2L1CA

Shc-ptb:biphosphorylated integrin beta3 cytoplasmic tail complex (1:1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
191
structure length
191
Chain Sequence
GQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHC (Src homology 2 domain containing) transforming protein
publication title Integrin {beta}3 phosphorylation dictates its complex with the Shc phosphotyrosine-binding (PTB) domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 41
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2l1cA00
2DHKA 3M1IB 1TJ6A 3QIJA 2DLWA 5KCVA 2ELBA 4TKNA 5JHGA 2Y7BA 2EMTA 3KY9A 3GYOA 2LKOA 3A8PA 4TYZA 4WSFA 1UNPA 5C5BB 5KQ4A 1RRPB 3FM8C 4ZRKA 3PVLA 3PG7A 1IRSA 1V89A 2P0FA 2KGXB 3WYFB 1MIXA 2RUKB 1XODA 3PZDA 1P6SA 4HB3B 2H7EA 2I1KA 1FGYA 3SNHA 4PQ0A 5D3XA 1RJ2A 2W2XC 4YONA 3TW1A 2D10A 4GPTB 5GOWB 2D9VA 4D0NB 1LB1A 1XX0A 3KZ1A 2RNRB 1X11A 1BTNA 4A5KA 1BWNA 4Y94A 2YS5A 3U8ZA 2I1JA 1U2BA 3SYXA 4ZRIA 5HE2A 5C79A 3NSUA 3DXCA 5HE1A 2YS3A 1TXDA 4NSWA 2DKPA 2HE7A 3CIKA 1UPRA 3PVUA 4KHAA 4CHJA 3VIAA 3D8DA 3F5RA 4H8SA 2J0MA 3ODWA 5DHAB 5HE0A 4DX8A 2D9XA 1DDVA 4HAVB 2E2XA 4IFSA 5CLLB 1LW3A 4WJ7A 1X86A 5J3QA 2XQNM 1DDWA 1XCGA 2H7DA 4GMVA 5J3YA 1TQZA 2DTCA 2W2WA 3A8QA 2J0KA 2EJ8A 3GYPA 4PNKA 1V5PA 3FSSA 2QKMA 1MAIA 1J19A 2MDXA 2ELAA 4A6FB 4YL8A 1J0WA 3P6AA 4HB0B 2VSZA 2OQBA 1M7EA 1U27A 3SO6A 2GS0A 3ODOA 2CY4A 4HAWB 5LONB 1BAKA 2D4QA 3SUZA 1I2HA 2K2UA 2DFKA 2X18A 1DYNA 4HDQA 2NZ8B 2MWNB 2VKIA 5DI9B 2Q13A 3ZDTA 5J3TA 4K17A 1OQNA 2G35A 3IVFA 5FI1A 1V88A 3PEGA 4Z2MB 3KSYA 4IOYX 1W1DA 1QQGA 2VRWB 1MK7B 1P5TA 2KUPA 1FOEA 1AQCA 2GCLA 3D8EA 3PVWA 2RLOA 1U5DA 3HK0A 1FGZA 4NY0A 2UVMA 1KZGA 1OY2A 4Z2NA 2CODA 2QKLA 4HDOA 2EC1A 1WGQA 1E5WA 2KCJA 1PFJA 1MPHA 5JLJB 2D2QA 2GJYA 3HQCA 4L6EA 1WG7A 1FHOA 1W1GA 2NMBA 4A6FA 2Z0QA 5D3VA 3ULBA 1Y5OA 1H10A 4IAPA 1PLSA 4KHBB 5FI0A 1N3HA 3ULCA 2ADZA 2Z0PA 3N7CA 1M7RA 1DBHA 3ODXA 3VOQA 2CAYA 5JP4A 1XR0B 4EMOA 2DYQA 2Y8GA 3PSCA 1AWEA 4MY6A 4MT7A 4A6KA 5C16A 2K00A 2D9YA 2BCJA 2M38A 2Z0OA 5EFXA 1X1GA 3QBVB 5JHHA 2YF0A 1X05A 3TO1A 2DKQA 3BJIA 2PZ1A 1K5GB 1U5EA 1ZVRA 2YS1A 2YVCA 1GC6A 2AL6A 1BTKA 1FHXA 2UZSA 2W2XD 1XKEA 1WI1A 2P0HA 3KRXA 2I5FA 3F0WA 3AU5A 4B6HA 1QC6A 4CYEA 1WGUA 4K81A 1KI1B 2J0JA 4EKUA 2HTHB 4K2OA 1EF1A 5D3YA 3UZTA 2RVBB 4DX90 1NI2A 1V5UA 4ZRJA 3O96A 5D3WA 4HAZB 2ZPYA 1PMSA 2COFA 2COAA 1U29A 2Y8FA 2YRYA 1W1HA 3RCPA 4HB4B 3T06A 2AEHA 2YT0A 4DBBA 2ROZB 1Q67A 3G9WA 5DIFB 2P8VA 5L81A 4CHMA 1GG3A 3A98B 2RSGA 3QWMA 1FAOA 2DA0A 4GZUA 2MFQA 2R09A 1ZC4B 4EJNA 1UEFA 4HB2B 5D27A 1UPQA 1I7AA 2J59M 1WJ1A 3MPXA 2MKRA 2L1CA 2LOZA 1SHCA 2CRFA 4KAXB 1MIZB 4GXBA 3AU4A 2D9ZA 3TCAA 2UZRA 2CY5A 1WJMA 2P0DA 4F7GA 2DYNA 1U5GA 3TFMA 4P7IA 2COCA 3OANA 4WVFB 2LYDA 4HATB 1GC7A 1P3RA 2R0DA 2DX1A 3ML4A 4KHOA 2FJLA 2DHJA 3TVVA 2I5CA 4HHVA 1V5MA 1XD4A 3ZVRA 4F7UP 1EGXA 3P7ZA 5C6RA 2V76A 2K2JA 2LG1A 1NU2A 3KRWA 4DXAB 3FEHA 2M14A 3PP2A 2DX5A 1FHWA 1UNRA 1EAZA 5DH9B 1ZSQA 4HAXB 5LOPB 1MK9B 1DDMA 1X1FA 1ISNA 1SGHA 2GCJA 2LOXA 3X23A 1DROA 1ZC3B 5CLQB 3SV1A 2N23A 1U5FA 4GMXB 1K5DB 2DHIA 1H4RA 2D9WA 2L2IA 2RGNB 1UNQA 5DHFB 3V5WA 1Z87A 3LJUX 2ROVA 1B55A 1OMWA 1NTYA 2YT1A 4C0AA 1EVHA 2LULA 2D11A 2N0YA 4XWXA 1MKEA 5C5BA 4HAYB 2IYBA 4A6HA 4BBKA 4KVGB 2EMSA 4GN1A 1KZ7A 3CXBB 3DXEA 2DN6A 4MK0A 2IFSA 1Y19B 3U7DA 3DXDA 1NTVA 1WVHA 2JP2A 3D8FA 1FB8A 5KQ1A 3WA0A 3MDBC 3HW2B 1ZM0A 3AJ4A 5HE3A 2OTXA 3BINA 4F7HA 4HAUB 2YSZA 1V61A 4K2PA
chains in the Genus database with same CATH superfamily
2DHKA 3M1IB 1TJ6A 3QIJA 2DLWA 5KCVA 2ELBA 4TKNA 5JHGA 2Y7BA 2EMTA 3KY9A 2RRFA 3GYOA 2LKOA 3A8PA 4TYZA 4WSFA 1UNPA 5C5BB 5KQ4A 1RRPB 3FM8C 2KR0A 4ZRKA 4DIXA 3PVLA 3PG7A 1IRSA 1V89A 2P0FA 2KGXB 2KIGA 4QXAB 3WYFB 1MIXA 2RUKB 1XODA 3PZDA 1P6SA 4HB3B 2H7EA 2I1KA 1FGYA 3SNHA 4PQ0A 5D3XA 1RJ2A 2W2XC 4YONA 3TW1A 2D10A 4GPTB 5GOWB 2D9VA 2NBVA 4D0NB 1LB1A 1XX0A 1ZYIA 2Z14A 2RNRB 3KZ1A 1X11A 1BTNA 4A5KA 1BWNA 4Y94A 2YS5A 3U8ZA 2I1JA 1U2BA 3SYXA 4ZRIA 5HE2A 5C79A 3NSUA 4GOUA 3DXCA 5HE1A 2YS3A 1TXDA 4NSWA 2DKPA 2HE7A 3CIKA 1UPRA 3PVUA 4KHAA 4CHJA 3VIAA 3NWDA 2R2YA 3D8DA 3F5RA 4H8SA 2J0MA 3NWAA 3ODWA 5DHAB 5HE0A 4DX8A 2D9XA 1DDVA 4HAVB 2E2XA 4IFSA 5CLLB 1LW3A 4WJ7A 1X86A 5J3QA 2XQNM 1DDWA 1XCGA 2H7DA 4GMVA 5J3YA 1TQZA 2DTCA 2W2WA 4OT1A 3A8QA 2FJUB 2J0KA 2EJ8A 5I2SA 3GYPA 4PNKA 1V5PA 3FSSA 2QKMA 1MAIA 1J19A 2MDXA 2ELAA 4A6FB 4YL8A 1J0WA 3P6AA 4HB0B 2VSZA 2OQBA 1M7EA 1U27A 3SO6A 2GS0A 3ODOA 2CY4A 4HAWB 5LONB 1BAKA 2D4QA 3SUZA 2Z4DA 1I2HA 2K2UA 2DFKA 2K49A 2X18A 1DYNA 4HDQA 4KHBA 4QJ5B 2NZ8B 2MWNB 2VKIA 5DI9B 2Q13A 3ZDTA 5J3TA 4K17A 1OQNA 2G35A 3IVFA 5FI1A 3OHMB 1V88A 3PEGA 4Z2MB 4HSIA 3KSYA 4IOYX 3DCXA 1W1DA 1QQGA 2VRWB 1MK7B 1P5TA 2KUPA 1FOEA 2Z59A 1AQCA 2GCLA 3D8EA 3PVWA 2RLOA 5LG4B 1U5DA 3HK0A 1FGZA 4NY0A 2UVMA 1KZGA 1OY2A 4Z2NA 2CODA 2QKLA 4HDOA 2EC1A 1WGQA 1E5WA 2KCJA 2K8EA 1PFJA 1MPHA 5JLJB 2D2QA 2GJYA 3HQCA 4L6EA 1WG7A 1FHOA 1W1GA 2NMBA 4A6FA 2Z0QA 5D3VA 3ULBA 1Y5OA 1H10A 4IAPA 1PLSA 4KHBB 5FI0A 1N3HA 3ULCA 2ADZA 2Z0PA 3N7CA 1M7RA 1DBHA 3ODXA 3VOQA 2CAYA 5JP4A 1XR0B 4EMOA 2DYQA 2Y8GA 3PSCA 1AWEA 1T77A 4MY6A 4MT7A 4A6KA 5C16A 2K00A 2D9YA 2ZKMX 2BCJA 4QJ4B 2M38A 2Z0OA 5EFXA 1X1GA 3QBVB 5JHHA 3FVCA 2YF0A 1X05A 3TO1A 2DKQA 3BJIA 2PZ1A 1K5GB 1U5EA 1ZVRA 2YS1A 2YVCA 1MI1A 1GC6A 2AL6A 1BTKA 1FHXA 2UZSA 2W2XD 1XKEA 1WI1A 2P0HA 3KRXA 2I5FA 3F0WA 3AU5A 4B6HA 1QC6A 4CYEA 1WGUA 4K81A 1KI1B 2J0JA 4EKUA 2HTHB 4K2OA 1EF1A 5D3YA 3UZTA 2RVBB 4L1RA 4DX90 1NI2A 1V5UA 4ZRJA 3O96A 4OSNA 5D3WA 4HAZB 2ZPYA 1PMSA 2COFA 3HSAA 2COAA 1U29A 2Y8FA 2YRYA 4GNKB 1W1HA 3RCPA 4HB4B 3T06A 2AEHA 2YT0A 4DBBA 2ROZB 1Q67A 3G9WA 5DIFB 2P8VA 5L81A 4CHMA 1GG3A 3A98B 2RSGA 3QWMA 5IRSA 1FAOA 2DA0A 4GZUA 2MFQA 2R09A 1ZC4B 4EJNA 1UEFA 4HB2B 5D27A 1UPQA 1I7AA 2J59M 1WJ1A 3MPXA 2MKRA 2L1CA 2LOZA 1SHCA 2CRFA 4KAXB 1MIZB 4CSQA 4GXBA 3AU4A 4QJ3B 2D9ZA 3TCAA 2UZRA 2CY5A 1WJMA 2P0DA 4F7GA 2DYNA 1U5GA 3TFMA 4P7IA 2COCA 3OANA 4WVFB 2LYDA 4HATB 1GC7A 1P3RA 2R0DA 2DX1A 3ML4A 4KHOA 2FJLA 2KIEA 2DHJA 3TVVA 2I5CA 4HHVA 1V5MA 1XD4A 3ZVRA 4F7UP 1EGXA 3P7ZA 5C6RA 2V76A 2K2JA 3NW8A 2LG1A 1NU2A 3KRWA 4DXAB 3FEHA 2M14A 3PP2A 3NWFA 2DX5A 1FHWA 1UNRA 2Z13A 1EAZA 5DH9B 1ZSQA 4HAXB 5LOPB 3A58A 5I2MA 3HIEA 1MK9B 1DDMA 1X1FA 1ISNA 1SGHA 2GCJA 2LOXA 3X23A 1DROA 1ZC3B 5CLQB 3SV1A 2N23A 1U5FA 4GMXB 1K5DB 2DHIA 1H4RA 2D9WA 2L2IA 2RGNB 1UNQA 5DHFB 3V5WA 1Z87A 3LJUX 2ROVA 1B55A 1OMWA 1NTYA 2YT1A 4C0AA 1EVHA 2LULA 2D11A 2N0YA 4XWXA 1MKEA 2KUQA 5C5BA 4HAYB 5M4YB 2IYBA 4A6HA 4BBKA 4KVGB 2EMSA 3B77A 4GN1A 1KZ7A 3CXBB 3DXEA 2DN6A 4MK0A 2IFSA 1Y19B 3U7DA 3DXDA 1NTVA 1WVHA 2JP2A 3D8FA 1FB8A 5KQ1A 3WA0A 3MDBC 3HW2B 1ZM0A 3AJ4A 4D6WA 5HE3A 2OTXA 3BINA 4F7HA 3U12A 4HAUB 2YSZA 1V61A 2GUMA 4K2PA 2YT2A
chains in the Genus database with same CATH topology
2DHKA 3M1IB 1TJ6A 3QIJA 2DLWA 5KCVA 2ELBA 4TKNA 5JHGA 2Y7BA 2EMTA 3KY9A 3GYOA 2LKOA 3A8PA 4TYZA 4WSFA 1UNPA 5C5BB 5KQ4A 1RRPB 3FM8C 4ZRKA 3PVLA 3PG7A 1IRSA 1V89A 2P0FA 2KGXB 3WYFB 1MIXA 2RUKB 1XODA 3PZDA 1P6SA 4HB3B 2H7EA 2I1KA 1FGYA 3SNHA 4PQ0A 5D3XA 1RJ2A 2W2XC 4YONA 3TW1A 2D10A 4GPTB 5GOWB 2D9VA 4D0NB 1LB1A 1XX0A 3KZ1A 2RNRB 1X11A 1BTNA 4A5KA 1BWNA 4Y94A 2YS5A 3U8ZA 2I1JA 1U2BA 3SYXA 4ZRIA 5HE2A 5C79A 3NSUA 3DXCA 5HE1A 2YS3A 1TXDA 4NSWA 2DKPA 2HE7A 3CIKA 1UPRA 3PVUA 4KHAA 4CHJA 3VIAA 3D8DA 3F5RA 4H8SA 2J0MA 3ODWA 5DHAB 5HE0A 4DX8A 2D9XA 1DDVA 4HAVB 2E2XA 4IFSA 5CLLB 1LW3A 4WJ7A 1X86A 5J3QA 2XQNM 1DDWA 1XCGA 2H7DA 4GMVA 5J3YA 1TQZA 2DTCA 2W2WA 3A8QA 2J0KA 2EJ8A 3GYPA 4PNKA 1V5PA 3FSSA 2QKMA 1MAIA 1J19A 2MDXA 2ELAA 4A6FB 4YL8A 1J0WA 3P6AA 4HB0B 2VSZA 2OQBA 1M7EA 1U27A 3SO6A 2GS0A 3ODOA 2CY4A 4HAWB 5LONB 1BAKA 2D4QA 3SUZA 1I2HA 2K2UA 2DFKA 2X18A 1DYNA 4HDQA 2NZ8B 2MWNB 2VKIA 5DI9B 2Q13A 3ZDTA 5J3TA 4K17A 1OQNA 2G35A 3IVFA 5FI1A 1V88A 3PEGA 4Z2MB 3KSYA 4IOYX 1W1DA 1QQGA 2VRWB 1MK7B 1P5TA 2KUPA 1FOEA 1AQCA 2GCLA 3D8EA 3PVWA 2RLOA 1U5DA 3HK0A 1FGZA 4NY0A 2UVMA 1KZGA 1OY2A 4Z2NA 2CODA 2QKLA 4HDOA 2EC1A 1WGQA 1E5WA 2KCJA 1PFJA 1MPHA 5JLJB 2D2QA 2GJYA 3HQCA 4L6EA 1WG7A 1FHOA 1W1GA 2NMBA 4A6FA 2Z0QA 5D3VA 3ULBA 1Y5OA 1H10A 4IAPA 1PLSA 4KHBB 5FI0A 1N3HA 3ULCA 2ADZA 2Z0PA 3N7CA 1M7RA 1DBHA 3ODXA 3VOQA 2CAYA 5JP4A 1XR0B 4EMOA 2DYQA 2Y8GA 3PSCA 1AWEA 4MY6A 4MT7A 4A6KA 5C16A 2K00A 2D9YA 2BCJA 2M38A 2Z0OA 5EFXA 1X1GA 3QBVB 5JHHA 2YF0A 1X05A 3TO1A 2DKQA 3BJIA 2PZ1A 1K5GB 1U5EA 1ZVRA 2YS1A 2YVCA 1GC6A 2AL6A 1BTKA 1FHXA 2UZSA 2W2XD 1XKEA 1WI1A 2P0HA 3KRXA 2I5FA 3F0WA 3AU5A 4B6HA 1QC6A 4CYEA 1WGUA 4K81A 1KI1B 2J0JA 4EKUA 2HTHB 4K2OA 1EF1A 5D3YA 3UZTA 2RVBB 4DX90 1NI2A 1V5UA 4ZRJA 3O96A 5D3WA 4HAZB 2ZPYA 1PMSA 2COFA 2COAA 1U29A 2Y8FA 2YRYA 1W1HA 3RCPA 4HB4B 3T06A 2AEHA 2YT0A 4DBBA 2ROZB 1Q67A 3G9WA 5DIFB 2P8VA 5L81A 4CHMA 1GG3A 3A98B 2RSGA 3QWMA 1FAOA 2DA0A 4GZUA 2MFQA 2R09A 1ZC4B 4EJNA 1UEFA 4HB2B 5D27A 1UPQA 1I7AA 2J59M 1WJ1A 3MPXA 2MKRA 2L1CA 2LOZA 1SHCA 2CRFA 4KAXB 1MIZB 4GXBA 3AU4A 2D9ZA 3TCAA 2UZRA 2CY5A 1WJMA 2P0DA 4F7GA 2DYNA 1U5GA 3TFMA 4P7IA 2COCA 3OANA 4WVFB 2LYDA 4HATB 1GC7A 1P3RA 2R0DA 2DX1A 3ML4A 4KHOA 2FJLA 2DHJA 3TVVA 2I5CA 4HHVA 1V5MA 1XD4A 3ZVRA 4F7UP 1EGXA 3P7ZA 5C6RA 2V76A 2K2JA 2LG1A 1NU2A 3KRWA 4DXAB 3FEHA 2M14A 3PP2A 2DX5A 1FHWA 1UNRA 1EAZA 5DH9B 1ZSQA 4HAXB 5LOPB 1MK9B 1DDMA 1X1FA 1ISNA 1SGHA 2GCJA 2LOXA 3X23A 1DROA 1ZC3B 5CLQB 3SV1A 2N23A 1U5FA 4GMXB 1K5DB 2DHIA 1H4RA 2D9WA 2L2IA 2RGNB 1UNQA 5DHFB 3V5WA 1Z87A 3LJUX 2ROVA 1B55A 1OMWA 1NTYA 2YT1A 4C0AA 1EVHA 2LULA 2D11A 2N0YA 4XWXA 1MKEA 5C5BA 4HAYB 2IYBA 4A6HA 4BBKA 4KVGB 2EMSA 4GN1A 1KZ7A 3CXBB 3DXEA 2DN6A 4MK0A 2IFSA 1Y19B 3U7DA 3DXDA 1NTVA 1WVHA 2JP2A 3D8FA 1FB8A 5KQ1A 3WA0A 3MDBC 3HW2B 1ZM0A 3AJ4A 5HE3A 2OTXA 3BINA 4F7HA 4HAUB 2YSZA 1V61A 4K2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHK A;  3M1I B;  1TJ6 A;  3QIJ A;  2DLW A;  5KCV A;  2ELB A;  4TKN A;  5JHG A;  2Y7B A;  2EMT A;  3KY9 A;  3GYO A;  2LKO A;  3A8P A;  4TYZ A;  4WSF A;  1UNP A;  5C5B B;  5KQ4 A;  1RRP B;  3FM8 C;  4ZRK A;  3PVL A;  3PG7 A;  1IRS A;  1V89 A;  2P0F A;  2KGX B;  3WYF B;  1MIX A;  2RUK B;  1XOD A;  3PZD A;  1P6S A;  4HB3 B;  2H7E A;  2I1K A;  1FGY A;  3SNH A;  4PQ0 A;  5D3X A;  1RJ2 A;  2W2X C;  4YON A;  3TW1 A;  2D10 A;  4GPT B;  5GOW B;  2D9V A;  4D0N B;  1LB1 A;  1XX0 A;  3KZ1 A;  2RNR B;  1X11 A;  1BTN A;  4A5K A;  1BWN A;  4Y94 A;  2YS5 A;  3U8Z A;  2I1J A;  1U2B A;  3SYX A;  4ZRI A;  5HE2 A;  5C79 A;  3NSU A;  3DXC A;  5HE1 A;  2YS3 A;  1TXD A;  4NSW A;  2DKP A;  2HE7 A;  3CIK A;  1UPR A;  3PVU A;  4KHA A;  4CHJ A;  3VIA A;  3D8D A;  3F5R A;  4H8S A;  2J0M A;  3ODW A;  5DHA B;  5HE0 A;  4DX8 A;  2D9X A;  1DDV A;  4HAV B;  2E2X A;  4IFS A;  5CLL B;  1LW3 A;  4WJ7 A;  1X86 A;  5J3Q A;  2XQN M;  1DDW A;  1XCG A;  2H7D A;  4GMV A;  5J3Y A;  1TQZ A;  2DTC A;  2W2W A;  3A8Q A;  2J0K A;  2EJ8 A;  3GYP A;  4PNK A;  1V5P A;  3FSS A;  2QKM A;  1MAI A;  1J19 A;  2MDX A;  2ELA A;  4A6F B;  4YL8 A;  1J0W A;  3P6A A;  4HB0 B;  2VSZ A;  2OQB A;  1M7E A;  1U27 A;  3SO6 A;  2GS0 A;  3ODO A;  2CY4 A;  4HAW B;  5LON B;  1BAK A;  2D4Q A;  3SUZ A;  1I2H A;  2K2U A;  2DFK A;  2X18 A;  1DYN A;  4HDQ A;  2NZ8 B;  2MWN B;  2VKI A;  5DI9 B;  2Q13 A;  3ZDT A;  5J3T A;  4K17 A;  1OQN A;  2G35 A;  3IVF A;  5FI1 A;  1V88 A;  3PEG A;  4Z2M B;  3KSY A;  4IOY X;  1W1D A;  1QQG A;  2VRW B;  1MK7 B;  1P5T A;  2KUP A;  1FOE A;  1AQC A;  2GCL A;  3D8E A;  3PVW A;  2RLO A;  1U5D A;  3HK0 A;  1FGZ A;  4NY0 A;  2UVM A;  1KZG A;  1OY2 A;  4Z2N A;  2COD A;  2QKL A;  4HDO A;  2EC1 A;  1WGQ A;  1E5W A;  2KCJ A;  1PFJ A;  1MPH A;  5JLJ B;  2D2Q A;  2GJY A;  3HQC A;  4L6E A;  1WG7 A;  1FHO A;  1W1G A;  2NMB A;  4A6F A;  2Z0Q A;  5D3V A;  3ULB A;  1Y5O A;  1H10 A;  4IAP A;  1PLS A;  4KHB B;  5FI0 A;  1N3H A;  3ULC A;  2ADZ A;  2Z0P A;  3N7C A;  1M7R A;  1DBH A;  3ODX A;  3VOQ A;  2CAY A;  5JP4 A;  1XR0 B;  4EMO A;  2DYQ A;  2Y8G A;  3PSC A;  1AWE A;  4MY6 A;  4MT7 A;  4A6K A;  5C16 A;  2K00 A;  2D9Y A;  2BCJ A;  2M38 A;  2Z0O A;  5EFX A;  1X1G A;  3QBV B;  5JHH A;  2YF0 A;  1X05 A;  3TO1 A;  2DKQ A;  3BJI A;  2PZ1 A;  1K5G B;  1U5E A;  1ZVR A;  2YS1 A;  2YVC A;  1GC6 A;  2AL6 A;  1BTK A;  1FHX A;  2UZS A;  2W2X D;  1XKE A;  1WI1 A;  2P0H A;  3KRX A;  2I5F A;  3F0W A;  3AU5 A;  4B6H A;  1QC6 A;  4CYE A;  1WGU A;  4K81 A;  1KI1 B;  2J0J A;  4EKU A;  2HTH B;  4K2O A;  1EF1 A;  5D3Y A;  3UZT A;  2RVB B;  4DX9 0;  1NI2 A;  1V5U A;  4ZRJ A;  3O96 A;  5D3W A;  4HAZ B;  2ZPY A;  1PMS A;  2COF A;  2COA A;  1U29 A;  2Y8F A;  2YRY A;  1W1H A;  3RCP A;  4HB4 B;  3T06 A;  2AEH A;  2YT0 A;  4DBB A;  2ROZ B;  1Q67 A;  3G9W A;  5DIF B;  2P8V A;  5L81 A;  4CHM A;  1GG3 A;  3A98 B;  2RSG A;  3QWM A;  1FAO A;  2DA0 A;  4GZU A;  2MFQ A;  2R09 A;  1ZC4 B;  4EJN A;  1UEF A;  4HB2 B;  5D27 A;  1UPQ A;  1I7A A;  2J59 M;  1WJ1 A;  3MPX A;  2MKR A;  2L1C A;  2LOZ A;  1SHC A;  2CRF A;  4KAX B;  1MIZ B;  4GXB A;  3AU4 A;  2D9Z A;  3TCA A;  2UZR A;  2CY5 A;  1WJM A;  2P0D A;  4F7G A;  2DYN A;  1U5G A;  3TFM A;  4P7I A;  2COC A;  3OAN A;  4WVF B;  2LYD A;  4HAT B;  1GC7 A;  1P3R A;  2R0D A;  2DX1 A;  3ML4 A;  4KHO A;  2FJL A;  2DHJ A;  3TVV A;  2I5C A;  4HHV A;  1V5M A;  1XD4 A;  3ZVR A;  4F7U P;  1EGX A;  3P7Z A;  5C6R A;  2V76 A;  2K2J A;  2LG1 A;  1NU2 A;  3KRW A;  4DXA B;  3FEH A;  2M14 A;  3PP2 A;  2DX5 A;  1FHW A;  1UNR A;  1EAZ A;  5DH9 B;  1ZSQ A;  4HAX B;  5LOP B;  1MK9 B;  1DDM A;  1X1F A;  1ISN A;  1SGH A;  2GCJ A;  2LOX A;  3X23 A;  1DRO A;  1ZC3 B;  5CLQ B;  3SV1 A;  2N23 A;  1U5F A;  4GMX B;  1K5D B;  2DHI A;  1H4R A;  2D9W A;  2L2I A;  2RGN B;  1UNQ A;  5DHF B;  3V5W A;  1Z87 A;  3LJU X;  2ROV A;  1B55 A;  1OMW A;  1NTY A;  2YT1 A;  4C0A A;  1EVH A;  2LUL A;  2D11 A;  2N0Y A;  4XWX A;  1MKE A;  5C5B A;  4HAY B;  2IYB A;  4A6H A;  4BBK A;  4KVG B;  2EMS A;  4GN1 A;  1KZ7 A;  3CXB B;  3DXE A;  2DN6 A;  4MK0 A;  2IFS A;  1Y19 B;  3U7D A;  3DXD A;  1NTV A;  1WVH A;  2JP2 A;  3D8F A;  1FB8 A;  5KQ1 A;  3WA0 A;  3MDB C;  3HW2 B;  1ZM0 A;  3AJ4 A;  5HE3 A;  2OTX A;  3BIN A;  4F7H A;  4HAU B;  2YSZ A;  1V61 A;  4K2P A; 
#chains in the Genus database with same CATH topology
 2DHK A;  3M1I B;  1TJ6 A;  3QIJ A;  2DLW A;  5KCV A;  2ELB A;  4TKN A;  5JHG A;  2Y7B A;  2EMT A;  3KY9 A;  2RRF A;  3GYO A;  2LKO A;  3A8P A;  4TYZ A;  4WSF A;  1UNP A;  5C5B B;  5KQ4 A;  1RRP B;  3FM8 C;  2KR0 A;  4ZRK A;  4DIX A;  3PVL A;  3PG7 A;  1IRS A;  1V89 A;  2P0F A;  2KGX B;  2KIG A;  4QXA B;  3WYF B;  1MIX A;  2RUK B;  1XOD A;  3PZD A;  1P6S A;  4HB3 B;  2H7E A;  2I1K A;  1FGY A;  3SNH A;  4PQ0 A;  5D3X A;  1RJ2 A;  2W2X C;  4YON A;  3TW1 A;  2D10 A;  4GPT B;  5GOW B;  2D9V A;  2NBV A;  4D0N B;  1LB1 A;  1XX0 A;  1ZYI A;  2Z14 A;  2RNR B;  3KZ1 A;  1X11 A;  1BTN A;  4A5K A;  1BWN A;  4Y94 A;  2YS5 A;  3U8Z A;  2I1J A;  1U2B A;  3SYX A;  4ZRI A;  5HE2 A;  5C79 A;  3NSU A;  4GOU A;  3DXC A;  5HE1 A;  2YS3 A;  1TXD A;  4NSW A;  2DKP A;  2HE7 A;  3CIK A;  1UPR A;  3PVU A;  4KHA A;  4CHJ A;  3VIA A;  3NWD A;  2R2Y A;  3D8D A;  3F5R A;  4H8S A;  2J0M A;  3NWA A;  3ODW A;  5DHA B;  5HE0 A;  4DX8 A;  2D9X A;  1DDV A;  4HAV B;  2E2X A;  4IFS A;  5CLL B;  1LW3 A;  4WJ7 A;  1X86 A;  5J3Q A;  2XQN M;  1DDW A;  1XCG A;  2H7D A;  4GMV A;  5J3Y A;  1TQZ A;  2DTC A;  2W2W A;  4OT1 A;  3A8Q A;  2FJU B;  2J0K A;  2EJ8 A;  5I2S A;  3GYP A;  4PNK A;  1V5P A;  3FSS A;  2QKM A;  1MAI A;  1J19 A;  2MDX A;  2ELA A;  4A6F B;  4YL8 A;  1J0W A;  3P6A A;  4HB0 B;  2VSZ A;  2OQB A;  1M7E A;  1U27 A;  3SO6 A;  2GS0 A;  3ODO A;  2CY4 A;  4HAW B;  5LON B;  1BAK A;  2D4Q A;  3SUZ A;  2Z4D A;  1I2H A;  2K2U A;  2DFK A;  2K49 A;  2X18 A;  1DYN A;  4HDQ A;  4KHB A;  4QJ5 B;  2NZ8 B;  2MWN B;  2VKI A;  5DI9 B;  2Q13 A;  3ZDT A;  5J3T A;  4K17 A;  1OQN A;  2G35 A;  3IVF A;  5FI1 A;  3OHM B;  1V88 A;  3PEG A;  4Z2M B;  4HSI A;  3KSY A;  4IOY X;  3DCX A;  1W1D A;  1QQG A;  2VRW B;  1MK7 B;  1P5T A;  2KUP A;  1FOE A;  2Z59 A;  1AQC A;  2GCL A;  3D8E A;  3PVW A;  2RLO A;  5LG4 B;  1U5D A;  3HK0 A;  1FGZ A;  4NY0 A;  2UVM A;  1KZG A;  1OY2 A;  4Z2N A;  2COD A;  2QKL A;  4HDO A;  2EC1 A;  1WGQ A;  1E5W A;  2KCJ A;  2K8E A;  1PFJ A;  1MPH A;  5JLJ B;  2D2Q A;  2GJY A;  3HQC A;  4L6E A;  1WG7 A;  1FHO A;  1W1G A;  2NMB A;  4A6F A;  2Z0Q A;  5D3V A;  3ULB A;  1Y5O A;  1H10 A;  4IAP A;  1PLS A;  4KHB B;  5FI0 A;  1N3H A;  3ULC A;  2ADZ A;  2Z0P A;  3N7C A;  1M7R A;  1DBH A;  3ODX A;  3VOQ A;  2CAY A;  5JP4 A;  1XR0 B;  4EMO A;  2DYQ A;  2Y8G A;  3PSC A;  1AWE A;  1T77 A;  4MY6 A;  4MT7 A;  4A6K A;  5C16 A;  2K00 A;  2D9Y A;  2ZKM X;  2BCJ A;  4QJ4 B;  2M38 A;  2Z0O A;  5EFX A;  1X1G A;  3QBV B;  5JHH A;  3FVC A;  2YF0 A;  1X05 A;  3TO1 A;  2DKQ A;  3BJI A;  2PZ1 A;  1K5G B;  1U5E A;  1ZVR A;  2YS1 A;  2YVC A;  1MI1 A;  1GC6 A;  2AL6 A;  1BTK A;  1FHX A;  2UZS A;  2W2X D;  1XKE A;  1WI1 A;  2P0H A;  3KRX A;  2I5F A;  3F0W A;  3AU5 A;  4B6H A;  1QC6 A;  4CYE A;  1WGU A;  4K81 A;  1KI1 B;  2J0J A;  4EKU A;  2HTH B;  4K2O A;  1EF1 A;  5D3Y A;  3UZT A;  2RVB B;  4L1R A;  4DX9 0;  1NI2 A;  1V5U A;  4ZRJ A;  3O96 A;  4OSN A;  5D3W A;  4HAZ B;  2ZPY A;  1PMS A;  2COF A;  3HSA A;  2COA A;  1U29 A;  2Y8F A;  2YRY A;  4GNK B;  1W1H A;  3RCP A;  4HB4 B;  3T06 A;  2AEH A;  2YT0 A;  4DBB A;  2ROZ B;  1Q67 A;  3G9W A;  5DIF B;  2P8V A;  5L81 A;  4CHM A;  1GG3 A;  3A98 B;  2RSG A;  3QWM A;  5IRS A;  1FAO A;  2DA0 A;  4GZU A;  2MFQ A;  2R09 A;  1ZC4 B;  4EJN A;  1UEF A;  4HB2 B;  5D27 A;  1UPQ A;  1I7A A;  2J59 M;  1WJ1 A;  3MPX A;  2MKR A;  2L1C A;  2LOZ A;  1SHC A;  2CRF A;  4KAX B;  1MIZ B;  4CSQ A;  4GXB A;  3AU4 A;  4QJ3 B;  2D9Z A;  3TCA A;  2UZR A;  2CY5 A;  1WJM A;  2P0D A;  4F7G A;  2DYN A;  1U5G A;  3TFM A;  4P7I A;  2COC A;  3OAN A;  4WVF B;  2LYD A;  4HAT B;  1GC7 A;  1P3R A;  2R0D A;  2DX1 A;  3ML4 A;  4KHO A;  2FJL A;  2KIE A;  2DHJ A;  3TVV A;  2I5C A;  4HHV A;  1V5M A;  1XD4 A;  3ZVR A;  4F7U P;  1EGX A;  3P7Z A;  5C6R A;  2V76 A;  2K2J A;  3NW8 A;  2LG1 A;  1NU2 A;  3KRW A;  4DXA B;  3FEH A;  2M14 A;  3PP2 A;  3NWF A;  2DX5 A;  1FHW A;  1UNR A;  2Z13 A;  1EAZ A;  5DH9 B;  1ZSQ A;  4HAX B;  5LOP B;  3A58 A;  5I2M A;  3HIE A;  1MK9 B;  1DDM A;  1X1F A;  1ISN A;  1SGH A;  2GCJ A;  2LOX A;  3X23 A;  1DRO A;  1ZC3 B;  5CLQ B;  3SV1 A;  2N23 A;  1U5F A;  4GMX B;  1K5D B;  2DHI A;  1H4R A;  2D9W A;  2L2I A;  2RGN B;  1UNQ A;  5DHF B;  3V5W A;  1Z87 A;  3LJU X;  2ROV A;  1B55 A;  1OMW A;  1NTY A;  2YT1 A;  4C0A A;  1EVH A;  2LUL A;  2D11 A;  2N0Y A;  4XWX A;  1MKE A;  2KUQ A;  5C5B A;  4HAY B;  5M4Y B;  2IYB A;  4A6H A;  4BBK A;  4KVG B;  2EMS A;  3B77 A;  4GN1 A;  1KZ7 A;  3CXB B;  3DXE A;  2DN6 A;  4MK0 A;  2IFS A;  1Y19 B;  3U7D A;  3DXD A;  1NTV A;  1WVH A;  2JP2 A;  3D8F A;  1FB8 A;  5KQ1 A;  3WA0 A;  3MDB C;  3HW2 B;  1ZM0 A;  3AJ4 A;  4D6W A;  5HE3 A;  2OTX A;  3BIN A;  4F7H A;  3U12 A;  4HAU B;  2YSZ A;  1V61 A;  2GUM A;  4K2P A;  2YT2 A; 
#chains in the Genus database with same CATH homology
 2DHK A;  3M1I B;  1TJ6 A;  3QIJ A;  2DLW A;  5KCV A;  2ELB A;  4TKN A;  5JHG A;  2Y7B A;  2EMT A;  3KY9 A;  3GYO A;  2LKO A;  3A8P A;  4TYZ A;  4WSF A;  1UNP A;  5C5B B;  5KQ4 A;  1RRP B;  3FM8 C;  4ZRK A;  3PVL A;  3PG7 A;  1IRS A;  1V89 A;  2P0F A;  2KGX B;  3WYF B;  1MIX A;  2RUK B;  1XOD A;  3PZD A;  1P6S A;  4HB3 B;  2H7E A;  2I1K A;  1FGY A;  3SNH A;  4PQ0 A;  5D3X A;  1RJ2 A;  2W2X C;  4YON A;  3TW1 A;  2D10 A;  4GPT B;  5GOW B;  2D9V A;  4D0N B;  1LB1 A;  1XX0 A;  3KZ1 A;  2RNR B;  1X11 A;  1BTN A;  4A5K A;  1BWN A;  4Y94 A;  2YS5 A;  3U8Z A;  2I1J A;  1U2B A;  3SYX A;  4ZRI A;  5HE2 A;  5C79 A;  3NSU A;  3DXC A;  5HE1 A;  2YS3 A;  1TXD A;  4NSW A;  2DKP A;  2HE7 A;  3CIK A;  1UPR A;  3PVU A;  4KHA A;  4CHJ A;  3VIA A;  3D8D A;  3F5R A;  4H8S A;  2J0M A;  3ODW A;  5DHA B;  5HE0 A;  4DX8 A;  2D9X A;  1DDV A;  4HAV B;  2E2X A;  4IFS A;  5CLL B;  1LW3 A;  4WJ7 A;  1X86 A;  5J3Q A;  2XQN M;  1DDW A;  1XCG A;  2H7D A;  4GMV A;  5J3Y A;  1TQZ A;  2DTC A;  2W2W A;  3A8Q A;  2J0K A;  2EJ8 A;  3GYP A;  4PNK A;  1V5P A;  3FSS A;  2QKM A;  1MAI A;  1J19 A;  2MDX A;  2ELA A;  4A6F B;  4YL8 A;  1J0W A;  3P6A A;  4HB0 B;  2VSZ A;  2OQB A;  1M7E A;  1U27 A;  3SO6 A;  2GS0 A;  3ODO A;  2CY4 A;  4HAW B;  5LON B;  1BAK A;  2D4Q A;  3SUZ A;  1I2H A;  2K2U A;  2DFK A;  2X18 A;  1DYN A;  4HDQ A;  2NZ8 B;  2MWN B;  2VKI A;  5DI9 B;  2Q13 A;  3ZDT A;  5J3T A;  4K17 A;  1OQN A;  2G35 A;  3IVF A;  5FI1 A;  1V88 A;  3PEG A;  4Z2M B;  3KSY A;  4IOY X;  1W1D A;  1QQG A;  2VRW B;  1MK7 B;  1P5T A;  2KUP A;  1FOE A;  1AQC A;  2GCL A;  3D8E A;  3PVW A;  2RLO A;  1U5D A;  3HK0 A;  1FGZ A;  4NY0 A;  2UVM A;  1KZG A;  1OY2 A;  4Z2N A;  2COD A;  2QKL A;  4HDO A;  2EC1 A;  1WGQ A;  1E5W A;  2KCJ A;  1PFJ A;  1MPH A;  5JLJ B;  2D2Q A;  2GJY A;  3HQC A;  4L6E A;  1WG7 A;  1FHO A;  1W1G A;  2NMB A;  4A6F A;  2Z0Q A;  5D3V A;  3ULB A;  1Y5O A;  1H10 A;  4IAP A;  1PLS A;  4KHB B;  5FI0 A;  1N3H A;  3ULC A;  2ADZ A;  2Z0P A;  3N7C A;  1M7R A;  1DBH A;  3ODX A;  3VOQ A;  2CAY A;  5JP4 A;  1XR0 B;  4EMO A;  2DYQ A;  2Y8G A;  3PSC A;  1AWE A;  4MY6 A;  4MT7 A;  4A6K A;  5C16 A;  2K00 A;  2D9Y A;  2BCJ A;  2M38 A;  2Z0O A;  5EFX A;  1X1G A;  3QBV B;  5JHH A;  2YF0 A;  1X05 A;  3TO1 A;  2DKQ A;  3BJI A;  2PZ1 A;  1K5G B;  1U5E A;  1ZVR A;  2YS1 A;  2YVC A;  1GC6 A;  2AL6 A;  1BTK A;  1FHX A;  2UZS A;  2W2X D;  1XKE A;  1WI1 A;  2P0H A;  3KRX A;  2I5F A;  3F0W A;  3AU5 A;  4B6H A;  1QC6 A;  4CYE A;  1WGU A;  4K81 A;  1KI1 B;  2J0J A;  4EKU A;  2HTH B;  4K2O A;  1EF1 A;  5D3Y A;  3UZT A;  2RVB B;  4DX9 0;  1NI2 A;  1V5U A;  4ZRJ A;  3O96 A;  5D3W A;  4HAZ B;  2ZPY A;  1PMS A;  2COF A;  2COA A;  1U29 A;  2Y8F A;  2YRY A;  1W1H A;  3RCP A;  4HB4 B;  3T06 A;  2AEH A;  2YT0 A;  4DBB A;  2ROZ B;  1Q67 A;  3G9W A;  5DIF B;  2P8V A;  5L81 A;  4CHM A;  1GG3 A;  3A98 B;  2RSG A;  3QWM A;  1FAO A;  2DA0 A;  4GZU A;  2MFQ A;  2R09 A;  1ZC4 B;  4EJN A;  1UEF A;  4HB2 B;  5D27 A;  1UPQ A;  1I7A A;  2J59 M;  1WJ1 A;  3MPX A;  2MKR A;  2L1C A;  2LOZ A;  1SHC A;  2CRF A;  4KAX B;  1MIZ B;  4GXB A;  3AU4 A;  2D9Z A;  3TCA A;  2UZR A;  2CY5 A;  1WJM A;  2P0D A;  4F7G A;  2DYN A;  1U5G A;  3TFM A;  4P7I A;  2COC A;  3OAN A;  4WVF B;  2LYD A;  4HAT B;  1GC7 A;  1P3R A;  2R0D A;  2DX1 A;  3ML4 A;  4KHO A;  2FJL A;  2DHJ A;  3TVV A;  2I5C A;  4HHV A;  1V5M A;  1XD4 A;  3ZVR A;  4F7U P;  1EGX A;  3P7Z A;  5C6R A;  2V76 A;  2K2J A;  2LG1 A;  1NU2 A;  3KRW A;  4DXA B;  3FEH A;  2M14 A;  3PP2 A;  2DX5 A;  1FHW A;  1UNR A;  1EAZ A;  5DH9 B;  1ZSQ A;  4HAX B;  5LOP B;  1MK9 B;  1DDM A;  1X1F A;  1ISN A;  1SGH A;  2GCJ A;  2LOX A;  3X23 A;  1DRO A;  1ZC3 B;  5CLQ B;  3SV1 A;  2N23 A;  1U5F A;  4GMX B;  1K5D B;  2DHI A;  1H4R A;  2D9W A;  2L2I A;  2RGN B;  1UNQ A;  5DHF B;  3V5W A;  1Z87 A;  3LJU X;  2ROV A;  1B55 A;  1OMW A;  1NTY A;  2YT1 A;  4C0A A;  1EVH A;  2LUL A;  2D11 A;  2N0Y A;  4XWX A;  1MKE A;  5C5B A;  4HAY B;  2IYB A;  4A6H A;  4BBK A;  4KVG B;  2EMS A;  4GN1 A;  1KZ7 A;  3CXB B;  3DXE A;  2DN6 A;  4MK0 A;  2IFS A;  1Y19 B;  3U7D A;  3DXD A;  1NTV A;  1WVH A;  2JP2 A;  3D8F A;  1FB8 A;  5KQ1 A;  3WA0 A;  3MDB C;  3HW2 B;  1ZM0 A;  3AJ4 A;  5HE3 A;  2OTX A;  3BIN A;  4F7H A;  4HAU B;  2YSZ A;  1V61 A;  4K2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...