2L1CA

Shc-ptb:biphosphorylated integrin beta3 cytoplasmic tail complex (1:1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
191
structure length
191
Chain Sequence
b'GQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHC (Src homology 2 domain containing) transforming protein
publication title Integrin {beta}3 phosphorylation dictates its complex with the Shc phosphotyrosine-binding (PTB) domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 41
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2l1cA00
4F7HA 3TO1A 2MWNB 3FEHA 2QKLA 4Z2NA 2ZPYA 3IVFA 5C16A 1KZ7A 4K17A 2E2XA 1BTNA 3CXBB 4MY6A 4IAPA 1UNPA 3BJIA 2NZ8B 5D3YA 2LOZA 3ULBA 5HE2A 1U5DA 3FM8C 3MDBC 4PQ0A 4K81A 2G35A 5D3VA 4C0AA 4HHVA 3PSCA 5CLQB 3TW1A 4B6HA 1B55A 2DLWA 4HAXB 3MPXA 1MK9B 3SUZA 5FI1A 1Y5OA 2HTHB 1GG3A 1X11A 3ODXA 2YS5A 3TCAA 2D11A 1MK7B 4KHOA 4F7UP 2Z0OA 5DI9B 2LG1A 3PEGA 2RVBB 4KVGB 4Z2MB 2YS3A 2IFSA 4HATB 4WJ7A 2Z0QA 2DX5A 4PNKA 5C5BB 1XCGA 1N3HA 2K2JA 4MT7A 3F5RA 2AEHA 3D8FA 3GYOA 1UPQA 1I2HA 2J0MA 1QC6A 2XQNM 3NSUA 2DYQA 1Z87A 4HAYB 2YT0A 4CHMA 1FGYA 2YT1A 1RJ2A 3SYXA 3U8ZA 4GN1A 5D3WA 1P5TA 2EMTA 1FAOA 3X23A 4HAVB 3AJ4A 2YVCA 3KSYA 2D9ZA 4TYZA 3T06A 1V61A 1XD4A 2CAYA 4A6HA 4DBBA 1DDMA 1ZM0A 1AQCA 2YSZA 1TJ6A 2YF0A 2X18A 3QWMA 2J0KA 1X05A 4WVFB 1W1GA 4P7IA 4GMXB 3UZTA 3F0WA 3SV1A 4A6KA 1V5PA 1MAIA 1Q67A 3P6AA 1V89A 1MIZB 5HE3A 1TQZA 4CHJA 2K00A 3A8QA 4YONA 4ZRJA 1H4RA 2QKMA 2ROZB 5CLLB 2JP2A 1BTKA 2I5FA 2DA0A 2EC1A 2EJ8A 4L6EA 3TFMA 3ULCA 5JHGA 2D9YA 1WJ1A 2L2IA 4NSWA 1MKEA 1J0WA 3G9WA 2FJLA 2DHJA 3D8EA 2COFA 2P0FA 1XKEA 2W2XD 1K5GB 3AU4A 4KHAA 1WJMA 2P0DA 1ISNA 5J3TA 2L1CA 1UEFA 1E5WA 2VRWB 2H7DA 3WA0A 1TXDA 1UPRA 2H7EA 2VSZA 2P0HA 1X1FA 3FSSA 2PZ1A 3QBVB 2UVMA 1V88A 4HAUB 2YS1A 3A8PA 2VKIA 4EKUA 5DIFB 1KI1B 4GXBA 1SGHA 2KGXB 2M14A 3OANA 1EVHA 1OY2A 1BWNA 1OQNA 4Y94A 3PP2A 2D4QA 3QIJA 4A6FA 4KAXB 3PVWA 3RCPA 5LONB 2D9WA 1BAKA 3KZ1A 2DHKA 1ZVRA 5C79A 1U5FA 5J3YA 1UNQA 2UZSA 1SHCA 1U2BA 2MFQA 5JP4A 1WGUA 3HQCA 2Q13A 3VIAA 2KUPA 5FI0A 3U7DA 1P6SA 1I7AA 1KZGA 4BBKA 2RSGA 1WI1A 3DXEA 1U29A 4TKNA 1WG7A 2CY5A 5L81A 1FHXA 5KQ1A 2YRYA 4GMVA 5C6RA 3BINA 3P7ZA 1NTYA 4HB0B 5KCVA 2R09A 4CYEA 2J59M 4EJNA 4DX8A 2I1JA 2DYNA 1WVHA 3V5WA 1NI2A 2HE7A 3KY9A 2LOXA 2GJYA 3A98B 4DX90 3TVVA 1W1DA 4HAWB 2P8VA 2MDXA 3GYPA 2DN6A 5GOWB 1X86A 2OQBA 2ADZA 2N23A 1DDVA 2RLOA 1MPHA 1OMWA 2AL6A 5JLJB 3HK0A 4HB4B 3ODWA 1XODA 2D10A 3N7CA 2DKPA 4YL8A 2COCA 2DKQA 2GCJA 3ODOA 5D3XA 1P3RA 1UNRA 1NTVA 1Y19B 2CY4A 2GCLA 2D9VA 3ZDTA 2V76A 1GC7A 1ZC3B 5KQ4A 1IRSA 2UZRA 4ZRIA 4NY0A 4ZRKA 3DXDA 4GPTB 1FHOA 2W2XC 1H10A 4GZUA 2RUKB 4HDOA 2N0YA 3M1IB 1XR0B 2CODA 4IOYX 2DHIA 2R0DA 3KRWA 4A6FB 4F7GA 4HB2B 4DXAB 4KHBB 5JHHA 3KRXA 2K2UA 4K2OA 5EFXA 2LYDA 1PLSA 5HE1A 2MKRA 1FB8A 4HB3B 2ELBA 3AU5A 4A5KA 2LKOA 2DX1A 1MIXA 1PFJA 1X1GA 4EMOA 2ROVA 2I1KA 3PZDA 2DTCA 2NMBA 3SNHA 1V5UA 1FHWA 2D2QA 3PVLA 1EF1A 2LULA 5DHAB 4D0NB 2Y8GA 1FGZA 1J19A 1DBHA 1RRPB 3D8DA 4IFSA 5LOPB 2RNRB 3LJUX 1LB1A 4K2PA 2GS0A 5C5BA 2DFKA 1U5GA 2W2WA 3HW2B 3DXCA 5DH9B 2COAA 3O96A 5DHFB 2Y7BA 4MK0A 1AWEA 1U27A 2KCJA 2Y8FA 1WGQA 1EGXA 3WYFB 1DDWA 2CRFA 1QQGA 2Z0PA 1V5MA 1U5EA 3ZVRA 1NU2A 3ML4A 3CIKA 1ZC4B 1DROA 2BCJA 2ELAA 2J0JA 5HE0A 3SO6A 1M7EA 1XX0A 4HAZB 2D9XA 1PMSA 1LW3A 2I5CA 1K5DB 3PG7A 1DYNA 5J3QA 1GC6A 4XWXA 4HDQA 2EMSA 2M38A 1EAZA 2RGNB 2OTXA 1M7RA 1FOEA 3VOQA 4H8SA 4WSFA 1W1HA 5D27A 2IYBA 1ZSQA 3PVUA
chains in the Genus database with same CATH superfamily
4F7HA 3TO1A 2MWNB 3FEHA 2QKLA 4Z2NA 2ZPYA 3IVFA 5C16A 1KZ7A 4K17A 4D6WA 2E2XA 1BTNA 3CXBB 4MY6A 4IAPA 1UNPA 3BJIA 2NZ8B 5D3YA 2LOZA 3OHMB 5HE2A 3ULBA 1U5DA 3FM8C 3MDBC 4PQ0A 4K81A 2G35A 5D3VA 4C0AA 4HHVA 3PSCA 5CLQB 3NW8A 3TW1A 2KIEA 4B6HA 1B55A 2DLWA 2R2YA 4HAXB 3MPXA 1MK9B 1ZYIA 3SUZA 5FI1A 3DCXA 1Y5OA 2HTHB 1GG3A 5I2SA 1X11A 3ODXA 2YS5A 3TCAA 2D11A 3HSAA 1MK7B 4KHOA 4F7UP 2Z0OA 5DI9B 2LG1A 3PEGA 2RVBB 4KVGB 2GUMA 4Z2MB 2YS3A 2IFSA 4HATB 4WJ7A 2Z0QA 2DX5A 4PNKA 5C5BB 1XCGA 1N3HA 2K2JA 4MT7A 3F5RA 2AEHA 3D8FA 3FVCA 1UPQA 3GYOA 4KHBA 1I2HA 2J0MA 1QC6A 2XQNM 3NSUA 2DYQA 1Z87A 4HAYB 2YT0A 4CHMA 1FGYA 2YT1A 1RJ2A 3SYXA 3U8ZA 4GN1A 4GNKB 5D3WA 1P5TA 2EMTA 1FAOA 3X23A 3U12A 4HAVB 3AJ4A 2YVCA 3KSYA 2D9ZA 4TYZA 3T06A 1V61A 1XD4A 2CAYA 4A6HA 4DBBA 1DDMA 1ZM0A 1AQCA 2YSZA 1TJ6A 2YF0A 2X18A 3QWMA 2J0KA 1X05A 4WVFB 1W1GA 4P7IA 4GMXB 3UZTA 3F0WA 3SV1A 4A6KA 1MI1A 1V5PA 1MAIA 1Q67A 3P6AA 1V89A 1MIZB 3NWDA 5HE3A 1TQZA 2ZKMX 4CHJA 2K00A 3A8QA 4YONA 4ZRJA 1H4RA 2QKMA 2ROZB 5CLLB 2JP2A 1BTKA 2I5FA 2DA0A 2EC1A 2EJ8A 4L6EA 3TFMA 3ULCA 5JHGA 1T77A 2D9YA 1WJ1A 2L2IA 4NSWA 1MKEA 1J0WA 3G9WA 2FJLA 2DHJA 3D8EA 2COFA 2P0FA 1XKEA 2W2XD 1K5GB 3AU4A 4KHAA 1WJMA 2P0DA 1ISNA 5J3TA 2L1CA 1UEFA 1E5WA 2VRWB 2H7DA 3WA0A 1TXDA 1UPRA 2H7EA 2VSZA 2P0HA 1X1FA 3FSSA 2PZ1A 3QBVB 2UVMA 1V88A 4HAUB 4QJ5B 2YS1A 3A8PA 2VKIA 4EKUA 5DIFB 1KI1B 4GXBA 1SGHA 2KGXB 2M14A 3OANA 3NWAA 1EVHA 1OY2A 1BWNA 1OQNA 4Y94A 3PP2A 2D4QA 3QIJA 5LG4B 4A6FA 4KAXB 3PVWA 3RCPA 5LONB 2D9WA 1BAKA 2DHKA 3KZ1A 2KR0A 4HSIA 1ZVRA 4CSQA 5C79A 1U5FA 5J3YA 1UNQA 2UZSA 1SHCA 1U2BA 2MFQA 5JP4A 1WGUA 3HQCA 2Q13A 3VIAA 2KUPA 5FI0A 5I2MA 3U7DA 1P6SA 1I7AA 1KZGA 4GOUA 4BBKA 2RSGA 1WI1A 3DXEA 1U29A 4TKNA 1WG7A 2CY5A 5L81A 1FHXA 5KQ1A 2YRYA 4GMVA 5C6RA 3BINA 3P7ZA 1NTYA 4HB0B 5KCVA 2R09A 4OT1A 4L1RA 4CYEA 2J59M 4EJNA 4DX8A 2KIGA 2I1JA 2DYNA 1WVHA 3V5WA 1NI2A 2HE7A 3KY9A 2LOXA 2GJYA 3A98B 4DX90 3NWFA 3TVVA 2RRFA 1W1DA 4HAWB 2K8EA 3HIEA 2P8VA 2MDXA 2K49A 3GYPA 2DN6A 5GOWB 1X86A 2OQBA 2ADZA 2N23A 1DDVA 2RLOA 1MPHA 3A58A 1OMWA 2AL6A 5JLJB 3HK0A 4HB4B 3ODWA 2KUQA 1XODA 2D10A 3N7CA 2DKPA 4YL8A 2COCA 2DKQA 2GCJA 3ODOA 5D3XA 1P3RA 1UNRA 2Z4DA 1NTVA 2YT2A 1Y19B 2CY4A 2GCLA 2D9VA 4QXAB 2V76A 3ZDTA 1GC7A 2NBVA 5M4YB 1ZC3B 4QJ4B 5KQ4A 1IRSA 2UZRA 4ZRIA 4NY0A 4ZRKA 3DXDA 4GPTB 4DIXA 1FHOA 2W2XC 4OSNA 1H10A 4GZUA 2RUKB 4HDOA 2N0YA 3M1IB 1XR0B 2CODA 4IOYX 2DHIA 2R0DA 3KRWA 4A6FB 4F7GA 4HB2B 4DXAB 4KHBB 5JHHA 3KRXA 2K2UA 4K2OA 5EFXA 2LYDA 1PLSA 4QJ3B 2MKRA 1FB8A 5HE1A 2Z14A 4HB3B 2ELBA 3AU5A 3B77A 4A5KA 2LKOA 2DX1A 1MIXA 1PFJA 1X1GA 4EMOA 2ROVA 2I1KA 3PZDA 2DTCA 2NMBA 3SNHA 1V5UA 1FHWA 2D2QA 3PVLA 1EF1A 2LULA 5DHAB 4D0NB 2FJUB 2Y8GA 1FGZA 1J19A 1DBHA 1RRPB 3D8DA 5IRSA 4IFSA 5LOPB 2RNRB 3LJUX 1LB1A 4K2PA 2GS0A 5C5BA 2DFKA 1U5GA 2W2WA 3HW2B 3DXCA 5DH9B 2COAA 3O96A 5DHFB 2Y7BA 4MK0A 1AWEA 1U27A 2KCJA 2Y8FA 1WGQA 1EGXA 3WYFB 1DDWA 2CRFA 1QQGA 2Z0PA 1V5MA 1U5EA 3ZVRA 1NU2A 3ML4A 3CIKA 1ZC4B 1DROA 2BCJA 2ELAA 2J0JA 5HE0A 3SO6A 1M7EA 1XX0A 4HAZB 2D9XA 2Z13A 1PMSA 1LW3A 2Z59A 2I5CA 1K5DB 3PG7A 1DYNA 5J3QA 1GC6A 4XWXA 4HDQA 2EMSA 2M38A 1EAZA 2RGNB 2OTXA 1M7RA 1FOEA 3VOQA 4H8SA 4WSFA 1W1HA 5D27A 2IYBA 1ZSQA 3PVUA
chains in the Genus database with same CATH topology
4F7HA 3TO1A 2MWNB 3FEHA 2QKLA 4Z2NA 2ZPYA 3IVFA 5C16A 1KZ7A 4K17A 2E2XA 1BTNA 3CXBB 4MY6A 4IAPA 1UNPA 3BJIA 2NZ8B 5D3YA 2LOZA 3ULBA 5HE2A 1U5DA 3FM8C 3MDBC 4PQ0A 4K81A 2G35A 5D3VA 4C0AA 4HHVA 3PSCA 5CLQB 3TW1A 4B6HA 1B55A 2DLWA 4HAXB 3MPXA 1MK9B 3SUZA 5FI1A 1Y5OA 2HTHB 1GG3A 1X11A 3ODXA 2YS5A 3TCAA 2D11A 1MK7B 4KHOA 4F7UP 2Z0OA 5DI9B 2LG1A 3PEGA 2RVBB 4KVGB 4Z2MB 2YS3A 2IFSA 4HATB 4WJ7A 2Z0QA 2DX5A 4PNKA 5C5BB 1XCGA 1N3HA 2K2JA 4MT7A 3F5RA 2AEHA 3D8FA 3GYOA 1UPQA 1I2HA 2J0MA 1QC6A 2XQNM 3NSUA 2DYQA 1Z87A 4HAYB 2YT0A 4CHMA 1FGYA 2YT1A 1RJ2A 3SYXA 3U8ZA 4GN1A 5D3WA 1P5TA 2EMTA 1FAOA 3X23A 4HAVB 3AJ4A 2YVCA 3KSYA 2D9ZA 4TYZA 3T06A 1V61A 1XD4A 2CAYA 4A6HA 4DBBA 1DDMA 1ZM0A 1AQCA 2YSZA 1TJ6A 2YF0A 2X18A 3QWMA 2J0KA 1X05A 4WVFB 1W1GA 4P7IA 4GMXB 3UZTA 3F0WA 3SV1A 4A6KA 1V5PA 1MAIA 1Q67A 3P6AA 1V89A 1MIZB 5HE3A 1TQZA 4CHJA 2K00A 3A8QA 4YONA 4ZRJA 1H4RA 2QKMA 2ROZB 5CLLB 2JP2A 1BTKA 2I5FA 2DA0A 2EC1A 2EJ8A 4L6EA 3TFMA 3ULCA 5JHGA 2D9YA 1WJ1A 2L2IA 4NSWA 1MKEA 1J0WA 3G9WA 2FJLA 2DHJA 3D8EA 2COFA 2P0FA 1XKEA 2W2XD 1K5GB 3AU4A 4KHAA 1WJMA 2P0DA 1ISNA 5J3TA 2L1CA 1UEFA 1E5WA 2VRWB 2H7DA 3WA0A 1TXDA 1UPRA 2H7EA 2VSZA 2P0HA 1X1FA 3FSSA 2PZ1A 3QBVB 2UVMA 1V88A 4HAUB 2YS1A 3A8PA 2VKIA 4EKUA 5DIFB 1KI1B 4GXBA 1SGHA 2KGXB 2M14A 3OANA 1EVHA 1OY2A 1BWNA 1OQNA 4Y94A 3PP2A 2D4QA 3QIJA 4A6FA 4KAXB 3PVWA 3RCPA 5LONB 2D9WA 1BAKA 3KZ1A 2DHKA 1ZVRA 5C79A 1U5FA 5J3YA 1UNQA 2UZSA 1SHCA 1U2BA 2MFQA 5JP4A 1WGUA 3HQCA 2Q13A 3VIAA 2KUPA 5FI0A 3U7DA 1P6SA 1I7AA 1KZGA 4BBKA 2RSGA 1WI1A 3DXEA 1U29A 4TKNA 1WG7A 2CY5A 5L81A 1FHXA 5KQ1A 2YRYA 4GMVA 5C6RA 3BINA 3P7ZA 1NTYA 4HB0B 5KCVA 2R09A 4CYEA 2J59M 4EJNA 4DX8A 2I1JA 2DYNA 1WVHA 3V5WA 1NI2A 2HE7A 3KY9A 2LOXA 2GJYA 3A98B 4DX90 3TVVA 1W1DA 4HAWB 2P8VA 2MDXA 3GYPA 2DN6A 5GOWB 1X86A 2OQBA 2ADZA 2N23A 1DDVA 2RLOA 1MPHA 1OMWA 2AL6A 5JLJB 3HK0A 4HB4B 3ODWA 1XODA 2D10A 3N7CA 2DKPA 4YL8A 2COCA 2DKQA 2GCJA 3ODOA 5D3XA 1P3RA 1UNRA 1NTVA 1Y19B 2CY4A 2GCLA 2D9VA 3ZDTA 2V76A 1GC7A 1ZC3B 5KQ4A 1IRSA 2UZRA 4ZRIA 4NY0A 4ZRKA 3DXDA 4GPTB 1FHOA 2W2XC 1H10A 4GZUA 2RUKB 4HDOA 2N0YA 3M1IB 1XR0B 2CODA 4IOYX 2DHIA 2R0DA 3KRWA 4A6FB 4F7GA 4HB2B 4DXAB 4KHBB 5JHHA 3KRXA 2K2UA 4K2OA 5EFXA 2LYDA 1PLSA 5HE1A 2MKRA 1FB8A 4HB3B 2ELBA 3AU5A 4A5KA 2LKOA 2DX1A 1MIXA 1PFJA 1X1GA 4EMOA 2ROVA 2I1KA 3PZDA 2DTCA 2NMBA 3SNHA 1V5UA 1FHWA 2D2QA 3PVLA 1EF1A 2LULA 5DHAB 4D0NB 2Y8GA 1FGZA 1J19A 1DBHA 1RRPB 3D8DA 4IFSA 5LOPB 2RNRB 3LJUX 1LB1A 4K2PA 2GS0A 5C5BA 2DFKA 1U5GA 2W2WA 3HW2B 3DXCA 5DH9B 2COAA 3O96A 5DHFB 2Y7BA 4MK0A 1AWEA 1U27A 2KCJA 2Y8FA 1WGQA 1EGXA 3WYFB 1DDWA 2CRFA 1QQGA 2Z0PA 1V5MA 1U5EA 3ZVRA 1NU2A 3ML4A 3CIKA 1ZC4B 1DROA 2BCJA 2ELAA 2J0JA 5HE0A 3SO6A 1M7EA 1XX0A 4HAZB 2D9XA 1PMSA 1LW3A 2I5CA 1K5DB 3PG7A 1DYNA 5J3QA 1GC6A 4XWXA 4HDQA 2EMSA 2M38A 1EAZA 2RGNB 2OTXA 1M7RA 1FOEA 3VOQA 4H8SA 4WSFA 1W1HA 5D27A 2IYBA 1ZSQA 3PVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7H A;  3TO1 A;  2MWN B;  3FEH A;  2QKL A;  4Z2N A;  2ZPY A;  3IVF A;  5C16 A;  1KZ7 A;  4K17 A;  2E2X A;  1BTN A;  3CXB B;  4MY6 A;  4IAP A;  1UNP A;  3BJI A;  2NZ8 B;  5D3Y A;  2LOZ A;  3ULB A;  5HE2 A;  1U5D A;  3FM8 C;  3MDB C;  4PQ0 A;  4K81 A;  2G35 A;  5D3V A;  4C0A A;  4HHV A;  3PSC A;  5CLQ B;  3TW1 A;  4B6H A;  1B55 A;  2DLW A;  4HAX B;  3MPX A;  1MK9 B;  3SUZ A;  5FI1 A;  1Y5O A;  2HTH B;  1GG3 A;  1X11 A;  3ODX A;  2YS5 A;  3TCA A;  2D11 A;  1MK7 B;  4KHO A;  4F7U P;  2Z0O A;  5DI9 B;  2LG1 A;  3PEG A;  2RVB B;  4KVG B;  4Z2M B;  2YS3 A;  2IFS A;  4HAT B;  4WJ7 A;  2Z0Q A;  2DX5 A;  4PNK A;  5C5B B;  1XCG A;  1N3H A;  2K2J A;  4MT7 A;  3F5R A;  2AEH A;  3D8F A;  3GYO A;  1UPQ A;  1I2H A;  2J0M A;  1QC6 A;  2XQN M;  3NSU A;  2DYQ A;  1Z87 A;  4HAY B;  2YT0 A;  4CHM A;  1FGY A;  2YT1 A;  1RJ2 A;  3SYX A;  3U8Z A;  4GN1 A;  5D3W A;  1P5T A;  2EMT A;  1FAO A;  3X23 A;  4HAV B;  3AJ4 A;  2YVC A;  3KSY A;  2D9Z A;  4TYZ A;  3T06 A;  1V61 A;  1XD4 A;  2CAY A;  4A6H A;  4DBB A;  1DDM A;  1ZM0 A;  1AQC A;  2YSZ A;  1TJ6 A;  2YF0 A;  2X18 A;  3QWM A;  2J0K A;  1X05 A;  4WVF B;  1W1G A;  4P7I A;  4GMX B;  3UZT A;  3F0W A;  3SV1 A;  4A6K A;  1V5P A;  1MAI A;  1Q67 A;  3P6A A;  1V89 A;  1MIZ B;  5HE3 A;  1TQZ A;  4CHJ A;  2K00 A;  3A8Q A;  4YON A;  4ZRJ A;  1H4R A;  2QKM A;  2ROZ B;  5CLL B;  2JP2 A;  1BTK A;  2I5F A;  2DA0 A;  2EC1 A;  2EJ8 A;  4L6E A;  3TFM A;  3ULC A;  5JHG A;  2D9Y A;  1WJ1 A;  2L2I A;  4NSW A;  1MKE A;  1J0W A;  3G9W A;  2FJL A;  2DHJ A;  3D8E A;  2COF A;  2P0F A;  1XKE A;  2W2X D;  1K5G B;  3AU4 A;  4KHA A;  1WJM A;  2P0D A;  1ISN A;  5J3T A;  2L1C A;  1UEF A;  1E5W A;  2VRW B;  2H7D A;  3WA0 A;  1TXD A;  1UPR A;  2H7E A;  2VSZ A;  2P0H A;  1X1F A;  3FSS A;  2PZ1 A;  3QBV B;  2UVM A;  1V88 A;  4HAU B;  2YS1 A;  3A8P A;  2VKI A;  4EKU A;  5DIF B;  1KI1 B;  4GXB A;  1SGH A;  2KGX B;  2M14 A;  3OAN A;  1EVH A;  1OY2 A;  1BWN A;  1OQN A;  4Y94 A;  3PP2 A;  2D4Q A;  3QIJ A;  4A6F A;  4KAX B;  3PVW A;  3RCP A;  5LON B;  2D9W A;  1BAK A;  3KZ1 A;  2DHK A;  1ZVR A;  5C79 A;  1U5F A;  5J3Y A;  1UNQ A;  2UZS A;  1SHC A;  1U2B A;  2MFQ A;  5JP4 A;  1WGU A;  3HQC A;  2Q13 A;  3VIA A;  2KUP A;  5FI0 A;  3U7D A;  1P6S A;  1I7A A;  1KZG A;  4BBK A;  2RSG A;  1WI1 A;  3DXE A;  1U29 A;  4TKN A;  1WG7 A;  2CY5 A;  5L81 A;  1FHX A;  5KQ1 A;  2YRY A;  4GMV A;  5C6R A;  3BIN A;  3P7Z A;  1NTY A;  4HB0 B;  5KCV A;  2R09 A;  4CYE A;  2J59 M;  4EJN A;  4DX8 A;  2I1J A;  2DYN A;  1WVH A;  3V5W A;  1NI2 A;  2HE7 A;  3KY9 A;  2LOX A;  2GJY A;  3A98 B;  4DX9 0;  3TVV A;  1W1D A;  4HAW B;  2P8V A;  2MDX A;  3GYP A;  2DN6 A;  5GOW B;  1X86 A;  2OQB A;  2ADZ A;  2N23 A;  1DDV A;  2RLO A;  1MPH A;  1OMW A;  2AL6 A;  5JLJ B;  3HK0 A;  4HB4 B;  3ODW A;  1XOD A;  2D10 A;  3N7C A;  2DKP A;  4YL8 A;  2COC A;  2DKQ A;  2GCJ A;  3ODO A;  5D3X A;  1P3R A;  1UNR A;  1NTV A;  1Y19 B;  2CY4 A;  2GCL A;  2D9V A;  3ZDT A;  2V76 A;  1GC7 A;  1ZC3 B;  5KQ4 A;  1IRS A;  2UZR A;  4ZRI A;  4NY0 A;  4ZRK A;  3DXD A;  4GPT B;  1FHO A;  2W2X C;  1H10 A;  4GZU A;  2RUK B;  4HDO A;  2N0Y A;  3M1I B;  1XR0 B;  2COD A;  4IOY X;  2DHI A;  2R0D A;  3KRW A;  4A6F B;  4F7G A;  4HB2 B;  4DXA B;  4KHB B;  5JHH A;  3KRX A;  2K2U A;  4K2O A;  5EFX A;  2LYD A;  1PLS A;  5HE1 A;  2MKR A;  1FB8 A;  4HB3 B;  2ELB A;  3AU5 A;  4A5K A;  2LKO A;  2DX1 A;  1MIX A;  1PFJ A;  1X1G A;  4EMO A;  2ROV A;  2I1K A;  3PZD A;  2DTC A;  2NMB A;  3SNH A;  1V5U A;  1FHW A;  2D2Q A;  3PVL A;  1EF1 A;  2LUL A;  5DHA B;  4D0N B;  2Y8G A;  1FGZ A;  1J19 A;  1DBH A;  1RRP B;  3D8D A;  4IFS A;  5LOP B;  2RNR B;  3LJU X;  1LB1 A;  4K2P A;  2GS0 A;  5C5B A;  2DFK A;  1U5G A;  2W2W A;  3HW2 B;  3DXC A;  5DH9 B;  2COA A;  3O96 A;  5DHF B;  2Y7B A;  4MK0 A;  1AWE A;  1U27 A;  2KCJ A;  2Y8F A;  1WGQ A;  1EGX A;  3WYF B;  1DDW A;  2CRF A;  1QQG A;  2Z0P A;  1V5M A;  1U5E A;  3ZVR A;  1NU2 A;  3ML4 A;  3CIK A;  1ZC4 B;  1DRO A;  2BCJ A;  2ELA A;  2J0J A;  5HE0 A;  3SO6 A;  1M7E A;  1XX0 A;  4HAZ B;  2D9X A;  1PMS A;  1LW3 A;  2I5C A;  1K5D B;  3PG7 A;  1DYN A;  5J3Q A;  1GC6 A;  4XWX A;  4HDQ A;  2EMS A;  2M38 A;  1EAZ A;  2RGN B;  2OTX A;  1M7R A;  1FOE A;  3VOQ A;  4H8S A;  4WSF A;  1W1H A;  5D27 A;  2IYB A;  1ZSQ A;  3PVU A; 
#chains in the Genus database with same CATH topology
 4F7H A;  3TO1 A;  2MWN B;  3FEH A;  2QKL A;  4Z2N A;  2ZPY A;  3IVF A;  5C16 A;  1KZ7 A;  4K17 A;  4D6W A;  2E2X A;  1BTN A;  3CXB B;  4MY6 A;  4IAP A;  1UNP A;  3BJI A;  2NZ8 B;  5D3Y A;  2LOZ A;  3OHM B;  5HE2 A;  3ULB A;  1U5D A;  3FM8 C;  3MDB C;  4PQ0 A;  4K81 A;  2G35 A;  5D3V A;  4C0A A;  4HHV A;  3PSC A;  5CLQ B;  3NW8 A;  3TW1 A;  2KIE A;  4B6H A;  1B55 A;  2DLW A;  2R2Y A;  4HAX B;  3MPX A;  1MK9 B;  1ZYI A;  3SUZ A;  5FI1 A;  3DCX A;  1Y5O A;  2HTH B;  1GG3 A;  5I2S A;  1X11 A;  3ODX A;  2YS5 A;  3TCA A;  2D11 A;  3HSA A;  1MK7 B;  4KHO A;  4F7U P;  2Z0O A;  5DI9 B;  2LG1 A;  3PEG A;  2RVB B;  4KVG B;  2GUM A;  4Z2M B;  2YS3 A;  2IFS A;  4HAT B;  4WJ7 A;  2Z0Q A;  2DX5 A;  4PNK A;  5C5B B;  1XCG A;  1N3H A;  2K2J A;  4MT7 A;  3F5R A;  2AEH A;  3D8F A;  3FVC A;  1UPQ A;  3GYO A;  4KHB A;  1I2H A;  2J0M A;  1QC6 A;  2XQN M;  3NSU A;  2DYQ A;  1Z87 A;  4HAY B;  2YT0 A;  4CHM A;  1FGY A;  2YT1 A;  1RJ2 A;  3SYX A;  3U8Z A;  4GN1 A;  4GNK B;  5D3W A;  1P5T A;  2EMT A;  1FAO A;  3X23 A;  3U12 A;  4HAV B;  3AJ4 A;  2YVC A;  3KSY A;  2D9Z A;  4TYZ A;  3T06 A;  1V61 A;  1XD4 A;  2CAY A;  4A6H A;  4DBB A;  1DDM A;  1ZM0 A;  1AQC A;  2YSZ A;  1TJ6 A;  2YF0 A;  2X18 A;  3QWM A;  2J0K A;  1X05 A;  4WVF B;  1W1G A;  4P7I A;  4GMX B;  3UZT A;  3F0W A;  3SV1 A;  4A6K A;  1MI1 A;  1V5P A;  1MAI A;  1Q67 A;  3P6A A;  1V89 A;  1MIZ B;  3NWD A;  5HE3 A;  1TQZ A;  2ZKM X;  4CHJ A;  2K00 A;  3A8Q A;  4YON A;  4ZRJ A;  1H4R A;  2QKM A;  2ROZ B;  5CLL B;  2JP2 A;  1BTK A;  2I5F A;  2DA0 A;  2EC1 A;  2EJ8 A;  4L6E A;  3TFM A;  3ULC A;  5JHG A;  1T77 A;  2D9Y A;  1WJ1 A;  2L2I A;  4NSW A;  1MKE A;  1J0W A;  3G9W A;  2FJL A;  2DHJ A;  3D8E A;  2COF A;  2P0F A;  1XKE A;  2W2X D;  1K5G B;  3AU4 A;  4KHA A;  1WJM A;  2P0D A;  1ISN A;  5J3T A;  2L1C A;  1UEF A;  1E5W A;  2VRW B;  2H7D A;  3WA0 A;  1TXD A;  1UPR A;  2H7E A;  2VSZ A;  2P0H A;  1X1F A;  3FSS A;  2PZ1 A;  3QBV B;  2UVM A;  1V88 A;  4HAU B;  4QJ5 B;  2YS1 A;  3A8P A;  2VKI A;  4EKU A;  5DIF B;  1KI1 B;  4GXB A;  1SGH A;  2KGX B;  2M14 A;  3OAN A;  3NWA A;  1EVH A;  1OY2 A;  1BWN A;  1OQN A;  4Y94 A;  3PP2 A;  2D4Q A;  3QIJ A;  5LG4 B;  4A6F A;  4KAX B;  3PVW A;  3RCP A;  5LON B;  2D9W A;  1BAK A;  2DHK A;  3KZ1 A;  2KR0 A;  4HSI A;  1ZVR A;  4CSQ A;  5C79 A;  1U5F A;  5J3Y A;  1UNQ A;  2UZS A;  1SHC A;  1U2B A;  2MFQ A;  5JP4 A;  1WGU A;  3HQC A;  2Q13 A;  3VIA A;  2KUP A;  5FI0 A;  5I2M A;  3U7D A;  1P6S A;  1I7A A;  1KZG A;  4GOU A;  4BBK A;  2RSG A;  1WI1 A;  3DXE A;  1U29 A;  4TKN A;  1WG7 A;  2CY5 A;  5L81 A;  1FHX A;  5KQ1 A;  2YRY A;  4GMV A;  5C6R A;  3BIN A;  3P7Z A;  1NTY A;  4HB0 B;  5KCV A;  2R09 A;  4OT1 A;  4L1R A;  4CYE A;  2J59 M;  4EJN A;  4DX8 A;  2KIG A;  2I1J A;  2DYN A;  1WVH A;  3V5W A;  1NI2 A;  2HE7 A;  3KY9 A;  2LOX A;  2GJY A;  3A98 B;  4DX9 0;  3NWF A;  3TVV A;  2RRF A;  1W1D A;  4HAW B;  2K8E A;  3HIE A;  2P8V A;  2MDX A;  2K49 A;  3GYP A;  2DN6 A;  5GOW B;  1X86 A;  2OQB A;  2ADZ A;  2N23 A;  1DDV A;  2RLO A;  1MPH A;  3A58 A;  1OMW A;  2AL6 A;  5JLJ B;  3HK0 A;  4HB4 B;  3ODW A;  2KUQ A;  1XOD A;  2D10 A;  3N7C A;  2DKP A;  4YL8 A;  2COC A;  2DKQ A;  2GCJ A;  3ODO A;  5D3X A;  1P3R A;  1UNR A;  2Z4D A;  1NTV A;  2YT2 A;  1Y19 B;  2CY4 A;  2GCL A;  2D9V A;  4QXA B;  2V76 A;  3ZDT A;  1GC7 A;  2NBV A;  5M4Y B;  1ZC3 B;  4QJ4 B;  5KQ4 A;  1IRS A;  2UZR A;  4ZRI A;  4NY0 A;  4ZRK A;  3DXD A;  4GPT B;  4DIX A;  1FHO A;  2W2X C;  4OSN A;  1H10 A;  4GZU A;  2RUK B;  4HDO A;  2N0Y A;  3M1I B;  1XR0 B;  2COD A;  4IOY X;  2DHI A;  2R0D A;  3KRW A;  4A6F B;  4F7G A;  4HB2 B;  4DXA B;  4KHB B;  5JHH A;  3KRX A;  2K2U A;  4K2O A;  5EFX A;  2LYD A;  1PLS A;  4QJ3 B;  2MKR A;  1FB8 A;  5HE1 A;  2Z14 A;  4HB3 B;  2ELB A;  3AU5 A;  3B77 A;  4A5K A;  2LKO A;  2DX1 A;  1MIX A;  1PFJ A;  1X1G A;  4EMO A;  2ROV A;  2I1K A;  3PZD A;  2DTC A;  2NMB A;  3SNH A;  1V5U A;  1FHW A;  2D2Q A;  3PVL A;  1EF1 A;  2LUL A;  5DHA B;  4D0N B;  2FJU B;  2Y8G A;  1FGZ A;  1J19 A;  1DBH A;  1RRP B;  3D8D A;  5IRS A;  4IFS A;  5LOP B;  2RNR B;  3LJU X;  1LB1 A;  4K2P A;  2GS0 A;  5C5B A;  2DFK A;  1U5G A;  2W2W A;  3HW2 B;  3DXC A;  5DH9 B;  2COA A;  3O96 A;  5DHF B;  2Y7B A;  4MK0 A;  1AWE A;  1U27 A;  2KCJ A;  2Y8F A;  1WGQ A;  1EGX A;  3WYF B;  1DDW A;  2CRF A;  1QQG A;  2Z0P A;  1V5M A;  1U5E A;  3ZVR A;  1NU2 A;  3ML4 A;  3CIK A;  1ZC4 B;  1DRO A;  2BCJ A;  2ELA A;  2J0J A;  5HE0 A;  3SO6 A;  1M7E A;  1XX0 A;  4HAZ B;  2D9X A;  2Z13 A;  1PMS A;  1LW3 A;  2Z59 A;  2I5C A;  1K5D B;  3PG7 A;  1DYN A;  5J3Q A;  1GC6 A;  4XWX A;  4HDQ A;  2EMS A;  2M38 A;  1EAZ A;  2RGN B;  2OTX A;  1M7R A;  1FOE A;  3VOQ A;  4H8S A;  4WSF A;  1W1H A;  5D27 A;  2IYB A;  1ZSQ A;  3PVU A; 
#chains in the Genus database with same CATH homology
 4F7H A;  3TO1 A;  2MWN B;  3FEH A;  2QKL A;  4Z2N A;  2ZPY A;  3IVF A;  5C16 A;  1KZ7 A;  4K17 A;  2E2X A;  1BTN A;  3CXB B;  4MY6 A;  4IAP A;  1UNP A;  3BJI A;  2NZ8 B;  5D3Y A;  2LOZ A;  3ULB A;  5HE2 A;  1U5D A;  3FM8 C;  3MDB C;  4PQ0 A;  4K81 A;  2G35 A;  5D3V A;  4C0A A;  4HHV A;  3PSC A;  5CLQ B;  3TW1 A;  4B6H A;  1B55 A;  2DLW A;  4HAX B;  3MPX A;  1MK9 B;  3SUZ A;  5FI1 A;  1Y5O A;  2HTH B;  1GG3 A;  1X11 A;  3ODX A;  2YS5 A;  3TCA A;  2D11 A;  1MK7 B;  4KHO A;  4F7U P;  2Z0O A;  5DI9 B;  2LG1 A;  3PEG A;  2RVB B;  4KVG B;  4Z2M B;  2YS3 A;  2IFS A;  4HAT B;  4WJ7 A;  2Z0Q A;  2DX5 A;  4PNK A;  5C5B B;  1XCG A;  1N3H A;  2K2J A;  4MT7 A;  3F5R A;  2AEH A;  3D8F A;  3GYO A;  1UPQ A;  1I2H A;  2J0M A;  1QC6 A;  2XQN M;  3NSU A;  2DYQ A;  1Z87 A;  4HAY B;  2YT0 A;  4CHM A;  1FGY A;  2YT1 A;  1RJ2 A;  3SYX A;  3U8Z A;  4GN1 A;  5D3W A;  1P5T A;  2EMT A;  1FAO A;  3X23 A;  4HAV B;  3AJ4 A;  2YVC A;  3KSY A;  2D9Z A;  4TYZ A;  3T06 A;  1V61 A;  1XD4 A;  2CAY A;  4A6H A;  4DBB A;  1DDM A;  1ZM0 A;  1AQC A;  2YSZ A;  1TJ6 A;  2YF0 A;  2X18 A;  3QWM A;  2J0K A;  1X05 A;  4WVF B;  1W1G A;  4P7I A;  4GMX B;  3UZT A;  3F0W A;  3SV1 A;  4A6K A;  1V5P A;  1MAI A;  1Q67 A;  3P6A A;  1V89 A;  1MIZ B;  5HE3 A;  1TQZ A;  4CHJ A;  2K00 A;  3A8Q A;  4YON A;  4ZRJ A;  1H4R A;  2QKM A;  2ROZ B;  5CLL B;  2JP2 A;  1BTK A;  2I5F A;  2DA0 A;  2EC1 A;  2EJ8 A;  4L6E A;  3TFM A;  3ULC A;  5JHG A;  2D9Y A;  1WJ1 A;  2L2I A;  4NSW A;  1MKE A;  1J0W A;  3G9W A;  2FJL A;  2DHJ A;  3D8E A;  2COF A;  2P0F A;  1XKE A;  2W2X D;  1K5G B;  3AU4 A;  4KHA A;  1WJM A;  2P0D A;  1ISN A;  5J3T A;  2L1C A;  1UEF A;  1E5W A;  2VRW B;  2H7D A;  3WA0 A;  1TXD A;  1UPR A;  2H7E A;  2VSZ A;  2P0H A;  1X1F A;  3FSS A;  2PZ1 A;  3QBV B;  2UVM A;  1V88 A;  4HAU B;  2YS1 A;  3A8P A;  2VKI A;  4EKU A;  5DIF B;  1KI1 B;  4GXB A;  1SGH A;  2KGX B;  2M14 A;  3OAN A;  1EVH A;  1OY2 A;  1BWN A;  1OQN A;  4Y94 A;  3PP2 A;  2D4Q A;  3QIJ A;  4A6F A;  4KAX B;  3PVW A;  3RCP A;  5LON B;  2D9W A;  1BAK A;  3KZ1 A;  2DHK A;  1ZVR A;  5C79 A;  1U5F A;  5J3Y A;  1UNQ A;  2UZS A;  1SHC A;  1U2B A;  2MFQ A;  5JP4 A;  1WGU A;  3HQC A;  2Q13 A;  3VIA A;  2KUP A;  5FI0 A;  3U7D A;  1P6S A;  1I7A A;  1KZG A;  4BBK A;  2RSG A;  1WI1 A;  3DXE A;  1U29 A;  4TKN A;  1WG7 A;  2CY5 A;  5L81 A;  1FHX A;  5KQ1 A;  2YRY A;  4GMV A;  5C6R A;  3BIN A;  3P7Z A;  1NTY A;  4HB0 B;  5KCV A;  2R09 A;  4CYE A;  2J59 M;  4EJN A;  4DX8 A;  2I1J A;  2DYN A;  1WVH A;  3V5W A;  1NI2 A;  2HE7 A;  3KY9 A;  2LOX A;  2GJY A;  3A98 B;  4DX9 0;  3TVV A;  1W1D A;  4HAW B;  2P8V A;  2MDX A;  3GYP A;  2DN6 A;  5GOW B;  1X86 A;  2OQB A;  2ADZ A;  2N23 A;  1DDV A;  2RLO A;  1MPH A;  1OMW A;  2AL6 A;  5JLJ B;  3HK0 A;  4HB4 B;  3ODW A;  1XOD A;  2D10 A;  3N7C A;  2DKP A;  4YL8 A;  2COC A;  2DKQ A;  2GCJ A;  3ODO A;  5D3X A;  1P3R A;  1UNR A;  1NTV A;  1Y19 B;  2CY4 A;  2GCL A;  2D9V A;  3ZDT A;  2V76 A;  1GC7 A;  1ZC3 B;  5KQ4 A;  1IRS A;  2UZR A;  4ZRI A;  4NY0 A;  4ZRK A;  3DXD A;  4GPT B;  1FHO A;  2W2X C;  1H10 A;  4GZU A;  2RUK B;  4HDO A;  2N0Y A;  3M1I B;  1XR0 B;  2COD A;  4IOY X;  2DHI A;  2R0D A;  3KRW A;  4A6F B;  4F7G A;  4HB2 B;  4DXA B;  4KHB B;  5JHH A;  3KRX A;  2K2U A;  4K2O A;  5EFX A;  2LYD A;  1PLS A;  5HE1 A;  2MKR A;  1FB8 A;  4HB3 B;  2ELB A;  3AU5 A;  4A5K A;  2LKO A;  2DX1 A;  1MIX A;  1PFJ A;  1X1G A;  4EMO A;  2ROV A;  2I1K A;  3PZD A;  2DTC A;  2NMB A;  3SNH A;  1V5U A;  1FHW A;  2D2Q A;  3PVL A;  1EF1 A;  2LUL A;  5DHA B;  4D0N B;  2Y8G A;  1FGZ A;  1J19 A;  1DBH A;  1RRP B;  3D8D A;  4IFS A;  5LOP B;  2RNR B;  3LJU X;  1LB1 A;  4K2P A;  2GS0 A;  5C5B A;  2DFK A;  1U5G A;  2W2W A;  3HW2 B;  3DXC A;  5DH9 B;  2COA A;  3O96 A;  5DHF B;  2Y7B A;  4MK0 A;  1AWE A;  1U27 A;  2KCJ A;  2Y8F A;  1WGQ A;  1EGX A;  3WYF B;  1DDW A;  2CRF A;  1QQG A;  2Z0P A;  1V5M A;  1U5E A;  3ZVR A;  1NU2 A;  3ML4 A;  3CIK A;  1ZC4 B;  1DRO A;  2BCJ A;  2ELA A;  2J0J A;  5HE0 A;  3SO6 A;  1M7E A;  1XX0 A;  4HAZ B;  2D9X A;  1PMS A;  1LW3 A;  2I5C A;  1K5D B;  3PG7 A;  1DYN A;  5J3Q A;  1GC6 A;  4XWX A;  4HDQ A;  2EMS A;  2M38 A;  1EAZ A;  2RGN B;  2OTX A;  1M7R A;  1FOE A;  3VOQ A;  4H8S A;  4WSF A;  1W1H A;  5D27 A;  2IYB A;  1ZSQ A;  3PVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...