 4RHSA 1GUSA 3VDYA 1K8MA 1XJVA 1ILPA 3RMHA 2UUCQ 3CCVA 1STNA 4NW2A 4A3IG 5CBAE 3C2PA 3V05A 3PQIA 1F9SA 3O13A 1X32A 1A2UA 5M5YB 1X6OA 1A8VA 3HOZB 3CMAA 1SYDA 2BDOA 4DUZL 2ICEC 4NKLA 4A3JH 3C3LA 2MQHA 2XVSA 3DHQA 1ASZA 2KA7A 4TQUS 5J3BA 1Q8IA 1AN8A 3W3AA 4KTAA 4GKKL 4KD3A 2PZUA 1SN8A 3I4MH 1I6HB 3NUCA 4MNOA 4LFBQ 1AZQA 3GTKH 5C44H 1NCVA 3RZOH 4YY3L 2OQKA 1XTCD 2VZAA 4OO1G 1LACA 4JI3L 2Z8LA 1Z6HA 2R7ZH 1XNQL 1PH8A 4FF4A 5H1SE 1ILQA 5CV9A 5CR3A 4C3HH 2YTXA 4JI2Q 4LF9Q 2QW7A 3M4OH 2EXDA 4KN7C 4HJ5A 1SFOH 4LFAL 4WJ4A 2PO4A 2HDLA 3CP0A 3W1BA 4BBRB 4IALA 4A3MG 3RZDH 4X3UA 2RDFA 5IODA 3SK5A 4A3CG 1A2TA 4NXNQ 3D31A 2G9HD 1KRSA 3ULPA 1ZXTA 3G7LA 3S9WA 1Y8OB 3WWVA 2FJ2A 3DWPA 3L2PA 3G6EA 1TIID 1I4PA 4FO2A 2N55A 2HT1A 5J39A 1QNUA 4A93G 1Q3LA 3F2DA 3SK8A 1S3OA 2JEBI 2O5JC 3NTKA 1F2MA 1SYEA 4AQYQ 2UU9L 2Q2TA 3K58A 4IOCA 4GZYC 2K5NA 3KLSX 3D0FA 4NXML 1N8RC 3CQZB 4HSPA 1V1OA 5EJWA 3HG9A 5LL6X 1L1OA 2BCOA 3HS0C 1CZGA 1YIJA 4XQJA 4A3LG 3E0JA 4HN7A 1HHVA 1EYAA 3VR4A 4LNQA 3IFTA 1RIPA 2K5WA 5M5WH 1DZ1A 1IXRA 3MAQA 1HCZA 2K5HA 4BY7H 5G3LF 4H02A 3J81i 4TRDA 1PRTC 4DNIA 1VQIA 4HTHA 4BXXH 2Q2IA 3RN2A 1WI5A 1NMFA 1S5DD 2WB1B 3I4NB 3AEVA 5M3FB 1SE4A 4C1NI 5CORA 4UHVA 2F52A 1B4OA 1DYQA 2AQ2B 2K4KA 3F2CA 4QQBX 1VMPA 1JE5A 2A8VA 3KLSA 1JCKB 3N6RA 3SGIA 5C5MA 3W1GA 5IE8A 3OTOL 3K0XA 1R9TH 4A3JG 2EYHA 4K0KQ 3S2DH 4PQXA 1G51A 5ISRA 2RDHA 3F2BA 3TBIB 1I50H 4HJ9A 4DR4L 5KYIA 4JYAQ 3PCOB 4RGTA 4A3GG 2B2YA 4Z9CB 3NK9A 3JAML 2K03A 3T51B 2IWHA 3S16H 2J0TD 1Q12A 2RKSA 1J5EL 1HTLD 5FK9C 2WKCA 4C3IB 4JV5L 5LMNQ 1Q1BA 3M4YA 3VYTA 4L63B 1WTVA 5C44G 2KJXA 2NTTA 4IPDA 1TXYA 4K8IA 2VUMB 3CCJA 4FDBA 1B3QA 4B3SL 1SMYC 5EQ0A 1E22A 1N33Q 1VQNA 4MIUA 2PW7A 3PUVA 2B39A 1TWCH 5KYLA 3L3OC 1X54A 2PPBC 1N9WA 4CDDC 4X62Q 1WCMH 1C48A 4C2MH 3HOUH 4FVMA 2UUBQ 3DEPA 2YTVA 3S14H 2EYFA 2JA8B 4WJWA 3GD7A 4F7XA 4O42A 2E2JB 2CHBD 2FMMA 3KYHC 3CHBD 4S3SA 1FL0A 3I73A 1Y8NB 2KECA 1PRTD 2JA5H 4DV1Q 2Q8TA 1DD2A 2EJMA 3CPFA 2JSOA 3OMCA 4AYBG 1JICA 2EZVA 4J15A 2ATWA 3FDTA 4MTNA 3J7YW 4DV6Q 2CWAA 1C9OA 2I07B 3HOVH 3MXGA 1RD9D 2JN4A 2PMZE 1SMXA 3HRZC 5E4WC 4UPAA 1TR5A 2BE5C 4UY8C 1ESFA 4AH6A 2PYKA 3BDOA 3IL8A 4DR6L 1W6JA 3BZCA 2VL6A 3CCEA 5A2QL 3E5SA 3I3CA 4JVZA 4OIKA 3RD4A 3J80c 1VQ9A 3KLWA 1GXDC 1B1ZA 2OXPA 4RG1A 2K5QA 1XMQL 3IKJA 2Z1CA 4EVOA 3J81c 1RDPD 4G7HC 3KOJA 4ZKCB 1Q8KA 3HOXB 4OONA 4JI7Q 1OXSC 1Y14B 1EQRA 4ILWA 4BY7G 3OOCA 2B2UA 3FKIH 1EIHA 4BXXG 1CA5A 1A3UA 1E1TA 1GKHA 5EPJA 3AMUA 3H91A 2XWJB 4P74A 1C0AA 1VQMA 2L11A 3RLFA 5CYUA 4YHHL 5IT9L 4BBSH 3H09A 1G291 2IX1A 3DEOA 5EPLA 4KY7A 4KN4C 3I2ZA 1KNEA 1NTGA 1TS3A 1AH9A 3HEJA 2F4IA 2VS1A 1L0YB 3HKZB 4LF4L 4QUFA 3CXCA 5FLXL 1J8IA 1J9OA 2NZ1D 5I9PA 2X6GA 2J7ZA 1CI3M 5JJIA 3H6MA 1DOMA 4B3MQ 5KNDA 4QIWB 2Q2HA 5IWAL 1JQYD 5IGBA 4DNRB 5JEAH 3HOWH 1KLUD 2CQOA 4H7BA 4OXPA 5IGGA 2BE5D 4CKBA 2UUAQ 4BWGB 3MXNB 3MTSA 1KC8C 2WACA 4LUVA 3DWAA 3E0EA 4XIGS 5CC4A 5BN3A 1EOVA 5BN4A 1K8AC 5D3IB 1WCMG 3GTKB 3S24A 1EFWA 3HOUG 4C3JH 5IYBH 5DM63 3KUPA 4DAVA 2MO1A 5A2QE 2N49A 2PZTA 3TN2A 2TSSA 1MSHA 3CW2C 4OHJA 1WD1A 2F03A 3BDCA 3J80L 1GD7A 1IYUA 2JA6H 4HSVA 3BG3A 4PV1C 2JQOA 3J81L 1SDFA 1BNZA 1Z9FA 1CHQD 1S5BD 4WORA 1SEBD 3UI2A 3HOVG 4HAEA 1N36Q 1BVSA 2MJ8A 5KIXA 2F0GA 1A3VA 4IUPA 5LHY1 1BKBA 1TS5A 1CKNA 3KF6B 4BY1H 4A3DB 2E2IB 4LK1C 1EY9A 2RCFA 2O4XA 3D4WA 2EOTA 2K14A 2B2WC 1EZ6A 3FEWX 4LUOA 1Q86C 1LUZA 3GTPH 1IYVA 3S1MH 2EXZA 3KLRA 1I3QB 2E76C 4HR7B 5CV6A 3GTOB 4BA2I 4A3KB 5AJ3L 1EY8A 1PTOH 3OW7A 3R8BA 4FP5D 1TWGH 3I70A 4DR2Q 3L7ZC 1SE8A 5IGCA 3CC7A 2F3VA 2MNAA 1H9RA 1JWMD 1TU2B 1U9RA 1OTCA 2K28A 5M3MB 1QILA 1WTHA 5KRUA 1B2TA 3FKIG 3S1NB 5CV7A 2WKDA 3LGJA 3X3NA 4CJ2C 4X65L 2A69D 4ZUIA 1H9SB 1SJED 2IJ0A 4IQZA 2LXJA 1IBML 5EKKA 1EY5A 1WTRA 5KNCA 4B3TQ 2R6GA 3S15B 2ZJQA 5FOBB 1PDQA 1HNZL 2F0JA 3KJOA 2H4OA 1SYGA 2DUDA 5IYDH 1IYJB 1ZEQX 2JA9A 1YNXA 4UP9A 1LT6D 3UDIA 5FLMH 1O7LA 1RTNA 3DMUA 4K2LA 3TP5A 3K5NA 3K5LA 2R93B 4KI0A 2BH2A 1HNXQ 4ZKBB 2EJGC 2F0FA 1ML0D 4GKJQ 1EL0A 3CU7A 1LT5D 5T1GA 3J81E 4LFCQ 4JOIA 1XXGA 4TSSA 5JEAG 4EQNA 1XNRQ 1ZKOA 2R92B 5ELOA 2WFWA 2QF7A 4QUCA 3CPWA 4CKEA 1CSQA 3K0YA 1ICFB 2Y0SB 3D6WA 2FINB 3J7ZC 4A3EH 2Z0SA 2GN5A 3K5OA 4C3JG 4HCSA 2KVMA 5IYBG 3BVZA 2M2LA 4IUNA 3E3XA 3PO3B 2V4DA 3RLOA 5A35A 4A3IH 2C35B 3GTGH 3Q24A 1I4QA 1HFNA 4CDEC 1JJCB 3RUZA 1NMGA 3OWEB 2JA6G 4E6IA 2NVTB 1TS2A 4R4OA 1EIYB 4ZCKA 3TQYA 3MA2B 2IPKD 3ERSX 2F0HA 4DUZQ 1IKMA 3TZDA 2PQAA 3MXNA 1B53A 2I5HA 2HHHL 3K6OA 4JOIC 2VB3X 1STHA 4APVA 4BY1G 1V8QA 3M3YB 5E1FA 3BYYB 4GKKQ 3R2TA 4GN5A 2ZTEA 1MJCA 3S2HH 4KHPL 2WAQB 3LNNA 1O7IA 4DR1L 1JWSD 4C1NK 1SR3A 3ERQA 1EYDA 1JT8A 2KEDA 4YY3Q 1SRUA 5C4XB 4JG2A 4JI3Q 1SSOA 1JC7A 1FNVA 1XNQQ 3JC66 1TKWB 3SDZA 1CZWA 2SNMA 4Q5VA 1LTSD 3GTLB 2XNAC 1NR2A 4LAAA 1M4VA 1AE2A 2IT1A 1QVGA 4PZ7A 4LFAQ 2VNUD 3SVMA 1VF5C 2KCCA 3BVGA 2CKZB 1DM0B 4NDXA 4A75A 5BN5A 2D5DA 1KNAA 4A3MH 1L1OB 3R93A 4DAMA 3K59A 2L55A 3TP7A 4KY5A 5JEAJ 5I9OA 5C5LA 1GM5A 4F87A 3FPPA 1EQVA 5FJ8H 5IP7H 3GTMH 2NVXB 4DFAA 5IYDG 4RAUC 3C1FA 1PH4A 1VQBA 1PV4A 5FLMG 5C3EB 1N34L 5M5XH 1S5CD 2B63H 3A8JE 2UU9Q 4X64L 5TSSA 1E7ZA 2PW5A 2HCCA 4QY7A 3MXUA 1BBUA 2EDGA 4NXMQ 3SE0A 3H15A 1D6EC 2L5TA 4OO1I 1M8AA 1PFSA 2Z4HA 4KV6A 1A0IA 3UDFA 1Y1WB 3Q0AA 2RVLA 3HOYB 4ZUJA 2PI2A 3SR1A 1SBBB 1Y1VH 4OEMB 4U673 1TY0A 5L37A 3Q6SA 2OEOA 4X3TA 1YJWA 1BOSA 1JJ2A 1B50A 1MKHA 1O7ZA 5GQOA 5KNBA 4A3EG 2WV6D 5EBDA 1ZYRD 2WIIB 1Y69U 1VQ6A 2HQEA 4LJZC 1VQ8A 3HGBA 2RHSB 2LSSA 4GLAC 4DV4L 2WB1G 1HZCA 4P75A 3WOFA 2MGSA 1CQVA 1O78A 1VQOA 3OTOQ 1I4RA 1GUOA 1VMCA 2CH4A 2E2HB 4ZRZA 2I5LX 3I91A 1U5KA 4DR4Q 2L0CA 3NXWA 4R9WA 5AFWA 1HZBA 4A3GH 2VXWA 1X55A 1J5EQ 3N52A 2N88A 1K28A 1JMCA 2SEBD 4JV5Q 4LW1A 3OIQA 1B3AA 1LTGD 1SE3A 5J22A 1Z7TA 1E0BA 1TWAB 3S17B 2G9DA 2C9OA 4B3SQ 3G6JB 2EIFA 1KQSA 2F0UA 5FKAC 2E5LL 4K8JA 2H5XA 4H0LC 1LTTD 1M90C 1QVFA 2J4XA 2LFNA 2QEJC 2NZHA 2V1CC 4DR3L 5JJKA 3NTIA 5D65A 1JOQA 2QDBA 2OT2A 4H44C 4DV2L 5M9OA 2JA8G 2NVQH 1CQFA 2JJQA 1XMOL 2IY5B 3M4PA 3ND8A 1EY6A 4JI8L 4JBJA 4YCVA 1TS4A 1VQCA 3EIVA 4CGYB 1XPUA 3C1EA 5IGFA 5C0XH 1BR9A 4OELB 1P8LA 4KHZA 5FJ8G 5IP7G 1RTOA 3K7AB 2A1AA 4LUZA 5GADC 4HMJA 2B63G 2ZJPA 4JBWA 3CKIB 5COYA 3J81j 4FXDA 4OWWB 1PFMA 3CMEA 3EROA 4DR6Q 3A56A 1LTRD 3VA7A 2N8NA 3H0GH 5IGDA 5GAHC 2MHVA 3T1HL 1CA6A 1QJOA 2XTIA 2L12A 4YWKA 2YU9B 1XMQQ 5CV4A 1Y1VG 1HRJA 3WDNA 4CBVA 3A7AB 1K83B 1JORA 2KEEA 2EY1A 3TS0A 4HIOA 1WTOA 2FXQA 2OTLA 2RQXA 5FO7B 1Z47A 1VQJA 5C0XI 2GVBA 1B70B 1BUVT 2NBFA 1K3RA 1OXXK 1E3PA 1LTAD 2CWPA 3BS1A 4AIMA 1ESRA 2ASBA 4YHHQ 1T5XD 2NVYB 4YCUA 2GA4B 3FPUB 2FHTA 4Y7NH 4IJLA 4YCWA 5JAVA 1KTKA 1TWFH 4L8JA 3CCSA 2K33A 1A3TA 4R8IA 3NE5B 4OX9L 2FFKB 1L1OC 1ET9A 1YNNC 1QB5D 4R1JA 4EQPA 1F2YA 4LF4Q 2DJGC 4A4IA 4K6DA 5FO9B 5LL6S 2VQEL 4K6LA 2A6EC 1VQHA 1TWHB 3AFPA 1VQPA 1CKMA 1ASYA 1NJIC 2JYOA 2E74C 3DXJC 3QIAA 4QJFA 4QMGA 1L0WA 3PO2H 4DV0L 1ICWA 3S1QB 5IIFA 4FF2A 1DGSA 2UXCL 2DNEA 2ID0A 2HUGA 2EYPA 5IWAQ 2K6AA 3A8KE 3OW2A 2EYLA 3GTJH 4UP7A 3PIP3 1JE4A 3NWSA 1NBWA 2ZXOA 2OCEA 2IHFA 4GN4B 4JI0L 1PH1A 2KENA 5JPNC 2MPMA 4EQ5A 1S72A 2KCMA 3FMCA 2WP8J 1CKNB 3PIOA 1VQGA 3W5OA 1CT1D 1ENFA 1PZKD 1SNCA 3A7LA 3I72A 4KLKA 1YHAA 5IOCA 3RNUA 3KJPA 1MI2A 3BZKA 2B2YC 2RCNA 5C0XG 4I7AA 1X3PA 2XSCA 1BCPF 3HZXA 2F4VL 5C4JB 1LYLA 1WOCA 4OIJA 4JI5L 1PZJD 3NWTA 4ULLA 3H3VC 1EU4A 3IRBA 2EY5A 5EPKA 4IPGA 1VS0A 3ONAB 1F9RA 3TDQA 4A3BH 3QJYA 1YNND 3TEHB 2AUKA 3H0GG 1D5XC 1GHKA 2A6ED 5AJ3Q 2WB1E 3NBHB 4RCOA 5CGKA 2UXBL 4A93B 2HD3A 3M7GA 3GO5A 3GTQB 4ID6A 1LT4D 2NTSA 3TREA 4IUVA 1STBA 2PNHA 3K80C 2F1MA 1V43A 5GROA 5LMNW 2F0QA 2OF1A 2M00A 3PUXA 1DONA 4X65Q 2JA7H 1RODA 1NR4A 1CFMA 1PH3A 3M7NA 3S1RH 4DKAC 4IURA 4KJNA 4HIMA 2MP1A 1IBMQ 4JPBW 1SNMA 3GV6A 1MJEA 1OO9B 3P1HA 3DM1A 4FF3A 5E3FA 3DLLA 2E8GA 2A5HA 1OXUA 4Q0FA 3TZUA 3ULLA 1HNZQ 3CRLC 4HIKA 1FYCA 1TQOA 1L0XB 1XPRA 4NB3A 2RSNA 3V2TA 1O80A 4LF5L 1DCZA 1BQQT 2Q8RE 4CHTB 1QZHA 3EA6A 4ZYSA 1I94L 2D9UA 2O5IC 4YWLA 3V96A 1H9KA 4P2CB 4K5VA 2L15A 3QO2A 2WINB 5HY6A 1NSNS 2P5ZX 2B2TA 3PO2G 1CSPA 1JB3A 1EIGA 1EY4A 4EX5A 4A3JB 2B2UC 2E2DC 1U4MA 1F9QA 3PSIA 5KEEA 5C0XJ 4CKCA 4A3GB 1NNXA 4DAYB 2PQAB 2A69C 3T13A 3I4MB 1B7YB 4A3FH 5ELNA 4GN3B 1STAA 5C44B 2F0VA 2LMCB 4DK3C 1F9PA 1G8ZD 3CC2A 3RZOB 5DAUA 5LMUL 3PO3G 2R7ZB 2IX0A 4GNXA 3T53B 1WFQA 3I4OA 5HGTA 4HEDA 4ZLTF 4LF6L 1H9JA 3BU2A 4C3HB 5M5YH 2IX3A 2ZT9C 3HFZB 2VB2X 3NENA 1S5ED 2F0WA 4MTKA 4I65A 2B2TC 3M4OB 3G71A 4R8NA 4ODGA 4IN3A 2HHHQ 1SFOB 3HOZH 1N32L 1EQTA 1XPOA 1FJGL 1EWCA 3SEBA 1X56A 1VCIA 5CV8A 2OQ0A 3PUYA 1RCVD 3J7A5 2A73B 1YJ9A 4ZAIA 3RZDB 4KHPQ 1XYIA 1QVCA 2ZJRA 1BBXC 4DR1Q 2N78A 1UEBA 4A3BG 4AYBB 3BDLA 4JK1C 1I6HH 2F0LA 1NY4A 2QDLA 3UE0A 1D2BA 1NE3A 1SAPA 3AQQA 2AWOA 1DOLA 4POFA 4RGMA 2ZTDA 5G3LD 1P16A 2X6LA 2JA7G 3NQIA 3QWNA 1XWEA 4HJAA 4KKSA 4BBRH 5M5WB 1JJGA 5KGUA 3OPOA 3NBHA 3P20A 4BY7B 4PG3A 4G7ZC 1FVIA 3U4VA 1UNSA 3E9IA 3MEFA 1IL8A 3EBEA 1K3BC 4X66L 4PZ6A 1XTDA 1G6PA 1N34Q 2XIWA 1QWYA 3MVVA 4X64Q 1GOZA 4B3RL 4CDFC 1LO5D 5F2DA 3TS2A 1VQLA 3X3MA 1IBLL 5EBCA 2BH8A 2F3IA 4XYQA 4RFBA 3CQZH 1UWVA 2UXDL 4O0AA 5HGQA 1R9TB 1V1QA 3S2DB 2M9VA 3KF8A 1I50B 1V1PB 1KDCA 3UE1A 2PQEA 4DR5L 3LX0A 1HFGA 2XWBB 3S16B 3I56A 2KOLA 1A63A 1MIUA 3MZ5A 3FVQA 2IL8A 4A3FG 1X9NA 4G7OC 2VY3A 3VYSA 1EIFA 4HJ7A 1F77A 1PFBA 3F2UA 1HR0W 4DV4Q 1G2TA 3G48A 1LTBD 3MEHA 4V0BA 1I4GA 1MD2D 3I4NH 4R4QA 5M3FH 4IPCA 4N8X1 1TWCB 1HZAA 1IBKL 1BCPD 4FYDA 4DUYL 2AHOB 1WCMB 5EKIA 3VYUA 2A74C 4ME3A 4C2MB 3HOUB 1E2ZA 1II3A 3PIO3 4DAYA 3HOZG 1X3FA 3S14B 3T56B 4GOPB 2F0MA 3A5ZB 1S5FD 3J7AF 4M8AA 3BVMA 1GO3E 2NB0A 2IW3A 1HJPA 4CJ0B 3KBGA 1VQAA 2F0TA 4N8FA 4F88A 1RKNA 3T16A 2JA5B 3ER0A 1PHJA 3OIPA 3VR3A 1KIXA 1CHPD 1YJNA 4C3IH 4DV5L 1T9HA 3DM3A 2E5LQ 3HOVB 4J8QA 2VUMH 1ZYRC 1PLFA 5IYCG 5D3DA 4DV7L 2F0PA 1EYGA 3STBD 1I4XA 3U50C 4DR3Q 3A0JA 2A6HD 1GUWA 4KHVA 3QG1A 3K5MA 4GLXA 1PZID 1U4LA 2D2CC 4DV2Q 3R2IA 1TVXA 4RKLA 3U58A 2ZTCA 4FF1A 2JA8H 1XMOQ 1W6KA 4EQOA 4JI8Q 1LV9A 5D14A 1E2VA 4BBRG 1HR0L 2E2JH 2AMCB 1B9NA 3URYA 4F8MA 4MZ9A 3ITPA 2R7FA 3SXHA 5HURA 3FKIB 3ZJYC 4DV3L 2F0OA 4K5XA 5DEHA 1Q90A 3BZDB 3ZYYX 2L9HA 2KHIA 1UE5A 1HPCA 1JOOA 3K7UC 1Y8PB 2VQFL 1SXTA 2Y0SE 3Q8DA 1X3EA 4BBSB 3I90A 2ZM6L 4C56C 2MUYA 3JAMi 4UAIA 3T1HQ 3I4LA 1DJRD 2AWNA 2SOBA 3K57A 1KL9A 1HQRD 4KMUC 1UUPA 1FGUA 1QE6A 1HNWL 3BJUA 4YWMA 1D1KA 1C7YA 1Q82C 2Z6BA 4DPGA 2K04A 3A5UA 3KK7A 3M4QA 3C46A 2KHSA 3PUWA 3HOXH 5JVH3 1UAPA 2K05A 1VQEA 3EN2A 4ABNA 5C4HA 3HOWB 4X3KA 1W2BA 4FNFA 1B44D 3I4NG 2R3ZA 5M3FG 1GUTA 2QGQA 2HIXA 5IP9H 1K8OA 4LF8L 4OX9Q 1V1PA 2NYZD 4LWCA 4MN3A 4RGNA 4C3JB 3B6YA 3K8AA 3IAYA 5J1ZA 4QL5A 1A6XA 5I2XA 1VQKA 2L1BA 2VQEQ 3GQBA 3GV3A 1PH9A 2BOSA 1RJTA 2OTJA 2IHEA 2JA6B 5JJLA 3CF5A 4DV0Q 1KD1C 1G91A 4LF7L 2UXCQ 1QUQA 1EZ8A 2RBMA 4JI6L 2K1BA 2ENBA 1YNJC 4C3IG 5EGTA 4HJ8A 3LWEA 2D0PA 1GVPA 4FXKC 2VUMG 4BY1B 4BS9A 2PCFB 1HUNA 2NN6H 4JI0Q 1YHBA 4DNTB 2F0EA 4NMZA 5ELEA 4GOPA 4JI4L 2YYZA 2CW0D 1IW7D 2I0QA 5CV5A 3EJIA 4RHRA 4CJ1B 1SYBA 1YITA 3GTPB 3S1MB 4P72A 3U9OA 1D8LA 1KRTA 5GAEC 1SNQA 1PTOB 4RH6A 4RGOS 4B9XA 1TWGB 4IPHA 1HUMA 2K32A 4DK6C 4DR7L 4J6HA 1ET6A 1L2FA 2JEAI 2ICIA 1KLGD 2EE1A 5ELFA 2MFIA 2F4VQ 2DGYA 2B2VA 2E75C 3QB3A 1R4PB 1LLRD 4JI5Q 5JVG3 4UDUC 3E9HA 1JOKA 3OMGA 2KUMA 4OWTB 4JI1L 4BA1I 3JAMc 3SHLA 1YVCA 1FNWA 4ALPA 4A3DH 1UEAB 2E2IH 3U4ZA 1PTOF 4TVAB 4GOPC 4KK7A 5EAYA 1PXUA 2NN6I 1CKOA 3F8TA 2BA1A 1EFID 1FD7D 2UXBQ 4KKTA 3DUZA 1ENCA 1I3QH 3PF4A 2XRQD 3GTOH 4A3KH 1I4HA 4L5TA 5BR8L 2PNRC 3RR5A 1RL2A 3T1YL 2HDMA 1WTPA 4JW0A 4R4CA 5C4ZA 1HQMC 1KABA 1YNJD 3PGZA 4QB4A 1KAWA 1PYWD 3HOXG 1LTID 4GS3A 4XTCS 2B2VC 4R4TA 4B9WA 5M3MH 4HIDA 1FGBD 3S1NH 3NQTA 4HCEA 1E2WA 2EY2A 3AB9A 2HQLA 2PMZB 5DLQE 1ENAA 5ELDA 4TKOB 5IGEA 4JC0A 1C4QA 1E24A 3J80i 4ZQ3A 3CCMA 1PVOA 4A3EB 5IP9G 3S15H 1STGA 1EWIA 1Q1EA 3PF5A 1LM0A 4LF5Q 1B8AA 1D7QA 1EY7A 1I94Q 1D1IA 4A3IB 3GTGB 3HKZG 2UUCL 4IJHA 2R93H 5I6YA 4IUQA 3D4DA 4M1UB 2LY7A 4YIJA 2CVRA 1PFNA 4GNXB 2YTYA 4UP8A 4RWSC 1TY2A 1CM9A 2X69A 2AKWB 1KAAA 2A19A 1SNDA 5FO8B 2R92H 1BCPB 2NN6G 4IO9A 4XQNA 2QCPX 2DY7A 3VR6A 3MWYW 3S2HB 1WYDA 3L0OA 1D5ZC 2F0DA 2EYMA 2TMPA 3VYRA 3I4MG 1LT3D 1PYSB 1TT2A 1CUKA 2XGTA 4KY6A 4LFBL 4Y52H 5LMUQ 1WJJA 3PO3H 1K8GA 3CD6A 1K0SA 5IT9c 4J1MA 2Q2UA 4WRDA 4LF6Q 2R7ZG 1U4PA 4MHEA 2R7DA 2Z9HA 2NVTH 4C3HG 3TP6A 3AFQA 3VR5A 1N32Q 4DXFA 4HMIA 1EYCA 4JI2L 4LF9L 1FJGQ 1VQ7A 3U9SA 1MGSA 3GDEA 4KJOA 1VQDA 5FLXc 1VDZA 2EYOA 3LWUA 4A3MB 4P73A 5DNFA 5NUCA 4A3DG 4B08A 3M3YH 3CCLA 1WD0A 1DXMA 1QZGA 4DA2A 4NXNL 1YHQA 3GTMB 3TRZA 2KBNA 3A54A 2K5VA 5C4XH 5M5XB 4A3KG 3P7JA 2B63B 3QR8A 2RDGA 4DU9A 1STYA 3ULJA 4IFDH 2EYJA 3L9AX 1Q7YC 4DN4M 3GTLH 4AQYL 3MFYA 4K2KA 1YI2A 5C6AA 1VQ4A 2RHQB 1U4RA 2BA0A 4DAPA 3AU7A 1YBYA 4P71A 4G57A 5M3MG 2QEXA 3M9BA 4N9PA 4L6TB 1Y1VB 1EWHA 3TP8A 1KHIA 2XN9C 1WTQA 2K52A 5JJZA 1AZPA 4JBMA 3D8GA 4PMBA 2D0OA 4O2DA 4ME5A 3BYTB 1WVLA 3KF8B 1SNPA 3OWFA 3A55A 3JAME 1NUCA 3OYYA 4X66Q 3VA5A 1BF4A 1SNOA 1PH5A 1DOKA 1PTOC 2K7VA 3J7AV 1SMYD 3NTHA 2NVXH 1WTXA 5C3XA 4B3RQ 5ELBA 4DK0A 5C3EH 5EKLA 3CCRA 2R93G 5IY0A 1IBLQ 3PMFA 5I2YA 2DY8A 1PA6A 2UXDQ 1NAPA 3F1ZA 1UE1A 2XRSD 1Y1WH 4IFDI 1GHJA 3OHXC 3OSOA 3HOYH 2LS01 2R92G 4DR5Q 1YEZA 2FMCA 3I8ZA 2L4NA 4X3SA 4K0KL 2RA4A 4JYAL 4PZ8A 2D62A 3IFDA 2O2LD 1EEID 2Y0SG 4K5WA 2EY6A 5LMNL 1JB7A 1HA6A 1MHWC 3CAMA 5E7NA 4L5SA 1IBKQ 4DUYQ 1N33L 1LABA 2B2WA 3NEMA 3H3VH 2I46A 4KD4A 4RKBA 3FP9A 1QCBD 3VR2A 1PH6A 1Q46A 2B3GA 4X62L 2ALYB 1LTLA 2F0KA 2E2HH 2ZXRA 3MXPA 1D5MC 1XX8A 2VW9A 1PMRA 2NVQB 2EVBA 4OL7A 2UUBL 1AW7A 2G5DA 3A74A 1U0LA 2B8FA 2K5DA 4PMCA 4GLVB 2YV5A 5K36H 1JWUD 3I55A 1PTOD 1HTPA 1M1KC 4RCNA 5I6WA 1JR0D 1MSGA 2WAQG 3H94A 4RA8A 2NUCA 4DV5Q 2JA5G 1KXLA 3NELA 1G6ZA 4DV1L 2LKVA 2PZWA 1TWAH 2DN8A 1GUNA 4NP5A 3S17H 2B29A 3RN5A 5C4XG 4DV6L 1O7YA 2RF4A 4DV7Q 4R4IA 5IYCH 2AQ1B 3EQLC 5T1IA 4GNXC 4IFDG 1I5FA 2LXKA 1SYCA 2AUJD 1X3QA 1A62A 3GP7A 2CH4W 3H0GB 4XYOA 4IZ8A 5IT9E 3D6CA 1YZ6A 2CFMA 3UDXA 3WOEA 3CRKC 1RF2D 1BCPC 1ONLA 4K14A 1SJHD 3HKZE 3D3RA 3H3VI 1R4QB 3K81C 4XT1B 3CCQA 1HR0Q 4QCLA 1VQ5A 1BBWA 1S40A 2OWOA 1BDOA 4FXGC 3MFGA 1EQQA 1IL2A 2Q8IB 2N3SA 3QOLA 3MC0B 2EQSA 5FLXE 4QIWE 4CDCC 4DV3Q 1KDAA 2RSOA 3SK6A 4JI7L 1FR3A 1STEA 3K7AH 3T4AC 1GUGA 1HA5A 2VQFQ 1IZ6A 5C3EG 3EFXD 3NHHA 3HP3A 1G2SA 1SLJA 2ZM6Q 4Y7NB 3KDFB 4DXGA 1B9MA 4NPSA 4BBSG 2KCTA 4JBKA 1TWFB 4KKUA 3STBC 1HH2P 3NP8A 1K9MC 1CK1A 2A6HC 1Y1WG 1RHPA 4DGZA 1HNWQ 4L5RC 5C3WA 1Q81C 3TMEA 3HOYG 2YU9H 1GJXA 1K73C 1SYFA 2QA4A 2CCZA 1FNUA 1MBYA 1K83H 3J80E 3PO2B 1EUJA 2K01A 1F2LA 2F0SA 2KHJA 1PYBA 1EY0A 5JPMC 1HXYD 3GTJB 2A68C 3QOJA 1PH7A 4B3ML 4EGVA 3HOWG 4X6AH 2F0NA 2KCNA 3RLNA 1QUQB 4V190 1VF7A 3Q23A 2F3WA 4XXEA 2UUAL 4O1NA 2NVYH 4LF8Q 4H13C 3W2DA 4AYBE 3ICEA 2KQ3A 2EJFC 1WTWA 3FRPB 4XQQA 1C8CA 3R3OA 4DF7A 5E4XA 2K50A 2AQ3B 4IFDJ 3NBIA 4PNYA 3PV0A 1AE3A 5CBEE 1SROA 1EOTA 1HZ9A 4WJ3M 5K36G 1TWHH 4LF7Q 1S4ZA 3KFUA 2C5CA 4JI6Q 3FHWA 1EEFD 4RMFA 2Z6KA 3S1QH 1T5EA 1X65A 3MHBA 3PIPA 1QG7A 1UE7A 2BDNA 3CCUA 2K75A 1N36L 4IOAA 3I7FA 4JI4Q 2PI2E 1AEXA 4LMQD 4A3BB 2H1EA 4G4KA 4QF4A 1BXTA 3CC4A 4QGUA 1A15A 2SNSA 1E1OA 1OXTA 3UDGA 5JOBA 4OO1H 3E6ZX 1PRTB 4DR7Q 1V9PA 1AFPA 5GAGC 1UE6A 1KDBA 5K5PA 4DR2L 4N9TA 2R61A 3TSSA 2SDFA 2A68D 4XDXA 3NPPA 3HKSA 5ELCA 3KF6A 3AYHB 1PH2A 2DJFC 2JA7B 2CQAA 3EVQA 4L5QA 2Z6KC 4POGA 4JI1Q 5C4JH 3S1RB 2JE6I 2NWGA 5I4DA 1IHZA 1EU3A 1QNKA 1VQFA 4OGQC 3P75A 2F0IA 2ES2A 4A3CH 1H95A 1K0RA 2DNCA 4B3TL 1PRTF 1F2ZA 1CTMA 2I5MX 2B8GA 2CW0C 3PUZA 3KBXA 1IW7C 2HIVA 3D4RA 4ZK9B 5BR8Q 4U68A 3T1YQ 4JCVE
chains in the Genus database with same CATH topology
1IKLA 1OXVA 4DK1A 4IUUA 2Z4IA 5CMDA 4XT3B 3DWQA 1H9MA 1H9SA 4I7ZC 1I6VC 1SE2A 1BO0A 3NSWA 4WFN3 2HCIA 3SK4A 2JXMB 3A8IE 2EPBA 2QKIC 5DM73 2JP1A 4PMWA 2ZXPA 3ND9A 2QILA 4IUTA 3M85A 4A3FB 3Q22A 1QOHA 1AP0A 4RHSA 1GUSA 1K8MA 1ILPA 3RMHA 1STNA 4NW2A 5CBAE 3C2PA 3V05A 1F9SA 3O13A 1X32A 1A2UA 5M5YB 3HOZB 1SYDA 2BDOA 2ICEC 4NKLA 3C3LA 2XVSA 3DHQA 2KA7A 4TQUS 1Q8IA 1AN8A 3W3AA 4KTAA 4KD3A 2PZUA 1I6HB 3NUCA 1AZQA 1NCVA 1XTCD 4OO1G 1LACA 2Z8LA 1Z6HA 4FF4A 1ILQA 5CV9A 5CR3A 4KN7C 2PO4A 2HDLA 4BBRB 4IALA 4X3UA 2RDFA 5IODA 3SK5A 1A2TA 3D31A 2G9HD 1ZXTA 3G7LA 3S9WA 1Y8OB 2FJ2A 3DWPA 1TIID 1I4PA 4FO2A 2N55A 5J39A 1QNUA 1Q3LA 3SK8A 2JEBI 2O5JC 3NTKA 1F2MA 1SYEA 3K58A 4GZYC 3KLSX 3CQZB 4HSPA 1V1OA 5EJWA 3HG9A 5LL6X 2BCOA 3HS0C 1CZGA 4XQJA 3E0JA 4HN7A 1HHVA 1EYAA 3VR4A 3IFTA 2K5WA 1DZ1A 3MAQA 1HCZA 5G3LF 4TRDA 1PRTC 4HTHA 1S5DD 2WB1B 3I4NB 5M3FB 1SE4A 4C1NI 5CORA 1B4OA 1DYQA 2AQ2B 1VMPA 3KLSA 1JCKB 3N6RA 5C5MA 2EYHA 4PQXA 5ISRA 2RDHA 3TBIB 5KYIA 4RGTA 2B2YA 4Z9CB 3NK9A 3JAML 2K03A 3T51B 2IWHA 2J0TD 1Q12A 2RKSA 1HTLD 5FK9C 2WKCA 4C3IB 1Q1BA 3M4YA 3VYTA 4L63B 1WTVA 2KJXA 2NTTA 4K8IA 2VUMB 1SMYC 5EQ0A 4MIUA 2PW7A 3PUVA 2B39A 5KYLA 3L3OC 2PPBC 1C48A 4FVMA 3DEPA 2EYFA 2JA8B 4WJWA 3GD7A 4F7XA 4O42A 2E2JB 2CHBD 2FMMA 3CHBD 4S3SA 3I73A 1Y8NB 2KECA 1PRTD 2Q8TA 1DD2A 2EJMA 2JSOA 3OMCA 2EZVA 1JICA 3FDTA 3J7YW 2I07B 3MXGA 1RD9D 3HRZC 5E4WC 1TR5A 2BE5C 1ESFA 2PYKA 3BDOA 3IL8A 1W6JA 5A2QL 3E5SA 3I3CA 4OIKA 3RD4A 1GXDC 1B1ZA 2OXPA 2K5QA 3IKJA 2Z1CA 4EVOA 1RDPD 4G7HC 4ZKCB 3HOXB 1OXSC 4ILWA 3OOCA 2B2UA 1EIHA 1CA5A 1A3UA 5EPJA 3AMUA 3H91A 2XWJB 2L11A 3RLFA 5CYUA 5IT9L 3H09A 1G291 2IX1A 3DEOA 5EPLA 4KY7A 4KN4C 1KNEA 1TS3A 3HEJA 2F4IA 3HKZB 1L0YB 4QUFA 5FLXL 1J8IA 1J9OA 2NZ1D 5I9PA 2X6GA 2J7ZA 1CI3M 3H6MA 1DOMA 5KNDA 4QIWB 1JQYD 5IGBA 4DNRB 5JEAH 1KLUD 4H7BA 5IGGA 2BE5D 4CKBA 4BWGB 3MTSA 2WACA 3DWAA 4XIGS 5CC4A 5BN3A 5BN4A 5D3IB 3GTKB 5DM63 3KUPA 4DAVA 5A2QE 2PZTA 3TN2A 2TSSA 1MSHA 4OHJA 1WD1A 2F03A 3BDCA 3J80L 1IYUA 4HSVA 3BG3A 4PV1C 3J81L 1SDFA 1BNZA 1CHQD 1S5BD 4WORA 1SEBD 3UI2A 4HAEA 2MJ8A 5KIXA 2F0GA 1A3VA 4IUPA 5LHY1 1TS5A 4A3DB 2E2IB 4LK1C 1EY9A 2O4XA 3D4WA 2EOTA 2B2WC 1EZ6A 3FEWX 1IYVA 2EXZA 3KLRA 1I3QB 2E76C 4HR7B 5CV6A 3GTOB 4BA2I 4A3KB 1EY8A 1PTOH 3OW7A 3R8BA 4FP5D 3I70A 3L7ZC 5IGCA 2F3VA 1H9RA 1JWMD 1TU2B 1U9RA 2K28A 5M3MB 1QILA 5KRUA 1B2TA 3S1NB 5CV7A 2WKDA 3X3NA 4CJ2C 2A69D 4ZUIA 1H9SB 1SJED 2IJ0A 4IQZA 5EKKA 1EY5A 1WTRA 5KNCA 2R6GA 3S15B 5FOBB 1PDQA 2F0JA 2H4OA 1SYGA 1ZEQX 1LT6D 3K5LA 1O7LA 1RTNA 3DMUA 4K2LA 3TP5A 3K5NA 2R93B 4KI0A 4ZKBB 2EJGC 2F0FA 1ML0D 1EL0A 3CU7A 1LT5D 5T1GA 3J81E 1XXGA 4TSSA 5JEAG 4EQNA 1ZKOA 2R92B 2QF7A 4QUCA 4CKEA 3K0YA 2Y0SB 3D6WA 2FINB 3K5OA 4C3JG 4HCSA 2KVMA 3BVZA 2M2LA 4IUNA 3PO3B 2V4DA 5A35A 3Q24A 1I4QA 1HFNA 3RUZA 3OWEB 4E6IA 2NVTB 1TS2A 3MA2B 2IPKD 2F0HA 1IKMA 3TZDA 3MXNA 1B53A 3K6OA 2VB3X 1STHA 1V8QA 3M3YB 5E1FA 3BYYB 3R2TA 2WAQB 3LNNA 1JWSD 4C1NK 3ERQA 1EYDA 2KEDA 5C4XB 1SSOA 1JC7A 1FNVA 1TKWB 3SDZA 1CZWA 2SNMA 4Q5VA 1LTSD 3GTLB 2XNAC 1NR2A 4LAAA 1M4VA 2IT1A 2VNUD 3SVMA 1VF5C 2KCCA 3BVGA 1DM0B 4NDXA 5BN5A 2D5DA 1KNAA 3R93A 3K59A 2L55A 3TP7A 4KY5A 5JEAJ 5I9OA 5C5LA 4F87A 3FPPA 1EQVA 2NVXB 4DFAA 4RAUC 3C1FA 5C3EB 1S5CD 3A8JE 5TSSA 2PW5A 2HCCA 3MXUA 2EDGA 3SE0A 1D6EC 2L5TA 4OO1I 1M8AA 2Z4HA 4KV6A 1Y1WB 3Q0AA 2RVLA 3HOYB 4ZUJA 3SR1A 1SBBB 4U673 1TY0A 3Q6SA 2OEOA 4X3TA 1BOSA 1B50A 1O7ZA 5KNBA 2WV6D 5EBDA 1ZYRD 2WIIB 1Y69U 2HQEA 4LJZC 3HGBA 3WOFA 2MGSA 1CQVA 1O78A 1I4RA 1GUOA 1VMCA 2E2HB 4ZRZA 3I91A 2L0CA 3NXWA 4R9WA 5AFWA 2VXWA 3N52A 2N88A 2SEBD 3OIQA 1B3AA 1LTGD 1SE3A 5J22A 1Z7TA 1E0BA 1TWAB 3S17B 2G9DA 2C9OA 3G6JB 2F0UA 5FKAC 4K8JA 4H0LC 1LTTD 2J4XA 2LFNA 2QEJC 3NTIA 5D65A 1JOQA 2QDBA 2OT2A 4H44C 5M9OA 1CQFA 3ND8A 1EY6A 1TS4A 4CGYB 3C1EA 5IGFA 5C0XH 1BR9A 4KHZA 1RTOA 3K7AB 4HMJA 4JBWA 3CKIB 5COYA 4FXDA 1PFMA 3EROA 3A56A 1LTRD 3VA7A 5IGDA 2MHVA 1CA6A 1QJOA 2L12A 2YU9B 5CV4A 1HRJA 3WDNA 4CBVA 3A7AB 1K83B 1JORA 2KEEA 2EY1A 1WTOA 2RQXA 5FO7B 1Z47A 5C0XI 1BUVT 2NBFA 1OXXK 1LTAD 3BS1A 1ESRA 1T5XD 2NVYB 2GA4B 3FPUB 2FHTA 5JAVA 1KTKA 4L8JA 2K33A 1A3TA 4R8IA 3NE5B 2FFKB 1ET9A 1YNNC 1QB5D 4EQPA 1F2YA 4K6DA 5FO9B 5LL6S 4K6LA 2A6EC 1TWHB 2JYOA 2E74C 3DXJC 3QIAA 4QMGA 1ICWA 3S1QB 5IIFA 4FF2A 2DNEA 2ID0A 2HUGA 2EYPA 2K6AA 3A8KE 2EYLA 3PIP3 1JE4A 3NWSA 2ZXOA 5JPNC 2MPMA 3FMCA 2WP8J 1CT1D 1ENFA 1PZKD 1SNCA 3A7LA 3I72A 5IOCA 1MI2A 2B2YC 5C0XG 1X3PA 2XSCA 1BCPF 3HZXA 5C4JB 4OIJA 1PZJD 3NWTA 4ULLA 3H3VC 1EU4A 2EY5A 5EPKA 3ONAB 1F9RA 3TDQA 3QJYA 1YNND 2AUKA 1D5XC 1GHKA 2A6ED 4RCOA 5CGKA 4A93B 3M7GA 3GO5A 3GTQB 4ID6A 1LT4D 2NTSA 4IUVA 1STBA 2F1MA 1V43A 2F0QA 2OF1A 2M00A 3PUXA 1DONA 1RODA 1NR4A 1CFMA 3M7NA 4IURA 4KJNA 2MP1A 1SNMA 3GV6A 1OO9B 3P1HA 3DM1A 4FF3A 5E3FA 2A5HA 1OXUA 4Q0FA 3TZUA 3CRLC 1FYCA 1TQOA 1L0XB 2RSNA 3V2TA 1O80A 1DCZA 1BQQT 2Q8RE 4CHTB 3EA6A 4ZYSA 2D9UA 2O5IC 3V96A 1H9KA 4P2CB 4K5VA 3QO2A 2WINB 1NSNS 2B2TA 1JB3A 1EIGA 1EY4A 4A3JB 2B2UC 2E2DC 1U4MA 1F9QA 5KEEA 5C0XJ 4CKCA 4A3GB 2A69C 3T13A 3I4MB 1STAA 5C44B 2F0VA 2LMCB 1F9PA 1G8ZD 3RZOB 5DAUA 2R7ZB 2IX0A 3T53B 5HGTA 4HEDA 4ZLTF 1H9JA 4C3HB 2IX3A 2ZT9C 2VB2X 1S5ED 2F0WA 4I65A 2B2TC 3M4OB 4R8NA 4ODGA 4IN3A 1SFOB 1EQTA 1EWCA 3SEBA 1VCIA 5CV8A 3PUYA 1RCVD 2A73B 4ZAIA 3RZDB 1XYIA 1BBXC 4AYBB 3BDLA 4JK1C 2F0LA 1D2BA 1SAPA 2AWOA 1DOLA 4RGMA 5G3LD 2X6LA 3NQIA 3QWNA 1XWEA 4KKSA 5M5WB 5KGUA 3OPOA 3NBHA 3P20A 4BY7B 4G7ZC 1UNSA 1IL8A 2XIWA 1QWYA 3MVVA 1GOZA 1LO5D 5F2DA 3X3MA 5EBCA 4XYQA 4RFBA 1R9TB 3S2DB 2M9VA 3KF8A 1I50B 1V1PB 1KDCA 2PQEA 3LX0A 1HFGA 2XWBB 3S16B 2KOLA 3MZ5A 3FVQA 2IL8A 4G7OC 3VYSA 1F77A 1PFBA 3F2UA 1G2TA 1LTBD 3MEHA 4V0BA 1I4GA 1MD2D 1TWCB 1BCPD 4FYDA 1WCMB 5EKIA 3VYUA 2A74C 4C2MB 3HOUB 1E2ZA 1II3A 3PIO3 4DAYA 3S14B 3T56B 2F0MA 3J7AF 1S5FD 4M8AA 3BVMA 2NB0A 2IW3A 4CJ0B 3KBGA 2F0TA 4F88A 1RKNA 3T16A 2JA5B 3OIPA 3VR3A 1CHPD 3HOVB 4J8QA 1ZYRC 1PLFA 5D3DA 2F0PA 1I4XA 2A6HD 1GUWA 4KHVA 3QG1A 3K5MA 1PZID 1U4LA 2D2CC 3R2IA 1TVXA 4RKLA 4FF1A 1W6KA 4EQOA 1LV9A 5D14A 1E2VA 1B9NA 3URYA 4F8MA 3ITPA 5HURA 3SXHA 3FKIB 2F0OA 4K5XA 5DEHA 1Q90A 3BZDB 3ZYYX 2L9HA 1HPCA 1JOOA 1Y8PB 1SXTA 4BBSB 3I90A 4C56C 2MUYA 4UAIA 3I4LA 1DJRD 2AWNA 2SOBA 3K57A 4KMUC 1HQRD 1UUPA 1QE6A 1D1KA 2K04A 3KK7A 3C46A 2KHSA 3PUWA 5JVH3 1UAPA 2K05A 4ABNA 5C4HA 3HOWB 4X3KA 4FNFA 1B44D 2R3ZA 1GUTA 1K8OA 1V1PA 2NYZD 4MN3A 4RGNA 4C3JB 3IAYA 5J1ZA 1A6XA 5I2XA 2L1BA 3GQBA 3GV3A 2BOSA 1RJTA 2JA6B 1G91A 1EZ8A 2RBMA 2K1BA 2ENBA 1YNJC 4C3IG 5EGTA 3LWEA 4FXKC 4BY1B 4BS9A 2PCFB 1HUNA 2NN6H 4DNTB 2F0EA 4NMZA 5ELEA 2YYZA 2CW0D 1IW7D 5CV5A 3EJIA 4RHRA 4CJ1B 1SYBA 3GTPB 3S1MB 3U9OA 1SNQA 1PTOB 4RH6A 4RGOS 4B9XA 1TWGB 1HUMA 2K32A 4J6HA 1ET6A 2JEAI 2ICIA 1KLGD 2EE1A 5ELFA 2B2VA 2E75C 3QB3A 1R4PB 1LLRD 5JVG3 4UDUC 1JOKA 3OMGA 2KUMA 4BA1I 3SHLA 1FNWA 1UEAB 1PTOF 4KK7A 1PXUA 2NN6I 2BA1A 1EFID 1FD7D 4KKTA 3DUZA 1ENCA 2XRQD 1I4HA 2PNRC 2HDMA 1WTPA 5C4ZA 1HQMC 1KABA 1YNJD 4QB4A 1PYWD 1LTID 4XTCS 2B2VC 4B9WA 1FGBD 3NQTA 4HCEA 1E2WA 2EY2A 3AB9A 2PMZB 1ENAA 5ELDA 4TKOB 5IGEA 1C4QA 4ZQ3A 4A3EB 1STGA 1Q1EA 1EY7A 1D1IA 4A3IB 3GTGB 5I6YA 4IUQA 3D4DA 4M1UB 2LY7A 4YIJA 2CVRA 1PFNA 4RWSC 1TY2A 1CM9A 2X69A 1KAAA 1SNDA 5FO8B 1BCPB 2NN6G 4XQNA 2QCPX 2DY7A 3VR6A 3MWYW 3S2HB 1D5ZC 2F0DA 2EYMA 2TMPA 3VYRA 1LT3D 1TT2A 4KY6A 4J1MA 4WRDA 1U4PA 4MHEA 4C3HG 3TP6A 3VR5A 4DXFA 4HMIA 1EYCA 3U9SA 1MGSA 4KJOA 1VDZA 2EYOA 3LWUA 4A3MB 5DNFA 5NUCA 4B08A 1WD0A 1DXMA 4DA2A 3GTMB 3A54A 5M5XB 3P7JA 2B63B 2RDGA 4DU9A 1STYA 4IFDH 2EYJA 3L9AX 4DN4M 3MFYA 4K2KA 5C6AA 1U4RA 2BA0A 4DAPA 3AU7A 4G57A 4N9PA 4L6TB 1Y1VB 1EWHA 3TP8A 2XN9C 1WTQA 5JJZA 1AZPA 3D8GA 4PMBA 4ME5A 3BYTB 1WVLA 1SNPA 3OWFA 3A55A 3JAME 1NUCA 3VA5A 1BF4A 1SNOA 1DOKA 1PTOC 2K7VA 3J7AV 1SMYD 3NTHA 1WTXA 5C3XA 5ELBA 4DK0A 5EKLA 3PMFA 5I2YA 2DY8A 1NAPA 2XRSD 4IFDI 1GHJA 3OHXC 3OSOA 2LS01 2FMCA 3I8ZA 2L4NA 4X3SA 2RA4A 2D62A 3IFDA 2O2LD 1EEID 4K5WA 2EY6A 1HA6A 1LABA 2B2WA 2I46A 4KD4A 4RKBA 1QCBD 3VR2A 2F0KA 2ZXRA 3MXPA 1D5MC 1XX8A 1PMRA 2NVQB 2EVBA 4OL7A 1AW7A 2B8FA 2K5DA 4PMCA 5K36H 1JWUD 1PTOD 1HTPA 4RCNA 5I6WA 1JR0D 1MSGA 3H94A 4RA8A 2NUCA 1G6ZA 2LKVA 2PZWA 2DN8A 1GUNA 4NP5A 1O7YA 2AQ1B 3EQLC 5T1IA 4IFDG 1SYCA 2AUJD 1X3QA 3GP7A 3H0GB 4XYOA 4IZ8A 5IT9E 3D6CA 3WOEA 3CRKC 1RF2D 1BCPC 1ONLA 4K14A 1SJHD 3D3RA 1R4QB 4XT1B 4QCLA 1BDOA 4FXGC 3MFGA 2Q8IB 3QOLA 3MC0B 5FLXE 1KDAA 2RSOA 3SK6A 1FR3A 1STEA 3T4AC 1GUGA 1HA5A 3EFXD 3NHHA 3HP3A 1G2SA 4Y7NB 4DXGA 1B9MA 1TWFB 4KKUA 3NP8A 1CK1A 2A6HC 1RHPA 4DGZA 5C3WA 3TMEA 1GJXA 1SYFA 1FNUA 1MBYA 3J80E 3PO2B 2K01A 1F2LA 2F0SA 1EY0A 5JPMC 1HXYD 3GTJB 2A68C 3QOJA 4EGVA 2F0NA 2KCNA 4V190 1VF7A 3Q23A 2F3WA 4XXEA 4O1NA 4H13C 3W2DA 2KQ3A 2EJFC 1WTWA 3FRPB 4XQQA 1C8CA 3R3OA 4DF7A 5E4XA 2AQ3B 4IFDJ 3NBIA 4PNYA 3PV0A 5CBEE 1EOTA 5K36G 1S4ZA 2C5CA 1EEFD 1T5EA 3MHBA 1QG7A 2BDNA 1AEXA 4LMQD 4A3BB 2H1EA 4G4KA 4QF4A 1BXTA 1A15A 2SNSA 1OXTA 5JOBA 4OO1H 3E6ZX 1PRTB 1AFPA 1KDBA 5K5PA 4N9TA 2R61A 3TSSA 2SDFA 2A68D 4XDXA 3NPPA 5ELCA 2JA7B 2CQAA 3EVQA 3S1RB 2JE6I 2NWGA 5I4DA 1IHZA 1EU3A 1QNKA 4OGQC 3P75A 2F0IA 2DNCA 1PRTF 1F2ZA 1CTMA 2B8GA 2CW0C 3PUZA 3KBXA 1IW7C 3D4RA 4ZK9B 4U68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKL A;  1XX8 A;  1J8I A;  3SVM A;  2MP1 A;  1DOL A;  3GV6 A;  4X3U A;  2B2V C;  3DM1 A;  2NYZ D;  1DOM A;  4MN3 A;  3P7J A;  4IUU A;  5CMD A;  2X6L A;  1KNA A;  4XT3 B;  1ZXT A;  2JYO A;  1RTN A;  3R93 A;  2L1B A;  3DEP A;  3G7L A;  1WTW A;  1ICW A;  2FJ2 A;  3GV3 A;  1C8C A;  1MSG A;  4RA8 A;  1RJT A;  2HUG A;  1PLF A;  2RSN A;  4DN4 M;  5E4X A;  4ZKB B;  1G6Z A;  1BO0 A;  1O80 A;  2N55 A;  5D65 A;  4O42 A;  2Q8R E;  1ML0 D;  3MTS A;  1U4R A;  2HCI A;  1Q3L A;  2EPB A;  1JE4 A;  2FMM A;  2D9U A;  1G91 A;  1EL0 A;  2JP1 A;  2K1B A;  1O7Y A;  2KEC A;  1EOT A;  4RAU C;  5T1G A;  2Q8T A;  5CBE E;  1GUW A;  3QO2 A;  1JIC A;  3LWE A;  4IUT A;  3KUP A;  5T1I A;  1S4Z A;  2B2T A;  1U4L A;  2MPM A;  3FDT A;  5EJW A;  1WTQ A;  1TVX A;  1AP0 A;  5JJZ A;  1AZP A;  1IL8 A;  4QUC A;  3TN2 A;  1HUN A;  1MSH A;  2HCC A;  1EIG A;  1X3Q A;  1WVL A;  4IUQ A;  2XIW A;  1WD1 A;  1LV9 A;  2B2U C;  1ILP A;  5D14 A;  1U4M A;  1F9Q A;  1QG7 A;  1M8A A;  3D6W A;  4HSV A;  2FIN B;  4NW2 A;  1DOK A;  2CVR A;  1RTO A;  1PFN A;  5CBA E;  1BF4 A;  1HHV A;  4RWS C;  5E4W C;  1F9S A;  1CM9 A;  2BDN A;  2RVL A;  2X69 A;  1X32 A;  4CJ1 B;  1SDF A;  1WTX A;  1BNZ A;  1DZ1 A;  4HCS A;  2KVM A;  3IL8 A;  4XT1 B;  2M2L A;  1MI2 A;  2B2Y C;  4LMQ D;  5COY A;  3I3C A;  4OIK A;  3UI2 A;  1X3P A;  2H1E A;  1PFM A;  2MJ8 A;  4HAE A;  1HFN A;  3Q6S A;  4IUP A;  4X3T A;  2L9H A;  1F9P A;  1B50 A;  2DY7 A;  1HUM A;  2DY8 A;  3MWY W;  1A15 A;  2RSO A;  1O7Z A;  4OIJ A;  1NAP A;  2EE1 A;  1CA6 A;  4ZKC B;  3I90 A;  2EOT A;  2L12 A;  1IKM A;  1HFG A;  2B2V A;  2B2W C;  2KOL A;  5COR A;  4HED A;  3TZD A;  4UAI A;  5EPK A;  4ZLT F;  1B4O A;  1B53 A;  2IL8 A;  3ONA B;  1HRJ A;  1VMP A;  3HP3 A;  2B2U A;  1G2S A;  3I8Z A;  2L4N A;  4X3S A;  1F9R A;  2SDF A;  2RA4 A;  4XDX A;  2KUM A;  1EIH A;  2B2T C;  2KEE A;  1CA5 A;  1QE6 A;  1AZQ A;  5EPJ A;  1U4P A;  1PFB A;  3IFD A;  4MHE A;  2MGS A;  3F2U A;  1NCV A;  1WTO A;  1G2T A;  1EQT A;  3H91 A;  1RHP A;  1VMC A;  2L11 A;  2K04 A;  4ZAI A;  2B2Y A;  2NWG A;  1QNK A;  3I91 A;  2K03 A;  2KED A;  2K28 A;  1MGS A;  1XYI A;  2K05 A;  1HA6 A;  3DEO A;  4R9W A;  5AFW A;  4IUV A;  1BBX C;  1B2T A;  1ILQ A;  5EPL A;  1SSO A;  1ESR A;  5EKI A;  4CJ2 C;  3FPU B;  2FHT A;  1WTV A;  2VXW A;  1KNE A;  5DNF A;  4X3K A;  3N52 A;  2N88 A;  2K01 A;  1DON A;  2B2W A;  1F2L A;  4R8I A;  2HDM A;  4QUF A;  3KBX A;  1ROD A;  1NR4 A;  1B3A A;  2HDL A;  1WTP A;  2R3Z A;  1WD0 A;  1NR2 A;  2FFK B;  4ZK9 B;  1WTR A;  1SAP A;  5EQ0 A;  4U68 A;  4CJ0 B;  1E0B A;  1J9O A;  4IUR A;  2NZ1 D;  2X6G A;  2J7Z A;  1PDQ A; 
#chains in the Genus database with same CATH topology
 1IKL A;  4A93 H;  2JK8 A;  1OXV A;  3GTQ H;  4DK1 A;  1X3G A;  1HNX L;  4IUU A;  2Z4I A;  5CMD A;  4XT3 B;  3DWQ A;  1H9M A;  3G4S A;  1J6Q A;  1H9S A;  4I7Z C;  4GKJ L;  3KDF A;  1I6V C;  1SE2 A;  1W3S A;  1BO0 A;  3NSW A;  4LFC L;  4A3L H;  2NZO A;  4WFN 3;  2HCI A;  3SK4 A;  2JXM B;  3A8I E;  2EPB A;  1XNR L;  4A76 A;  2QKI C;  2MO0 A;  5DM7 3;  4OWX B;  2JP1 A;  4PMW A;  2GVA A;  2WAQ E;  2ZXP A;  3ND9 A;  2QIL A;  4IUT A;  3M85 A;  4A3F B;  3Q22 A;  1QOH A;  1AP0 A;  4RHS A;  1GUS A;  3VDY A;  1K8M A;  1XJV A;  1ILP A;  3RMH A;  2UUC Q;  3CCV A;  1STN A;  4NW2 A;  4A3I G;  5CBA E;  3C2P A;  3V05 A;  3PQI A;  1F9S A;  3O13 A;  1X32 A;  1A2U A;  5M5Y B;  1X6O A;  1A8V A;  3HOZ B;  3CMA A;  1SYD A;  2BDO A;  4DUZ L;  2ICE C;  4NKL A;  4A3J H;  3C3L A;  2MQH A;  2XVS A;  3DHQ A;  1ASZ A;  2KA7 A;  4TQU S;  5J3B A;  1Q8I A;  1AN8 A;  3W3A A;  4KTA A;  4GKK L;  4KD3 A;  2PZU A;  1SN8 A;  3I4M H;  1I6H B;  3NUC A;  4MNO A;  4LFB Q;  1AZQ A;  3GTK H;  5C44 H;  1NCV A;  3RZO H;  4YY3 L;  2OQK A;  1XTC D;  2VZA A;  4OO1 G;  1LAC A;  4JI3 L;  2Z8L A;  1Z6H A;  2R7Z H;  1XNQ L;  1PH8 A;  4FF4 A;  5H1S E;  1ILQ A;  5CV9 A;  5CR3 A;  4C3H H;  2YTX A;  4JI2 Q;  4LF9 Q;  2QW7 A;  3M4O H;  2EXD A;  4KN7 C;  4HJ5 A;  1SFO H;  4LFA L;  4WJ4 A;  2PO4 A;  2HDL A;  3CP0 A;  3W1B A;  4BBR B;  4IAL A;  4A3M G;  3RZD H;  4X3U A;  2RDF A;  5IOD A;  3SK5 A;  4A3C G;  1A2T A;  4NXN Q;  3D31 A;  2G9H D;  1KRS A;  3ULP A;  1ZXT A;  3G7L A;  3S9W A;  1Y8O B;  3WWV A;  2FJ2 A;  3DWP A;  3L2P A;  3G6E A;  1TII D;  1I4P A;  4FO2 A;  2N55 A;  2HT1 A;  5J39 A;  1QNU A;  4A93 G;  1Q3L A;  3F2D A;  3SK8 A;  1S3O A;  2JEB I;  2O5J C;  3NTK A;  1F2M A;  1SYE A;  4AQY Q;  2UU9 L;  2Q2T A;  3K58 A;  4IOC A;  4GZY C;  2K5N A;  3KLS X;  3D0F A;  4NXM L;  1N8R C;  3CQZ B;  4HSP A;  1V1O A;  5EJW A;  3HG9 A;  5LL6 X;  1L1O A;  2BCO A;  3HS0 C;  1CZG A;  1YIJ A;  4XQJ A;  4A3L G;  3E0J A;  4HN7 A;  1HHV A;  1EYA A;  3VR4 A;  4LNQ A;  3IFT A;  1RIP A;  2K5W A;  5M5W H;  1DZ1 A;  1IXR A;  3MAQ A;  1HCZ A;  2K5H A;  4BY7 H;  5G3L F;  4H02 A;  3J81 i;  4TRD A;  1PRT C;  4DNI A;  1VQI A;  4HTH A;  4BXX H;  2Q2I A;  3RN2 A;  1WI5 A;  1NMF A;  1S5D D;  2WB1 B;  3I4N B;  3AEV A;  5M3F B;  1SE4 A;  4C1N I;  5COR A;  4UHV A;  2F52 A;  1B4O A;  1DYQ A;  2AQ2 B;  2K4K A;  3F2C A;  4QQB X;  1VMP A;  1JE5 A;  2A8V A;  3KLS A;  1JCK B;  3N6R A;  3SGI A;  5C5M A;  3W1G A;  5IE8 A;  3OTO L;  3K0X A;  1R9T H;  4A3J G;  2EYH A;  4K0K Q;  3S2D H;  4PQX A;  1G51 A;  5ISR A;  2RDH A;  3F2B A;  3TBI B;  1I50 H;  4HJ9 A;  4DR4 L;  5KYI A;  4JYA Q;  3PCO B;  4RGT A;  4A3G G;  2B2Y A;  4Z9C B;  3NK9 A;  3JAM L;  2K03 A;  3T51 B;  2IWH A;  3S16 H;  2J0T D;  1Q12 A;  2RKS A;  1J5E L;  1HTL D;  5FK9 C;  2WKC A;  4C3I B;  4JV5 L;  5LMN Q;  1Q1B A;  3M4Y A;  3VYT A;  4L63 B;  1WTV A;  5C44 G;  2KJX A;  2NTT A;  4IPD A;  1TXY A;  4K8I A;  2VUM B;  3CCJ A;  4FDB A;  1B3Q A;  4B3S L;  1SMY C;  5EQ0 A;  1E22 A;  1N33 Q;  1VQN A;  4MIU A;  2PW7 A;  3PUV A;  2B39 A;  1TWC H;  5KYL A;  3L3O C;  1X54 A;  2PPB C;  1N9W A;  4CDD C;  4X62 Q;  1WCM H;  1C48 A;  4C2M H;  3HOU H;  4FVM A;  2UUB Q;  3DEP A;  2YTV A;  3S14 H;  2EYF A;  2JA8 B;  4WJW A;  3GD7 A;  4F7X A;  4O42 A;  2E2J B;  2CHB D;  2FMM A;  3KYH C;  3CHB D;  4S3S A;  1FL0 A;  3I73 A;  1Y8N B;  2KEC A;  1PRT D;  2JA5 H;  4DV1 Q;  2Q8T A;  1DD2 A;  2EJM A;  3CPF A;  2JSO A;  3OMC A;  4AYB G;  1JIC A;  2EZV A;  4J15 A;  2ATW A;  3FDT A;  4MTN A;  3J7Y W;  4DV6 Q;  2CWA A;  1C9O A;  2I07 B;  3HOV H;  3MXG A;  1RD9 D;  2JN4 A;  2PMZ E;  1SMX A;  3HRZ C;  5E4W C;  4UPA A;  1TR5 A;  2BE5 C;  4UY8 C;  1ESF A;  4AH6 A;  2PYK A;  3BDO A;  3IL8 A;  4DR6 L;  1W6J A;  3BZC A;  2VL6 A;  3CCE A;  5A2Q L;  3E5S A;  3I3C A;  4JVZ A;  4OIK A;  3RD4 A;  3J80 c;  1VQ9 A;  3KLW A;  1GXD C;  1B1Z A;  2OXP A;  4RG1 A;  2K5Q A;  1XMQ L;  3IKJ A;  2Z1C A;  4EVO A;  3J81 c;  1RDP D;  4G7H C;  3KOJ A;  4ZKC B;  1Q8K A;  3HOX B;  4OON A;  4JI7 Q;  1OXS C;  1Y14 B;  1EQR A;  4ILW A;  4BY7 G;  3OOC A;  2B2U A;  3FKI H;  1EIH A;  4BXX G;  1CA5 A;  1A3U A;  1E1T A;  1GKH A;  5EPJ A;  3AMU A;  3H91 A;  2XWJ B;  4P74 A;  1C0A A;  1VQM A;  2L11 A;  3RLF A;  5CYU A;  4YHH L;  5IT9 L;  4BBS H;  3H09 A;  1G29 1;  2IX1 A;  3DEO A;  5EPL A;  4KY7 A;  4KN4 C;  3I2Z A;  1KNE A;  1NTG A;  1TS3 A;  1AH9 A;  3HEJ A;  2F4I A;  2VS1 A;  1L0Y B;  3HKZ B;  4LF4 L;  4QUF A;  3CXC A;  5FLX L;  1J8I A;  1J9O A;  2NZ1 D;  5I9P A;  2X6G A;  2J7Z A;  1CI3 M;  5JJI A;  3H6M A;  1DOM A;  4B3M Q;  5KND A;  4QIW B;  2Q2H A;  5IWA L;  1JQY D;  5IGB A;  4DNR B;  5JEA H;  3HOW H;  1KLU D;  2CQO A;  4H7B A;  4OXP A;  5IGG A;  2BE5 D;  4CKB A;  2UUA Q;  4BWG B;  3MXN B;  3MTS A;  1KC8 C;  2WAC A;  4LUV A;  3DWA A;  3E0E A;  4XIG S;  5CC4 A;  5BN3 A;  1EOV A;  5BN4 A;  1K8A C;  5D3I B;  1WCM G;  3GTK B;  3S24 A;  1EFW A;  3HOU G;  4C3J H;  5IYB H;  5DM6 3;  3KUP A;  4DAV A;  2MO1 A;  5A2Q E;  2N49 A;  2PZT A;  3TN2 A;  2TSS A;  1MSH A;  3CW2 C;  4OHJ A;  1WD1 A;  2F03 A;  3BDC A;  3J80 L;  1GD7 A;  1IYU A;  2JA6 H;  4HSV A;  3BG3 A;  4PV1 C;  2JQO A;  3J81 L;  1SDF A;  1BNZ A;  1Z9F A;  1CHQ D;  1S5B D;  4WOR A;  1SEB D;  3UI2 A;  3HOV G;  4HAE A;  1N36 Q;  1BVS A;  2MJ8 A;  5KIX A;  2F0G A;  1A3V A;  4IUP A;  5LHY 1;  1BKB A;  1TS5 A;  1CKN A;  3KF6 B;  4BY1 H;  4A3D B;  2E2I B;  4LK1 C;  1EY9 A;  2RCF A;  2O4X A;  3D4W A;  2EOT A;  2K14 A;  2B2W C;  1EZ6 A;  3FEW X;  4LUO A;  1Q86 C;  1LUZ A;  3GTP H;  1IYV A;  3S1M H;  2EXZ A;  3KLR A;  1I3Q B;  2E76 C;  4HR7 B;  5CV6 A;  3GTO B;  4BA2 I;  4A3K B;  5AJ3 L;  1EY8 A;  1PTO H;  3OW7 A;  3R8B A;  4FP5 D;  1TWG H;  3I70 A;  4DR2 Q;  3L7Z C;  1SE8 A;  5IGC A;  3CC7 A;  2F3V A;  2MNA A;  1H9R A;  1JWM D;  1TU2 B;  1U9R A;  1OTC A;  2K28 A;  5M3M B;  1QIL A;  1WTH A;  5KRU A;  1B2T A;  3FKI G;  3S1N B;  5CV7 A;  2WKD A;  3LGJ A;  3X3N A;  4CJ2 C;  4X65 L;  2A69 D;  4ZUI A;  1H9S B;  1SJE D;  2IJ0 A;  4IQZ A;  2LXJ A;  1IBM L;  5EKK A;  1EY5 A;  1WTR A;  5KNC A;  4B3T Q;  2R6G A;  3S15 B;  2ZJQ A;  5FOB B;  1PDQ A;  1HNZ L;  2F0J A;  3KJO A;  2H4O A;  1SYG A;  2DUD A;  5IYD H;  1IYJ B;  1ZEQ X;  2JA9 A;  1YNX A;  4UP9 A;  1LT6 D;  3UDI A;  5FLM H;  1O7L A;  1RTN A;  3DMU A;  4K2L A;  3TP5 A;  3K5N A;  3K5L A;  2R93 B;  4KI0 A;  2BH2 A;  1HNX Q;  4ZKB B;  2EJG C;  2F0F A;  1ML0 D;  4GKJ Q;  1EL0 A;  3CU7 A;  1LT5 D;  5T1G A;  3J81 E;  4LFC Q;  4JOI A;  1XXG A;  4TSS A;  5JEA G;  4EQN A;  1XNR Q;  1ZKO A;  2R92 B;  5ELO A;  2WFW A;  2QF7 A;  4QUC A;  3CPW A;  4CKE A;  1CSQ A;  3K0Y A;  1ICF B;  2Y0S B;  3D6W A;  2FIN B;  3J7Z C;  4A3E H;  2Z0S A;  2GN5 A;  3K5O A;  4C3J G;  4HCS A;  2KVM A;  5IYB G;  3BVZ A;  2M2L A;  4IUN A;  3E3X A;  3PO3 B;  2V4D A;  3RLO A;  5A35 A;  4A3I H;  2C35 B;  3GTG H;  3Q24 A;  1I4Q A;  1HFN A;  4CDE C;  1JJC B;  3RUZ A;  1NMG A;  3OWE B;  2JA6 G;  4E6I A;  2NVT B;  1TS2 A;  4R4O A;  1EIY B;  4ZCK A;  3TQY A;  3MA2 B;  2IPK D;  3ERS X;  2F0H A;  4DUZ Q;  1IKM A;  3TZD A;  2PQA A;  3MXN A;  1B53 A;  2I5H A;  2HHH L;  3K6O A;  4JOI C;  2VB3 X;  1STH A;  4APV A;  4BY1 G;  1V8Q A;  3M3Y B;  5E1F A;  3BYY B;  4GKK Q;  3R2T A;  4GN5 A;  2ZTE A;  1MJC A;  3S2H H;  4KHP L;  2WAQ B;  3LNN A;  1O7I A;  4DR1 L;  1JWS D;  4C1N K;  1SR3 A;  3ERQ A;  1EYD A;  1JT8 A;  2KED A;  4YY3 Q;  1SRU A;  5C4X B;  4JG2 A;  4JI3 Q;  1SSO A;  1JC7 A;  1FNV A;  1XNQ Q;  3JC6 6;  1TKW B;  3SDZ A;  1CZW A;  2SNM A;  4Q5V A;  1LTS D;  3GTL B;  2XNA C;  1NR2 A;  4LAA A;  1M4V A;  1AE2 A;  2IT1 A;  1QVG A;  4PZ7 A;  4LFA Q;  2VNU D;  3SVM A;  1VF5 C;  2KCC A;  3BVG A;  2CKZ B;  1DM0 B;  4NDX A;  4A75 A;  5BN5 A;  2D5D A;  1KNA A;  4A3M H;  1L1O B;  3R93 A;  4DAM A;  3K59 A;  2L55 A;  3TP7 A;  4KY5 A;  5JEA J;  5I9O A;  5C5L A;  1GM5 A;  4F87 A;  3FPP A;  1EQV A;  5FJ8 H;  5IP7 H;  3GTM H;  2NVX B;  4DFA A;  5IYD G;  4RAU C;  3C1F A;  1PH4 A;  1VQB A;  1PV4 A;  5FLM G;  5C3E B;  1N34 L;  5M5X H;  1S5C D;  2B63 H;  3A8J E;  2UU9 Q;  4X64 L;  5TSS A;  1E7Z A;  2PW5 A;  2HCC A;  4QY7 A;  3MXU A;  1BBU A;  2EDG A;  4NXM Q;  3SE0 A;  3H15 A;  1D6E C;  2L5T A;  4OO1 I;  1M8A A;  1PFS A;  2Z4H A;  4KV6 A;  1A0I A;  3UDF A;  1Y1W B;  3Q0A A;  2RVL A;  3HOY B;  4ZUJ A;  2PI2 A;  3SR1 A;  1SBB B;  1Y1V H;  4OEM B;  4U67 3;  1TY0 A;  5L37 A;  3Q6S A;  2OEO A;  4X3T A;  1YJW A;  1BOS A;  1JJ2 A;  1B50 A;  1MKH A;  1O7Z A;  5GQO A;  5KNB A;  4A3E G;  2WV6 D;  5EBD A;  1ZYR D;  2WII B;  1Y69 U;  1VQ6 A;  2HQE A;  4LJZ C;  1VQ8 A;  3HGB A;  2RHS B;  2LSS A;  4GLA C;  4DV4 L;  2WB1 G;  1HZC A;  4P75 A;  3WOF A;  2MGS A;  1CQV A;  1O78 A;  1VQO A;  3OTO Q;  1I4R A;  1GUO A;  1VMC A;  2CH4 A;  2E2H B;  4ZRZ A;  2I5L X;  3I91 A;  1U5K A;  4DR4 Q;  2L0C A;  3NXW A;  4R9W A;  5AFW A;  1HZB A;  4A3G H;  2VXW A;  1X55 A;  1J5E Q;  3N52 A;  2N88 A;  1K28 A;  1JMC A;  2SEB D;  4JV5 Q;  4LW1 A;  3OIQ A;  1B3A A;  1LTG D;  1SE3 A;  5J22 A;  1Z7T A;  1E0B A;  1TWA B;  3S17 B;  2G9D A;  2C9O A;  4B3S Q;  3G6J B;  2EIF A;  1KQS A;  2F0U A;  5FKA C;  2E5L L;  4K8J A;  2H5X A;  4H0L C;  1LTT D;  1M90 C;  1QVF A;  2J4X A;  2LFN A;  2QEJ C;  2NZH A;  2V1C C;  4DR3 L;  5JJK A;  3NTI A;  5D65 A;  1JOQ A;  2QDB A;  2OT2 A;  4H44 C;  4DV2 L;  5M9O A;  2JA8 G;  2NVQ H;  1CQF A;  2JJQ A;  1XMO L;  2IY5 B;  3M4P A;  3ND8 A;  1EY6 A;  4JI8 L;  4JBJ A;  4YCV A;  1TS4 A;  1VQC A;  3EIV A;  4CGY B;  1XPU A;  3C1E A;  5IGF A;  5C0X H;  1BR9 A;  4OEL B;  1P8L A;  4KHZ A;  5FJ8 G;  5IP7 G;  1RTO A;  3K7A B;  2A1A A;  4LUZ A;  5GAD C;  4HMJ A;  2B63 G;  2ZJP A;  4JBW A;  3CKI B;  5COY A;  3J81 j;  4FXD A;  4OWW B;  1PFM A;  3CME A;  3ERO A;  4DR6 Q;  3A56 A;  1LTR D;  3VA7 A;  2N8N A;  3H0G H;  5IGD A;  5GAH C;  2MHV A;  3T1H L;  1CA6 A;  1QJO A;  2XTI A;  2L12 A;  4YWK A;  2YU9 B;  1XMQ Q;  5CV4 A;  1Y1V G;  1HRJ A;  3WDN A;  4CBV A;  3A7A B;  1K83 B;  1JOR A;  2KEE A;  2EY1 A;  3TS0 A;  4HIO A;  1WTO A;  2FXQ A;  2OTL A;  2RQX A;  5FO7 B;  1Z47 A;  1VQJ A;  5C0X I;  2GVB A;  1B70 B;  1BUV T;  2NBF A;  1K3R A;  1OXX K;  1E3P A;  1LTA D;  2CWP A;  3BS1 A;  4AIM A;  1ESR A;  2ASB A;  4YHH Q;  1T5X D;  2NVY B;  4YCU A;  2GA4 B;  3FPU B;  2FHT A;  4Y7N H;  4IJL A;  4YCW A;  5JAV A;  1KTK A;  1TWF H;  4L8J A;  3CCS A;  2K33 A;  1A3T A;  4R8I A;  3NE5 B;  4OX9 L;  2FFK B;  1L1O C;  1ET9 A;  1YNN C;  1QB5 D;  4R1J A;  4EQP A;  1F2Y A;  4LF4 Q;  2DJG C;  4A4I A;  4K6D A;  5FO9 B;  5LL6 S;  2VQE L;  4K6L A;  2A6E C;  1VQH A;  1TWH B;  3AFP A;  1VQP A;  1CKM A;  1ASY A;  1NJI C;  2JYO A;  2E74 C;  3DXJ C;  3QIA A;  4QJF A;  4QMG A;  1L0W A;  3PO2 H;  4DV0 L;  1ICW A;  3S1Q B;  5IIF A;  4FF2 A;  1DGS A;  2UXC L;  2DNE A;  2ID0 A;  2HUG A;  2EYP A;  5IWA Q;  2K6A A;  3A8K E;  3OW2 A;  2EYL A;  3GTJ H;  4UP7 A;  3PIP 3;  1JE4 A;  3NWS A;  1NBW A;  2ZXO A;  2OCE A;  2IHF A;  4GN4 B;  4JI0 L;  1PH1 A;  2KEN A;  5JPN C;  2MPM A;  4EQ5 A;  1S72 A;  2KCM A;  3FMC A;  2WP8 J;  1CKN B;  3PIO A;  1VQG A;  3W5O A;  1CT1 D;  1ENF A;  1PZK D;  1SNC A;  3A7L A;  3I72 A;  4KLK A;  1YHA A;  5IOC A;  3RNU A;  3KJP A;  1MI2 A;  3BZK A;  2B2Y C;  2RCN A;  5C0X G;  4I7A A;  1X3P A;  2XSC A;  1BCP F;  3HZX A;  2F4V L;  5C4J B;  1LYL A;  1WOC A;  4OIJ A;  4JI5 L;  1PZJ D;  3NWT A;  4ULL A;  3H3V C;  1EU4 A;  3IRB A;  2EY5 A;  5EPK A;  4IPG A;  1VS0 A;  3ONA B;  1F9R A;  3TDQ A;  4A3B H;  3QJY A;  1YNN D;  3TEH B;  2AUK A;  3H0G G;  1D5X C;  1GHK A;  2A6E D;  5AJ3 Q;  2WB1 E;  3NBH B;  4RCO A;  5CGK A;  2UXB L;  4A93 B;  2HD3 A;  3M7G A;  3GO5 A;  3GTQ B;  4ID6 A;  1LT4 D;  2NTS A;  3TRE A;  4IUV A;  1STB A;  2PNH A;  3K80 C;  2F1M A;  1V43 A;  5GRO A;  5LMN W;  2F0Q A;  2OF1 A;  2M00 A;  3PUX A;  1DON A;  4X65 Q;  2JA7 H;  1ROD A;  1NR4 A;  1CFM A;  1PH3 A;  3M7N A;  3S1R H;  4DKA C;  4IUR A;  4KJN A;  4HIM A;  2MP1 A;  1IBM Q;  4JPB W;  1SNM A;  3GV6 A;  1MJE A;  1OO9 B;  3P1H A;  3DM1 A;  4FF3 A;  5E3F A;  3DLL A;  2E8G A;  2A5H A;  1OXU A;  4Q0F A;  3TZU A;  3ULL A;  1HNZ Q;  3CRL C;  4HIK A;  1FYC A;  1TQO A;  1L0X B;  1XPR A;  4NB3 A;  2RSN A;  3V2T A;  1O80 A;  4LF5 L;  1DCZ A;  1BQQ T;  2Q8R E;  4CHT B;  1QZH A;  3EA6 A;  4ZYS A;  1I94 L;  2D9U A;  2O5I C;  4YWL A;  3V96 A;  1H9K A;  4P2C B;  4K5V A;  2L15 A;  3QO2 A;  2WIN B;  5HY6 A;  1NSN S;  2P5Z X;  2B2T A;  3PO2 G;  1CSP A;  1JB3 A;  1EIG A;  1EY4 A;  4EX5 A;  4A3J B;  2B2U C;  2E2D C;  1U4M A;  1F9Q A;  3PSI A;  5KEE A;  5C0X J;  4CKC A;  4A3G B;  1NNX A;  4DAY B;  2PQA B;  2A69 C;  3T13 A;  3I4M B;  1B7Y B;  4A3F H;  5ELN A;  4GN3 B;  1STA A;  5C44 B;  2F0V A;  2LMC B;  4DK3 C;  1F9P A;  1G8Z D;  3CC2 A;  3RZO B;  5DAU A;  5LMU L;  3PO3 G;  2R7Z B;  2IX0 A;  4GNX A;  3T53 B;  1WFQ A;  3I4O A;  5HGT A;  4HED A;  4ZLT F;  4LF6 L;  1H9J A;  3BU2 A;  4C3H B;  5M5Y H;  2IX3 A;  2ZT9 C;  3HFZ B;  2VB2 X;  3NEN A;  1S5E D;  2F0W A;  4MTK A;  4I65 A;  2B2T C;  3M4O B;  3G71 A;  4R8N A;  4ODG A;  4IN3 A;  2HHH Q;  1SFO B;  3HOZ H;  1N32 L;  1EQT A;  1XPO A;  1FJG L;  1EWC A;  3SEB A;  1X56 A;  1VCI A;  5CV8 A;  2OQ0 A;  3PUY A;  1RCV D;  3J7A 5;  2A73 B;  1YJ9 A;  4ZAI A;  3RZD B;  4KHP Q;  1XYI A;  1QVC A;  2ZJR A;  1BBX C;  4DR1 Q;  2N78 A;  1UEB A;  4A3B G;  4AYB B;  3BDL A;  4JK1 C;  1I6H H;  2F0L A;  1NY4 A;  2QDL A;  3UE0 A;  1D2B A;  1NE3 A;  1SAP A;  3AQQ A;  2AWO A;  1DOL A;  4POF A;  4RGM A;  2ZTD A;  5G3L D;  1P16 A;  2X6L A;  2JA7 G;  3NQI A;  3QWN A;  1XWE A;  4HJA A;  4KKS A;  4BBR H;  5M5W B;  1JJG A;  5KGU A;  3OPO A;  3NBH A;  3P20 A;  4BY7 B;  4PG3 A;  4G7Z C;  1FVI A;  3U4V A;  1UNS A;  3E9I A;  3MEF A;  1IL8 A;  3EBE A;  1K3B C;  4X66 L;  4PZ6 A;  1XTD A;  1G6P A;  1N34 Q;  2XIW A;  1QWY A;  3MVV A;  4X64 Q;  1GOZ A;  4B3R L;  4CDF C;  1LO5 D;  5F2D A;  3TS2 A;  1VQL A;  3X3M A;  1IBL L;  5EBC A;  2BH8 A;  2F3I A;  4XYQ A;  4RFB A;  3CQZ H;  1UWV A;  2UXD L;  4O0A A;  5HGQ A;  1R9T B;  1V1Q A;  3S2D B;  2M9V A;  3KF8 A;  1I50 B;  1V1P B;  1KDC A;  3UE1 A;  2PQE A;  4DR5 L;  3LX0 A;  1HFG A;  2XWB B;  3S16 B;  3I56 A;  2KOL A;  1A63 A;  1MIU A;  3MZ5 A;  3FVQ A;  2IL8 A;  4A3F G;  1X9N A;  4G7O C;  2VY3 A;  3VYS A;  1EIF A;  4HJ7 A;  1F77 A;  1PFB A;  3F2U A;  1HR0 W;  4DV4 Q;  1G2T A;  3G48 A;  1LTB D;  3MEH A;  4V0B A;  1I4G A;  1MD2 D;  3I4N H;  4R4Q A;  5M3F H;  4IPC A;  4N8X 1;  1TWC B;  1HZA A;  1IBK L;  1BCP D;  4FYD A;  4DUY L;  2AHO B;  1WCM B;  5EKI A;  3VYU A;  2A74 C;  4ME3 A;  4C2M B;  3HOU B;  1E2Z A;  1II3 A;  3PIO 3;  4DAY A;  3HOZ G;  1X3F A;  3S14 B;  3T56 B;  4GOP B;  2F0M A;  3A5Z B;  1S5F D;  3J7A F;  4M8A A;  3BVM A;  1GO3 E;  2NB0 A;  2IW3 A;  1HJP A;  4CJ0 B;  3KBG A;  1VQA A;  2F0T A;  4N8F A;  4F88 A;  1RKN A;  3T16 A;  2JA5 B;  3ER0 A;  1PHJ A;  3OIP A;  3VR3 A;  1KIX A;  1CHP D;  1YJN A;  4C3I H;  4DV5 L;  1T9H A;  3DM3 A;  2E5L Q;  3HOV B;  4J8Q A;  2VUM H;  1ZYR C;  1PLF A;  5IYC G;  5D3D A;  4DV7 L;  2F0P A;  1EYG A;  3STB D;  1I4X A;  3U50 C;  4DR3 Q;  3A0J A;  2A6H D;  1GUW A;  4KHV A;  3QG1 A;  3K5M A;  4GLX A;  1PZI D;  1U4L A;  2D2C C;  4DV2 Q;  3R2I A;  1TVX A;  4RKL A;  3U58 A;  2ZTC A;  4FF1 A;  2JA8 H;  1XMO Q;  1W6K A;  4EQO A;  4JI8 Q;  1LV9 A;  5D14 A;  1E2V A;  4BBR G;  1HR0 L;  2E2J H;  2AMC B;  1B9N A;  3URY A;  4F8M A;  4MZ9 A;  3ITP A;  2R7F A;  3SXH A;  5HUR A;  3FKI B;  3ZJY C;  4DV3 L;  2F0O A;  4K5X A;  5DEH A;  1Q90 A;  3BZD B;  3ZYY X;  2L9H A;  2KHI A;  1UE5 A;  1HPC A;  1JOO A;  3K7U C;  1Y8P B;  2VQF L;  1SXT A;  2Y0S E;  3Q8D A;  1X3E A;  4BBS B;  3I90 A;  2ZM6 L;  4C56 C;  2MUY A;  3JAM i;  4UAI A;  3T1H Q;  3I4L A;  1DJR D;  2AWN A;  2SOB A;  3K57 A;  1KL9 A;  1HQR D;  4KMU C;  1UUP A;  1FGU A;  1QE6 A;  1HNW L;  3BJU A;  4YWM A;  1D1K A;  1C7Y A;  1Q82 C;  2Z6B A;  4DPG A;  2K04 A;  3A5U A;  3KK7 A;  3M4Q A;  3C46 A;  2KHS A;  3PUW A;  3HOX H;  5JVH 3;  1UAP A;  2K05 A;  1VQE A;  3EN2 A;  4ABN A;  5C4H A;  3HOW B;  4X3K A;  1W2B A;  4FNF A;  1B44 D;  3I4N G;  2R3Z A;  5M3F G;  1GUT A;  2QGQ A;  2HIX A;  5IP9 H;  1K8O A;  4LF8 L;  4OX9 Q;  1V1P A;  2NYZ D;  4LWC A;  4MN3 A;  4RGN A;  4C3J B;  3B6Y A;  3K8A A;  3IAY A;  5J1Z A;  4QL5 A;  1A6X A;  5I2X A;  1VQK A;  2L1B A;  2VQE Q;  3GQB A;  3GV3 A;  1PH9 A;  2BOS A;  1RJT A;  2OTJ A;  2IHE A;  2JA6 B;  5JJL A;  3CF5 A;  4DV0 Q;  1KD1 C;  1G91 A;  4LF7 L;  2UXC Q;  1QUQ A;  1EZ8 A;  2RBM A;  4JI6 L;  2K1B A;  2ENB A;  1YNJ C;  4C3I G;  5EGT A;  4HJ8 A;  3LWE A;  2D0P A;  1GVP A;  4FXK C;  2VUM G;  4BY1 B;  4BS9 A;  2PCF B;  1HUN A;  2NN6 H;  4JI0 Q;  1YHB A;  4DNT B;  2F0E A;  4NMZ A;  5ELE A;  4GOP A;  4JI4 L;  2YYZ A;  2CW0 D;  1IW7 D;  2I0Q A;  5CV5 A;  3EJI A;  4RHR A;  4CJ1 B;  1SYB A;  1YIT A;  3GTP B;  3S1M B;  4P72 A;  3U9O A;  1D8L A;  1KRT A;  5GAE C;  1SNQ A;  1PTO B;  4RH6 A;  4RGO S;  4B9X A;  1TWG B;  4IPH A;  1HUM A;  2K32 A;  4DK6 C;  4DR7 L;  4J6H A;  1ET6 A;  1L2F A;  2JEA I;  2ICI A;  1KLG D;  2EE1 A;  5ELF A;  2MFI A;  2F4V Q;  2DGY A;  2B2V A;  2E75 C;  3QB3 A;  1R4P B;  1LLR D;  4JI5 Q;  5JVG 3;  4UDU C;  3E9H A;  1JOK A;  3OMG A;  2KUM A;  4OWT B;  4JI1 L;  4BA1 I;  3JAM c;  3SHL A;  1YVC A;  1FNW A;  4ALP A;  4A3D H;  1UEA B;  2E2I H;  3U4Z A;  1PTO F;  4TVA B;  4GOP C;  4KK7 A;  5EAY A;  1PXU A;  2NN6 I;  1CKO A;  3F8T A;  2BA1 A;  1EFI D;  1FD7 D;  2UXB Q;  4KKT A;  3DUZ A;  1ENC A;  1I3Q H;  3PF4 A;  2XRQ D;  3GTO H;  4A3K H;  1I4H A;  4L5T A;  5BR8 L;  2PNR C;  3RR5 A;  1RL2 A;  3T1Y L;  2HDM A;  1WTP A;  4JW0 A;  4R4C A;  5C4Z A;  1HQM C;  1KAB A;  1YNJ D;  3PGZ A;  4QB4 A;  1KAW A;  1PYW D;  3HOX G;  1LTI D;  4GS3 A;  4XTC S;  2B2V C;  4R4T A;  4B9W A;  5M3M H;  4HID A;  1FGB D;  3S1N H;  3NQT A;  4HCE A;  1E2W A;  2EY2 A;  3AB9 A;  2HQL A;  2PMZ B;  5DLQ E;  1ENA A;  5ELD A;  4TKO B;  5IGE A;  4JC0 A;  1C4Q A;  1E24 A;  3J80 i;  4ZQ3 A;  3CCM A;  1PVO A;  4A3E B;  5IP9 G;  3S15 H;  1STG A;  1EWI A;  1Q1E A;  3PF5 A;  1LM0 A;  4LF5 Q;  1B8A A;  1D7Q A;  1EY7 A;  1I94 Q;  1D1I A;  4A3I B;  3GTG B;  3HKZ G;  2UUC L;  4IJH A;  2R93 H;  5I6Y A;  4IUQ A;  3D4D A;  4M1U B;  2LY7 A;  4YIJ A;  2CVR A;  1PFN A;  4GNX B;  2YTY A;  4UP8 A;  4RWS C;  1TY2 A;  1CM9 A;  2X69 A;  2AKW B;  1KAA A;  2A19 A;  1SND A;  5FO8 B;  2R92 H;  1BCP B;  2NN6 G;  4IO9 A;  4XQN A;  2QCP X;  2DY7 A;  3VR6 A;  3MWY W;  3S2H B;  1WYD A;  3L0O A;  1D5Z C;  2F0D A;  2EYM A;  2TMP A;  3VYR A;  3I4M G;  1LT3 D;  1PYS B;  1TT2 A;  1CUK A;  2XGT A;  4KY6 A;  4LFB L;  4Y52 H;  5LMU Q;  1WJJ A;  3PO3 H;  1K8G A;  3CD6 A;  1K0S A;  5IT9 c;  4J1M A;  2Q2U A;  4WRD A;  4LF6 Q;  2R7Z G;  1U4P A;  4MHE A;  2R7D A;  2Z9H A;  2NVT H;  4C3H G;  3TP6 A;  3AFQ A;  3VR5 A;  1N32 Q;  4DXF A;  4HMI A;  1EYC A;  4JI2 L;  4LF9 L;  1FJG Q;  1VQ7 A;  3U9S A;  1MGS A;  3GDE A;  4KJO A;  1VQD A;  5FLX c;  1VDZ A;  2EYO A;  3LWU A;  4A3M B;  4P73 A;  5DNF A;  5NUC A;  4A3D G;  4B08 A;  3M3Y H;  3CCL A;  1WD0 A;  1DXM A;  1QZG A;  4DA2 A;  4NXN L;  1YHQ A;  3GTM B;  3TRZ A;  2KBN A;  3A54 A;  2K5V A;  5C4X H;  5M5X B;  4A3K G;  3P7J A;  2B63 B;  3QR8 A;  2RDG A;  4DU9 A;  1STY A;  3ULJ A;  4IFD H;  2EYJ A;  3L9A X;  1Q7Y C;  4DN4 M;  3GTL H;  4AQY L;  3MFY A;  4K2K A;  1YI2 A;  5C6A A;  1VQ4 A;  2RHQ B;  1U4R A;  2BA0 A;  4DAP A;  3AU7 A;  1YBY A;  4P71 A;  4G57 A;  5M3M G;  2QEX A;  3M9B A;  4N9P A;  4L6T B;  1Y1V B;  1EWH A;  3TP8 A;  1KHI A;  2XN9 C;  1WTQ A;  2K52 A;  5JJZ A;  1AZP A;  4JBM A;  3D8G A;  4PMB A;  2D0O A;  4O2D A;  4ME5 A;  3BYT B;  1WVL A;  3KF8 B;  1SNP A;  3OWF A;  3A55 A;  3JAM E;  1NUC A;  3OYY A;  4X66 Q;  3VA5 A;  1BF4 A;  1SNO A;  1PH5 A;  1DOK A;  1PTO C;  2K7V A;  3J7A V;  1SMY D;  3NTH A;  2NVX H;  1WTX A;  5C3X A;  4B3R Q;  5ELB A;  4DK0 A;  5C3E H;  5EKL A;  3CCR A;  2R93 G;  5IY0 A;  1IBL Q;  3PMF A;  5I2Y A;  2DY8 A;  1PA6 A;  2UXD Q;  1NAP A;  3F1Z A;  1UE1 A;  2XRS D;  1Y1W H;  4IFD I;  1GHJ A;  3OHX C;  3OSO A;  3HOY H;  2LS0 1;  2R92 G;  4DR5 Q;  1YEZ A;  2FMC A;  3I8Z A;  2L4N A;  4X3S A;  4K0K L;  2RA4 A;  4JYA L;  4PZ8 A;  2D62 A;  3IFD A;  2O2L D;  1EEI D;  2Y0S G;  4K5W A;  2EY6 A;  5LMN L;  1JB7 A;  1HA6 A;  1MHW C;  3CAM A;  5E7N A;  4L5S A;  1IBK Q;  4DUY Q;  1N33 L;  1LAB A;  2B2W A;  3NEM A;  3H3V H;  2I46 A;  4KD4 A;  4RKB A;  3FP9 A;  1QCB D;  3VR2 A;  1PH6 A;  1Q46 A;  2B3G A;  4X62 L;  2ALY B;  1LTL A;  2F0K A;  2E2H H;  2ZXR A;  3MXP A;  1D5M C;  1XX8 A;  2VW9 A;  1PMR A;  2NVQ B;  2EVB A;  4OL7 A;  2UUB L;  1AW7 A;  2G5D A;  3A74 A;  1U0L A;  2B8F A;  2K5D A;  4PMC A;  4GLV B;  2YV5 A;  5K36 H;  1JWU D;  3I55 A;  1PTO D;  1HTP A;  1M1K C;  4RCN A;  5I6W A;  1JR0 D;  1MSG A;  2WAQ G;  3H94 A;  4RA8 A;  2NUC A;  4DV5 Q;  2JA5 G;  1KXL A;  3NEL A;  1G6Z A;  4DV1 L;  2LKV A;  2PZW A;  1TWA H;  2DN8 A;  1GUN A;  4NP5 A;  3S17 H;  2B29 A;  3RN5 A;  5C4X G;  4DV6 L;  1O7Y A;  2RF4 A;  4DV7 Q;  4R4I A;  5IYC H;  2AQ1 B;  3EQL C;  5T1I A;  4GNX C;  4IFD G;  1I5F A;  2LXK A;  1SYC A;  2AUJ D;  1X3Q A;  1A62 A;  3GP7 A;  2CH4 W;  3H0G B;  4XYO A;  4IZ8 A;  5IT9 E;  3D6C A;  1YZ6 A;  2CFM A;  3UDX A;  3WOE A;  3CRK C;  1RF2 D;  1BCP C;  1ONL A;  4K14 A;  1SJH D;  3HKZ E;  3D3R A;  3H3V I;  1R4Q B;  3K81 C;  4XT1 B;  3CCQ A;  1HR0 Q;  4QCL A;  1VQ5 A;  1BBW A;  1S40 A;  2OWO A;  1BDO A;  4FXG C;  3MFG A;  1EQQ A;  1IL2 A;  2Q8I B;  2N3S A;  3QOL A;  3MC0 B;  2EQS A;  5FLX E;  4QIW E;  4CDC C;  4DV3 Q;  1KDA A;  2RSO A;  3SK6 A;  4JI7 L;  1FR3 A;  1STE A;  3K7A H;  3T4A C;  1GUG A;  1HA5 A;  2VQF Q;  1IZ6 A;  5C3E G;  3EFX D;  3NHH A;  3HP3 A;  1G2S A;  1SLJ A;  2ZM6 Q;  4Y7N B;  3KDF B;  4DXG A;  1B9M A;  4NPS A;  4BBS G;  2KCT A;  4JBK A;  1TWF B;  4KKU A;  3STB C;  1HH2 P;  3NP8 A;  1K9M C;  1CK1 A;  2A6H C;  1Y1W G;  1RHP A;  4DGZ A;  1HNW Q;  4L5R C;  5C3W A;  1Q81 C;  3TME A;  3HOY G;  2YU9 H;  1GJX A;  1K73 C;  1SYF A;  2QA4 A;  2CCZ A;  1FNU A;  1MBY A;  1K83 H;  3J80 E;  3PO2 B;  1EUJ A;  2K01 A;  1F2L A;  2F0S A;  2KHJ A;  1PYB A;  1EY0 A;  5JPM C;  1HXY D;  3GTJ B;  2A68 C;  3QOJ A;  1PH7 A;  4B3M L;  4EGV A;  3HOW G;  4X6A H;  2F0N A;  2KCN A;  3RLN A;  1QUQ B;  4V19 0;  1VF7 A;  3Q23 A;  2F3W A;  4XXE A;  2UUA L;  4O1N A;  2NVY H;  4LF8 Q;  4H13 C;  3W2D A;  4AYB E;  3ICE A;  2KQ3 A;  2EJF C;  1WTW A;  3FRP B;  4XQQ A;  1C8C A;  3R3O A;  4DF7 A;  5E4X A;  2K50 A;  2AQ3 B;  4IFD J;  3NBI A;  4PNY A;  3PV0 A;  1AE3 A;  5CBE E;  1SRO A;  1EOT A;  1HZ9 A;  4WJ3 M;  5K36 G;  1TWH H;  4LF7 Q;  1S4Z A;  3KFU A;  2C5C A;  4JI6 Q;  3FHW A;  1EEF D;  4RMF A;  2Z6K A;  3S1Q H;  1T5E A;  1X65 A;  3MHB A;  3PIP A;  1QG7 A;  1UE7 A;  2BDN A;  3CCU A;  2K75 A;  1N36 L;  4IOA A;  3I7F A;  4JI4 Q;  2PI2 E;  1AEX A;  4LMQ D;  4A3B B;  2H1E A;  4G4K A;  4QF4 A;  1BXT A;  3CC4 A;  4QGU A;  1A15 A;  2SNS A;  1E1O A;  1OXT A;  3UDG A;  5JOB A;  4OO1 H;  3E6Z X;  1PRT B;  4DR7 Q;  1V9P A;  1AFP A;  5GAG C;  1UE6 A;  1KDB A;  5K5P A;  4DR2 L;  4N9T A;  2R61 A;  3TSS A;  2SDF A;  2A68 D;  4XDX A;  3NPP A;  3HKS A;  5ELC A;  3KF6 A;  3AYH B;  1PH2 A;  2DJF C;  2JA7 B;  2CQA A;  3EVQ A;  4L5Q A;  2Z6K C;  4POG A;  4JI1 Q;  5C4J H;  3S1R B;  2JE6 I;  2NWG A;  5I4D A;  1IHZ A;  1EU3 A;  1QNK A;  1VQF A;  4OGQ C;  3P75 A;  2F0I A;  2ES2 A;  4A3C H;  1H95 A;  1K0R A;  2DNC A;  4B3T L;  1PRT F;  1F2Z A;  1CTM A;  2I5M X;  2B8G A;  2CW0 C;  3PUZ A;  3KBX A;  1IW7 C;  2HIV A;  3D4R A;  4ZK9 B;  5BR8 Q;  4U68 A;  3T1Y Q;  4JCV E; 
#chains in the Genus database with same CATH homology
 1IKL A;  1OXV A;  4DK1 A;  4IUU A;  2Z4I A;  5CMD A;  4XT3 B;  3DWQ A;  1H9M A;  1H9S A;  4I7Z C;  1I6V C;  1SE2 A;  1BO0 A;  3NSW A;  4WFN 3;  2HCI A;  3SK4 A;  2JXM B;  3A8I E;  2EPB A;  2QKI C;  5DM7 3;  2JP1 A;  4PMW A;  2ZXP A;  3ND9 A;  2QIL A;  4IUT A;  3M85 A;  4A3F B;  3Q22 A;  1QOH A;  1AP0 A;  4RHS A;  1GUS A;  1K8M A;  1ILP A;  3RMH A;  1STN A;  4NW2 A;  5CBA E;  3C2P A;  3V05 A;  1F9S A;  3O13 A;  1X32 A;  1A2U A;  5M5Y B;  3HOZ B;  1SYD A;  2BDO A;  2ICE C;  4NKL A;  3C3L A;  2XVS A;  3DHQ A;  2KA7 A;  4TQU S;  1Q8I A;  1AN8 A;  3W3A A;  4KTA A;  4KD3 A;  2PZU A;  1I6H B;  3NUC A;  1AZQ A;  1NCV A;  1XTC D;  4OO1 G;  1LAC A;  2Z8L A;  1Z6H A;  4FF4 A;  1ILQ A;  5CV9 A;  5CR3 A;  4KN7 C;  2PO4 A;  2HDL A;  4BBR B;  4IAL A;  4X3U A;  2RDF A;  5IOD A;  3SK5 A;  1A2T A;  3D31 A;  2G9H D;  1ZXT A;  3G7L A;  3S9W A;  1Y8O B;  2FJ2 A;  3DWP A;  1TII D;  1I4P A;  4FO2 A;  2N55 A;  5J39 A;  1QNU A;  1Q3L A;  3SK8 A;  2JEB I;  2O5J C;  3NTK A;  1F2M A;  1SYE A;  3K58 A;  4GZY C;  3KLS X;  3CQZ B;  4HSP A;  1V1O A;  5EJW A;  3HG9 A;  5LL6 X;  2BCO A;  3HS0 C;  1CZG A;  4XQJ A;  3E0J A;  4HN7 A;  1HHV A;  1EYA A;  3VR4 A;  3IFT A;  2K5W A;  1DZ1 A;  3MAQ A;  1HCZ A;  5G3L F;  4TRD A;  1PRT C;  4HTH A;  1S5D D;  2WB1 B;  3I4N B;  5M3F B;  1SE4 A;  4C1N I;  5COR A;  1B4O A;  1DYQ A;  2AQ2 B;  1VMP A;  3KLS A;  1JCK B;  3N6R A;  5C5M A;  2EYH A;  4PQX A;  5ISR A;  2RDH A;  3TBI B;  5KYI A;  4RGT A;  2B2Y A;  4Z9C B;  3NK9 A;  3JAM L;  2K03 A;  3T51 B;  2IWH A;  2J0T D;  1Q12 A;  2RKS A;  1HTL D;  5FK9 C;  2WKC A;  4C3I B;  1Q1B A;  3M4Y A;  3VYT A;  4L63 B;  1WTV A;  2KJX A;  2NTT A;  4K8I A;  2VUM B;  1SMY C;  5EQ0 A;  4MIU A;  2PW7 A;  3PUV A;  2B39 A;  5KYL A;  3L3O C;  2PPB C;  1C48 A;  4FVM A;  3DEP A;  2EYF A;  2JA8 B;  4WJW A;  3GD7 A;  4F7X A;  4O42 A;  2E2J B;  2CHB D;  2FMM A;  3CHB D;  4S3S A;  3I73 A;  1Y8N B;  2KEC A;  1PRT D;  2Q8T A;  1DD2 A;  2EJM A;  2JSO A;  3OMC A;  2EZV A;  1JIC A;  3FDT A;  3J7Y W;  2I07 B;  3MXG A;  1RD9 D;  3HRZ C;  5E4W C;  1TR5 A;  2BE5 C;  1ESF A;  2PYK A;  3BDO A;  3IL8 A;  1W6J A;  5A2Q L;  3E5S A;  3I3C A;  4OIK A;  3RD4 A;  1GXD C;  1B1Z A;  2OXP A;  2K5Q A;  3IKJ A;  2Z1C A;  4EVO A;  1RDP D;  4G7H C;  4ZKC B;  3HOX B;  1OXS C;  4ILW A;  3OOC A;  2B2U A;  1EIH A;  1CA5 A;  1A3U A;  5EPJ A;  3AMU A;  3H91 A;  2XWJ B;  2L11 A;  3RLF A;  5CYU A;  5IT9 L;  3H09 A;  1G29 1;  2IX1 A;  3DEO A;  5EPL A;  4KY7 A;  4KN4 C;  1KNE A;  1TS3 A;  3HEJ A;  2F4I A;  3HKZ B;  1L0Y B;  4QUF A;  5FLX L;  1J8I A;  1J9O A;  2NZ1 D;  5I9P A;  2X6G A;  2J7Z A;  1CI3 M;  3H6M A;  1DOM A;  5KND A;  4QIW B;  1JQY D;  5IGB A;  4DNR B;  5JEA H;  1KLU D;  4H7B A;  5IGG A;  2BE5 D;  4CKB A;  4BWG B;  3MTS A;  2WAC A;  3DWA A;  4XIG S;  5CC4 A;  5BN3 A;  5BN4 A;  5D3I B;  3GTK B;  5DM6 3;  3KUP A;  4DAV A;  5A2Q E;  2PZT A;  3TN2 A;  2TSS A;  1MSH A;  4OHJ A;  1WD1 A;  2F03 A;  3BDC A;  3J80 L;  1IYU A;  4HSV A;  3BG3 A;  4PV1 C;  3J81 L;  1SDF A;  1BNZ A;  1CHQ D;  1S5B D;  4WOR A;  1SEB D;  3UI2 A;  4HAE A;  2MJ8 A;  5KIX A;  2F0G A;  1A3V A;  4IUP A;  5LHY 1;  1TS5 A;  4A3D B;  2E2I B;  4LK1 C;  1EY9 A;  2O4X A;  3D4W A;  2EOT A;  2B2W C;  1EZ6 A;  3FEW X;  1IYV A;  2EXZ A;  3KLR A;  1I3Q B;  2E76 C;  4HR7 B;  5CV6 A;  3GTO B;  4BA2 I;  4A3K B;  1EY8 A;  1PTO H;  3OW7 A;  3R8B A;  4FP5 D;  3I70 A;  3L7Z C;  5IGC A;  2F3V A;  1H9R A;  1JWM D;  1TU2 B;  1U9R A;  2K28 A;  5M3M B;  1QIL A;  5KRU A;  1B2T A;  3S1N B;  5CV7 A;  2WKD A;  3X3N A;  4CJ2 C;  2A69 D;  4ZUI A;  1H9S B;  1SJE D;  2IJ0 A;  4IQZ A;  5EKK A;  1EY5 A;  1WTR A;  5KNC A;  2R6G A;  3S15 B;  5FOB B;  1PDQ A;  2F0J A;  2H4O A;  1SYG A;  1ZEQ X;  1LT6 D;  3K5L A;  1O7L A;  1RTN A;  3DMU A;  4K2L A;  3TP5 A;  3K5N A;  2R93 B;  4KI0 A;  4ZKB B;  2EJG C;  2F0F A;  1ML0 D;  1EL0 A;  3CU7 A;  1LT5 D;  5T1G A;  3J81 E;  1XXG A;  4TSS A;  5JEA G;  4EQN A;  1ZKO A;  2R92 B;  2QF7 A;  4QUC A;  4CKE A;  3K0Y A;  2Y0S B;  3D6W A;  2FIN B;  3K5O A;  4C3J G;  4HCS A;  2KVM A;  3BVZ A;  2M2L A;  4IUN A;  3PO3 B;  2V4D A;  5A35 A;  3Q24 A;  1I4Q A;  1HFN A;  3RUZ A;  3OWE B;  4E6I A;  2NVT B;  1TS2 A;  3MA2 B;  2IPK D;  2F0H A;  1IKM A;  3TZD A;  3MXN A;  1B53 A;  3K6O A;  2VB3 X;  1STH A;  1V8Q A;  3M3Y B;  5E1F A;  3BYY B;  3R2T A;  2WAQ B;  3LNN A;  1JWS D;  4C1N K;  3ERQ A;  1EYD A;  2KED A;  5C4X B;  1SSO A;  1JC7 A;  1FNV A;  1TKW B;  3SDZ A;  1CZW A;  2SNM A;  4Q5V A;  1LTS D;  3GTL B;  2XNA C;  1NR2 A;  4LAA A;  1M4V A;  2IT1 A;  2VNU D;  3SVM A;  1VF5 C;  2KCC A;  3BVG A;  1DM0 B;  4NDX A;  5BN5 A;  2D5D A;  1KNA A;  3R93 A;  3K59 A;  2L55 A;  3TP7 A;  4KY5 A;  5JEA J;  5I9O A;  5C5L A;  4F87 A;  3FPP A;  1EQV A;  2NVX B;  4DFA A;  4RAU C;  3C1F A;  5C3E B;  1S5C D;  3A8J E;  5TSS A;  2PW5 A;  2HCC A;  3MXU A;  2EDG A;  3SE0 A;  1D6E C;  2L5T A;  4OO1 I;  1M8A A;  2Z4H A;  4KV6 A;  1Y1W B;  3Q0A A;  2RVL A;  3HOY B;  4ZUJ A;  3SR1 A;  1SBB B;  4U67 3;  1TY0 A;  3Q6S A;  2OEO A;  4X3T A;  1BOS A;  1B50 A;  1O7Z A;  5KNB A;  2WV6 D;  5EBD A;  1ZYR D;  2WII B;  1Y69 U;  2HQE A;  4LJZ C;  3HGB A;  3WOF A;  2MGS A;  1CQV A;  1O78 A;  1I4R A;  1GUO A;  1VMC A;  2E2H B;  4ZRZ A;  3I91 A;  2L0C A;  3NXW A;  4R9W A;  5AFW A;  2VXW A;  3N52 A;  2N88 A;  2SEB D;  3OIQ A;  1B3A A;  1LTG D;  1SE3 A;  5J22 A;  1Z7T A;  1E0B A;  1TWA B;  3S17 B;  2G9D A;  2C9O A;  3G6J B;  2F0U A;  5FKA C;  4K8J A;  4H0L C;  1LTT D;  2J4X A;  2LFN A;  2QEJ C;  3NTI A;  5D65 A;  1JOQ A;  2QDB A;  2OT2 A;  4H44 C;  5M9O A;  1CQF A;  3ND8 A;  1EY6 A;  1TS4 A;  4CGY B;  3C1E A;  5IGF A;  5C0X H;  1BR9 A;  4KHZ A;  1RTO A;  3K7A B;  4HMJ A;  4JBW A;  3CKI B;  5COY A;  4FXD A;  1PFM A;  3ERO A;  3A56 A;  1LTR D;  3VA7 A;  5IGD A;  2MHV A;  1CA6 A;  1QJO A;  2L12 A;  2YU9 B;  5CV4 A;  1HRJ A;  3WDN A;  4CBV A;  3A7A B;  1K83 B;  1JOR A;  2KEE A;  2EY1 A;  1WTO A;  2RQX A;  5FO7 B;  1Z47 A;  5C0X I;  1BUV T;  2NBF A;  1OXX K;  1LTA D;  3BS1 A;  1ESR A;  1T5X D;  2NVY B;  2GA4 B;  3FPU B;  2FHT A;  5JAV A;  1KTK A;  4L8J A;  2K33 A;  1A3T A;  4R8I A;  3NE5 B;  2FFK B;  1ET9 A;  1YNN C;  1QB5 D;  4EQP A;  1F2Y A;  4K6D A;  5FO9 B;  5LL6 S;  4K6L A;  2A6E C;  1TWH B;  2JYO A;  2E74 C;  3DXJ C;  3QIA A;  4QMG A;  1ICW A;  3S1Q B;  5IIF A;  4FF2 A;  2DNE A;  2ID0 A;  2HUG A;  2EYP A;  2K6A A;  3A8K E;  2EYL A;  3PIP 3;  1JE4 A;  3NWS A;  2ZXO A;  5JPN C;  2MPM A;  3FMC A;  2WP8 J;  1CT1 D;  1ENF A;  1PZK D;  1SNC A;  3A7L A;  3I72 A;  5IOC A;  1MI2 A;  2B2Y C;  5C0X G;  1X3P A;  2XSC A;  1BCP F;  3HZX A;  5C4J B;  4OIJ A;  1PZJ D;  3NWT A;  4ULL A;  3H3V C;  1EU4 A;  2EY5 A;  5EPK A;  3ONA B;  1F9R A;  3TDQ A;  3QJY A;  1YNN D;  2AUK A;  1D5X C;  1GHK A;  2A6E D;  4RCO A;  5CGK A;  4A93 B;  3M7G A;  3GO5 A;  3GTQ B;  4ID6 A;  1LT4 D;  2NTS A;  4IUV A;  1STB A;  2F1M A;  1V43 A;  2F0Q A;  2OF1 A;  2M00 A;  3PUX A;  1DON A;  1ROD A;  1NR4 A;  1CFM A;  3M7N A;  4IUR A;  4KJN A;  2MP1 A;  1SNM A;  3GV6 A;  1OO9 B;  3P1H A;  3DM1 A;  4FF3 A;  5E3F A;  2A5H A;  1OXU A;  4Q0F A;  3TZU A;  3CRL C;  1FYC A;  1TQO A;  1L0X B;  2RSN A;  3V2T A;  1O80 A;  1DCZ A;  1BQQ T;  2Q8R E;  4CHT B;  3EA6 A;  4ZYS A;  2D9U A;  2O5I C;  3V96 A;  1H9K A;  4P2C B;  4K5V A;  3QO2 A;  2WIN B;  1NSN S;  2B2T A;  1JB3 A;  1EIG A;  1EY4 A;  4A3J B;  2B2U C;  2E2D C;  1U4M A;  1F9Q A;  5KEE A;  5C0X J;  4CKC A;  4A3G B;  2A69 C;  3T13 A;  3I4M B;  1STA A;  5C44 B;  2F0V A;  2LMC B;  1F9P A;  1G8Z D;  3RZO B;  5DAU A;  2R7Z B;  2IX0 A;  3T53 B;  5HGT A;  4HED A;  4ZLT F;  1H9J A;  4C3H B;  2IX3 A;  2ZT9 C;  2VB2 X;  1S5E D;  2F0W A;  4I65 A;  2B2T C;  3M4O B;  4R8N A;  4ODG A;  4IN3 A;  1SFO B;  1EQT A;  1EWC A;  3SEB A;  1VCI A;  5CV8 A;  3PUY A;  1RCV D;  2A73 B;  4ZAI A;  3RZD B;  1XYI A;  1BBX C;  4AYB B;  3BDL A;  4JK1 C;  2F0L A;  1D2B A;  1SAP A;  2AWO A;  1DOL A;  4RGM A;  5G3L D;  2X6L A;  3NQI A;  3QWN A;  1XWE A;  4KKS A;  5M5W B;  5KGU A;  3OPO A;  3NBH A;  3P20 A;  4BY7 B;  4G7Z C;  1UNS A;  1IL8 A;  2XIW A;  1QWY A;  3MVV A;  1GOZ A;  1LO5 D;  5F2D A;  3X3M A;  5EBC A;  4XYQ A;  4RFB A;  1R9T B;  3S2D B;  2M9V A;  3KF8 A;  1I50 B;  1V1P B;  1KDC A;  2PQE A;  3LX0 A;  1HFG A;  2XWB B;  3S16 B;  2KOL A;  3MZ5 A;  3FVQ A;  2IL8 A;  4G7O C;  3VYS A;  1F77 A;  1PFB A;  3F2U A;  1G2T A;  1LTB D;  3MEH A;  4V0B A;  1I4G A;  1MD2 D;  1TWC B;  1BCP D;  4FYD A;  1WCM B;  5EKI A;  3VYU A;  2A74 C;  4C2M B;  3HOU B;  1E2Z A;  1II3 A;  3PIO 3;  4DAY A;  3S14 B;  3T56 B;  2F0M A;  3J7A F;  1S5F D;  4M8A A;  3BVM A;  2NB0 A;  2IW3 A;  4CJ0 B;  3KBG A;  2F0T A;  4F88 A;  1RKN A;  3T16 A;  2JA5 B;  3OIP A;  3VR3 A;  1CHP D;  3HOV B;  4J8Q A;  1ZYR C;  1PLF A;  5D3D A;  2F0P A;  1I4X A;  2A6H D;  1GUW A;  4KHV A;  3QG1 A;  3K5M A;  1PZI D;  1U4L A;  2D2C C;  3R2I A;  1TVX A;  4RKL A;  4FF1 A;  1W6K A;  4EQO A;  1LV9 A;  5D14 A;  1E2V A;  1B9N A;  3URY A;  4F8M A;  3ITP A;  5HUR A;  3SXH A;  3FKI B;  2F0O A;  4K5X A;  5DEH A;  1Q90 A;  3BZD B;  3ZYY X;  2L9H A;  1HPC A;  1JOO A;  1Y8P B;  1SXT A;  4BBS B;  3I90 A;  4C56 C;  2MUY A;  4UAI A;  3I4L A;  1DJR D;  2AWN A;  2SOB A;  3K57 A;  4KMU C;  1HQR D;  1UUP A;  1QE6 A;  1D1K A;  2K04 A;  3KK7 A;  3C46 A;  2KHS A;  3PUW A;  5JVH 3;  1UAP A;  2K05 A;  4ABN A;  5C4H A;  3HOW B;  4X3K A;  4FNF A;  1B44 D;  2R3Z A;  1GUT A;  1K8O A;  1V1P A;  2NYZ D;  4MN3 A;  4RGN A;  4C3J B;  3IAY A;  5J1Z A;  1A6X A;  5I2X A;  2L1B A;  3GQB A;  3GV3 A;  2BOS A;  1RJT A;  2JA6 B;  1G91 A;  1EZ8 A;  2RBM A;  2K1B A;  2ENB A;  1YNJ C;  4C3I G;  5EGT A;  3LWE A;  4FXK C;  4BY1 B;  4BS9 A;  2PCF B;  1HUN A;  2NN6 H;  4DNT B;  2F0E A;  4NMZ A;  5ELE A;  2YYZ A;  2CW0 D;  1IW7 D;  5CV5 A;  3EJI A;  4RHR A;  4CJ1 B;  1SYB A;  3GTP B;  3S1M B;  3U9O A;  1SNQ A;  1PTO B;  4RH6 A;  4RGO S;  4B9X A;  1TWG B;  1HUM A;  2K32 A;  4J6H A;  1ET6 A;  2JEA I;  2ICI A;  1KLG D;  2EE1 A;  5ELF A;  2B2V A;  2E75 C;  3QB3 A;  1R4P B;  1LLR D;  5JVG 3;  4UDU C;  1JOK A;  3OMG A;  2KUM A;  4BA1 I;  3SHL A;  1FNW A;  1UEA B;  1PTO F;  4KK7 A;  1PXU A;  2NN6 I;  2BA1 A;  1EFI D;  1FD7 D;  4KKT A;  3DUZ A;  1ENC A;  2XRQ D;  1I4H A;  2PNR C;  2HDM A;  1WTP A;  5C4Z A;  1HQM C;  1KAB A;  1YNJ D;  4QB4 A;  1PYW D;  1LTI D;  4XTC S;  2B2V C;  4B9W A;  1FGB D;  3NQT A;  4HCE A;  1E2W A;  2EY2 A;  3AB9 A;  2PMZ B;  1ENA A;  5ELD A;  4TKO B;  5IGE A;  1C4Q A;  4ZQ3 A;  4A3E B;  1STG A;  1Q1E A;  1EY7 A;  1D1I A;  4A3I B;  3GTG B;  5I6Y A;  4IUQ A;  3D4D A;  4M1U B;  2LY7 A;  4YIJ A;  2CVR A;  1PFN A;  4RWS C;  1TY2 A;  1CM9 A;  2X69 A;  1KAA A;  1SND A;  5FO8 B;  1BCP B;  2NN6 G;  4XQN A;  2QCP X;  2DY7 A;  3VR6 A;  3MWY W;  3S2H B;  1D5Z C;  2F0D A;  2EYM A;  2TMP A;  3VYR A;  1LT3 D;  1TT2 A;  4KY6 A;  4J1M A;  4WRD A;  1U4P A;  4MHE A;  4C3H G;  3TP6 A;  3VR5 A;  4DXF A;  4HMI A;  1EYC A;  3U9S A;  1MGS A;  4KJO A;  1VDZ A;  2EYO A;  3LWU A;  4A3M B;  5DNF A;  5NUC A;  4B08 A;  1WD0 A;  1DXM A;  4DA2 A;  3GTM B;  3A54 A;  5M5X B;  3P7J A;  2B63 B;  2RDG A;  4DU9 A;  1STY A;  4IFD H;  2EYJ A;  3L9A X;  4DN4 M;  3MFY A;  4K2K A;  5C6A A;  1U4R A;  2BA0 A;  4DAP A;  3AU7 A;  4G57 A;  4N9P A;  4L6T B;  1Y1V B;  1EWH A;  3TP8 A;  2XN9 C;  1WTQ A;  5JJZ A;  1AZP A;  3D8G A;  4PMB A;  4ME5 A;  3BYT B;  1WVL A;  1SNP A;  3OWF A;  3A55 A;  3JAM E;  1NUC A;  3VA5 A;  1BF4 A;  1SNO A;  1DOK A;  1PTO C;  2K7V A;  3J7A V;  1SMY D;  3NTH A;  1WTX A;  5C3X A;  5ELB A;  4DK0 A;  5EKL A;  3PMF A;  5I2Y A;  2DY8 A;  1NAP A;  2XRS D;  4IFD I;  1GHJ A;  3OHX C;  3OSO A;  2LS0 1;  2FMC A;  3I8Z A;  2L4N A;  4X3S A;  2RA4 A;  2D62 A;  3IFD A;  2O2L D;  1EEI D;  4K5W A;  2EY6 A;  1HA6 A;  1LAB A;  2B2W A;  2I46 A;  4KD4 A;  4RKB A;  1QCB D;  3VR2 A;  2F0K A;  2ZXR A;  3MXP A;  1D5M C;  1XX8 A;  1PMR A;  2NVQ B;  2EVB A;  4OL7 A;  1AW7 A;  2B8F A;  2K5D A;  4PMC A;  5K36 H;  1JWU D;  1PTO D;  1HTP A;  4RCN A;  5I6W A;  1JR0 D;  1MSG A;  3H94 A;  4RA8 A;  2NUC A;  1G6Z A;  2LKV A;  2PZW A;  2DN8 A;  1GUN A;  4NP5 A;  1O7Y A;  2AQ1 B;  3EQL C;  5T1I A;  4IFD G;  1SYC A;  2AUJ D;  1X3Q A;  3GP7 A;  3H0G B;  4XYO A;  4IZ8 A;  5IT9 E;  3D6C A;  3WOE A;  3CRK C;  1RF2 D;  1BCP C;  1ONL A;  4K14 A;  1SJH D;  3D3R A;  1R4Q B;  4XT1 B;  4QCL A;  1BDO A;  4FXG C;  3MFG A;  2Q8I B;  3QOL A;  3MC0 B;  5FLX E;  1KDA A;  2RSO A;  3SK6 A;  1FR3 A;  1STE A;  3T4A C;  1GUG A;  1HA5 A;  3EFX D;  3NHH A;  3HP3 A;  1G2S A;  4Y7N B;  4DXG A;  1B9M A;  1TWF B;  4KKU A;  3NP8 A;  1CK1 A;  2A6H C;  1RHP A;  4DGZ A;  5C3W A;  3TME A;  1GJX A;  1SYF A;  1FNU A;  1MBY A;  3J80 E;  3PO2 B;  2K01 A;  1F2L A;  2F0S A;  1EY0 A;  5JPM C;  1HXY D;  3GTJ B;  2A68 C;  3QOJ A;  4EGV A;  2F0N A;  2KCN A;  4V19 0;  1VF7 A;  3Q23 A;  2F3W A;  4XXE A;  4O1N A;  4H13 C;  3W2D A;  2KQ3 A;  2EJF C;  1WTW A;  3FRP B;  4XQQ A;  1C8C A;  3R3O A;  4DF7 A;  5E4X A;  2AQ3 B;  4IFD J;  3NBI A;  4PNY A;  3PV0 A;  5CBE E;  1EOT A;  5K36 G;  1S4Z A;  2C5C A;  1EEF D;  1T5E A;  3MHB A;  1QG7 A;  2BDN A;  1AEX A;  4LMQ D;  4A3B B;  2H1E A;  4G4K A;  4QF4 A;  1BXT A;  1A15 A;  2SNS A;  1OXT A;  5JOB A;  4OO1 H;  3E6Z X;  1PRT B;  1AFP A;  1KDB A;  5K5P A;  4N9T A;  2R61 A;  3TSS A;  2SDF A;  2A68 D;  4XDX A;  3NPP A;  5ELC A;  2JA7 B;  2CQA A;  3EVQ A;  3S1R B;  2JE6 I;  2NWG A;  5I4D A;  1IHZ A;  1EU3 A;  1QNK A;  4OGQ C;  3P75 A;  2F0I A;  2DNC A;  1PRT F;  1F2Z A;  1CTM A;  2B8G A;  2CW0 C;  3PUZ A;  3KBX A;  1IW7 C;  3D4R A;  4ZK9 B;  4U68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...