2L1CA

Shc-ptb:biphosphorylated integrin beta3 cytoplasmic tail complex (1:1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
191
structure length
191
Chain Sequence
b'GQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHC (Src homology 2 domain containing) transforming protein
molecule tags Cell adhesion
source organism Homo sapiens
publication title Integrin {beta}3 phosphorylation dictates its complex with the Shc phosphotyrosine-binding (PTB) domain.
pubmed doi rcsb
total genus 41
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2l1cA00
1PFJA 2D9VA 4A5KA 1DROA 1Q67A 4BBKA 2J0KA 3TCAA 2YSZA 1WJ1A 3M1IB 1DDWA 1X86A 5EFXA 4HB3B 2UZSA 3MDBC 1ZSQA 2CAYA 2GJYA 3TW1A 2K2UA 1GC7A 3D8DA 2Q13A 1ZC3B 3NSUA 1WG7A 2R09A 2VRWB 2DHJA 2QKLA 5LOPB 4HDOA 2CY5A 4WVFB 1U2BA 3F5RA 2D10A 1GG3A 3HK0A 2GCJA 2CODA 3KRXA 3O96A 2Y8GA 3HQCA 1KZGA 1P6SA 3P6AA 3BINA 2ZPYA 3P7ZA 2EMSA 3PG7A 3V5WA 2I1JA 3KRWA 1SHCA 2KUPA 2DN6A 2YS1A 2BCJA 4DX8A 3BJIA 4A6KA 2EMTA 1W1HA 4XWXA 3SUZA 3PVLA 2DX5A 4F7HA 2M14A 2DYQA 2E2XA 3SYXA 2V76A 5C79A 2DTCA 4IFSA 4EMOA 1OY2A 2VKIA 1DYNA 3TO1A 2YS5A 1P3RA 4DBBA 1J19A 1LB1A 1FAOA 2D2QA 1ISNA 1FOEA 2Z0OA 5DIFB 5D3VA 4WJ7A 1NU2A 3PVWA 2QKMA 2N0YA 4HAUB 3D8FA 2CRFA 2D9YA 1PMSA 4CHJA 1TXDA 4ZRIA 5HE2A 5JHGA 4K17A 3A8QA 2GCLA 3F0WA 5JP4A 5C5BA 4HAVB 1H10A 2KCJA 5D27A 4A6FB 4MT7A 1ZM0A 5DHFB 3ODOA 3ZVRA 1UPQA 1BAKA 1XKEA 1QC6A 5FI1A 5D3WA 4KHBB 5C6RA 4K2PA 1MK9B 4K2OA 3SO6A 4HHVA 1GC6A 3DXEA 5HE0A 3X23A 1V89A 4HATB 1BTKA 2W2XD 2JP2A 2Z0PA 3KY9A 3AU4A 1PLSA 1W1DA 3QIJA 1MIZB 4PNKA 3PZDA 2IFSA 4HAWB 1IRSA 1I2HA 2I5CA 4IAPA 4ZRJA 1N3HA 1W1GA 1DDMA 2D9XA 1DDVA 3ZDTA 5D3XA 2W2XC 2YT0A 3SV1A 1MPHA 2RGNB 5DI9B 3FSSA 4CHMA 3WYFB 4GXBA 4P7IA 1MKEA 1Z87A 5C5BB 2RLOA 1U29A 1Y5OA 1M7RA 1OMWA 1UEFA 4H8SA 2RVBB 1FGYA 3KSYA 3RCPA 3ML4A 5JLJB 2Y7BA 2LYDA 4TYZA 5HE3A 3CXBB 2M38A 3ULBA 2LOZA 2NMBA 2EC1A 3ODXA 1KZ7A 1U5EA 2R0DA 2L1CA 1FGZA 1AQCA 3DXCA 2RSGA 1K5DB 3PP2A 4MK0A 2EJ8A 2GS0A 2YT1A 1XX0A 4HAXB 5KQ4A 3FM8C 3FEHA 2FJLA 2DHIA 4HB0B 4GZUA 1WI1A 2P0FA 2G35A 1TJ6A 1EAZA 3ODWA 3IVFA 2LULA 1WGUA 2DYNA 4GMVA 1XR0B 5J3TA 1H4RA 4Z2NA 1MIXA 1M7EA 2OTXA 2YVCA 4F7GA 4TKNA 3GYOA 3PVUA 3QBVB 2LOXA 1WJMA 4EJNA 2H7DA 1U27A 3LJUX 4WSFA 1WVHA 2H7EA 2L2IA 4HB2B 1V88A 1EF1A 5J3QA 2DA0A 3GYPA 2DKQA 1MK7B 3WA0A 2J0JA 2J59M 3A8PA 3TVVA 1X05A 3AJ4A 1B55A 5J3YA 5C16A 2ELBA 2COAA 3PSCA 2D9WA 3U8ZA 1U5GA 3QWMA 2UZRA 2YF0A 4KHAA 3AU5A 4B6HA 4YL8A 2Y8FA 2YRYA 4F7UP 3U7DA 2HTHB 3CIKA 2AL6A 3KZ1A 1SGHA 1EVHA 3TFMA 1FHOA 1XCGA 1XD4A 2KGXB 5JHHA 4Z2MB 2VSZA 3DXDA 2HE7A 2YS3A 2COCA 5FI0A 4PQ0A 1X1FA 2COFA 4KHOA 2X18A 2PZ1A 4DXAB 4KVGB 3ULCA 5KCVA 1BWNA 3SNHA 4Y94A 2MFQA 1MAIA 4C0AA 4NSWA 2LG1A 1TQZA 1P5TA 5LONB 2D11A 2MKRA 4NY0A 1X1GA 2UVMA 1KI1B 1LW3A 1V5MA 4D0NB 2CY4A 4CYEA 1WGQA 2LKOA 1ZVRA 2ROZB 3G9WA 1UNRA 5DHAB 4A6HA 1DBHA 1AWEA 2DFKA 1RRPB 2NZ8B 1NTYA 2I5FA 4GMXB 2J0MA 2RNRB 4IOYX 1QQGA 1Y19B 4K81A 1UNPA 2ROVA 4HAZB 2RUKB 1E5WA 5CLLB 1FB8A 5CLQB 4GN1A 1RJ2A 1UNQA 3VIAA 4DX90 1V61A 1OQNA 2DX1A 2DLWA 2Z0QA 2D9ZA 2IYBA 2OQBA 1EGXA 4HAYB 4A6FA 1V5PA 2K00A 4L6EA 3MPXA 2ELAA 1NI2A 4HDQA 1J0WA 1UPRA 4GPTB 2P0DA 1K5GB 2P8VA 1U5FA 2XQNM 1FHXA 1X11A 1BTNA 1I7AA 5DH9B 4MY6A 3OANA 4HB4B 1NTVA 2DKPA 3A98B 2N23A 1V5UA 4EKUA 5GOWB 5D3YA 5L81A 2MWNB 3UZTA 1U5DA 2P0HA 2W2WA 3N7CA 2I1KA 3D8EA 3PEGA 4ZRKA 2AEHA 1XODA 2K2JA 3HW2B 4YONA 3VOQA 1FHWA 3T06A 4KAXB 1ZC4B 2DHKA 2D4QA 2ADZA 5KQ1A 5HE1A 2MDXA
chains in the Genus database with same CATH superfamily
1PFJA 2D9VA 4A5KA 1DROA 1Q67A 4BBKA 2J0KA 3TCAA 2YSZA 1WJ1A 3M1IB 1DDWA 1X86A 5EFXA 4HB3B 2UZSA 3MDBC 1ZSQA 2CAYA 2GJYA 3TW1A 2K2UA 1GC7A 3D8DA 2Q13A 1ZC3B 3NSUA 1WG7A 2R09A 3NWAA 5M4YB 2VRWB 2DHJA 2QKLA 5LOPB 4HDOA 2CY5A 4WVFB 2NBVA 1U2BA 3F5RA 2D10A 3NWDA 3FVCA 1GG3A 3HK0A 2GCJA 2CODA 3KRXA 4L1RA 3O96A 2Y8GA 3HQCA 1KZGA 2FJUB 1P6SA 3P6AA 3BINA 2ZPYA 3P7ZA 5I2MA 2EMSA 3PG7A 3V5WA 2I1JA 3KRWA 1SHCA 2KUPA 2DN6A 2YS1A 2BCJA 1ZYIA 4DX8A 3BJIA 4A6KA 2EMTA 1W1HA 4XWXA 3SUZA 3PVLA 2DX5A 2YT2A 4F7HA 2M14A 2DYQA 2E2XA 3OHMB 3SYXA 2V76A 5C79A 2DTCA 4IFSA 4EMOA 1OY2A 2VKIA 1DYNA 3TO1A 2YS5A 1P3RA 4DBBA 1J19A 1LB1A 1FAOA 2D2QA 4QJ5B 1ISNA 1FOEA 2Z0OA 5DIFB 5D3VA 4WJ7A 1NU2A 4DIXA 3PVWA 2QKMA 2N0YA 4HAUB 3D8FA 2CRFA 2D9YA 1PMSA 4CHJA 1TXDA 4ZRIA 5HE2A 5JHGA 3HIEA 4K17A 3A8QA 2GCLA 3F0WA 5JP4A 5C5BA 4HAVB 1H10A 2KCJA 5D27A 4A6FB 4MT7A 1ZM0A 5DHFB 3ODOA 3ZVRA 1MI1A 1UPQA 1BAKA 1XKEA 1QC6A 5FI1A 5D3WA 4KHBB 5C6RA 4K2PA 1MK9B 4K2OA 3SO6A 4HHVA 1GC6A 3DXEA 5HE0A 3X23A 1V89A 4HATB 1BTKA 2W2XD 2JP2A 2Z0PA 3KY9A 3AU4A 1PLSA 1W1DA 3QIJA 1MIZB 4PNKA 3PZDA 2IFSA 4HAWB 1IRSA 1I2HA 3B77A 2I5CA 4IAPA 2Z13A 4ZRJA 1N3HA 1W1GA 1DDMA 5I2SA 4GOUA 4CSQA 2D9XA 1DDVA 3ZDTA 5D3XA 2W2XC 2YT0A 3SV1A 1MPHA 2RGNB 5DI9B 3FSSA 4CHMA 3WYFB 2Z59A 2K8EA 4GXBA 3NWFA 4P7IA 1MKEA 1Z87A 5C5BB 2RLOA 1U29A 1Y5OA 3A58A 1M7RA 1OMWA 4OSNA 1UEFA 4H8SA 2RVBB 1FGYA 4HSIA 3KSYA 3RCPA 3ML4A 5JLJB 2Y7BA 2LYDA 4TYZA 5HE3A 2RRFA 3CXBB 2M38A 3ULBA 2LOZA 2NMBA 2EC1A 3ODXA 1KZ7A 1U5EA 2R0DA 2L1CA 1FGZA 4D6WA 2R2YA 1AQCA 3U12A 3DXCA 2RSGA 1K5DB 3PP2A 4MK0A 2EJ8A 2GS0A 2YT1A 1XX0A 4HAXB 5KQ4A 5IRSA 3FM8C 3FEHA 2FJLA 2DHIA 4HB0B 2Z14A 4GZUA 1WI1A 2P0FA 2G35A 1TJ6A 1EAZA 3ODWA 3IVFA 2LULA 1WGUA 2DYNA 4GMVA 1XR0B 5J3TA 1H4RA 4Z2NA 1MIXA 1M7EA 2OTXA 2YVCA 2ZKMX 4F7GA 4TKNA 3GYOA 3PVUA 3QBVB 2LOXA 1WJMA 4EJNA 2H7DA 1U27A 3LJUX 4WSFA 1WVHA 2H7EA 2KUQA 2L2IA 4HB2B 1V88A 4QJ4B 1EF1A 5J3QA 2DA0A 3GYPA 2DKQA 1MK7B 3WA0A 2J0JA 2J59M 3A8PA 3TVVA 1X05A 3AJ4A 1B55A 5J3YA 3HSAA 5C16A 2ELBA 2COAA 3PSCA 2D9WA 4GNKB 3U8ZA 1U5GA 3QWMA 2UZRA 2YF0A 4KHAA 3AU5A 4B6HA 4YL8A 2Y8FA 2YRYA 4F7UP 3U7DA 2HTHB 3CIKA 2AL6A 3KZ1A 1SGHA 1EVHA 3TFMA 1FHOA 1XCGA 1XD4A 2KGXB 2KR0A 5JHHA 4Z2MB 2VSZA 3DXDA 2HE7A 2YS3A 2COCA 5FI0A 4PQ0A 1X1FA 2COFA 4KHOA 2X18A 2PZ1A 4DXAB 4KVGB 3ULCA 3NW8A 5KCVA 1BWNA 3SNHA 4Y94A 2MFQA 2GUMA 1MAIA 4C0AA 4NSWA 2LG1A 2KIGA 1TQZA 1P5TA 5LG4B 5LONB 2D11A 2MKRA 3DCXA 4NY0A 1X1GA 2UVMA 1KI1B 1LW3A 1V5MA 4D0NB 2CY4A 4CYEA 1WGQA 2LKOA 1ZVRA 2ROZB 3G9WA 4KHBA 1UNRA 5DHAB 2K49A 4A6HA 1DBHA 1AWEA 2DFKA 1RRPB 2NZ8B 1NTYA 2I5FA 4GMXB 2J0MA 2RNRB 4IOYX 1QQGA 1Y19B 4K81A 1UNPA 2ROVA 4HAZB 2RUKB 1E5WA 5CLLB 2KIEA 1FB8A 5CLQB 4GN1A 1RJ2A 1UNQA 3VIAA 4DX90 2Z4DA 4QXAB 1V61A 1OQNA 2DX1A 4QJ3B 2DLWA 2Z0QA 2D9ZA 2IYBA 2OQBA 1EGXA 4HAYB 4A6FA 1V5PA 2K00A 4L6EA 3MPXA 2ELAA 1NI2A 4HDQA 1J0WA 1UPRA 4GPTB 1T77A 2P0DA 1K5GB 2P8VA 1U5FA 2XQNM 1FHXA 1X11A 1BTNA 1I7AA 5DH9B 4MY6A 3OANA 4OT1A 4HB4B 1NTVA 2DKPA 3A98B 2N23A 1V5UA 4EKUA 5GOWB 5D3YA 5L81A 2MWNB 3UZTA 1U5DA 2P0HA 2W2WA 3N7CA 2I1KA 3D8EA 3PEGA 4ZRKA 2AEHA 1XODA 2K2JA 3HW2B 4YONA 3VOQA 1FHWA 3T06A 4KAXB 1ZC4B 2DHKA 2D4QA 2ADZA 5KQ1A 5HE1A 2MDXA
chains in the Genus database with same CATH topology
1PFJA 2D9VA 4A5KA 1DROA 1Q67A 4BBKA 2J0KA 3TCAA 2YSZA 1WJ1A 3M1IB 1DDWA 1X86A 5EFXA 4HB3B 2UZSA 3MDBC 1ZSQA 2CAYA 2GJYA 3TW1A 2K2UA 1GC7A 3D8DA 2Q13A 1ZC3B 3NSUA 1WG7A 2R09A 2VRWB 2DHJA 2QKLA 5LOPB 4HDOA 2CY5A 4WVFB 1U2BA 3F5RA 2D10A 1GG3A 3HK0A 2GCJA 2CODA 3KRXA 3O96A 2Y8GA 3HQCA 1KZGA 1P6SA 3P6AA 3BINA 2ZPYA 3P7ZA 2EMSA 3PG7A 3V5WA 2I1JA 3KRWA 1SHCA 2KUPA 2DN6A 2YS1A 2BCJA 4DX8A 3BJIA 4A6KA 2EMTA 1W1HA 4XWXA 3SUZA 3PVLA 2DX5A 4F7HA 2M14A 2DYQA 2E2XA 3SYXA 2V76A 5C79A 2DTCA 4IFSA 4EMOA 1OY2A 2VKIA 1DYNA 3TO1A 2YS5A 1P3RA 4DBBA 1J19A 1LB1A 1FAOA 2D2QA 1ISNA 1FOEA 2Z0OA 5DIFB 5D3VA 4WJ7A 1NU2A 3PVWA 2QKMA 2N0YA 4HAUB 3D8FA 2CRFA 2D9YA 1PMSA 4CHJA 1TXDA 4ZRIA 5HE2A 5JHGA 4K17A 3A8QA 2GCLA 3F0WA 5JP4A 5C5BA 4HAVB 1H10A 2KCJA 5D27A 4A6FB 4MT7A 1ZM0A 5DHFB 3ODOA 3ZVRA 1UPQA 1BAKA 1XKEA 1QC6A 5FI1A 5D3WA 4KHBB 5C6RA 4K2PA 1MK9B 4K2OA 3SO6A 4HHVA 1GC6A 3DXEA 5HE0A 3X23A 1V89A 4HATB 1BTKA 2W2XD 2JP2A 2Z0PA 3KY9A 3AU4A 1PLSA 1W1DA 3QIJA 1MIZB 4PNKA 3PZDA 2IFSA 4HAWB 1IRSA 1I2HA 2I5CA 4IAPA 4ZRJA 1N3HA 1W1GA 1DDMA 2D9XA 1DDVA 3ZDTA 5D3XA 2W2XC 2YT0A 3SV1A 1MPHA 2RGNB 5DI9B 3FSSA 4CHMA 3WYFB 4GXBA 4P7IA 1MKEA 1Z87A 5C5BB 2RLOA 1U29A 1Y5OA 1M7RA 1OMWA 1UEFA 4H8SA 2RVBB 1FGYA 3KSYA 3RCPA 3ML4A 5JLJB 2Y7BA 2LYDA 4TYZA 5HE3A 3CXBB 2M38A 3ULBA 2LOZA 2NMBA 2EC1A 3ODXA 1KZ7A 1U5EA 2R0DA 2L1CA 1FGZA 1AQCA 3DXCA 2RSGA 1K5DB 3PP2A 4MK0A 2EJ8A 2GS0A 2YT1A 1XX0A 4HAXB 5KQ4A 3FM8C 3FEHA 2FJLA 2DHIA 4HB0B 4GZUA 1WI1A 2P0FA 2G35A 1TJ6A 1EAZA 3ODWA 3IVFA 2LULA 1WGUA 2DYNA 4GMVA 1XR0B 5J3TA 1H4RA 4Z2NA 1MIXA 1M7EA 2OTXA 2YVCA 4F7GA 4TKNA 3GYOA 3PVUA 3QBVB 2LOXA 1WJMA 4EJNA 2H7DA 1U27A 3LJUX 4WSFA 1WVHA 2H7EA 2L2IA 4HB2B 1V88A 1EF1A 5J3QA 2DA0A 3GYPA 2DKQA 1MK7B 3WA0A 2J0JA 2J59M 3A8PA 3TVVA 1X05A 3AJ4A 1B55A 5J3YA 5C16A 2ELBA 2COAA 3PSCA 2D9WA 3U8ZA 1U5GA 3QWMA 2UZRA 2YF0A 4KHAA 3AU5A 4B6HA 4YL8A 2Y8FA 2YRYA 4F7UP 3U7DA 2HTHB 3CIKA 2AL6A 3KZ1A 1SGHA 1EVHA 3TFMA 1FHOA 1XCGA 1XD4A 2KGXB 5JHHA 4Z2MB 2VSZA 3DXDA 2HE7A 2YS3A 2COCA 5FI0A 4PQ0A 1X1FA 2COFA 4KHOA 2X18A 2PZ1A 4DXAB 4KVGB 3ULCA 5KCVA 1BWNA 3SNHA 4Y94A 2MFQA 1MAIA 4C0AA 4NSWA 2LG1A 1TQZA 1P5TA 5LONB 2D11A 2MKRA 4NY0A 1X1GA 2UVMA 1KI1B 1LW3A 1V5MA 4D0NB 2CY4A 4CYEA 1WGQA 2LKOA 1ZVRA 2ROZB 3G9WA 1UNRA 5DHAB 4A6HA 1DBHA 1AWEA 2DFKA 1RRPB 2NZ8B 1NTYA 2I5FA 4GMXB 2J0MA 2RNRB 4IOYX 1QQGA 1Y19B 4K81A 1UNPA 2ROVA 4HAZB 2RUKB 1E5WA 5CLLB 1FB8A 5CLQB 4GN1A 1RJ2A 1UNQA 3VIAA 4DX90 1V61A 1OQNA 2DX1A 2DLWA 2Z0QA 2D9ZA 2IYBA 2OQBA 1EGXA 4HAYB 4A6FA 1V5PA 2K00A 4L6EA 3MPXA 2ELAA 1NI2A 4HDQA 1J0WA 1UPRA 4GPTB 2P0DA 1K5GB 2P8VA 1U5FA 2XQNM 1FHXA 1X11A 1BTNA 1I7AA 5DH9B 4MY6A 3OANA 4HB4B 1NTVA 2DKPA 3A98B 2N23A 1V5UA 4EKUA 5GOWB 5D3YA 5L81A 2MWNB 3UZTA 1U5DA 2P0HA 2W2WA 3N7CA 2I1KA 3D8EA 3PEGA 4ZRKA 2AEHA 1XODA 2K2JA 3HW2B 4YONA 3VOQA 1FHWA 3T06A 4KAXB 1ZC4B 2DHKA 2D4QA 2ADZA 5KQ1A 5HE1A 2MDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFJ A;  2D9V A;  4A5K A;  1DRO A;  1Q67 A;  4BBK A;  2J0K A;  3TCA A;  2YSZ A;  1WJ1 A;  3M1I B;  1DDW A;  1X86 A;  5EFX A;  4HB3 B;  2UZS A;  3MDB C;  1ZSQ A;  2CAY A;  2GJY A;  3TW1 A;  2K2U A;  1GC7 A;  3D8D A;  2Q13 A;  1ZC3 B;  3NSU A;  1WG7 A;  2R09 A;  2VRW B;  2DHJ A;  2QKL A;  5LOP B;  4HDO A;  2CY5 A;  4WVF B;  1U2B A;  3F5R A;  2D10 A;  1GG3 A;  3HK0 A;  2GCJ A;  2COD A;  3KRX A;  3O96 A;  2Y8G A;  3HQC A;  1KZG A;  1P6S A;  3P6A A;  3BIN A;  2ZPY A;  3P7Z A;  2EMS A;  3PG7 A;  3V5W A;  2I1J A;  3KRW A;  1SHC A;  2KUP A;  2DN6 A;  2YS1 A;  2BCJ A;  4DX8 A;  3BJI A;  4A6K A;  2EMT A;  1W1H A;  4XWX A;  3SUZ A;  3PVL A;  2DX5 A;  4F7H A;  2M14 A;  2DYQ A;  2E2X A;  3SYX A;  2V76 A;  5C79 A;  2DTC A;  4IFS A;  4EMO A;  1OY2 A;  2VKI A;  1DYN A;  3TO1 A;  2YS5 A;  1P3R A;  4DBB A;  1J19 A;  1LB1 A;  1FAO A;  2D2Q A;  1ISN A;  1FOE A;  2Z0O A;  5DIF B;  5D3V A;  4WJ7 A;  1NU2 A;  3PVW A;  2QKM A;  2N0Y A;  4HAU B;  3D8F A;  2CRF A;  2D9Y A;  1PMS A;  4CHJ A;  1TXD A;  4ZRI A;  5HE2 A;  5JHG A;  4K17 A;  3A8Q A;  2GCL A;  3F0W A;  5JP4 A;  5C5B A;  4HAV B;  1H10 A;  2KCJ A;  5D27 A;  4A6F B;  4MT7 A;  1ZM0 A;  5DHF B;  3ODO A;  3ZVR A;  1UPQ A;  1BAK A;  1XKE A;  1QC6 A;  5FI1 A;  5D3W A;  4KHB B;  5C6R A;  4K2P A;  1MK9 B;  4K2O A;  3SO6 A;  4HHV A;  1GC6 A;  3DXE A;  5HE0 A;  3X23 A;  1V89 A;  4HAT B;  1BTK A;  2W2X D;  2JP2 A;  2Z0P A;  3KY9 A;  3AU4 A;  1PLS A;  1W1D A;  3QIJ A;  1MIZ B;  4PNK A;  3PZD A;  2IFS A;  4HAW B;  1IRS A;  1I2H A;  2I5C A;  4IAP A;  4ZRJ A;  1N3H A;  1W1G A;  1DDM A;  2D9X A;  1DDV A;  3ZDT A;  5D3X A;  2W2X C;  2YT0 A;  3SV1 A;  1MPH A;  2RGN B;  5DI9 B;  3FSS A;  4CHM A;  3WYF B;  4GXB A;  4P7I A;  1MKE A;  1Z87 A;  5C5B B;  2RLO A;  1U29 A;  1Y5O A;  1M7R A;  1OMW A;  1UEF A;  4H8S A;  2RVB B;  1FGY A;  3KSY A;  3RCP A;  3ML4 A;  5JLJ B;  2Y7B A;  2LYD A;  4TYZ A;  5HE3 A;  3CXB B;  2M38 A;  3ULB A;  2LOZ A;  2NMB A;  2EC1 A;  3ODX A;  1KZ7 A;  1U5E A;  2R0D A;  2L1C A;  1FGZ A;  1AQC A;  3DXC A;  2RSG A;  1K5D B;  3PP2 A;  4MK0 A;  2EJ8 A;  2GS0 A;  2YT1 A;  1XX0 A;  4HAX B;  5KQ4 A;  3FM8 C;  3FEH A;  2FJL A;  2DHI A;  4HB0 B;  4GZU A;  1WI1 A;  2P0F A;  2G35 A;  1TJ6 A;  1EAZ A;  3ODW A;  3IVF A;  2LUL A;  1WGU A;  2DYN A;  4GMV A;  1XR0 B;  5J3T A;  1H4R A;  4Z2N A;  1MIX A;  1M7E A;  2OTX A;  2YVC A;  4F7G A;  4TKN A;  3GYO A;  3PVU A;  3QBV B;  2LOX A;  1WJM A;  4EJN A;  2H7D A;  1U27 A;  3LJU X;  4WSF A;  1WVH A;  2H7E A;  2L2I A;  4HB2 B;  1V88 A;  1EF1 A;  5J3Q A;  2DA0 A;  3GYP A;  2DKQ A;  1MK7 B;  3WA0 A;  2J0J A;  2J59 M;  3A8P A;  3TVV A;  1X05 A;  3AJ4 A;  1B55 A;  5J3Y A;  5C16 A;  2ELB A;  2COA A;  3PSC A;  2D9W A;  3U8Z A;  1U5G A;  3QWM A;  2UZR A;  2YF0 A;  4KHA A;  3AU5 A;  4B6H A;  4YL8 A;  2Y8F A;  2YRY A;  4F7U P;  3U7D A;  2HTH B;  3CIK A;  2AL6 A;  3KZ1 A;  1SGH A;  1EVH A;  3TFM A;  1FHO A;  1XCG A;  1XD4 A;  2KGX B;  5JHH A;  4Z2M B;  2VSZ A;  3DXD A;  2HE7 A;  2YS3 A;  2COC A;  5FI0 A;  4PQ0 A;  1X1F A;  2COF A;  4KHO A;  2X18 A;  2PZ1 A;  4DXA B;  4KVG B;  3ULC A;  5KCV A;  1BWN A;  3SNH A;  4Y94 A;  2MFQ A;  1MAI A;  4C0A A;  4NSW A;  2LG1 A;  1TQZ A;  1P5T A;  5LON B;  2D11 A;  2MKR A;  4NY0 A;  1X1G A;  2UVM A;  1KI1 B;  1LW3 A;  1V5M A;  4D0N B;  2CY4 A;  4CYE A;  1WGQ A;  2LKO A;  1ZVR A;  2ROZ B;  3G9W A;  1UNR A;  5DHA B;  4A6H A;  1DBH A;  1AWE A;  2DFK A;  1RRP B;  2NZ8 B;  1NTY A;  2I5F A;  4GMX B;  2J0M A;  2RNR B;  4IOY X;  1QQG A;  1Y19 B;  4K81 A;  1UNP A;  2ROV A;  4HAZ B;  2RUK B;  1E5W A;  5CLL B;  1FB8 A;  5CLQ B;  4GN1 A;  1RJ2 A;  1UNQ A;  3VIA A;  4DX9 0;  1V61 A;  1OQN A;  2DX1 A;  2DLW A;  2Z0Q A;  2D9Z A;  2IYB A;  2OQB A;  1EGX A;  4HAY B;  4A6F A;  1V5P A;  2K00 A;  4L6E A;  3MPX A;  2ELA A;  1NI2 A;  4HDQ A;  1J0W A;  1UPR A;  4GPT B;  2P0D A;  1K5G B;  2P8V A;  1U5F A;  2XQN M;  1FHX A;  1X11 A;  1BTN A;  1I7A A;  5DH9 B;  4MY6 A;  3OAN A;  4HB4 B;  1NTV A;  2DKP A;  3A98 B;  2N23 A;  1V5U A;  4EKU A;  5GOW B;  5D3Y A;  5L81 A;  2MWN B;  3UZT A;  1U5D A;  2P0H A;  2W2W A;  3N7C A;  2I1K A;  3D8E A;  3PEG A;  4ZRK A;  2AEH A;  1XOD A;  2K2J A;  3HW2 B;  4YON A;  3VOQ A;  1FHW A;  3T06 A;  4KAX B;  1ZC4 B;  2DHK A;  2D4Q A;  2ADZ A;  5KQ1 A;  5HE1 A;  2MDX A; 
#chains in the Genus database with same CATH topology
 1PFJ A;  2D9V A;  4A5K A;  1DRO A;  1Q67 A;  4BBK A;  2J0K A;  3TCA A;  2YSZ A;  1WJ1 A;  3M1I B;  1DDW A;  1X86 A;  5EFX A;  4HB3 B;  2UZS A;  3MDB C;  1ZSQ A;  2CAY A;  2GJY A;  3TW1 A;  2K2U A;  1GC7 A;  3D8D A;  2Q13 A;  1ZC3 B;  3NSU A;  1WG7 A;  2R09 A;  3NWA A;  5M4Y B;  2VRW B;  2DHJ A;  2QKL A;  5LOP B;  4HDO A;  2CY5 A;  4WVF B;  2NBV A;  1U2B A;  3F5R A;  2D10 A;  3NWD A;  3FVC A;  1GG3 A;  3HK0 A;  2GCJ A;  2COD A;  3KRX A;  4L1R A;  3O96 A;  2Y8G A;  3HQC A;  1KZG A;  2FJU B;  1P6S A;  3P6A A;  3BIN A;  2ZPY A;  3P7Z A;  5I2M A;  2EMS A;  3PG7 A;  3V5W A;  2I1J A;  3KRW A;  1SHC A;  2KUP A;  2DN6 A;  2YS1 A;  2BCJ A;  1ZYI A;  4DX8 A;  3BJI A;  4A6K A;  2EMT A;  1W1H A;  4XWX A;  3SUZ A;  3PVL A;  2DX5 A;  2YT2 A;  4F7H A;  2M14 A;  2DYQ A;  2E2X A;  3OHM B;  3SYX A;  2V76 A;  5C79 A;  2DTC A;  4IFS A;  4EMO A;  1OY2 A;  2VKI A;  1DYN A;  3TO1 A;  2YS5 A;  1P3R A;  4DBB A;  1J19 A;  1LB1 A;  1FAO A;  2D2Q A;  4QJ5 B;  1ISN A;  1FOE A;  2Z0O A;  5DIF B;  5D3V A;  4WJ7 A;  1NU2 A;  4DIX A;  3PVW A;  2QKM A;  2N0Y A;  4HAU B;  3D8F A;  2CRF A;  2D9Y A;  1PMS A;  4CHJ A;  1TXD A;  4ZRI A;  5HE2 A;  5JHG A;  3HIE A;  4K17 A;  3A8Q A;  2GCL A;  3F0W A;  5JP4 A;  5C5B A;  4HAV B;  1H10 A;  2KCJ A;  5D27 A;  4A6F B;  4MT7 A;  1ZM0 A;  5DHF B;  3ODO A;  3ZVR A;  1MI1 A;  1UPQ A;  1BAK A;  1XKE A;  1QC6 A;  5FI1 A;  5D3W A;  4KHB B;  5C6R A;  4K2P A;  1MK9 B;  4K2O A;  3SO6 A;  4HHV A;  1GC6 A;  3DXE A;  5HE0 A;  3X23 A;  1V89 A;  4HAT B;  1BTK A;  2W2X D;  2JP2 A;  2Z0P A;  3KY9 A;  3AU4 A;  1PLS A;  1W1D A;  3QIJ A;  1MIZ B;  4PNK A;  3PZD A;  2IFS A;  4HAW B;  1IRS A;  1I2H A;  3B77 A;  2I5C A;  4IAP A;  2Z13 A;  4ZRJ A;  1N3H A;  1W1G A;  1DDM A;  5I2S A;  4GOU A;  4CSQ A;  2D9X A;  1DDV A;  3ZDT A;  5D3X A;  2W2X C;  2YT0 A;  3SV1 A;  1MPH A;  2RGN B;  5DI9 B;  3FSS A;  4CHM A;  3WYF B;  2Z59 A;  2K8E A;  4GXB A;  3NWF A;  4P7I A;  1MKE A;  1Z87 A;  5C5B B;  2RLO A;  1U29 A;  1Y5O A;  3A58 A;  1M7R A;  1OMW A;  4OSN A;  1UEF A;  4H8S A;  2RVB B;  1FGY A;  4HSI A;  3KSY A;  3RCP A;  3ML4 A;  5JLJ B;  2Y7B A;  2LYD A;  4TYZ A;  5HE3 A;  2RRF A;  3CXB B;  2M38 A;  3ULB A;  2LOZ A;  2NMB A;  2EC1 A;  3ODX A;  1KZ7 A;  1U5E A;  2R0D A;  2L1C A;  1FGZ A;  4D6W A;  2R2Y A;  1AQC A;  3U12 A;  3DXC A;  2RSG A;  1K5D B;  3PP2 A;  4MK0 A;  2EJ8 A;  2GS0 A;  2YT1 A;  1XX0 A;  4HAX B;  5KQ4 A;  5IRS A;  3FM8 C;  3FEH A;  2FJL A;  2DHI A;  4HB0 B;  2Z14 A;  4GZU A;  1WI1 A;  2P0F A;  2G35 A;  1TJ6 A;  1EAZ A;  3ODW A;  3IVF A;  2LUL A;  1WGU A;  2DYN A;  4GMV A;  1XR0 B;  5J3T A;  1H4R A;  4Z2N A;  1MIX A;  1M7E A;  2OTX A;  2YVC A;  2ZKM X;  4F7G A;  4TKN A;  3GYO A;  3PVU A;  3QBV B;  2LOX A;  1WJM A;  4EJN A;  2H7D A;  1U27 A;  3LJU X;  4WSF A;  1WVH A;  2H7E A;  2KUQ A;  2L2I A;  4HB2 B;  1V88 A;  4QJ4 B;  1EF1 A;  5J3Q A;  2DA0 A;  3GYP A;  2DKQ A;  1MK7 B;  3WA0 A;  2J0J A;  2J59 M;  3A8P A;  3TVV A;  1X05 A;  3AJ4 A;  1B55 A;  5J3Y A;  3HSA A;  5C16 A;  2ELB A;  2COA A;  3PSC A;  2D9W A;  4GNK B;  3U8Z A;  1U5G A;  3QWM A;  2UZR A;  2YF0 A;  4KHA A;  3AU5 A;  4B6H A;  4YL8 A;  2Y8F A;  2YRY A;  4F7U P;  3U7D A;  2HTH B;  3CIK A;  2AL6 A;  3KZ1 A;  1SGH A;  1EVH A;  3TFM A;  1FHO A;  1XCG A;  1XD4 A;  2KGX B;  2KR0 A;  5JHH A;  4Z2M B;  2VSZ A;  3DXD A;  2HE7 A;  2YS3 A;  2COC A;  5FI0 A;  4PQ0 A;  1X1F A;  2COF A;  4KHO A;  2X18 A;  2PZ1 A;  4DXA B;  4KVG B;  3ULC A;  3NW8 A;  5KCV A;  1BWN A;  3SNH A;  4Y94 A;  2MFQ A;  2GUM A;  1MAI A;  4C0A A;  4NSW A;  2LG1 A;  2KIG A;  1TQZ A;  1P5T A;  5LG4 B;  5LON B;  2D11 A;  2MKR A;  3DCX A;  4NY0 A;  1X1G A;  2UVM A;  1KI1 B;  1LW3 A;  1V5M A;  4D0N B;  2CY4 A;  4CYE A;  1WGQ A;  2LKO A;  1ZVR A;  2ROZ B;  3G9W A;  4KHB A;  1UNR A;  5DHA B;  2K49 A;  4A6H A;  1DBH A;  1AWE A;  2DFK A;  1RRP B;  2NZ8 B;  1NTY A;  2I5F A;  4GMX B;  2J0M A;  2RNR B;  4IOY X;  1QQG A;  1Y19 B;  4K81 A;  1UNP A;  2ROV A;  4HAZ B;  2RUK B;  1E5W A;  5CLL B;  2KIE A;  1FB8 A;  5CLQ B;  4GN1 A;  1RJ2 A;  1UNQ A;  3VIA A;  4DX9 0;  2Z4D A;  4QXA B;  1V61 A;  1OQN A;  2DX1 A;  4QJ3 B;  2DLW A;  2Z0Q A;  2D9Z A;  2IYB A;  2OQB A;  1EGX A;  4HAY B;  4A6F A;  1V5P A;  2K00 A;  4L6E A;  3MPX A;  2ELA A;  1NI2 A;  4HDQ A;  1J0W A;  1UPR A;  4GPT B;  1T77 A;  2P0D A;  1K5G B;  2P8V A;  1U5F A;  2XQN M;  1FHX A;  1X11 A;  1BTN A;  1I7A A;  5DH9 B;  4MY6 A;  3OAN A;  4OT1 A;  4HB4 B;  1NTV A;  2DKP A;  3A98 B;  2N23 A;  1V5U A;  4EKU A;  5GOW B;  5D3Y A;  5L81 A;  2MWN B;  3UZT A;  1U5D A;  2P0H A;  2W2W A;  3N7C A;  2I1K A;  3D8E A;  3PEG A;  4ZRK A;  2AEH A;  1XOD A;  2K2J A;  3HW2 B;  4YON A;  3VOQ A;  1FHW A;  3T06 A;  4KAX B;  1ZC4 B;  2DHK A;  2D4Q A;  2ADZ A;  5KQ1 A;  5HE1 A;  2MDX A; 
#chains in the Genus database with same CATH homology
 1PFJ A;  2D9V A;  4A5K A;  1DRO A;  1Q67 A;  4BBK A;  2J0K A;  3TCA A;  2YSZ A;  1WJ1 A;  3M1I B;  1DDW A;  1X86 A;  5EFX A;  4HB3 B;  2UZS A;  3MDB C;  1ZSQ A;  2CAY A;  2GJY A;  3TW1 A;  2K2U A;  1GC7 A;  3D8D A;  2Q13 A;  1ZC3 B;  3NSU A;  1WG7 A;  2R09 A;  2VRW B;  2DHJ A;  2QKL A;  5LOP B;  4HDO A;  2CY5 A;  4WVF B;  1U2B A;  3F5R A;  2D10 A;  1GG3 A;  3HK0 A;  2GCJ A;  2COD A;  3KRX A;  3O96 A;  2Y8G A;  3HQC A;  1KZG A;  1P6S A;  3P6A A;  3BIN A;  2ZPY A;  3P7Z A;  2EMS A;  3PG7 A;  3V5W A;  2I1J A;  3KRW A;  1SHC A;  2KUP A;  2DN6 A;  2YS1 A;  2BCJ A;  4DX8 A;  3BJI A;  4A6K A;  2EMT A;  1W1H A;  4XWX A;  3SUZ A;  3PVL A;  2DX5 A;  4F7H A;  2M14 A;  2DYQ A;  2E2X A;  3SYX A;  2V76 A;  5C79 A;  2DTC A;  4IFS A;  4EMO A;  1OY2 A;  2VKI A;  1DYN A;  3TO1 A;  2YS5 A;  1P3R A;  4DBB A;  1J19 A;  1LB1 A;  1FAO A;  2D2Q A;  1ISN A;  1FOE A;  2Z0O A;  5DIF B;  5D3V A;  4WJ7 A;  1NU2 A;  3PVW A;  2QKM A;  2N0Y A;  4HAU B;  3D8F A;  2CRF A;  2D9Y A;  1PMS A;  4CHJ A;  1TXD A;  4ZRI A;  5HE2 A;  5JHG A;  4K17 A;  3A8Q A;  2GCL A;  3F0W A;  5JP4 A;  5C5B A;  4HAV B;  1H10 A;  2KCJ A;  5D27 A;  4A6F B;  4MT7 A;  1ZM0 A;  5DHF B;  3ODO A;  3ZVR A;  1UPQ A;  1BAK A;  1XKE A;  1QC6 A;  5FI1 A;  5D3W A;  4KHB B;  5C6R A;  4K2P A;  1MK9 B;  4K2O A;  3SO6 A;  4HHV A;  1GC6 A;  3DXE A;  5HE0 A;  3X23 A;  1V89 A;  4HAT B;  1BTK A;  2W2X D;  2JP2 A;  2Z0P A;  3KY9 A;  3AU4 A;  1PLS A;  1W1D A;  3QIJ A;  1MIZ B;  4PNK A;  3PZD A;  2IFS A;  4HAW B;  1IRS A;  1I2H A;  2I5C A;  4IAP A;  4ZRJ A;  1N3H A;  1W1G A;  1DDM A;  2D9X A;  1DDV A;  3ZDT A;  5D3X A;  2W2X C;  2YT0 A;  3SV1 A;  1MPH A;  2RGN B;  5DI9 B;  3FSS A;  4CHM A;  3WYF B;  4GXB A;  4P7I A;  1MKE A;  1Z87 A;  5C5B B;  2RLO A;  1U29 A;  1Y5O A;  1M7R A;  1OMW A;  1UEF A;  4H8S A;  2RVB B;  1FGY A;  3KSY A;  3RCP A;  3ML4 A;  5JLJ B;  2Y7B A;  2LYD A;  4TYZ A;  5HE3 A;  3CXB B;  2M38 A;  3ULB A;  2LOZ A;  2NMB A;  2EC1 A;  3ODX A;  1KZ7 A;  1U5E A;  2R0D A;  2L1C A;  1FGZ A;  1AQC A;  3DXC A;  2RSG A;  1K5D B;  3PP2 A;  4MK0 A;  2EJ8 A;  2GS0 A;  2YT1 A;  1XX0 A;  4HAX B;  5KQ4 A;  3FM8 C;  3FEH A;  2FJL A;  2DHI A;  4HB0 B;  4GZU A;  1WI1 A;  2P0F A;  2G35 A;  1TJ6 A;  1EAZ A;  3ODW A;  3IVF A;  2LUL A;  1WGU A;  2DYN A;  4GMV A;  1XR0 B;  5J3T A;  1H4R A;  4Z2N A;  1MIX A;  1M7E A;  2OTX A;  2YVC A;  4F7G A;  4TKN A;  3GYO A;  3PVU A;  3QBV B;  2LOX A;  1WJM A;  4EJN A;  2H7D A;  1U27 A;  3LJU X;  4WSF A;  1WVH A;  2H7E A;  2L2I A;  4HB2 B;  1V88 A;  1EF1 A;  5J3Q A;  2DA0 A;  3GYP A;  2DKQ A;  1MK7 B;  3WA0 A;  2J0J A;  2J59 M;  3A8P A;  3TVV A;  1X05 A;  3AJ4 A;  1B55 A;  5J3Y A;  5C16 A;  2ELB A;  2COA A;  3PSC A;  2D9W A;  3U8Z A;  1U5G A;  3QWM A;  2UZR A;  2YF0 A;  4KHA A;  3AU5 A;  4B6H A;  4YL8 A;  2Y8F A;  2YRY A;  4F7U P;  3U7D A;  2HTH B;  3CIK A;  2AL6 A;  3KZ1 A;  1SGH A;  1EVH A;  3TFM A;  1FHO A;  1XCG A;  1XD4 A;  2KGX B;  5JHH A;  4Z2M B;  2VSZ A;  3DXD A;  2HE7 A;  2YS3 A;  2COC A;  5FI0 A;  4PQ0 A;  1X1F A;  2COF A;  4KHO A;  2X18 A;  2PZ1 A;  4DXA B;  4KVG B;  3ULC A;  5KCV A;  1BWN A;  3SNH A;  4Y94 A;  2MFQ A;  1MAI A;  4C0A A;  4NSW A;  2LG1 A;  1TQZ A;  1P5T A;  5LON B;  2D11 A;  2MKR A;  4NY0 A;  1X1G A;  2UVM A;  1KI1 B;  1LW3 A;  1V5M A;  4D0N B;  2CY4 A;  4CYE A;  1WGQ A;  2LKO A;  1ZVR A;  2ROZ B;  3G9W A;  1UNR A;  5DHA B;  4A6H A;  1DBH A;  1AWE A;  2DFK A;  1RRP B;  2NZ8 B;  1NTY A;  2I5F A;  4GMX B;  2J0M A;  2RNR B;  4IOY X;  1QQG A;  1Y19 B;  4K81 A;  1UNP A;  2ROV A;  4HAZ B;  2RUK B;  1E5W A;  5CLL B;  1FB8 A;  5CLQ B;  4GN1 A;  1RJ2 A;  1UNQ A;  3VIA A;  4DX9 0;  1V61 A;  1OQN A;  2DX1 A;  2DLW A;  2Z0Q A;  2D9Z A;  2IYB A;  2OQB A;  1EGX A;  4HAY B;  4A6F A;  1V5P A;  2K00 A;  4L6E A;  3MPX A;  2ELA A;  1NI2 A;  4HDQ A;  1J0W A;  1UPR A;  4GPT B;  2P0D A;  1K5G B;  2P8V A;  1U5F A;  2XQN M;  1FHX A;  1X11 A;  1BTN A;  1I7A A;  5DH9 B;  4MY6 A;  3OAN A;  4HB4 B;  1NTV A;  2DKP A;  3A98 B;  2N23 A;  1V5U A;  4EKU A;  5GOW B;  5D3Y A;  5L81 A;  2MWN B;  3UZT A;  1U5D A;  2P0H A;  2W2W A;  3N7C A;  2I1K A;  3D8E A;  3PEG A;  4ZRK A;  2AEH A;  1XOD A;  2K2J A;  3HW2 B;  4YON A;  3VOQ A;  1FHW A;  3T06 A;  4KAX B;  1ZC4 B;  2DHK A;  2D4Q A;  2ADZ A;  5KQ1 A;  5HE1 A;  2MDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...