2L2DA

Solution nmr structure of human uba-like domain of otud7a_11_83, nesg target ht6304a/ocsp target otud7a_11_83/sgc-toronto
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
SAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The amino-terminal UBA domain of OTUD7A
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords OTU domain-containing protein 7A
total genus 17
structure length 73
sequence length 73
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l2dA00
2RRUA 1YLAA 3H4JA 2KNZA 3LCVB 1WJ7A 1OAIA 3K9PA 1XB2B 1TTEA 2L2DA 1HJPA 2DAMA 4F1IA 5JI2E 2EKKA 2DAGA 2LVOC 1G41A 2QSFX 1IFYA 4GEWA 1PGYA 2MROB 2HWJA 3IECA 4UN2B 3FRIA 2LVQD 1F4IA 2LVNC 1DO0A 2JZ0A 3GLHE 4G3OA 2LVAA 1Q02A 2L4FA 1TR8A 1IM2A 2ZTDA 1UFZA 2DI0A 3GLIE 2OO9A 3GLFE 2EJSA 1WGNA 1VEJA 2OOBA 2WZJA 1G3IA 2DHYA 1IXSA 2KHHA 1MN3A 1SG9A 1AIPC 2LBCA 1HT1E 1ZMWA 1GO5A 1KYIA 2JNHA 2KNAA 2L4EA 2MR9A 3E21A 4WP2A 1VG5A 2JY8A 1WIVA 1V92A 2DKLA 2K0BX 1QZEA 1NV8A 1HT2E 3B89A 2JZ1A 3GLGE 1R4GA 1OTRA 2DNAA 4R71A 2G3QA 2B3TA 2DAIA 2LVPC 1WGLA 2DZLA 5DFLA 2DENA 3LCUA 1A5TA 1HQYE 1CUKA 3K9OA 1OKSA 1ZMUA 2R0IA 3BBZA 2JP7A 1WHCA 2MGWA 1VEKA 1T43A 2CP8A 4HEOA 1BVSA 2LTUA 1VDLA 3IHPA 2BWBA 2JY6B 2DAKA 1E94E 1JR3E 3F92A 1ZMVA 2CWBA 4Q7JA 1EFUB 4DBGB 2EKFA 1C7YA 3T6PA 2MJ5B 4F2LA 2BWEA 2HAKA 2JY7A 1VEGA 2JY5A 1WR1B 2DAEA 3MMPA 3FRHA 1DV0A 1ZV1A 3FE3A 2QHOB 2K9DA 1NV9A 2H5XA 1G4AE 2ZTCA 3E46A 1DO2A 2OOAA 1XXHE 2O25A 2QNJA 1VQ1A 1OQYA 1P3QQ 2KNVA 1Y8GA 2JUJA 1T6OA
chains in the Genus database with same CATH superfamily
3PNVA 2XFTA 3H4JA 1OAIA 2Y21A 1YSYA 1XB2B 4XGIA 3KS8A 1VDDA 2L2DA 1HJPA 2DAMA 1I94M 2C96A 2LVOC 3V76A 1G41A 5EJCA 4GC5A 4M0DA 2HWJA 4QHSA 4XK8F 2FFJA 4QOZC 2L7IA 2V1CA 4KLNA 4LF6M 1R7RA 1Z5BA 3U6PA 2D7GA 2LVNC 4G3OA 3GLHE 3U6MA 4TUWA 1IBKM 4OVZA 2CHVA 2RGOA 3CF6E 1UFZA 3CGWA 3RE8A 2EA0A 2HL7A 2Q2EB 1NVMA 4IIWA 4L15A 4LRSA 2EJSA 1LV7A 3NWLA 3KOXE 5EXTA 1MN3A 2W82A 3PVSA 1AIPC 3TE6A 1ZMWA 2BJVA 2WSCF 3AKZA 4LFCM 1GLNA 1KYIA 2WSFF 3E21A 1PJQA 4II7A 4JI0M 4X66M 2OPFA 3GRUA 2YNMD 1Z59A 2KEBA 1AUAA 2R44A 3HHZA 2LHCA 4LJ4A 1NV8A 1EE8A 4KO8A 1C1KA 2XSZA 3SAUA 1S3SA 1KFVA 3T1HM 1FJGM 4R71A 5C1BA 1NNUC 3HU1A 2R62A 4X65M 4MGYE 2DWMA 4PDIA 5KQ8A 1TDZA 1CUKA 4GKJM 2VQFM 3KP0E 3T1YM 3K92A 2I7PA 3K9OA 3UK6A 2R0IA 3HU3A 3QWLA 1WHCA 5EQTA 2L7HA 3VKHA 1JR3A 5EP1A 1T43A 1WXQA 2R4EA 2Y20A 4HEOA 4DR5M 1N34M 4IJEA 1VDLA 1D2NA 3SAVA 2BWBA 4R3DA 2K47A 4W5WA 4LGYA 1IBMM 3A98B 1SXJC 2CWBA 3SHGB 5ITYA 1XNQM 2FOIC 4JV5M 4DR1M 1IXSB 3DA1A 3U6QA 3THGA 1SXJD 2M5ZA 3LQRA 3CF0A 3LW5F 2QBYB 5KO3A 3GO8A 3GQ5A 4RNAA 4PT5A 3HX3A 3NBXX 1VEGA 2X8AA 2J5YA 3L26A 1N33M 2KXEA 2FNAA 4NXNM 4CISA 1R6BX 2CFOA 2N35A 3K2LA 3U6OA 4LZJA 1QYRA 3RFWA 3AJIB 3K8ZA 2P5TA 1GL7A 2YQZA 3KS4A 5EP4A 4DV5M 3GPXA 3Q8XA 3U5ZB 1XNRM 1D0LA 4NC6A 2F5OA 1G4AE 2CHGA 3MJ5A 1N78A 2G5GX 1JR3D 2ZAOA 3C3EA 4RKUF 2XZUA 2RKOA 1N36M 2DZNB 4DBGB 3U60B 3JR4A 1I4WA 4R7GA 2ZBKB 3SMPA 1IY1A 4DV6M 5ITXA 4A3VB 1D0MA 3LCVB 3SBJA 3VK7A 2KNZA 5F3WA 2C5RA 5EXXA 3C58A 3KOWE 1QDTA 5JI2E 3U61B 2DAGA 4IBBA 1NY6A 3MHVC 1IFYA 4FCWA 4GEWA 5FSWA 4YHHM 4JI2M 2MROB 3BOSA 4P17A 4IBFA 3WHLA 1L1ZA 3NBIA 4UN2B 5C18A 4LRTA 2H1RA 4Y28F 5L8RF 2JZ0A 4JI5M 3FYDA 1EIJA 2Y0QA 4OVZB 5FLXS 1Q02A 1ZQ9A 2C9OA 4GH9A 5EXPA 3TWKA 4X62M 4S12A 4B3RM 2Z4RA 4B3TM 1HNXM 2OO9A 2YR0A 4FWHA 1D0KA 4LCBA 3DOAA 4AKGA 4I81A 4D82A 1WGNA 1R5LA 3KDSE 4AKHA 1IXSA 2LBCA 1HT1E 2V1UA 3J80S 1QQWA 3GPYA 1VG5A 4QNMA 2JY8A 1NJFA 1JB0F 2DVWB 2KDLA 2O01F 3FD9A 3T15A 2ZANA 1Q3BA 2BNKA 4KT0F 3E4RA 1J09A 1XMOM 3B89A 1PM5A 2JZ1A 1R4GA 1OTRA 3SYKA 3EIEA 4M9XA 2LHGA 3E9SA 5FTMA 1XXHA 3T38A 2DZLA 3HU2A 1J5EM 1PRBA 2CE7A 4LJ7A 1HQYE 1A5TA 1TDHA 3FTCA 3JR5A 2XLJA 1IY0A 3Q8GA 4LJ6A 1XC8A 4NL4H 4AG5A 5KPTA 2JP7A 1VEKA 3PNYA 1MU5A 2R18A 4MGKE 5ITQA 3HY5A 4IBCA 2CP8A 7CATA 3U6EA 1BVSA 5JI3E 4MB7A 3SFZA 3A46A 1IN4A 3IHPA 2I7NA 5FTNA 2OQ4A 4GHLA 1GKIA 2QQ8A 1HR0M 1E9SA 3F92A 4M9SA 4G4OA 2GQFA 4Q7JA 3QYBA 1UM8A 1L8QA 2UXDM 2J7OA 3PFIA 4LFAM 3PXGA 1PJTA 2EKFA 3FUXA 2UUAM 4F2LA 3M6AA 4HL4A 1OFHA 4LJAA 2JWSA 3TWLA 3HHYA 4LF9M 3AOEC 5DYGA 3GLGB 4M9ZA 2DAEA 1MX0A 2BJWA 1QVRA 3HHWA 3QYEA 4IBIA 5GKNA 3KW6A 4LJ8A 4B7FA 1NNJA 5IZ7D 2YFQA 1OJLA 5H37D 3A42A 1ZV1A 3SAWA 2CV1A 1SXJA 3BXWA 2EUCA 3VK8A 1YUBA 5ITRA 3GLFA 3VKGA 3RGSA 3HJ8A 1QAMA 1GVNA 4NXMM 2LH0A 2H5XA 3HGIA 3B74A 1IY2A 2ZTCA 4QHTA 4OU7A 1L2CA 3WHKA 1DO2A 1L2DA 4NOOB 3J27B 1P3QQ 1RU3A 5BPVA 3GLHA 1GL6A 2R6FA 4FWDA 4PD2A 4IBJA 3GLGA 3QAUA 4FVMA 4WW0A 4DR7M 1NY5A 4LF5M 2CV0A 3K9PA 4F1IA 3CTWB 3SMSA 1OIZA 1QAQA 2KZUA 5IWAM 2EKKA 2G8LA 2Z7JA 2QSFX 2VDBB 4LZZA 1E9RA 2MH8A 4NRWA 3L29A 3DFZA 1W5TA 3SYLA 4G4RA 1IXZA 4BB9A 3FTEA 3LVWA 3IECA 3LVVA 4GKKM 3B7QA 3FRIA 2WSEF 2QENA 2V6ZM 3B9PA 4ANRA 2LVQD 4BLCA 3LQQA 4GMQA 4JYAM 1DO0A 1W5SA 3I4VA 5ITXE 4LF7M 3JAMS 1HNWM 4PCZA 2LVAA 2XF3A 4LY6A 3GPPA 4FCTA 1N75A 1L1TA 2UXCM 2D7HA 4CIZA 4FW9A 1TR8A 1X37A 1NHGC 1IM2A 2M60A 2DI0A 4I5SA 3GLIE 1N77A 1J7KA 2VF8A 3D8LA 3ZC7B 4LG2A 2OOBA 1IN5A 2WZJA 5IREB 2KHHA 1H6UA 1SG9A 1SXJE 2DZOB 4FD2A 5FTLA 2UUCM 3SASA 3IG5A 4RF1A 1GJSA 3I01M 2XSZD 3HJSA 4WP2A 3U5ZA 3GRVA 4MGIE 8CATA 2F5NA 4B3SM 1QANA 2R65A 3U6LA 3GQ4A 3W0LB 1L2BA 3ZQJA 4GHAA 1QZEA 3J2PB 3W0FA 4LJ9A 2C98A 4QNRA 3GLGE 2DWNA 3GPUA 2F5PA 2B3TA 2UU9M 5FTKA 4OW0A 2JA2A 5DFLA 1LTMA 4ZPXA 3U6SA 4JI8M 1KSFX 1OIPA 2CEAA 1DGHB 3B7ZA 3GLIB 1ZMUA 3TQSA 5ITTA 2KZSA 2MGWA 4X64M 4LGMA 3HHXA 4G4QA 3I04M 5BR8M 1NJGA 5LMUM 4JI1M 3VFDA 2O5RA 1QUSA 4L16A 2JY6B 2X4AA 2XEPA 2HHHM 1E94E 2FH0A 4DV0M 4ITQA 2Z4SA 4LF4M 3GRRA 3L2AA 4B7HA 5LMNM 1QZMA 3C3DA 1GABA 3UGJA 3KSXA 5DNYA 1V34A 2FE8A 4NSOB 3HZJA 2CUZA 3VLFB 3GP1A 1EFUB 4L78A 4D80A 2K6BA 2C99A 1QDRA 1FNNA 1NHWC 1TGUA 3T6PA 3SARA 4JI3M 1JQJC 4DR2M 1HNZM 4CHTB 2L09A 2LWXA 4XBOA 2JY7A 4G6ZA 3FUTA 2J7NA 3GQ3A 2JY5A 1G59A 1XWIA 1E32A 3TWMA 4GIPA 1WR1B 2VIIA 2DHRA 4GITA 4I4LA 2KRUA 2XGNA 3AV0A 4LF8M 1NO1A 3TL4X 1TF0B 3M7GA 2ERCA 4MGZE 4DV2M 1N32M 3FE3A 2K9DA 2KRKA 2APLA 2CHQA 1IXRC 3SHFA 1SXJB 2R45A 3FTFA 4M0WA 2FS1A 5FTJA 1IBLM 3AL0C 2OOAA 1XXHE 2D7EA 2O25A 3GLHB 2EO2A 2QNJA 3IG8A 3KP1E 3KSJA 1VQ1A 3KOZE 4IBDA 4DV3M 2KNVA 3W67A 2RGHA 1Y8GA 1QUTA 2JUJA 1T6OA 1PJSA 3L28A 3R8FA 2RRUA 1YLAA 4FCVA 2QCUA 1YE9A 1WJ7A 4IBEA 3MK6A 1IN7A 4FWGA 1TH4A 1TTEA 2E5LM 4JI4M 1IQPA 1Z5AA 3HWSA 1R2ZA 2CV2A 3KVWA 3VDPA 1PGYA 2Z8YM 4AI6A 4DUYM 2Z3XA 4IBKA 1Z5CA 3R9XB 4L8RC 1K3XA 1R2YA 3DZDA 4JXJA 4DR3M 3CF2A 2DWLA 3KFUG 1F4IA 1V33A 4MGHA 3GLIA 4EIWA 1G8PA 1OFIA 4B7GA 1PJJA 1IN6A 4BBAA 2L4FA 1Q39A 4PDGA 4DV1M 2Y0TA 4IBGA 2ZTDA 2C9CA 3D8BA 4HLQA 2LNHC 3AOGA 3UZUA 3ZCBB 4MM3B 2XFSA 3GLFB 2JXNA 3KOYE 1XXHB 3GLFE 4K0KM 4GRIA 4RF0A 4KODA 1VEJA 4DV7M 3J7AS 1G3IA 2DHYA 4L6V6 3VDUA 3FTDA 3FYCA 5A2QS 3U6CA 2XH9A 3I51A 2L6OA 3B7NA 1GO5A 4KHPM 2L4EA 2JNHA 2KNAA 2MR9A 4LJ5A 4NRVA 4P16A 5E26A 1ORYB 2R46A 1K82A 1WIVA 4G4NA 4IJFA 1V92A 2DKLA 3TPZA 2K0BX 2KW0A 2F5SA 3FUWA 3J81S 3SC3A 4REZA 4CJ6A 2UXBM 5DYIA 4CGYB 1HT2E 4L4UA 3L25A 3HKPA 4AKIA 2DNAA 1Z6TA 4MH0E 1T3TA 2G3QA 4WURA 2DAIA 2NQ8C 5E6JA 2LVPC 3UMMA 1WGLA 3KXEC 2F4VM 4OX9M 1DGFA 2DENA 3LCUA 3LMMA 2ZAMA 3AFHA 3C9PA 3L27A 4B08A 1OKSA 4QOSA 1OAOC 4JN6A 2AHMA 4Z8XA 3BBZA 1DGHA 3HJQA 5EP2A 4DV4M 3FUUA 2XZFA 4I8OA 3U60A 5EXSA 5IT9S 2LTUA 3RGPA 4AQYM 3W68A 1IN8A 2DAKA 1JR3E 4GC9A 1MJGM 2A5YB 1G71A 1GJTA 1K3WA 3U61A 3AOEA 1ZMVA 1XMQM 2QP9X 1Q3CA 2HKJA 2GNOA 2LXEA 5EP3A 2DWZB 4JI6M 3EIHA 2VF7A 1ZAEA 4DR4M 3UJNA 1C7YA 2MJ5B 1NSFA 2HCBA 2BWEA 3I4YA 3J7BA 5ITUA 2HAKA 2DXIA 1DGBA 1DGGA 2KA6B 2QPAA 3FUVA 3H4MA 2QBYA 1XHBA 2X49A 5KQDA 1PJIA 4Z6YA 4AZFA 3SATA 5KPRA 4YY3M 3U6DA 3M0EA 2R4JA 3K1JA 3MMPA 3GRYA 4LFBM 3FKEA 3FRHA 3OTOM 4B3MM 2F5QA 1TH3A 5KPZA 2CRUA 1DV0A 2VQEM 2QHOB 3ZH9B 1HQCA 1TH2A 1NV9A 3ILKA 4D81A 4AG6A 4DR6M 3E46A 2ZM6M 2QZ4A 4AW4A 4JI7M 3A45A 1OQYA 4DUZM 1QAOA 2UUBM 4NSRA
chains in the Genus database with same CATH topology
2RRUA 1YLAA 3H4JA 2KNZA 3LCVB 1WJ7A 1OAIA 3K9PA 1XB2B 1TTEA 2L2DA 1HJPA 2DAMA 4F1IA 5JI2E 2EKKA 2DAGA 2LVOC 1G41A 2QSFX 1IFYA 4GEWA 1PGYA 2MROB 2HWJA 3IECA 4UN2B 3FRIA 2LVQD 1F4IA 2LVNC 1DO0A 2JZ0A 3GLHE 4G3OA 2LVAA 1Q02A 2L4FA 1TR8A 1IM2A 2ZTDA 1UFZA 2DI0A 3GLIE 2OO9A 3GLFE 2EJSA 1WGNA 1VEJA 2OOBA 2WZJA 1G3IA 2DHYA 1IXSA 2KHHA 1MN3A 1SG9A 1AIPC 2LBCA 1HT1E 1ZMWA 1GO5A 1KYIA 2JNHA 2KNAA 2L4EA 2MR9A 3E21A 4WP2A 1VG5A 2JY8A 1WIVA 1V92A 2DKLA 2K0BX 1QZEA 1NV8A 1HT2E 3B89A 2JZ1A 3GLGE 1R4GA 1OTRA 2DNAA 4R71A 2G3QA 2B3TA 2DAIA 2LVPC 1WGLA 2DZLA 5DFLA 2DENA 3LCUA 1A5TA 1HQYE 1CUKA 3K9OA 1OKSA 1ZMUA 2R0IA 3BBZA 2JP7A 1WHCA 2MGWA 1VEKA 1T43A 2CP8A 4HEOA 1BVSA 2LTUA 1VDLA 3IHPA 2BWBA 2JY6B 2DAKA 1E94E 1JR3E 3F92A 1ZMVA 2CWBA 4Q7JA 1EFUB 4DBGB 2EKFA 1C7YA 3T6PA 2MJ5B 4F2LA 2BWEA 2HAKA 2JY7A 1VEGA 2JY5A 1WR1B 2DAEA 3MMPA 3FRHA 1DV0A 1ZV1A 3FE3A 2QHOB 2K9DA 1NV9A 2H5XA 1G4AE 2ZTCA 3E46A 1DO2A 2OOAA 1XXHE 2O25A 2QNJA 1VQ1A 1OQYA 1P3QQ 2KNVA 1Y8GA 2JUJA 1T6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRU A;  1YLA A;  3H4J A;  2KNZ A;  3LCV B;  1WJ7 A;  1OAI A;  3K9P A;  1XB2 B;  1TTE A;  2L2D A;  1HJP A;  2DAM A;  4F1I A;  5JI2 E;  2EKK A;  2DAG A;  2LVO C;  1G41 A;  2QSF X;  1IFY A;  4GEW A;  1PGY A;  2MRO B;  2HWJ A;  3IEC A;  4UN2 B;  3FRI A;  2LVQ D;  1F4I A;  2LVN C;  1DO0 A;  2JZ0 A;  3GLH E;  4G3O A;  2LVA A;  1Q02 A;  2L4F A;  1TR8 A;  1IM2 A;  2ZTD A;  1UFZ A;  2DI0 A;  3GLI E;  2OO9 A;  3GLF E;  2EJS A;  1WGN A;  1VEJ A;  2OOB A;  2WZJ A;  1G3I A;  2DHY A;  1IXS A;  2KHH A;  1MN3 A;  1SG9 A;  1AIP C;  2LBC A;  1HT1 E;  1ZMW A;  1GO5 A;  1KYI A;  2JNH A;  2KNA A;  2L4E A;  2MR9 A;  3E21 A;  4WP2 A;  1VG5 A;  2JY8 A;  1WIV A;  1V92 A;  2DKL A;  2K0B X;  1QZE A;  1NV8 A;  1HT2 E;  3B89 A;  2JZ1 A;  3GLG E;  1R4G A;  1OTR A;  2DNA A;  4R71 A;  2G3Q A;  2B3T A;  2DAI A;  2LVP C;  1WGL A;  2DZL A;  5DFL A;  2DEN A;  3LCU A;  1A5T A;  1HQY E;  1CUK A;  3K9O A;  1OKS A;  1ZMU A;  2R0I A;  3BBZ A;  2JP7 A;  1WHC A;  2MGW A;  1VEK A;  1T43 A;  2CP8 A;  4HEO A;  1BVS A;  2LTU A;  1VDL A;  3IHP A;  2BWB A;  2JY6 B;  2DAK A;  1E94 E;  1JR3 E;  3F92 A;  1ZMV A;  2CWB A;  4Q7J A;  1EFU B;  4DBG B;  2EKF A;  1C7Y A;  3T6P A;  2MJ5 B;  4F2L A;  2BWE A;  2HAK A;  2JY7 A;  1VEG A;  2JY5 A;  1WR1 B;  2DAE A;  3MMP A;  3FRH A;  1DV0 A;  1ZV1 A;  3FE3 A;  2QHO B;  2K9D A;  1NV9 A;  2H5X A;  1G4A E;  2ZTC A;  3E46 A;  1DO2 A;  2OOA A;  1XXH E;  2O25 A;  2QNJ A;  1VQ1 A;  1OQY A;  1P3Q Q;  2KNV A;  1Y8G A;  2JUJ A;  1T6O A; 
#chains in the Genus database with same CATH topology
 3PNV A;  2XFT A;  3H4J A;  1OAI A;  2Y21 A;  1YSY A;  1XB2 B;  4XGI A;  3KS8 A;  1VDD A;  2L2D A;  1HJP A;  2DAM A;  1I94 M;  2C96 A;  2LVO C;  3V76 A;  1G41 A;  5EJC A;  4GC5 A;  4M0D A;  2HWJ A;  4QHS A;  4XK8 F;  2FFJ A;  4QOZ C;  2L7I A;  2V1C A;  4KLN A;  4LF6 M;  1R7R A;  1Z5B A;  3U6P A;  2D7G A;  2LVN C;  4G3O A;  3GLH E;  3U6M A;  4TUW A;  1IBK M;  4OVZ A;  2CHV A;  2RGO A;  3CF6 E;  1UFZ A;  3CGW A;  3RE8 A;  2EA0 A;  2HL7 A;  2Q2E B;  1NVM A;  4IIW A;  4L15 A;  4LRS A;  2EJS A;  1LV7 A;  3NWL A;  3KOX E;  5EXT A;  1MN3 A;  2W82 A;  3PVS A;  1AIP C;  3TE6 A;  1ZMW A;  2BJV A;  2WSC F;  3AKZ A;  4LFC M;  1GLN A;  1KYI A;  2WSF F;  3E21 A;  1PJQ A;  4II7 A;  4JI0 M;  4X66 M;  2OPF A;  3GRU A;  2YNM D;  1Z59 A;  2KEB A;  1AUA A;  2R44 A;  3HHZ A;  2LHC A;  4LJ4 A;  1NV8 A;  1EE8 A;  4KO8 A;  1C1K A;  2XSZ A;  3SAU A;  1S3S A;  1KFV A;  3T1H M;  1FJG M;  4R71 A;  5C1B A;  1NNU C;  3HU1 A;  2R62 A;  4X65 M;  4MGY E;  2DWM A;  4PDI A;  5KQ8 A;  1TDZ A;  1CUK A;  4GKJ M;  2VQF M;  3KP0 E;  3T1Y M;  3K92 A;  2I7P A;  3K9O A;  3UK6 A;  2R0I A;  3HU3 A;  3QWL A;  1WHC A;  5EQT A;  2L7H A;  3VKH A;  1JR3 A;  5EP1 A;  1T43 A;  1WXQ A;  2R4E A;  2Y20 A;  4HEO A;  4DR5 M;  1N34 M;  4IJE A;  1VDL A;  1D2N A;  3SAV A;  2BWB A;  4R3D A;  2K47 A;  4W5W A;  4LGY A;  1IBM M;  3A98 B;  1SXJ C;  2CWB A;  3SHG B;  5ITY A;  1XNQ M;  2FOI C;  4JV5 M;  4DR1 M;  1IXS B;  3DA1 A;  3U6Q A;  3THG A;  1SXJ D;  2M5Z A;  3LQR A;  3CF0 A;  3LW5 F;  2QBY B;  5KO3 A;  3GO8 A;  3GQ5 A;  4RNA A;  4PT5 A;  3HX3 A;  3NBX X;  1VEG A;  2X8A A;  2J5Y A;  3L26 A;  1N33 M;  2KXE A;  2FNA A;  4NXN M;  4CIS A;  1R6B X;  2CFO A;  2N35 A;  3K2L A;  3U6O A;  4LZJ A;  1QYR A;  3RFW A;  3AJI B;  3K8Z A;  2P5T A;  1GL7 A;  2YQZ A;  3KS4 A;  5EP4 A;  4DV5 M;  3GPX A;  3Q8X A;  3U5Z B;  1XNR M;  1D0L A;  4NC6 A;  2F5O A;  1G4A E;  2CHG A;  3MJ5 A;  1N78 A;  2G5G X;  1JR3 D;  2ZAO A;  3C3E A;  4RKU F;  2XZU A;  2RKO A;  1N36 M;  2DZN B;  4DBG B;  3U60 B;  3JR4 A;  1I4W A;  4R7G A;  2ZBK B;  3SMP A;  1IY1 A;  4DV6 M;  5ITX A;  4A3V B;  1D0M A;  3LCV B;  3SBJ A;  3VK7 A;  2KNZ A;  5F3W A;  2C5R A;  5EXX A;  3C58 A;  3KOW E;  1QDT A;  5JI2 E;  3U61 B;  2DAG A;  4IBB A;  1NY6 A;  3MHV C;  1IFY A;  4FCW A;  4GEW A;  5FSW A;  4YHH M;  4JI2 M;  2MRO B;  3BOS A;  4P17 A;  4IBF A;  3WHL A;  1L1Z A;  3NBI A;  4UN2 B;  5C18 A;  4LRT A;  2H1R A;  4Y28 F;  5L8R F;  2JZ0 A;  4JI5 M;  3FYD A;  1EIJ A;  2Y0Q A;  4OVZ B;  5FLX S;  1Q02 A;  1ZQ9 A;  2C9O A;  4GH9 A;  5EXP A;  3TWK A;  4X62 M;  4S12 A;  4B3R M;  2Z4R A;  4B3T M;  1HNX M;  2OO9 A;  2YR0 A;  4FWH A;  1D0K A;  4LCB A;  3DOA A;  4AKG A;  4I81 A;  4D82 A;  1WGN A;  1R5L A;  3KDS E;  4AKH A;  1IXS A;  2LBC A;  1HT1 E;  2V1U A;  3J80 S;  1QQW A;  3GPY A;  1VG5 A;  4QNM A;  2JY8 A;  1NJF A;  1JB0 F;  2DVW B;  2KDL A;  2O01 F;  3FD9 A;  3T15 A;  2ZAN A;  1Q3B A;  2BNK A;  4KT0 F;  3E4R A;  1J09 A;  1XMO M;  3B89 A;  1PM5 A;  2JZ1 A;  1R4G A;  1OTR A;  3SYK A;  3EIE A;  4M9X A;  2LHG A;  3E9S A;  5FTM A;  1XXH A;  3T38 A;  2DZL A;  3HU2 A;  1J5E M;  1PRB A;  2CE7 A;  4LJ7 A;  1HQY E;  1A5T A;  1TDH A;  3FTC A;  3JR5 A;  2XLJ A;  1IY0 A;  3Q8G A;  4LJ6 A;  1XC8 A;  4NL4 H;  4AG5 A;  5KPT A;  2JP7 A;  1VEK A;  3PNY A;  1MU5 A;  2R18 A;  4MGK E;  5ITQ A;  3HY5 A;  4IBC A;  2CP8 A;  7CAT A;  3U6E A;  1BVS A;  5JI3 E;  4MB7 A;  3SFZ A;  3A46 A;  1IN4 A;  3IHP A;  2I7N A;  5FTN A;  2OQ4 A;  4GHL A;  1GKI A;  2QQ8 A;  1HR0 M;  1E9S A;  3F92 A;  4M9S A;  4G4O A;  2GQF A;  4Q7J A;  3QYB A;  1UM8 A;  1L8Q A;  2UXD M;  2J7O A;  3PFI A;  4LFA M;  3PXG A;  1PJT A;  2EKF A;  3FUX A;  2UUA M;  4F2L A;  3M6A A;  4HL4 A;  1OFH A;  4LJA A;  2JWS A;  3TWL A;  3HHY A;  4LF9 M;  3AOE C;  5DYG A;  3GLG B;  4M9Z A;  2DAE A;  1MX0 A;  2BJW A;  1QVR A;  3HHW A;  3QYE A;  4IBI A;  5GKN A;  3KW6 A;  4LJ8 A;  4B7F A;  1NNJ A;  5IZ7 D;  2YFQ A;  1OJL A;  5H37 D;  3A42 A;  1ZV1 A;  3SAW A;  2CV1 A;  1SXJ A;  3BXW A;  2EUC A;  3VK8 A;  1YUB A;  5ITR A;  3GLF A;  3VKG A;  3RGS A;  3HJ8 A;  1QAM A;  1GVN A;  4NXM M;  2LH0 A;  2H5X A;  3HGI A;  3B74 A;  1IY2 A;  2ZTC A;  4QHT A;  4OU7 A;  1L2C A;  3WHK A;  1DO2 A;  1L2D A;  4NOO B;  3J27 B;  1P3Q Q;  1RU3 A;  5BPV A;  3GLH A;  1GL6 A;  2R6F A;  4FWD A;  4PD2 A;  4IBJ A;  3GLG A;  3QAU A;  4FVM A;  4WW0 A;  4DR7 M;  1NY5 A;  4LF5 M;  2CV0 A;  3K9P A;  4F1I A;  3CTW B;  3SMS A;  1OIZ A;  1QAQ A;  2KZU A;  5IWA M;  2EKK A;  2G8L A;  2Z7J A;  2QSF X;  2VDB B;  4LZZ A;  1E9R A;  2MH8 A;  4NRW A;  3L29 A;  3DFZ A;  1W5T A;  3SYL A;  4G4R A;  1IXZ A;  4BB9 A;  3FTE A;  3LVW A;  3IEC A;  3LVV A;  4GKK M;  3B7Q A;  3FRI A;  2WSE F;  2QEN A;  2V6Z M;  3B9P A;  4ANR A;  2LVQ D;  4BLC A;  3LQQ A;  4GMQ A;  4JYA M;  1DO0 A;  1W5S A;  3I4V A;  5ITX E;  4LF7 M;  3JAM S;  1HNW M;  4PCZ A;  2LVA A;  2XF3 A;  4LY6 A;  3GPP A;  4FCT A;  1N75 A;  1L1T A;  2UXC M;  2D7H A;  4CIZ A;  4FW9 A;  1TR8 A;  1X37 A;  1NHG C;  1IM2 A;  2M60 A;  2DI0 A;  4I5S A;  3GLI E;  1N77 A;  1J7K A;  2VF8 A;  3D8L A;  3ZC7 B;  4LG2 A;  2OOB A;  1IN5 A;  2WZJ A;  5IRE B;  2KHH A;  1H6U A;  1SG9 A;  1SXJ E;  2DZO B;  4FD2 A;  5FTL A;  2UUC M;  3SAS A;  3IG5 A;  4RF1 A;  1GJS A;  3I01 M;  2XSZ D;  3HJS A;  4WP2 A;  3U5Z A;  3GRV A;  4MGI E;  8CAT A;  2F5N A;  4B3S M;  1QAN A;  2R65 A;  3U6L A;  3GQ4 A;  3W0L B;  1L2B A;  3ZQJ A;  4GHA A;  1QZE A;  3J2P B;  3W0F A;  4LJ9 A;  2C98 A;  4QNR A;  3GLG E;  2DWN A;  3GPU A;  2F5P A;  2B3T A;  2UU9 M;  5FTK A;  4OW0 A;  2JA2 A;  5DFL A;  1LTM A;  4ZPX A;  3U6S A;  4JI8 M;  1KSF X;  1OIP A;  2CEA A;  1DGH B;  3B7Z A;  3GLI B;  1ZMU A;  3TQS A;  5ITT A;  2KZS A;  2MGW A;  4X64 M;  4LGM A;  3HHX A;  4G4Q A;  3I04 M;  5BR8 M;  1NJG A;  5LMU M;  4JI1 M;  3VFD A;  2O5R A;  1QUS A;  4L16 A;  2JY6 B;  2X4A A;  2XEP A;  2HHH M;  1E94 E;  2FH0 A;  4DV0 M;  4ITQ A;  2Z4S A;  4LF4 M;  3GRR A;  3L2A A;  4B7H A;  5LMN M;  1QZM A;  3C3D A;  1GAB A;  3UGJ A;  3KSX A;  5DNY A;  1V34 A;  2FE8 A;  4NSO B;  3HZJ A;  2CUZ A;  3VLF B;  3GP1 A;  1EFU B;  4L78 A;  4D80 A;  2K6B A;  2C99 A;  1QDR A;  1FNN A;  1NHW C;  1TGU A;  3T6P A;  3SAR A;  4JI3 M;  1JQJ C;  4DR2 M;  1HNZ M;  4CHT B;  2L09 A;  2LWX A;  4XBO A;  2JY7 A;  4G6Z A;  3FUT A;  2J7N A;  3GQ3 A;  2JY5 A;  1G59 A;  1XWI A;  1E32 A;  3TWM A;  4GIP A;  1WR1 B;  2VII A;  2DHR A;  4GIT A;  4I4L A;  2KRU A;  2XGN A;  3AV0 A;  4LF8 M;  1NO1 A;  3TL4 X;  1TF0 B;  3M7G A;  2ERC A;  4MGZ E;  4DV2 M;  1N32 M;  3FE3 A;  2K9D A;  2KRK A;  2APL A;  2CHQ A;  1IXR C;  3SHF A;  1SXJ B;  2R45 A;  3FTF A;  4M0W A;  2FS1 A;  5FTJ A;  1IBL M;  3AL0 C;  2OOA A;  1XXH E;  2D7E A;  2O25 A;  3GLH B;  2EO2 A;  2QNJ A;  3IG8 A;  3KP1 E;  3KSJ A;  1VQ1 A;  3KOZ E;  4IBD A;  4DV3 M;  2KNV A;  3W67 A;  2RGH A;  1Y8G A;  1QUT A;  2JUJ A;  1T6O A;  1PJS A;  3L28 A;  3R8F A;  2RRU A;  1YLA A;  4FCV A;  2QCU A;  1YE9 A;  1WJ7 A;  4IBE A;  3MK6 A;  1IN7 A;  4FWG A;  1TH4 A;  1TTE A;  2E5L M;  4JI4 M;  1IQP A;  1Z5A A;  3HWS A;  1R2Z A;  2CV2 A;  3KVW A;  3VDP A;  1PGY A;  2Z8Y M;  4AI6 A;  4DUY M;  2Z3X A;  4IBK A;  1Z5C A;  3R9X B;  4L8R C;  1K3X A;  1R2Y A;  3DZD A;  4JXJ A;  4DR3 M;  3CF2 A;  2DWL A;  3KFU G;  1F4I A;  1V33 A;  4MGH A;  3GLI A;  4EIW A;  1G8P A;  1OFI A;  4B7G A;  1PJJ A;  1IN6 A;  4BBA A;  2L4F A;  1Q39 A;  4PDG A;  4DV1 M;  2Y0T A;  4IBG A;  2ZTD A;  2C9C A;  3D8B A;  4HLQ A;  2LNH C;  3AOG A;  3UZU A;  3ZCB B;  4MM3 B;  2XFS A;  3GLF B;  2JXN A;  3KOY E;  1XXH B;  3GLF E;  4K0K M;  4GRI A;  4RF0 A;  4KOD A;  1VEJ A;  4DV7 M;  3J7A S;  1G3I A;  2DHY A;  4L6V 6;  3VDU A;  3FTD A;  3FYC A;  5A2Q S;  3U6C A;  2XH9 A;  3I51 A;  2L6O A;  3B7N A;  1GO5 A;  4KHP M;  2L4E A;  2JNH A;  2KNA A;  2MR9 A;  4LJ5 A;  4NRV A;  4P16 A;  5E26 A;  1ORY B;  2R46 A;  1K82 A;  1WIV A;  4G4N A;  4IJF A;  1V92 A;  2DKL A;  3TPZ A;  2K0B X;  2KW0 A;  2F5S A;  3FUW A;  3J81 S;  3SC3 A;  4REZ A;  4CJ6 A;  2UXB M;  5DYI A;  4CGY B;  1HT2 E;  4L4U A;  3L25 A;  3HKP A;  4AKI A;  2DNA A;  1Z6T A;  4MH0 E;  1T3T A;  2G3Q A;  4WUR A;  2DAI A;  2NQ8 C;  5E6J A;  2LVP C;  3UMM A;  1WGL A;  3KXE C;  2F4V M;  4OX9 M;  1DGF A;  2DEN A;  3LCU A;  3LMM A;  2ZAM A;  3AFH A;  3C9P A;  3L27 A;  4B08 A;  1OKS A;  4QOS A;  1OAO C;  4JN6 A;  2AHM A;  4Z8X A;  3BBZ A;  1DGH A;  3HJQ A;  5EP2 A;  4DV4 M;  3FUU A;  2XZF A;  4I8O A;  3U60 A;  5EXS A;  5IT9 S;  2LTU A;  3RGP A;  4AQY M;  3W68 A;  1IN8 A;  2DAK A;  1JR3 E;  4GC9 A;  1MJG M;  2A5Y B;  1G71 A;  1GJT A;  1K3W A;  3U61 A;  3AOE A;  1ZMV A;  1XMQ M;  2QP9 X;  1Q3C A;  2HKJ A;  2GNO A;  2LXE A;  5EP3 A;  2DWZ B;  4JI6 M;  3EIH A;  2VF7 A;  1ZAE A;  4DR4 M;  3UJN A;  1C7Y A;  2MJ5 B;  1NSF A;  2HCB A;  2BWE A;  3I4Y A;  3J7B A;  5ITU A;  2HAK A;  2DXI A;  1DGB A;  1DGG A;  2KA6 B;  2QPA A;  3FUV A;  3H4M A;  2QBY A;  1XHB A;  2X49 A;  5KQD A;  1PJI A;  4Z6Y A;  4AZF A;  3SAT A;  5KPR A;  4YY3 M;  3U6D A;  3M0E A;  2R4J A;  3K1J A;  3MMP A;  3GRY A;  4LFB M;  3FKE A;  3FRH A;  3OTO M;  4B3M M;  2F5Q A;  1TH3 A;  5KPZ A;  2CRU A;  1DV0 A;  2VQE M;  2QHO B;  3ZH9 B;  1HQC A;  1TH2 A;  1NV9 A;  3ILK A;  4D81 A;  4AG6 A;  4DR6 M;  3E46 A;  2ZM6 M;  2QZ4 A;  4AW4 A;  4JI7 M;  3A45 A;  1OQY A;  4DUZ M;  1QAO A;  2UUB M;  4NSR A; 
#chains in the Genus database with same CATH homology
 2RRU A;  1YLA A;  3H4J A;  2KNZ A;  3LCV B;  1WJ7 A;  1OAI A;  3K9P A;  1XB2 B;  1TTE A;  2L2D A;  1HJP A;  2DAM A;  4F1I A;  5JI2 E;  2EKK A;  2DAG A;  2LVO C;  1G41 A;  2QSF X;  1IFY A;  4GEW A;  1PGY A;  2MRO B;  2HWJ A;  3IEC A;  4UN2 B;  3FRI A;  2LVQ D;  1F4I A;  2LVN C;  1DO0 A;  2JZ0 A;  3GLH E;  4G3O A;  2LVA A;  1Q02 A;  2L4F A;  1TR8 A;  1IM2 A;  2ZTD A;  1UFZ A;  2DI0 A;  3GLI E;  2OO9 A;  3GLF E;  2EJS A;  1WGN A;  1VEJ A;  2OOB A;  2WZJ A;  1G3I A;  2DHY A;  1IXS A;  2KHH A;  1MN3 A;  1SG9 A;  1AIP C;  2LBC A;  1HT1 E;  1ZMW A;  1GO5 A;  1KYI A;  2JNH A;  2KNA A;  2L4E A;  2MR9 A;  3E21 A;  4WP2 A;  1VG5 A;  2JY8 A;  1WIV A;  1V92 A;  2DKL A;  2K0B X;  1QZE A;  1NV8 A;  1HT2 E;  3B89 A;  2JZ1 A;  3GLG E;  1R4G A;  1OTR A;  2DNA A;  4R71 A;  2G3Q A;  2B3T A;  2DAI A;  2LVP C;  1WGL A;  2DZL A;  5DFL A;  2DEN A;  3LCU A;  1A5T A;  1HQY E;  1CUK A;  3K9O A;  1OKS A;  1ZMU A;  2R0I A;  3BBZ A;  2JP7 A;  1WHC A;  2MGW A;  1VEK A;  1T43 A;  2CP8 A;  4HEO A;  1BVS A;  2LTU A;  1VDL A;  3IHP A;  2BWB A;  2JY6 B;  2DAK A;  1E94 E;  1JR3 E;  3F92 A;  1ZMV A;  2CWB A;  4Q7J A;  1EFU B;  4DBG B;  2EKF A;  1C7Y A;  3T6P A;  2MJ5 B;  4F2L A;  2BWE A;  2HAK A;  2JY7 A;  1VEG A;  2JY5 A;  1WR1 B;  2DAE A;  3MMP A;  3FRH A;  1DV0 A;  1ZV1 A;  3FE3 A;  2QHO B;  2K9D A;  1NV9 A;  2H5X A;  1G4A E;  2ZTC A;  3E46 A;  1DO2 A;  2OOA A;  1XXH E;  2O25 A;  2QNJ A;  1VQ1 A;  1OQY A;  1P3Q Q;  2KNV A;  1Y8G A;  2JUJ A;  1T6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...