2L2DA

Solution nmr structure of human uba-like domain of otud7a_11_83, nesg target ht6304a/ocsp target otud7a_11_83/sgc-toronto
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
b'SAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OTU domain-containing protein 7A
publication title The amino-terminal UBA domain of OTUD7A
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 73
sequence length 73
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l2dA00
1EFUB 3GLIE 1DV0A 1CUKA 1HQYE 4R71A 3LCUA 2QHOB 3B89A 1DO2A 1VQ1A 3FE3A 3IECA 1TTEA 2QSFX 2JNHA 2DHYA 1GO5A 2L2DA 1NV8A 4UN2B 2KNVA 1G4AE 1WR1B 2R0IA 3GLHE 5DFLA 1G3IA 1ZMVA 3BBZA 1KYIA 2EKFA 2B3TA 2MROB 2DNAA 4DBGB 1SG9A 1OAIA 1DO0A 1WJ7A 2JP7A 3K9PA 1JR3E 2DENA 4F2LA 1AIPC 1XXHE 1UFZA 3E21A 1F4IA 1WIVA 3H4JA 3FRHA 2HWJA 2H5XA 2L4FA 2LTUA 2JY7A 4F1IA 1IM2A 1VEGA 1IXSA 1G41A 1VEJA 2OO9A 2OOBA 1YLAA 2EKKA 1C7YA 1A5TA 1OTRA 2LVOC 1T6OA 2CP8A 2RRUA 1P3QQ 1BVSA 1HT1E 2G3QA 2KHHA 2LVQD 3MMPA 1Y8GA 2K0BX 2KNAA 4HEOA 2DAGA 4G3OA 2ZTCA 3IHPA 2JUJA 1PGYA 3GLFE 2WZJA 2O25A 4WP2A 2KNZA 2HAKA 2OOAA 3GLGE 1VDLA 2L4EA 1WGNA 2EJSA 2MR9A 2JZ1A 2DZLA 1HT2E 2JY5A 2DAIA 4Q7JA 1TR8A 3K9OA 3E46A 1HJPA 1V92A 1OQYA 4GEWA 2BWBA 1T43A 2CWBA 1R4GA 1WGLA 1OKSA 2DKLA 1VEKA 1WHCA 2DAMA 5JI2E 2ZTDA 2DAKA 2LVAA 2LBCA 3T6PA 1IFYA 1Q02A 2JZ0A 2LVNC 2QNJA 1E94E 1QZEA 2JY8A 1ZMUA 2BWEA 3FRIA 3F92A 1MN3A 2MGWA 1ZMWA 2LVPC 1XB2B 2DI0A 1VG5A 2MJ5B 2K9DA 2DAEA 2JY6B 3LCVB 1NV9A 1ZV1A
chains in the Genus database with same CATH superfamily
2QBYA 1DV0A 1OIZA 3E9SA 1DGHA 4MGHA 5H37D 4IBKA 1TDZA 2BJWA 4JI4M 3VDUA 1MU5A 2C9OA 1VQ1A 3D8LA 2LWXA 3FE3A 3IECA 3L25A 1GKIA 2X4AA 4LG2A 1TTEA 5C1BA 2JNHA 1HR0M 1SXJC 2ZAMA 3HY5A 4NC6A 1PJJA 1NJGA 1R2ZA 4QNRA 1NV8A 2CHQA 4UN2B 2CV2A 3MK6A 2MH8A 4JI2M 1NHGC 1G4AE 3FUXA 3U60A 4JI6M 3GLHE 5KPTA 4FWHA 3TWKA 1G3IA 4L4UA 4PD2A 3J80S 1YE9A 5ITYA 2FFJA 3HJSA 1KYIA 4GMQA 3SYLA 5KQDA 3KP0E 3LVVA 4OU7A 3AL0C 4NRVA 4L6V6 4DBGB 1DO0A 2JP7A 3KOZE 2DENA 3PNVA 3A98B 3JAMS 4DV3M 4B3MM 1AIPC 1AUAA 5EP2A 5E26A 2UUAM 2UXDM 3E21A 3EIEA 3QYBA 4JI8M 3NBIA 4LFAM 2HWJA 4IBIA 1D2NA 2WSEF 3T38A 2O5RA 2P5TA 3L28A 4F1IA 2DXIA 3J81S 1VEGA 4NRWA 2ZM6M 1IXSB 4FWDA 3VK7A 1HNWM 3C9PA 4M9ZA 3FKEA 3U6MA 1GJSA 4QHSA 3SASA 2EKKA 1HNZM 1A5TA 3J7AS 4X62M 3I4YA 3KOXE 1MJGM 5ITRA 3KP1E 1T3TA 4LJAA 2RRUA 3LMMA 4HL4A 5F3WA 1HT1E 1TH3A 2CFOA 4JYAM 3M0EA 4FCWA 2KHHA 2KZUA 2RKOA 4GHAA 3B74A 4MH0E 4IBCA 1J5EM 4HEOA 1IY2A 2JA2A 3V76A 2C5RA 1PJQA 2DAGA 2M5ZA 4WURA 1D0KA 4GKJM 2BNKA 3GLFE 3GPYA 1NJFA 4XK8F 4Z6YA 1EE8A 3KOWE 2KXEA 1Q3CA 4M0WA 4L15A 3CGWA 4JI1M 1Q3BA 4OX9M 5KPRA 5ITXE 3U5ZA 5BR8M 3VDPA 3GLGE 4NL4H 3VKGA 2L4EA 5DYGA 3GPUA 3RFWA 2XSZD 2JZ1A 5JI3E 2DZLA 4LJ9A 3KSJA 2VQFM 1NO1A 2UXCM 5DYIA 2JY5A 2DAIA 1QANA 4DV6M 4BBAA 5ITTA 4LF6M 1V92A 2OQ4A 2D7HA 1OQYA 1G71A 3GLHB 1GJTA 4GIPA 4QOZC 4JI7M 1OKSA 1FNNA 4CISA 2XGNA 4GRIA 5EP4A 4DR7M 1GVNA 1WXQA 2H1RA 4DR4M 5IT9S 3HU2A 3FUUA 4DV4M 3FYDA 2VDBB 3KS4A 3VLFB 2LH0A 2CE7A 1Z5AA 4IIWA 1XXHA 2LXEA 1X37A 2CEAA 2KRUA 3AFHA 4FW9A 1QUSA 4FD2A 4OVZA 2MGWA 4R3DA 1Z5BA 3AKZA 2Y20A 4JI3M 2J5YA 4PT5A 4FVMA 1L2BA 4GC5A 1GL6A 2KRKA 2MJ5B 3FD9A 3U61B 1L2CA 3ZC7B 3CF0A 4D81A 4LCBA 2JY6B 3CF6E 4DUYM 1EFUB 3GLIE 1JQJC 1HQYE 2CRUA 2RGHA 1C1KA 1TH4A 3LCUA 1DO2A 3A46A 1SXJD 2QP9X 4GC9A 3U6SA 4R7GA 3L29A 2C98A 5IZ7D 2XLJA 2UUCM 3SHFA 4AG5A 1S3SA 3SAWA 3ZQJA 2DHYA 1JB0F 4B7FA 4LY6A 1L1TA 1IN6A 3SMPA 5A2QS 3GLFB 3AJIB 4G4NA 1K82A 2DZOB 2WSFF 5DFLA 3U6CA 2M60A 3QWLA 2BJVA 1OFIA 2MROB 2EKFA 2B3TA 3FTEA 1QAOA 5FTNA 1NVMA 1WJ7A 4JV5M 1JR3E 3HGIA 4MGYE 4DUZM 4G4RA 4B3SM 1NNUC 2I7PA 2ZBKB 3MHVC 4IJFA 1UFZA 4IBDA 2Z3XA 1QUTA 3SC3A 3HWSA 2Z7JA 3H4JA 4I8OA 3FRHA 1E9RA 4KT0F 3I51A 3RE8A 3GQ3A 1XNQM 1Q39A 1NY5A 5FTLA 3QYEA 3JR4A 4I81A 4IBJA 3K92A 4MGIE 2C99A 4DV1M 4JI0M 5EJCA 2KW0A 5EXTA 3C3DA 3GP1A 4G4QA 3FUTA 3I01M 1IBLM 2F5PA 2CUZA 1T6OA 2HL7A 2N35A 2L6OA 1P3QQ 4AI6A 3U6OA 2DWMA 1IN4A 3MMPA 3HHYA 3W0LB 1Y8GA 2K0BX 3TQSA 2FOIC 2YFQA 3OTOM 2F5SA 4TUWA 4WW0A 2F5NA 4JN6A 2JUJA 4RF0A 1K3XA 3Q8XA 1L1ZA 3PNYA 4LRSA 4MGZE 2E5LM 2VF8A 2EUCA 2O25A 3GLIB 4WP2A 1LTMA 4L78A 1D0MA 2XSZA 1JR3D 3QAUA 3ZH9B 4ITQA 2UXBM 2V6ZM 1ZAEA 3LVWA 3W68A 3FYCA 3B7ZA 4IBBA 2CHVA 4OW0A 3L26A 3AV0A 1HT2E 4BLCA 5FLXS 3K8ZA 2F5OA 4M0DA 1H6UA 3DOAA 3E46A 1HJPA 2APLA 1NSFA 2QZ4A 1N36M 3KS8A 2R46A 1IBKM 1W5TA 2I7NA 2JWSA 4D82A 1FJGM 1T43A 2CWBA 4DR2M 1VEKA 2DAMA 2Z4RA 5C18A 4B08A 3W67A 2L09A 1VDDA 2DZNB 3TWLA 3DFZA 2LBCA 3T6PA 3K1JA 3U6DA 1XNRM 1IFYA 3C3EA 2LVNC 2F5QA 4KHPM 3E4RA 4S12A 2J7OA 1Z6TA 1IQPA 4ANRA 3F92A 1MN3A 4GH9A 4RF1A 2C9CA 3B9PA 3W0FA 2LVPC 4M9SA 1XB2B 4QOSA 1IN5A 5L8RF 1L2DA 2DI0A 4LJ5A 4RKUF 4AZFA 5ITXA 1QAMA 2F4VM 3GLGA 1PRBA 2QQ8A 3ILKA 3KXEC 4NSOB 2FS1A 2K9DA 1G8PA 3U6EA 7CATA 3LCVB 4GEWA 3AOEC 3FTFA 2Y0QA 2QBYB 1SXJA 3CF2A 1DGHB 1N75A 2RGOA 2QHOB 3SARA 3B89A 1OFHA 1UM8A 2FNAA 3HHWA 4Y28F 3SFZA 1LV7A 3HU1A 4JXJA 1J09A 4II7A 3SATA 4IBEA 4KODA 2QSFX 2L2DA 3A42A 1EIJA 4DR1M 1IBMM 3FTCA 3RGSA 3U60B 1N33M 2QCUA 1XHBA 2XFTA 3KW6A 3PVSA 4FCTA 1QVRA 4RNAA 2VQEM 4NSRA 2XZUA 2DNAA 5IWAM 3HJQA 1R5LA 1OAIA 3K9PA 4MB7A 3VK8A 3VKHA 2QPAA 3SAUA 4GHLA 3PFIA 3FTDA 2V1CA 4QHTA 3D8BA 1XXHE 3HU3A 3TE6A 3T1HM 4MM3B 5KPZA 1GABA 1N77A 2L4FA 1XWIA 2LTUA 1G59A 4LF7M 2ERCA 2UU9M 2DHRA 1NY6A 1IM2A 3IG8A 2Z4SA 4DV5M 1IXSA 4DR3M 3R9XB 1VEJA 1YUBA 5KQ8A 1R6BX 4REZA 5DNYA 4FCVA 1YLAA 3TWMA 2EO2A 2YNMD 1E32A 5ITQA 2R4EA 1OJLA 2ZANA 1Z5CA 3SMSA 2G5GX 3BXWA 5FSWA 4LZZA 3AOGA 1GO5A 3R8FA 5FTMA 2LVQD 3UMMA 4DV7M 2A5YB 2L7HA 4X65M 3U6PA 2FE8A 2KNAA 4X66M 3J2PB 1HQCA 2R18A 5EXXA 5KO3A 4L8RC 1OIPA 1PJTA 1I4WA 3GRRA 3KOYE 3KVWA 4P17A 5EQTA 1NHWC 3WHKA 3WHLA 4XGIA 2HKJA 4LJ6A 2WZJA 1YSYA 2LHGA 2HCBA 5GKNA 4LJ8A 2KNZA 3J7BA 1DGGA 2GNOA 2KZSA 2HAKA 2OPFA 1PJIA 2V1UA 4X64M 2OOAA 3K2LA 3U5ZB 2CV1A 4NXMM 4YY3M 2KDLA 1VDLA 4LF9M 4QNMA 3HHZA 4IBFA 3LW5F 4LRTA 3MJ5A 1QZMA 1XMOM 4A3VB 4Q7JA 1TR8A 1HNXM 2HHHM 4Z8XA 3GRYA 3RGPA 4LF5M 1ZQ9A 4AG6A 1XC8A 2BWBA 4IJEA 1TF0B 1TH2A 3GLHA 1R4GA 3GRUA 1N78A 3FUVA 8CATA 4FWGA 5JI2E 1K3WA 1KSFX 2DAKA 1DGBA 1GLNA 1XXHB 4P16A 4LF4M 2NQ8C 4OVZB 3FRIA 5FTKA 4D80A 3CTWB 4DV2M 4KO8A 2XZFA 4AKGA 1Z59A 5IREB 4LJ7A 3GQ5A 3HHXA 1DGFA 3UGJA 5EXSA 3U61A 5LMNM 2DAEA 2Y21A 2CHGA 1IXZA 2VIIA 4DV0M 2XEPA 2ZAOA 2C96A 3SBJA 1ZV1A 2R4JA 1N34M 3I4VA 1CUKA 4I5SA 4XBOA 3TL4X 2X49A 4R71A 2FH0A 1IXRC 4DR5M 3EIHA 1W5SA 3A45A 2WSCF 3HX3A 3UK6A 4GITA 2Q2EB 3I04M 4CIZA 3M7GA 1TGUA 3THGA 4B3TM 3KFUG 1TDHA 3C58A 3U6QA 2K47A 5E6JA 3GLFA 3GPXA 2KNVA 2R6FA 2GQFA 1RU3A 1WR1B 2L7IA 2R0IA 4LGMA 4CHTB 4K0KM 1ZMVA 2YQZA 3BBZA 1V33A 4MGKE 5FTJA 1SG9A 1KFVA 2R62A 3M6AA 4PCZA 4F2LA 5EP1A 4I4LA 3L27A 1F4IA 1WIVA 3JR5A 4B3RM 1ORYB 3H4MA 4PDGA 2H5XA 4BB9A 2JY7A 2XF3A 2R44A 1J7KA 2AHMA 2LHCA 4EIWA 3IG5A 1XMQM 1G41A 2O01F 1IN7A 1QQWA 3HZJA 2OO9A 1V34A 1IY1A 1MX0A 2OOBA 3DA1A 3J27B 5ITUA 3KSXA 2KEBA 1R7RA 3DZDA 4NOOB 3NBXX 4KLNA 1C7YA 2W82A 4YHHM 1OTRA 3GRVA 2LVOC 1QYRA 1SXJE 1QAQA 2CP8A 2G8LA 4M9XA 3VFDA 3U6LA 4HLQA 1BVSA 3HJ8A 4AQYM 3LQQA 2G3QA 2X8AA 2XH9A 3HKPA 3FUWA 4IBGA 3ZCBB 1PM5A 2JXNA 3UZUA 2DWZB 3TPZA 4G4OA 1N32M 4CJ6A 5BPVA 4G3OA 2ZTCA 3IHPA 1PGYA 4G6ZA 2DVWB 4B7GA 5EP3A 2KA6B 4LFCM 2LNHC 2K6BA 2J7NA 3B7QA 4LGYA 1I94M 5LMUM 4JI5M 3GLIA 1OAOC 3GPPA 4LFBM 2XFSA 3SHGB 1IN8A 1R2YA 2CV0A 1WGNA 2D7EA 4LJ4A 2EJSA 2MR9A 4AKIA 1NNJA 4LZJA 3T1YM 3K9OA 3GQ4A 4LF8M 1PJSA 1D0LA 4AW4A 2VF7A 3KDSE 2DWNA 2Y0TA 4L16A 2UUBM 3B7NA 1WGLA 2DKLA 2Z8YM 1WHCA 1QDRA 2R65A 3T15A 4AKHA 3Q8GA 4GKKM 1GL7A 2ZTDA 2EA0A 2R45A 1JR3A 2D7GA 3UJNA 2LVAA 4B7HA 1Q02A 2JZ0A 1IY0A 2QNJA 4W5WA 1QDTA 1L8QA 1E94E 4PDIA 1QZEA 2JY8A 1ZMUA 3NWLA 2BWEA 3AOEA 3PXGA 2YR0A 2QENA 1ZMWA 4ZPXA 3SAVA 2DWLA 1VG5A 3GLGB 3BOSA 3LQRA 3L2AA 3SYKA 4NXNM 4CGYB 4DR6M 5EXPA 1NV9A 1E9SA 3GO8A 1SXJB
chains in the Genus database with same CATH topology
1EFUB 3GLIE 1DV0A 1CUKA 1HQYE 4R71A 3LCUA 2QHOB 3B89A 1DO2A 1VQ1A 3FE3A 3IECA 1TTEA 2QSFX 2JNHA 2DHYA 1GO5A 2L2DA 1NV8A 4UN2B 2KNVA 1G4AE 1WR1B 2R0IA 3GLHE 5DFLA 1G3IA 1ZMVA 3BBZA 1KYIA 2EKFA 2B3TA 2MROB 2DNAA 4DBGB 1SG9A 1OAIA 1DO0A 1WJ7A 2JP7A 3K9PA 1JR3E 2DENA 4F2LA 1AIPC 1XXHE 1UFZA 3E21A 1F4IA 1WIVA 3H4JA 3FRHA 2HWJA 2H5XA 2L4FA 2LTUA 2JY7A 4F1IA 1IM2A 1VEGA 1IXSA 1G41A 1VEJA 2OO9A 2OOBA 1YLAA 2EKKA 1C7YA 1A5TA 1OTRA 2LVOC 1T6OA 2CP8A 2RRUA 1P3QQ 1BVSA 1HT1E 2G3QA 2KHHA 2LVQD 3MMPA 1Y8GA 2K0BX 2KNAA 4HEOA 2DAGA 4G3OA 2ZTCA 3IHPA 2JUJA 1PGYA 3GLFE 2WZJA 2O25A 4WP2A 2KNZA 2HAKA 2OOAA 3GLGE 1VDLA 2L4EA 1WGNA 2EJSA 2MR9A 2JZ1A 2DZLA 1HT2E 2JY5A 2DAIA 4Q7JA 1TR8A 3K9OA 3E46A 1HJPA 1V92A 1OQYA 4GEWA 2BWBA 1T43A 2CWBA 1R4GA 1WGLA 1OKSA 2DKLA 1VEKA 1WHCA 2DAMA 5JI2E 2ZTDA 2DAKA 2LVAA 2LBCA 3T6PA 1IFYA 1Q02A 2JZ0A 2LVNC 2QNJA 1E94E 1QZEA 2JY8A 1ZMUA 2BWEA 3FRIA 3F92A 1MN3A 2MGWA 1ZMWA 2LVPC 1XB2B 2DI0A 1VG5A 2MJ5B 2K9DA 2DAEA 2JY6B 3LCVB 1NV9A 1ZV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFU B;  3GLI E;  1DV0 A;  1CUK A;  1HQY E;  4R71 A;  3LCU A;  2QHO B;  3B89 A;  1DO2 A;  1VQ1 A;  3FE3 A;  3IEC A;  1TTE A;  2QSF X;  2JNH A;  2DHY A;  1GO5 A;  2L2D A;  1NV8 A;  4UN2 B;  2KNV A;  1G4A E;  1WR1 B;  2R0I A;  3GLH E;  5DFL A;  1G3I A;  1ZMV A;  3BBZ A;  1KYI A;  2EKF A;  2B3T A;  2MRO B;  2DNA A;  4DBG B;  1SG9 A;  1OAI A;  1DO0 A;  1WJ7 A;  2JP7 A;  3K9P A;  1JR3 E;  2DEN A;  4F2L A;  1AIP C;  1XXH E;  1UFZ A;  3E21 A;  1F4I A;  1WIV A;  3H4J A;  3FRH A;  2HWJ A;  2H5X A;  2L4F A;  2LTU A;  2JY7 A;  4F1I A;  1IM2 A;  1VEG A;  1IXS A;  1G41 A;  1VEJ A;  2OO9 A;  2OOB A;  1YLA A;  2EKK A;  1C7Y A;  1A5T A;  1OTR A;  2LVO C;  1T6O A;  2CP8 A;  2RRU A;  1P3Q Q;  1BVS A;  1HT1 E;  2G3Q A;  2KHH A;  2LVQ D;  3MMP A;  1Y8G A;  2K0B X;  2KNA A;  4HEO A;  2DAG A;  4G3O A;  2ZTC A;  3IHP A;  2JUJ A;  1PGY A;  3GLF E;  2WZJ A;  2O25 A;  4WP2 A;  2KNZ A;  2HAK A;  2OOA A;  3GLG E;  1VDL A;  2L4E A;  1WGN A;  2EJS A;  2MR9 A;  2JZ1 A;  2DZL A;  1HT2 E;  2JY5 A;  2DAI A;  4Q7J A;  1TR8 A;  3K9O A;  3E46 A;  1HJP A;  1V92 A;  1OQY A;  4GEW A;  2BWB A;  1T43 A;  2CWB A;  1R4G A;  1WGL A;  1OKS A;  2DKL A;  1VEK A;  1WHC A;  2DAM A;  5JI2 E;  2ZTD A;  2DAK A;  2LVA A;  2LBC A;  3T6P A;  1IFY A;  1Q02 A;  2JZ0 A;  2LVN C;  2QNJ A;  1E94 E;  1QZE A;  2JY8 A;  1ZMU A;  2BWE A;  3FRI A;  3F92 A;  1MN3 A;  2MGW A;  1ZMW A;  2LVP C;  1XB2 B;  2DI0 A;  1VG5 A;  2MJ5 B;  2K9D A;  2DAE A;  2JY6 B;  3LCV B;  1NV9 A;  1ZV1 A; 
#chains in the Genus database with same CATH topology
 2QBY A;  1DV0 A;  1OIZ A;  3E9S A;  1DGH A;  4MGH A;  5H37 D;  4IBK A;  1TDZ A;  2BJW A;  4JI4 M;  3VDU A;  1MU5 A;  2C9O A;  1VQ1 A;  3D8L A;  2LWX A;  3FE3 A;  3IEC A;  3L25 A;  1GKI A;  2X4A A;  4LG2 A;  1TTE A;  5C1B A;  2JNH A;  1HR0 M;  1SXJ C;  2ZAM A;  3HY5 A;  4NC6 A;  1PJJ A;  1NJG A;  1R2Z A;  4QNR A;  1NV8 A;  2CHQ A;  4UN2 B;  2CV2 A;  3MK6 A;  2MH8 A;  4JI2 M;  1NHG C;  1G4A E;  3FUX A;  3U60 A;  4JI6 M;  3GLH E;  5KPT A;  4FWH A;  3TWK A;  1G3I A;  4L4U A;  4PD2 A;  3J80 S;  1YE9 A;  5ITY A;  2FFJ A;  3HJS A;  1KYI A;  4GMQ A;  3SYL A;  5KQD A;  3KP0 E;  3LVV A;  4OU7 A;  3AL0 C;  4NRV A;  4L6V 6;  4DBG B;  1DO0 A;  2JP7 A;  3KOZ E;  2DEN A;  3PNV A;  3A98 B;  3JAM S;  4DV3 M;  4B3M M;  1AIP C;  1AUA A;  5EP2 A;  5E26 A;  2UUA M;  2UXD M;  3E21 A;  3EIE A;  3QYB A;  4JI8 M;  3NBI A;  4LFA M;  2HWJ A;  4IBI A;  1D2N A;  2WSE F;  3T38 A;  2O5R A;  2P5T A;  3L28 A;  4F1I A;  2DXI A;  3J81 S;  1VEG A;  4NRW A;  2ZM6 M;  1IXS B;  4FWD A;  3VK7 A;  1HNW M;  3C9P A;  4M9Z A;  3FKE A;  3U6M A;  1GJS A;  4QHS A;  3SAS A;  2EKK A;  1HNZ M;  1A5T A;  3J7A S;  4X62 M;  3I4Y A;  3KOX E;  1MJG M;  5ITR A;  3KP1 E;  1T3T A;  4LJA A;  2RRU A;  3LMM A;  4HL4 A;  5F3W A;  1HT1 E;  1TH3 A;  2CFO A;  4JYA M;  3M0E A;  4FCW A;  2KHH A;  2KZU A;  2RKO A;  4GHA A;  3B74 A;  4MH0 E;  4IBC A;  1J5E M;  4HEO A;  1IY2 A;  2JA2 A;  3V76 A;  2C5R A;  1PJQ A;  2DAG A;  2M5Z A;  4WUR A;  1D0K A;  4GKJ M;  2BNK A;  3GLF E;  3GPY A;  1NJF A;  4XK8 F;  4Z6Y A;  1EE8 A;  3KOW E;  2KXE A;  1Q3C A;  4M0W A;  4L15 A;  3CGW A;  4JI1 M;  1Q3B A;  4OX9 M;  5KPR A;  5ITX E;  3U5Z A;  5BR8 M;  3VDP A;  3GLG E;  4NL4 H;  3VKG A;  2L4E A;  5DYG A;  3GPU A;  3RFW A;  2XSZ D;  2JZ1 A;  5JI3 E;  2DZL A;  4LJ9 A;  3KSJ A;  2VQF M;  1NO1 A;  2UXC M;  5DYI A;  2JY5 A;  2DAI A;  1QAN A;  4DV6 M;  4BBA A;  5ITT A;  4LF6 M;  1V92 A;  2OQ4 A;  2D7H A;  1OQY A;  1G71 A;  3GLH B;  1GJT A;  4GIP A;  4QOZ C;  4JI7 M;  1OKS A;  1FNN A;  4CIS A;  2XGN A;  4GRI A;  5EP4 A;  4DR7 M;  1GVN A;  1WXQ A;  2H1R A;  4DR4 M;  5IT9 S;  3HU2 A;  3FUU A;  4DV4 M;  3FYD A;  2VDB B;  3KS4 A;  3VLF B;  2LH0 A;  2CE7 A;  1Z5A A;  4IIW A;  1XXH A;  2LXE A;  1X37 A;  2CEA A;  2KRU A;  3AFH A;  4FW9 A;  1QUS A;  4FD2 A;  4OVZ A;  2MGW A;  4R3D A;  1Z5B A;  3AKZ A;  2Y20 A;  4JI3 M;  2J5Y A;  4PT5 A;  4FVM A;  1L2B A;  4GC5 A;  1GL6 A;  2KRK A;  2MJ5 B;  3FD9 A;  3U61 B;  1L2C A;  3ZC7 B;  3CF0 A;  4D81 A;  4LCB A;  2JY6 B;  3CF6 E;  4DUY M;  1EFU B;  3GLI E;  1JQJ C;  1HQY E;  2CRU A;  2RGH A;  1C1K A;  1TH4 A;  3LCU A;  1DO2 A;  3A46 A;  1SXJ D;  2QP9 X;  4GC9 A;  3U6S A;  4R7G A;  3L29 A;  2C98 A;  5IZ7 D;  2XLJ A;  2UUC M;  3SHF A;  4AG5 A;  1S3S A;  3SAW A;  3ZQJ A;  2DHY A;  1JB0 F;  4B7F A;  4LY6 A;  1L1T A;  1IN6 A;  3SMP A;  5A2Q S;  3GLF B;  3AJI B;  4G4N A;  1K82 A;  2DZO B;  2WSF F;  5DFL A;  3U6C A;  2M60 A;  3QWL A;  2BJV A;  1OFI A;  2MRO B;  2EKF A;  2B3T A;  3FTE A;  1QAO A;  5FTN A;  1NVM A;  1WJ7 A;  4JV5 M;  1JR3 E;  3HGI A;  4MGY E;  4DUZ M;  4G4R A;  4B3S M;  1NNU C;  2I7P A;  2ZBK B;  3MHV C;  4IJF A;  1UFZ A;  4IBD A;  2Z3X A;  1QUT A;  3SC3 A;  3HWS A;  2Z7J A;  3H4J A;  4I8O A;  3FRH A;  1E9R A;  4KT0 F;  3I51 A;  3RE8 A;  3GQ3 A;  1XNQ M;  1Q39 A;  1NY5 A;  5FTL A;  3QYE A;  3JR4 A;  4I81 A;  4IBJ A;  3K92 A;  4MGI E;  2C99 A;  4DV1 M;  4JI0 M;  5EJC A;  2KW0 A;  5EXT A;  3C3D A;  3GP1 A;  4G4Q A;  3FUT A;  3I01 M;  1IBL M;  2F5P A;  2CUZ A;  1T6O A;  2HL7 A;  2N35 A;  2L6O A;  1P3Q Q;  4AI6 A;  3U6O A;  2DWM A;  1IN4 A;  3MMP A;  3HHY A;  3W0L B;  1Y8G A;  2K0B X;  3TQS A;  2FOI C;  2YFQ A;  3OTO M;  2F5S A;  4TUW A;  4WW0 A;  2F5N A;  4JN6 A;  2JUJ A;  4RF0 A;  1K3X A;  3Q8X A;  1L1Z A;  3PNY A;  4LRS A;  4MGZ E;  2E5L M;  2VF8 A;  2EUC A;  2O25 A;  3GLI B;  4WP2 A;  1LTM A;  4L78 A;  1D0M A;  2XSZ A;  1JR3 D;  3QAU A;  3ZH9 B;  4ITQ A;  2UXB M;  2V6Z M;  1ZAE A;  3LVW A;  3W68 A;  3FYC A;  3B7Z A;  4IBB A;  2CHV A;  4OW0 A;  3L26 A;  3AV0 A;  1HT2 E;  4BLC A;  5FLX S;  3K8Z A;  2F5O A;  4M0D A;  1H6U A;  3DOA A;  3E46 A;  1HJP A;  2APL A;  1NSF A;  2QZ4 A;  1N36 M;  3KS8 A;  2R46 A;  1IBK M;  1W5T A;  2I7N A;  2JWS A;  4D82 A;  1FJG M;  1T43 A;  2CWB A;  4DR2 M;  1VEK A;  2DAM A;  2Z4R A;  5C18 A;  4B08 A;  3W67 A;  2L09 A;  1VDD A;  2DZN B;  3TWL A;  3DFZ A;  2LBC A;  3T6P A;  3K1J A;  3U6D A;  1XNR M;  1IFY A;  3C3E A;  2LVN C;  2F5Q A;  4KHP M;  3E4R A;  4S12 A;  2J7O A;  1Z6T A;  1IQP A;  4ANR A;  3F92 A;  1MN3 A;  4GH9 A;  4RF1 A;  2C9C A;  3B9P A;  3W0F A;  2LVP C;  4M9S A;  1XB2 B;  4QOS A;  1IN5 A;  5L8R F;  1L2D A;  2DI0 A;  4LJ5 A;  4RKU F;  4AZF A;  5ITX A;  1QAM A;  2F4V M;  3GLG A;  1PRB A;  2QQ8 A;  3ILK A;  3KXE C;  4NSO B;  2FS1 A;  2K9D A;  1G8P A;  3U6E A;  7CAT A;  3LCV B;  4GEW A;  3AOE C;  3FTF A;  2Y0Q A;  2QBY B;  1SXJ A;  3CF2 A;  1DGH B;  1N75 A;  2RGO A;  2QHO B;  3SAR A;  3B89 A;  1OFH A;  1UM8 A;  2FNA A;  3HHW A;  4Y28 F;  3SFZ A;  1LV7 A;  3HU1 A;  4JXJ A;  1J09 A;  4II7 A;  3SAT A;  4IBE A;  4KOD A;  2QSF X;  2L2D A;  3A42 A;  1EIJ A;  4DR1 M;  1IBM M;  3FTC A;  3RGS A;  3U60 B;  1N33 M;  2QCU A;  1XHB A;  2XFT A;  3KW6 A;  3PVS A;  4FCT A;  1QVR A;  4RNA A;  2VQE M;  4NSR A;  2XZU A;  2DNA A;  5IWA M;  3HJQ A;  1R5L A;  1OAI A;  3K9P A;  4MB7 A;  3VK8 A;  3VKH A;  2QPA A;  3SAU A;  4GHL A;  3PFI A;  3FTD A;  2V1C A;  4QHT A;  3D8B A;  1XXH E;  3HU3 A;  3TE6 A;  3T1H M;  4MM3 B;  5KPZ A;  1GAB A;  1N77 A;  2L4F A;  1XWI A;  2LTU A;  1G59 A;  4LF7 M;  2ERC A;  2UU9 M;  2DHR A;  1NY6 A;  1IM2 A;  3IG8 A;  2Z4S A;  4DV5 M;  1IXS A;  4DR3 M;  3R9X B;  1VEJ A;  1YUB A;  5KQ8 A;  1R6B X;  4REZ A;  5DNY A;  4FCV A;  1YLA A;  3TWM A;  2EO2 A;  2YNM D;  1E32 A;  5ITQ A;  2R4E A;  1OJL A;  2ZAN A;  1Z5C A;  3SMS A;  2G5G X;  3BXW A;  5FSW A;  4LZZ A;  3AOG A;  1GO5 A;  3R8F A;  5FTM A;  2LVQ D;  3UMM A;  4DV7 M;  2A5Y B;  2L7H A;  4X65 M;  3U6P A;  2FE8 A;  2KNA A;  4X66 M;  3J2P B;  1HQC A;  2R18 A;  5EXX A;  5KO3 A;  4L8R C;  1OIP A;  1PJT A;  1I4W A;  3GRR A;  3KOY E;  3KVW A;  4P17 A;  5EQT A;  1NHW C;  3WHK A;  3WHL A;  4XGI A;  2HKJ A;  4LJ6 A;  2WZJ A;  1YSY A;  2LHG A;  2HCB A;  5GKN A;  4LJ8 A;  2KNZ A;  3J7B A;  1DGG A;  2GNO A;  2KZS A;  2HAK A;  2OPF A;  1PJI A;  2V1U A;  4X64 M;  2OOA A;  3K2L A;  3U5Z B;  2CV1 A;  4NXM M;  4YY3 M;  2KDL A;  1VDL A;  4LF9 M;  4QNM A;  3HHZ A;  4IBF A;  3LW5 F;  4LRT A;  3MJ5 A;  1QZM A;  1XMO M;  4A3V B;  4Q7J A;  1TR8 A;  1HNX M;  2HHH M;  4Z8X A;  3GRY A;  3RGP A;  4LF5 M;  1ZQ9 A;  4AG6 A;  1XC8 A;  2BWB A;  4IJE A;  1TF0 B;  1TH2 A;  3GLH A;  1R4G A;  3GRU A;  1N78 A;  3FUV A;  8CAT A;  4FWG A;  5JI2 E;  1K3W A;  1KSF X;  2DAK A;  1DGB A;  1GLN A;  1XXH B;  4P16 A;  4LF4 M;  2NQ8 C;  4OVZ B;  3FRI A;  5FTK A;  4D80 A;  3CTW B;  4DV2 M;  4KO8 A;  2XZF A;  4AKG A;  1Z59 A;  5IRE B;  4LJ7 A;  3GQ5 A;  3HHX A;  1DGF A;  3UGJ A;  5EXS A;  3U61 A;  5LMN M;  2DAE A;  2Y21 A;  2CHG A;  1IXZ A;  2VII A;  4DV0 M;  2XEP A;  2ZAO A;  2C96 A;  3SBJ A;  1ZV1 A;  2R4J A;  1N34 M;  3I4V A;  1CUK A;  4I5S A;  4XBO A;  3TL4 X;  2X49 A;  4R71 A;  2FH0 A;  1IXR C;  4DR5 M;  3EIH A;  1W5S A;  3A45 A;  2WSC F;  3HX3 A;  3UK6 A;  4GIT A;  2Q2E B;  3I04 M;  4CIZ A;  3M7G A;  1TGU A;  3THG A;  4B3T M;  3KFU G;  1TDH A;  3C58 A;  3U6Q A;  2K47 A;  5E6J A;  3GLF A;  3GPX A;  2KNV A;  2R6F A;  2GQF A;  1RU3 A;  1WR1 B;  2L7I A;  2R0I A;  4LGM A;  4CHT B;  4K0K M;  1ZMV A;  2YQZ A;  3BBZ A;  1V33 A;  4MGK E;  5FTJ A;  1SG9 A;  1KFV A;  2R62 A;  3M6A A;  4PCZ A;  4F2L A;  5EP1 A;  4I4L A;  3L27 A;  1F4I A;  1WIV A;  3JR5 A;  4B3R M;  1ORY B;  3H4M A;  4PDG A;  2H5X A;  4BB9 A;  2JY7 A;  2XF3 A;  2R44 A;  1J7K A;  2AHM A;  2LHC A;  4EIW A;  3IG5 A;  1XMQ M;  1G41 A;  2O01 F;  1IN7 A;  1QQW A;  3HZJ A;  2OO9 A;  1V34 A;  1IY1 A;  1MX0 A;  2OOB A;  3DA1 A;  3J27 B;  5ITU A;  3KSX A;  2KEB A;  1R7R A;  3DZD A;  4NOO B;  3NBX X;  4KLN A;  1C7Y A;  2W82 A;  4YHH M;  1OTR A;  3GRV A;  2LVO C;  1QYR A;  1SXJ E;  1QAQ A;  2CP8 A;  2G8L A;  4M9X A;  3VFD A;  3U6L A;  4HLQ A;  1BVS A;  3HJ8 A;  4AQY M;  3LQQ A;  2G3Q A;  2X8A A;  2XH9 A;  3HKP A;  3FUW A;  4IBG A;  3ZCB B;  1PM5 A;  2JXN A;  3UZU A;  2DWZ B;  3TPZ A;  4G4O A;  1N32 M;  4CJ6 A;  5BPV A;  4G3O A;  2ZTC A;  3IHP A;  1PGY A;  4G6Z A;  2DVW B;  4B7G A;  5EP3 A;  2KA6 B;  4LFC M;  2LNH C;  2K6B A;  2J7N A;  3B7Q A;  4LGY A;  1I94 M;  5LMU M;  4JI5 M;  3GLI A;  1OAO C;  3GPP A;  4LFB M;  2XFS A;  3SHG B;  1IN8 A;  1R2Y A;  2CV0 A;  1WGN A;  2D7E A;  4LJ4 A;  2EJS A;  2MR9 A;  4AKI A;  1NNJ A;  4LZJ A;  3T1Y M;  3K9O A;  3GQ4 A;  4LF8 M;  1PJS A;  1D0L A;  4AW4 A;  2VF7 A;  3KDS E;  2DWN A;  2Y0T A;  4L16 A;  2UUB M;  3B7N A;  1WGL A;  2DKL A;  2Z8Y M;  1WHC A;  1QDR A;  2R65 A;  3T15 A;  4AKH A;  3Q8G A;  4GKK M;  1GL7 A;  2ZTD A;  2EA0 A;  2R45 A;  1JR3 A;  2D7G A;  3UJN A;  2LVA A;  4B7H A;  1Q02 A;  2JZ0 A;  1IY0 A;  2QNJ A;  4W5W A;  1QDT A;  1L8Q A;  1E94 E;  4PDI A;  1QZE A;  2JY8 A;  1ZMU A;  3NWL A;  2BWE A;  3AOE A;  3PXG A;  2YR0 A;  2QEN A;  1ZMW A;  4ZPX A;  3SAV A;  2DWL A;  1VG5 A;  3GLG B;  3BOS A;  3LQR A;  3L2A A;  3SYK A;  4NXN M;  4CGY B;  4DR6 M;  5EXP A;  1NV9 A;  1E9S A;  3GO8 A;  1SXJ B; 
#chains in the Genus database with same CATH homology
 1EFU B;  3GLI E;  1DV0 A;  1CUK A;  1HQY E;  4R71 A;  3LCU A;  2QHO B;  3B89 A;  1DO2 A;  1VQ1 A;  3FE3 A;  3IEC A;  1TTE A;  2QSF X;  2JNH A;  2DHY A;  1GO5 A;  2L2D A;  1NV8 A;  4UN2 B;  2KNV A;  1G4A E;  1WR1 B;  2R0I A;  3GLH E;  5DFL A;  1G3I A;  1ZMV A;  3BBZ A;  1KYI A;  2EKF A;  2B3T A;  2MRO B;  2DNA A;  4DBG B;  1SG9 A;  1OAI A;  1DO0 A;  1WJ7 A;  2JP7 A;  3K9P A;  1JR3 E;  2DEN A;  4F2L A;  1AIP C;  1XXH E;  1UFZ A;  3E21 A;  1F4I A;  1WIV A;  3H4J A;  3FRH A;  2HWJ A;  2H5X A;  2L4F A;  2LTU A;  2JY7 A;  4F1I A;  1IM2 A;  1VEG A;  1IXS A;  1G41 A;  1VEJ A;  2OO9 A;  2OOB A;  1YLA A;  2EKK A;  1C7Y A;  1A5T A;  1OTR A;  2LVO C;  1T6O A;  2CP8 A;  2RRU A;  1P3Q Q;  1BVS A;  1HT1 E;  2G3Q A;  2KHH A;  2LVQ D;  3MMP A;  1Y8G A;  2K0B X;  2KNA A;  4HEO A;  2DAG A;  4G3O A;  2ZTC A;  3IHP A;  2JUJ A;  1PGY A;  3GLF E;  2WZJ A;  2O25 A;  4WP2 A;  2KNZ A;  2HAK A;  2OOA A;  3GLG E;  1VDL A;  2L4E A;  1WGN A;  2EJS A;  2MR9 A;  2JZ1 A;  2DZL A;  1HT2 E;  2JY5 A;  2DAI A;  4Q7J A;  1TR8 A;  3K9O A;  3E46 A;  1HJP A;  1V92 A;  1OQY A;  4GEW A;  2BWB A;  1T43 A;  2CWB A;  1R4G A;  1WGL A;  1OKS A;  2DKL A;  1VEK A;  1WHC A;  2DAM A;  5JI2 E;  2ZTD A;  2DAK A;  2LVA A;  2LBC A;  3T6P A;  1IFY A;  1Q02 A;  2JZ0 A;  2LVN C;  2QNJ A;  1E94 E;  1QZE A;  2JY8 A;  1ZMU A;  2BWE A;  3FRI A;  3F92 A;  1MN3 A;  2MGW A;  1ZMW A;  2LVP C;  1XB2 B;  2DI0 A;  1VG5 A;  2MJ5 B;  2K9D A;  2DAE A;  2JY6 B;  3LCV B;  1NV9 A;  1ZV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...