2L2DA

Solution nmr structure of human uba-like domain of otud7a_11_83, nesg target ht6304a/ocsp target otud7a_11_83/sgc-toronto
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
SAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OTU domain-containing protein 7A
publication title The amino-terminal UBA domain of OTUD7A
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 73
sequence length 73
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l2dA00
1DO2A 2K9DA 2OOBA 1TTEA 2QSFX 2OO9A 1C7YA 2JNHA 2DAKA 2LVNC 1R4GA 1SG9A 2JZ1A 4HEOA 2DENA 2ZTDA 1ZV1A 3LCUA 1TR8A 1WGLA 1JR3E 1DO0A 5DFLA 1CUKA 4GEWA 1OAIA 3E21A 1OKSA 5JI2E 2DI0A 1IM2A 1WIVA 4WP2A 3MMPA 2EKKA 1NV9A 1VDLA 1VEGA 1EFUB 2DAEA 3FRHA 1E94E 2DAMA 4UN2B 2QNJA 1KYIA 2HWJA 3E46A 1VQ1A 1GO5A 1V92A 2JY5A 2JUJA 3BBZA 2QHOB 1G4AE 1HJPA 2MR9A 4G3OA 2KNVA 3LCVB 1WHCA 2DAGA 3IHPA 2JP7A 2JY7A 3K9PA 2L2DA 1OQYA 1UFZA 2EKFA 4F1IA 1T43A 2JY8A 1XXHE 4DBGB 1ZMUA 2MROB 3F92A 3GLHE 2H5XA 2RRUA 2KHHA 1NV8A 3H4JA 3T6PA 1Y8GA 2BWBA 1IXSA 3FE3A 2DHYA 2MGWA 1WR1B 1F4IA 1VEJA 2LVOC 2CWBA 1HT2E 2O25A 1PGYA 2ZTCA 4Q7JA 2DAIA 2HAKA 2WZJA 4R71A 3B89A 2G3QA 3IECA 1P3QQ 2CP8A 1Q02A 1HQYE 2DKLA 2LTUA 1QZEA 3GLIE 1WJ7A 1ZMVA 3GLGE 2DNAA 2LBCA 1YLAA 1G41A 4F2LA 2DZLA 2OOAA 1A5TA 3GLFE 2BWEA 2LVQD 1IFYA 1HT1E 2LVPC 1XB2B 3K9OA 1WGNA 2KNAA 2KNZA 2JY6B 2MJ5B 2LVAA 1BVSA 2R0IA 2JZ0A 1MN3A 1ZMWA 1G3IA 3FRIA 1OTRA 1AIPC 2K0BX 2L4EA 1DV0A 1T6OA 1VEKA 1VG5A 2EJSA 2L4FA 2B3TA
chains in the Genus database with same CATH superfamily
4DV0M 2FNAA 2C96A 2XLJA 3VDPA 1SXJB 2YQZA 3GRVA 3VK7A 1C7YA 1Q3CA 4ZPXA 4LZZA 2LVNC 4QHSA 2L09A 1SG9A 3KW6A 3SMSA 3GLGA 1EIJA 3GLFB 3VKHA 2DENA 4B3TM 4IJEA 7CATA 3UGJA 5KO3A 4LF7M 2UU9M 1G8PA 4NXNM 4GRIA 2K6BA 3KXEC 3U6OA 1CUKA 4JI7M 4IBCA 2EO2A 1K82A 4OX9M 3U6SA 1IM2A 1WIVA 5BPVA 4NSOB 2BNKA 1HQCA 3TWLA 2CHVA 5ITYA 4DR1M 1NV9A 1VEGA 1J5EM 4JI0M 4REZA 4JI5M 4IBBA 3VKGA 2VIIA 4KO8A 1E94E 3GLIB 1N34M 2FFJA 1E9SA 2LHCA 2QNJA 4JXJA 3L29A 1V92A 2JY5A 2L7HA 3B7NA 4FWGA 5LMUM 3BBZA 2ZAMA 2I7NA 2MR9A 3KS4A 4II7A 2Y20A 1OFIA 4XGIA 2N35A 4DV6M 1V33A 3IHPA 2JP7A 3A98B 4PCZA 2V6ZM 4X65M 1N77A 2XZUA 2R18A 2L2DA 1FJGM 3FTDA 3KS8A 2XFSA 2FH0A 3KSXA 2F5SA 2MROB 3GLHE 4GHAA 2H5XA 2Y0TA 2KHHA 2I7PA 3H4JA 5BR8M 1GLNA 4MGZE 1T3TA 4R3DA 1NNJA 1IBMM 3KOWE 2F5QA 2LWXA 1IN7A 4CISA 2KDLA 2L7IA 2KZSA 3OTOM 4JI6M 2M60A 3I4VA 2O25A 1XNRM 1YSYA 3AV0A 1I4WA 1N75A 4QHTA 1D0LA 1PJJA 3SMPA 2X8AA 3U60A 1OAOC 2HAKA 4M9XA 4JI1M 4R71A 1NY6A 3B89A 2G3QA 1Q02A 2CP8A 1LTMA 3U6DA 2LTUA 1MJGM 2GQFA 4M9ZA 1ZMVA 4B08A 3PNYA 2DNAA 3QAUA 3UJNA 1Z5BA 3HJSA 2OOAA 4G6ZA 1XWIA 5ITUA 2R4EA 3KSJA 1IXZA 3L27A 2R44A 2OQ4A 3PFIA 1XXHB 1XB2B 4X64M 5ITXE 1AUAA 2KNAA 2JY6B 4QNRA 1BVSA 3HJQA 2JZ0A 3GLHA 4Z8XA 3GQ4A 1WXQA 3ZC7B 4BBAA 3TPZA 4B3MM 1V34A 2BJWA 2KRKA 3B9PA 2K0BX 1PJIA 1IY2A 1T6OA 3J27B 1VEKA 1VG5A 1W5TA 3B7QA 1D0KA 3CTWB 4QNMA 1YUBA 4JI3M 3SYKA 1E9RA 3UZUA 2Z8YM 3U6CA 1QUTA 1GJSA 1K3WA 3HY5A 1E32A 3LVWA 1HR0M 2Y0QA 2QSFX 1GKIA 2OO9A 4L15A 4CIZA 3SASA 4NXMM 1QZMA 1DGHB 1GJTA 4CHTB 3FYDA 3UMMA 5GKNA 4LG2A 1N33M 3GLGB 4LF6M 3U6QA 4AQYM 3FUWA 2CUZA 2KZUA 4HEOA 4L6V6 1S3SA 3T1YM 4FWDA 3AL0C 2HL7A 4GH9A 1OJLA 2RKOA 1ZV1A 2CE7A 3HHWA 4LF9M 1XNQM 4NL4H 2XSZD 1WGLA 2XH9A 5DFLA 3HGIA 4GEWA 4JN6A 3ZQJA 4B7HA 4BLCA 2BJVA 5KQDA 3E21A 1OKSA 1R5LA 1IN6A 4IBIA 3AOEA 3L26A 2C9CA 4LZJA 1N36M 2K47A 3KVWA 1Z5AA 2LNHC 3D8BA 1PRBA 4M0WA 2O01F 2CEAA 3KP1E 1XC8A 3AOGA 3PNVA 4DR6M 2EKKA 3I01M 1VDLA 1NVMA 1HNWM 2C98A 4I5SA 3FRHA 2CV0A 3FD9A 2VQFM 2GNOA 4P17A 5EP4A 3M7GA 1GVNA 3LVVA 2VF8A 4MM3B 3ILKA 4OW0A 3U5ZB 2JUJA 1IBLM 3T15A 3L25A 2QHOB 1G4AE 3SAVA 1HJPA 4FCTA 2Z3XA 2CV2A 2XSZA 2Z7JA 3AFHA 3K8ZA 2WSEF 1KFVA 1G71A 3VDUA 1FNNA 2JY7A 3BXWA 3K9PA 2CRUA 3L28A 2KA6B 3NBIA 3RE8A 4DV7M 1LV7A 1C1KA 3SBJA 4QOZC 1UFZA 2EKFA 3J2PB 1SXJD 1UM8A 4LF5M 1IQPA 2MH8A 4JI2M 1X37A 2UXDM 4A3VB 3F92A 3HJ8A 3MJ5A 1OFHA 4I81A 2DHRA 3GPPA 1NV8A 4BB9A 4RKUF 4LJ6A 1Y8GA 1IXSA 1Z6TA 1QAQA 4P16A 2A5YB 1L2CA 1F4IA 1QUSA 4NC6A 2LVOC 1PGYA 4AZFA 1H6UA 2Q2EB 4Q7JA 5FTLA 4MB7A 2XFTA 3T38A 4AI6A 1Z59A 3GO8A 3U61B 3R8FA 4B7GA 5FTKA 5IWAM 1HNXM 1VDDA 2DKLA 3SFZA 3JAMS 3GLIE 2UXBM 2R4JA 2LBCA 2F4VM 1G41A 4LFBM 5C18A 2QBYA 2DZLA 3RGSA 1A5TA 1SXJA 3CF2A 1NHWC 3GPXA 3KFUG 4B3RM 2QZ4A 2ZBKB 4IBDA 2LVQD 2F5OA 1PJTA 1IFYA 2ZM6M 4K0KM 4L8RC 2C99A 2J5YA 4AG6A 3R9XB 5EXTA 1J7KA 3DOAA 4AKIA 3GLFA 1PJSA 1L8QA 2KNZA 1GL6A 3GLHB 3Q8XA 4IBJA 4MGYE 1NSFA 2R0IA 1QYRA 1MN3A 3FKEA 3J81S 2HCBA 3HHXA 4DV3M 4GC5A 4DV1M 3FUXA 3FRIA 3A46A 1TH2A 1OTRA 1AIPC 2L4EA 4YY3M 1DV0A 1L1TA 1EE8A 1I94M 1QDRA 5EJCA 2EJSA 2JA2A 5KPRA 3TWKA 3GQ3A 3SC3A 1JR3D 1HNZM 4IBFA 2K9DA 4QOSA 2DXIA 3DZDA 3Q8GA 4LCBA 2WSFF 4DR2M 3AJIB 4PD2A 2JNHA 2VQEM 2DAKA 3GLIA 3C9PA 3FTCA 2L6OA 1OIPA 2R65A 2ZTDA 4LJ5A 2VDBB 3QWLA 1L2BA 4Y28F 3DA1A 1QAOA 3FUTA 3AKZA 1MX0A 2R6FA 3GRYA 3LCUA 1TR8A 1JQJC 1DO0A 1MU5A 5ITQA 4JYAM 1IN5A 3IG8A 5JI2E 2ZANA 3C3EA 4NSRA 5KPZA 3NBXX 5A2QS 2G5GX 1JR3A 3K2LA 4YHHM 4L4UA 1ZQ9A 4TUWA 5FTMA 1DGBA 4MH0E 4G4NA 3RFWA 3HHYA 2QENA 1N78A 1IN8A 2C5RA 4XK8F 3GP1A 2XGNA 1NHGC 3E4RA 4WURA 1GL7A 3V76A 4G4OA 1KYIA 4HL4A 3DFZA 3E46A 4AKHA 1TGUA 1GO5A 3SAWA 3CF6E 1XMQM 2FS1A 1N32M 4G3OA 4I8OA 2KNVA 4I4LA 1WHCA 4IBGA 4KHPM 5IREB 2DAGA 4CGYB 2KRUA 2UXCM 1TH4A 2JWSA 2J7NA 4LRTA 1TDZA 2WSCF 4ANRA 4CJ6A 3GRRA 3HU1A 3JR5A 3U6LA 4PDIA 2DWLA 4LY6A 2QPAA 3GPYA 2UUBM 1TF0B 1T43A 2JY8A 4DBGB 2QCUA 1ZMUA 3FYCA 4GKJM 1XHBA 4IIWA 5KQ8A 3CF0A 5EP1A 4MGHA 2YNMD 4JI8M 2H1RA 1NJFA 2CHQA 2ZAOA 3ZCBB 5C1BA 2DHYA 4X66M 3KOYE 3KOZE 3THGA 1WR1B 1XXHA 1XMOM 2D7GA 1VEJA 2CWBA 1HT2E 3A42A 4LGYA 4OVZA 4W5WA 1RU3A 2DVWB 3I04M 1K3XA 2ZTCA 2FOIC 3AOEC 2RGHA 3KOXE 4GC9A 4DUYM 3K92A 1SXJE 3W67A 4FCWA 3TQSA 2UUCM 3MK6A 2QBYB 1WJ7A 5DYGA 5FTNA 4F2LA 1Z5CA 4S12A 4OU7A 4DV4M 3GLFE 2Z4RA 4Z6YA 3W0FA 2BWEA 1DGHA 3B74A 3GRUA 4D80A 3GQ5A 1HT1E 3LMMA 2LVPC 5ITTA 3W68A 4LJ9A 2G8LA 4PT5A 2V1CA 2CV1A 4LJ8A 2O5RA 5F3WA 2DWNA 3A45A 2MJ5B 3I4YA 4WW0A 3PVSA 2OPFA 5E6JA 4GKKM 1D0MA 3SARA 2JXNA 2APLA 4L78A 3U60B 1ZMWA 2C9OA 2EUCA 2LXEA 5EXPA 4NRWA 1IY1A 2L4FA 3QYEA 2B3TA 3LW5F 3W0LB 1DO2A 2HHHM 1R7RA 2OOBA 4FW9A 3JR4A 1TTEA 3C58A 2NQ8C 1R2YA 3C3DA 4JI4M 1QDTA 1DGFA 1L1ZA 2UUAM 2M5ZA 4AKGA 4NOOB 5JI3E 1IXRC 4KLNA 3VLFB 4ITQA 2CHGA 4LFAM 1R4GA 2Y21A 1YE9A 2JZ1A 3M0EA 4DR5M 1Q3BA 3M6AA 3HU2A 3SHGB 5DNYA 4G4RA 3TWMA 2DZOB 1NNUC 3CGWA 4FWHA 3T1HM 3LQQA 3FTFA 1NJGA 3U5ZA 3HKPA 4LJAA 3H4MA 3HHZA 1JR3E 1QVRA 2W82A 3EIEA 2QP9X 5E26A 1IY0A 1OAIA 5IZ7D 4G4QA 2HKJA 2LH0A 1SXJC 1ORYB 2DI0A 3L2AA 2RGOA 3U6EA 4M0DA 1OIZA 2CFOA 4WP2A 4LRSA 1DGGA 2DZNB 5EXXA 3MMPA 5L8RF 2EA0A 3WHLA 2DAEA 5ITRA 1EFUB 4R7GA 2YFQA 3FUUA 2R62A 4EIWA 3I51A 2DAMA 4UN2B 4B3SM 3BOSA 1ZAEA 4AG5A 3GPUA 2XZFA 4PDGA 5LMNM 2HWJA 4DV2M 1W5SA 4DV5M 2YR0A 4RF0A 1VQ1A 2Z4SA 2R45A 3SHFA 4DR3M 3D8LA 4FVMA 3EIHA 4GMQA 4XBOA 3B7ZA 3LCVB 4GITA 5EP2A 1Q39A 4D81A 2DWZB 1TH3A 3U6MA 1PJQA 4B7FA 4M9SA 3U61A 4LFCM 1R2ZA 4LF4M 4D82A 2ERCA 1J09A 4RF1A 1OQYA 5H37D 1PM5A 5FSWA 2F5NA 4F1IA 4HLQA 3PXGA 4IBEA 4KT0F 3K1JA 2DWMA 1XXHE 2VF7A 2X4AA 4DUZM 3SATA 2LHGA 4RNAA 1R6BX 4DR7M 4GIPA 2RRUA 3NWLA 3HX3A 5EXSA 1QANA 4LGMA 3T6PA 3VK8A 1JB0F 2BWBA 4MGKE 1G59A 4IJFA 3FE3A 2MGWA 3SYLA 3TL4X 1IBKM 3FTEA 4AW4A 3E9SA 5KPTA 4L16A 4OVZB 2XF3A 4NRVA 3ZH9B 4IBKA 3J7AS 1NO1A 4X62M 3HU3A 2F5PA 4DR4M 3SAUA 4MGIE 2DAIA 2FE8A 5FTJA 5EP3A 2X49A 2WZJA 5FLXS 1D2NA 3J7BA 4LJ4A 3IECA 1P3QQ 1HQYE 2KW0A 3RGPA 4GHLA 1QZEA 1GABA 3GLGE 2QQ8A 3MHVC 5IT9S 1TDHA 1YLAA 1L2DA 1QQWA 5DYIA 4JV5M 1QAMA 3FUVA 2E5LM 2AHMA 3HZJA 3QYBA 2D7HA 4FD2A 1IN4A 4KODA 1IXSB 2XEPA 3KP0E 3J80S 3K9OA 1WGNA 2R46A 2KXEA 3IG5A 2LVAA 1KSFX 4LF8M 4LJ7A 3UK6A 5EQTA 4FCVA 8CATA 2D7EA 3KDSE 3VFDA 1G3IA 2V1UA 3HWSA 3U6PA 5ITXA 2J7OA 2KEBA 3TE6A 1NY5A 3LQRA 2P5TA 3WHKA
chains in the Genus database with same CATH topology
1DO2A 2K9DA 2OOBA 1TTEA 2QSFX 2OO9A 1C7YA 2JNHA 2DAKA 2LVNC 1R4GA 1SG9A 2JZ1A 4HEOA 2DENA 2ZTDA 1ZV1A 3LCUA 1TR8A 1WGLA 1JR3E 1DO0A 5DFLA 1CUKA 4GEWA 1OAIA 3E21A 1OKSA 5JI2E 2DI0A 1IM2A 1WIVA 4WP2A 3MMPA 2EKKA 1NV9A 1VDLA 1VEGA 1EFUB 2DAEA 3FRHA 1E94E 2DAMA 4UN2B 2QNJA 1KYIA 2HWJA 3E46A 1VQ1A 1GO5A 1V92A 2JY5A 2JUJA 3BBZA 2QHOB 1G4AE 1HJPA 2MR9A 4G3OA 2KNVA 3LCVB 1WHCA 2DAGA 3IHPA 2JP7A 2JY7A 3K9PA 2L2DA 1OQYA 1UFZA 2EKFA 4F1IA 1T43A 2JY8A 1XXHE 4DBGB 1ZMUA 2MROB 3F92A 3GLHE 2H5XA 2RRUA 2KHHA 1NV8A 3H4JA 3T6PA 1Y8GA 2BWBA 1IXSA 3FE3A 2DHYA 2MGWA 1WR1B 1F4IA 1VEJA 2LVOC 2CWBA 1HT2E 2O25A 1PGYA 2ZTCA 4Q7JA 2DAIA 2HAKA 2WZJA 4R71A 3B89A 2G3QA 3IECA 1P3QQ 2CP8A 1Q02A 1HQYE 2DKLA 2LTUA 1QZEA 3GLIE 1WJ7A 1ZMVA 3GLGE 2DNAA 2LBCA 1YLAA 1G41A 4F2LA 2DZLA 2OOAA 1A5TA 3GLFE 2BWEA 2LVQD 1IFYA 1HT1E 2LVPC 1XB2B 3K9OA 1WGNA 2KNAA 2KNZA 2JY6B 2MJ5B 2LVAA 1BVSA 2R0IA 2JZ0A 1MN3A 1ZMWA 1G3IA 3FRIA 1OTRA 1AIPC 2K0BX 2L4EA 1DV0A 1T6OA 1VEKA 1VG5A 2EJSA 2L4FA 2B3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DO2 A;  2K9D A;  2OOB A;  1TTE A;  2QSF X;  2OO9 A;  1C7Y A;  2JNH A;  2DAK A;  2LVN C;  1R4G A;  1SG9 A;  2JZ1 A;  4HEO A;  2DEN A;  2ZTD A;  1ZV1 A;  3LCU A;  1TR8 A;  1WGL A;  1JR3 E;  1DO0 A;  5DFL A;  1CUK A;  4GEW A;  1OAI A;  3E21 A;  1OKS A;  5JI2 E;  2DI0 A;  1IM2 A;  1WIV A;  4WP2 A;  3MMP A;  2EKK A;  1NV9 A;  1VDL A;  1VEG A;  1EFU B;  2DAE A;  3FRH A;  1E94 E;  2DAM A;  4UN2 B;  2QNJ A;  1KYI A;  2HWJ A;  3E46 A;  1VQ1 A;  1GO5 A;  1V92 A;  2JY5 A;  2JUJ A;  3BBZ A;  2QHO B;  1G4A E;  1HJP A;  2MR9 A;  4G3O A;  2KNV A;  3LCV B;  1WHC A;  2DAG A;  3IHP A;  2JP7 A;  2JY7 A;  3K9P A;  2L2D A;  1OQY A;  1UFZ A;  2EKF A;  4F1I A;  1T43 A;  2JY8 A;  1XXH E;  4DBG B;  1ZMU A;  2MRO B;  3F92 A;  3GLH E;  2H5X A;  2RRU A;  2KHH A;  1NV8 A;  3H4J A;  3T6P A;  1Y8G A;  2BWB A;  1IXS A;  3FE3 A;  2DHY A;  2MGW A;  1WR1 B;  1F4I A;  1VEJ A;  2LVO C;  2CWB A;  1HT2 E;  2O25 A;  1PGY A;  2ZTC A;  4Q7J A;  2DAI A;  2HAK A;  2WZJ A;  4R71 A;  3B89 A;  2G3Q A;  3IEC A;  1P3Q Q;  2CP8 A;  1Q02 A;  1HQY E;  2DKL A;  2LTU A;  1QZE A;  3GLI E;  1WJ7 A;  1ZMV A;  3GLG E;  2DNA A;  2LBC A;  1YLA A;  1G41 A;  4F2L A;  2DZL A;  2OOA A;  1A5T A;  3GLF E;  2BWE A;  2LVQ D;  1IFY A;  1HT1 E;  2LVP C;  1XB2 B;  3K9O A;  1WGN A;  2KNA A;  2KNZ A;  2JY6 B;  2MJ5 B;  2LVA A;  1BVS A;  2R0I A;  2JZ0 A;  1MN3 A;  1ZMW A;  1G3I A;  3FRI A;  1OTR A;  1AIP C;  2K0B X;  2L4E A;  1DV0 A;  1T6O A;  1VEK A;  1VG5 A;  2EJS A;  2L4F A;  2B3T A; 
#chains in the Genus database with same CATH topology
 4DV0 M;  2FNA A;  2C96 A;  2XLJ A;  3VDP A;  1SXJ B;  2YQZ A;  3GRV A;  3VK7 A;  1C7Y A;  1Q3C A;  4ZPX A;  4LZZ A;  2LVN C;  4QHS A;  2L09 A;  1SG9 A;  3KW6 A;  3SMS A;  3GLG A;  1EIJ A;  3GLF B;  3VKH A;  2DEN A;  4B3T M;  4IJE A;  7CAT A;  3UGJ A;  5KO3 A;  4LF7 M;  2UU9 M;  1G8P A;  4NXN M;  4GRI A;  2K6B A;  3KXE C;  3U6O A;  1CUK A;  4JI7 M;  4IBC A;  2EO2 A;  1K82 A;  4OX9 M;  3U6S A;  1IM2 A;  1WIV A;  5BPV A;  4NSO B;  2BNK A;  1HQC A;  3TWL A;  2CHV A;  5ITY A;  4DR1 M;  1NV9 A;  1VEG A;  1J5E M;  4JI0 M;  4REZ A;  4JI5 M;  4IBB A;  3VKG A;  2VII A;  4KO8 A;  1E94 E;  3GLI B;  1N34 M;  2FFJ A;  1E9S A;  2LHC A;  2QNJ A;  4JXJ A;  3L29 A;  1V92 A;  2JY5 A;  2L7H A;  3B7N A;  4FWG A;  5LMU M;  3BBZ A;  2ZAM A;  2I7N A;  2MR9 A;  3KS4 A;  4II7 A;  2Y20 A;  1OFI A;  4XGI A;  2N35 A;  4DV6 M;  1V33 A;  3IHP A;  2JP7 A;  3A98 B;  4PCZ A;  2V6Z M;  4X65 M;  1N77 A;  2XZU A;  2R18 A;  2L2D A;  1FJG M;  3FTD A;  3KS8 A;  2XFS A;  2FH0 A;  3KSX A;  2F5S A;  2MRO B;  3GLH E;  4GHA A;  2H5X A;  2Y0T A;  2KHH A;  2I7P A;  3H4J A;  5BR8 M;  1GLN A;  4MGZ E;  1T3T A;  4R3D A;  1NNJ A;  1IBM M;  3KOW E;  2F5Q A;  2LWX A;  1IN7 A;  4CIS A;  2KDL A;  2L7I A;  2KZS A;  3OTO M;  4JI6 M;  2M60 A;  3I4V A;  2O25 A;  1XNR M;  1YSY A;  3AV0 A;  1I4W A;  1N75 A;  4QHT A;  1D0L A;  1PJJ A;  3SMP A;  2X8A A;  3U60 A;  1OAO C;  2HAK A;  4M9X A;  4JI1 M;  4R71 A;  1NY6 A;  3B89 A;  2G3Q A;  1Q02 A;  2CP8 A;  1LTM A;  3U6D A;  2LTU A;  1MJG M;  2GQF A;  4M9Z A;  1ZMV A;  4B08 A;  3PNY A;  2DNA A;  3QAU A;  3UJN A;  1Z5B A;  3HJS A;  2OOA A;  4G6Z A;  1XWI A;  5ITU A;  2R4E A;  3KSJ A;  1IXZ A;  3L27 A;  2R44 A;  2OQ4 A;  3PFI A;  1XXH B;  1XB2 B;  4X64 M;  5ITX E;  1AUA A;  2KNA A;  2JY6 B;  4QNR A;  1BVS A;  3HJQ A;  2JZ0 A;  3GLH A;  4Z8X A;  3GQ4 A;  1WXQ A;  3ZC7 B;  4BBA A;  3TPZ A;  4B3M M;  1V34 A;  2BJW A;  2KRK A;  3B9P A;  2K0B X;  1PJI A;  1IY2 A;  1T6O A;  3J27 B;  1VEK A;  1VG5 A;  1W5T A;  3B7Q A;  1D0K A;  3CTW B;  4QNM A;  1YUB A;  4JI3 M;  3SYK A;  1E9R A;  3UZU A;  2Z8Y M;  3U6C A;  1QUT A;  1GJS A;  1K3W A;  3HY5 A;  1E32 A;  3LVW A;  1HR0 M;  2Y0Q A;  2QSF X;  1GKI A;  2OO9 A;  4L15 A;  4CIZ A;  3SAS A;  4NXM M;  1QZM A;  1DGH B;  1GJT A;  4CHT B;  3FYD A;  3UMM A;  5GKN A;  4LG2 A;  1N33 M;  3GLG B;  4LF6 M;  3U6Q A;  4AQY M;  3FUW A;  2CUZ A;  2KZU A;  4HEO A;  4L6V 6;  1S3S A;  3T1Y M;  4FWD A;  3AL0 C;  2HL7 A;  4GH9 A;  1OJL A;  2RKO A;  1ZV1 A;  2CE7 A;  3HHW A;  4LF9 M;  1XNQ M;  4NL4 H;  2XSZ D;  1WGL A;  2XH9 A;  5DFL A;  3HGI A;  4GEW A;  4JN6 A;  3ZQJ A;  4B7H A;  4BLC A;  2BJV A;  5KQD A;  3E21 A;  1OKS A;  1R5L A;  1IN6 A;  4IBI A;  3AOE A;  3L26 A;  2C9C A;  4LZJ A;  1N36 M;  2K47 A;  3KVW A;  1Z5A A;  2LNH C;  3D8B A;  1PRB A;  4M0W A;  2O01 F;  2CEA A;  3KP1 E;  1XC8 A;  3AOG A;  3PNV A;  4DR6 M;  2EKK A;  3I01 M;  1VDL A;  1NVM A;  1HNW M;  2C98 A;  4I5S A;  3FRH A;  2CV0 A;  3FD9 A;  2VQF M;  2GNO A;  4P17 A;  5EP4 A;  3M7G A;  1GVN A;  3LVV A;  2VF8 A;  4MM3 B;  3ILK A;  4OW0 A;  3U5Z B;  2JUJ A;  1IBL M;  3T15 A;  3L25 A;  2QHO B;  1G4A E;  3SAV A;  1HJP A;  4FCT A;  2Z3X A;  2CV2 A;  2XSZ A;  2Z7J A;  3AFH A;  3K8Z A;  2WSE F;  1KFV A;  1G71 A;  3VDU A;  1FNN A;  2JY7 A;  3BXW A;  3K9P A;  2CRU A;  3L28 A;  2KA6 B;  3NBI A;  3RE8 A;  4DV7 M;  1LV7 A;  1C1K A;  3SBJ A;  4QOZ C;  1UFZ A;  2EKF A;  3J2P B;  1SXJ D;  1UM8 A;  4LF5 M;  1IQP A;  2MH8 A;  4JI2 M;  1X37 A;  2UXD M;  4A3V B;  3F92 A;  3HJ8 A;  3MJ5 A;  1OFH A;  4I81 A;  2DHR A;  3GPP A;  1NV8 A;  4BB9 A;  4RKU F;  4LJ6 A;  1Y8G A;  1IXS A;  1Z6T A;  1QAQ A;  4P16 A;  2A5Y B;  1L2C A;  1F4I A;  1QUS A;  4NC6 A;  2LVO C;  1PGY A;  4AZF A;  1H6U A;  2Q2E B;  4Q7J A;  5FTL A;  4MB7 A;  2XFT A;  3T38 A;  4AI6 A;  1Z59 A;  3GO8 A;  3U61 B;  3R8F A;  4B7G A;  5FTK A;  5IWA M;  1HNX M;  1VDD A;  2DKL A;  3SFZ A;  3JAM S;  3GLI E;  2UXB M;  2R4J A;  2LBC A;  2F4V M;  1G41 A;  4LFB M;  5C18 A;  2QBY A;  2DZL A;  3RGS A;  1A5T A;  1SXJ A;  3CF2 A;  1NHW C;  3GPX A;  3KFU G;  4B3R M;  2QZ4 A;  2ZBK B;  4IBD A;  2LVQ D;  2F5O A;  1PJT A;  1IFY A;  2ZM6 M;  4K0K M;  4L8R C;  2C99 A;  2J5Y A;  4AG6 A;  3R9X B;  5EXT A;  1J7K A;  3DOA A;  4AKI A;  3GLF A;  1PJS A;  1L8Q A;  2KNZ A;  1GL6 A;  3GLH B;  3Q8X A;  4IBJ A;  4MGY E;  1NSF A;  2R0I A;  1QYR A;  1MN3 A;  3FKE A;  3J81 S;  2HCB A;  3HHX A;  4DV3 M;  4GC5 A;  4DV1 M;  3FUX A;  3FRI A;  3A46 A;  1TH2 A;  1OTR A;  1AIP C;  2L4E A;  4YY3 M;  1DV0 A;  1L1T A;  1EE8 A;  1I94 M;  1QDR A;  5EJC A;  2EJS A;  2JA2 A;  5KPR A;  3TWK A;  3GQ3 A;  3SC3 A;  1JR3 D;  1HNZ M;  4IBF A;  2K9D A;  4QOS A;  2DXI A;  3DZD A;  3Q8G A;  4LCB A;  2WSF F;  4DR2 M;  3AJI B;  4PD2 A;  2JNH A;  2VQE M;  2DAK A;  3GLI A;  3C9P A;  3FTC A;  2L6O A;  1OIP A;  2R65 A;  2ZTD A;  4LJ5 A;  2VDB B;  3QWL A;  1L2B A;  4Y28 F;  3DA1 A;  1QAO A;  3FUT A;  3AKZ A;  1MX0 A;  2R6F A;  3GRY A;  3LCU A;  1TR8 A;  1JQJ C;  1DO0 A;  1MU5 A;  5ITQ A;  4JYA M;  1IN5 A;  3IG8 A;  5JI2 E;  2ZAN A;  3C3E A;  4NSR A;  5KPZ A;  3NBX X;  5A2Q S;  2G5G X;  1JR3 A;  3K2L A;  4YHH M;  4L4U A;  1ZQ9 A;  4TUW A;  5FTM A;  1DGB A;  4MH0 E;  4G4N A;  3RFW A;  3HHY A;  2QEN A;  1N78 A;  1IN8 A;  2C5R A;  4XK8 F;  3GP1 A;  2XGN A;  1NHG C;  3E4R A;  4WUR A;  1GL7 A;  3V76 A;  4G4O A;  1KYI A;  4HL4 A;  3DFZ A;  3E46 A;  4AKH A;  1TGU A;  1GO5 A;  3SAW A;  3CF6 E;  1XMQ M;  2FS1 A;  1N32 M;  4G3O A;  4I8O A;  2KNV A;  4I4L A;  1WHC A;  4IBG A;  4KHP M;  5IRE B;  2DAG A;  4CGY B;  2KRU A;  2UXC M;  1TH4 A;  2JWS A;  2J7N A;  4LRT A;  1TDZ A;  2WSC F;  4ANR A;  4CJ6 A;  3GRR A;  3HU1 A;  3JR5 A;  3U6L A;  4PDI A;  2DWL A;  4LY6 A;  2QPA A;  3GPY A;  2UUB M;  1TF0 B;  1T43 A;  2JY8 A;  4DBG B;  2QCU A;  1ZMU A;  3FYC A;  4GKJ M;  1XHB A;  4IIW A;  5KQ8 A;  3CF0 A;  5EP1 A;  4MGH A;  2YNM D;  4JI8 M;  2H1R A;  1NJF A;  2CHQ A;  2ZAO A;  3ZCB B;  5C1B A;  2DHY A;  4X66 M;  3KOY E;  3KOZ E;  3THG A;  1WR1 B;  1XXH A;  1XMO M;  2D7G A;  1VEJ A;  2CWB A;  1HT2 E;  3A42 A;  4LGY A;  4OVZ A;  4W5W A;  1RU3 A;  2DVW B;  3I04 M;  1K3X A;  2ZTC A;  2FOI C;  3AOE C;  2RGH A;  3KOX E;  4GC9 A;  4DUY M;  3K92 A;  1SXJ E;  3W67 A;  4FCW A;  3TQS A;  2UUC M;  3MK6 A;  2QBY B;  1WJ7 A;  5DYG A;  5FTN A;  4F2L A;  1Z5C A;  4S12 A;  4OU7 A;  4DV4 M;  3GLF E;  2Z4R A;  4Z6Y A;  3W0F A;  2BWE A;  1DGH A;  3B74 A;  3GRU A;  4D80 A;  3GQ5 A;  1HT1 E;  3LMM A;  2LVP C;  5ITT A;  3W68 A;  4LJ9 A;  2G8L A;  4PT5 A;  2V1C A;  2CV1 A;  4LJ8 A;  2O5R A;  5F3W A;  2DWN A;  3A45 A;  2MJ5 B;  3I4Y A;  4WW0 A;  3PVS A;  2OPF A;  5E6J A;  4GKK M;  1D0M A;  3SAR A;  2JXN A;  2APL A;  4L78 A;  3U60 B;  1ZMW A;  2C9O A;  2EUC A;  2LXE A;  5EXP A;  4NRW A;  1IY1 A;  2L4F A;  3QYE A;  2B3T A;  3LW5 F;  3W0L B;  1DO2 A;  2HHH M;  1R7R A;  2OOB A;  4FW9 A;  3JR4 A;  1TTE A;  3C58 A;  2NQ8 C;  1R2Y A;  3C3D A;  4JI4 M;  1QDT A;  1DGF A;  1L1Z A;  2UUA M;  2M5Z A;  4AKG A;  4NOO B;  5JI3 E;  1IXR C;  4KLN A;  3VLF B;  4ITQ A;  2CHG A;  4LFA M;  1R4G A;  2Y21 A;  1YE9 A;  2JZ1 A;  3M0E A;  4DR5 M;  1Q3B A;  3M6A A;  3HU2 A;  3SHG B;  5DNY A;  4G4R A;  3TWM A;  2DZO B;  1NNU C;  3CGW A;  4FWH A;  3T1H M;  3LQQ A;  3FTF A;  1NJG A;  3U5Z A;  3HKP A;  4LJA A;  3H4M A;  3HHZ A;  1JR3 E;  1QVR A;  2W82 A;  3EIE A;  2QP9 X;  5E26 A;  1IY0 A;  1OAI A;  5IZ7 D;  4G4Q A;  2HKJ A;  2LH0 A;  1SXJ C;  1ORY B;  2DI0 A;  3L2A A;  2RGO A;  3U6E A;  4M0D A;  1OIZ A;  2CFO A;  4WP2 A;  4LRS A;  1DGG A;  2DZN B;  5EXX A;  3MMP A;  5L8R F;  2EA0 A;  3WHL A;  2DAE A;  5ITR A;  1EFU B;  4R7G A;  2YFQ A;  3FUU A;  2R62 A;  4EIW A;  3I51 A;  2DAM A;  4UN2 B;  4B3S M;  3BOS A;  1ZAE A;  4AG5 A;  3GPU A;  2XZF A;  4PDG A;  5LMN M;  2HWJ A;  4DV2 M;  1W5S A;  4DV5 M;  2YR0 A;  4RF0 A;  1VQ1 A;  2Z4S A;  2R45 A;  3SHF A;  4DR3 M;  3D8L A;  4FVM A;  3EIH A;  4GMQ A;  4XBO A;  3B7Z A;  3LCV B;  4GIT A;  5EP2 A;  1Q39 A;  4D81 A;  2DWZ B;  1TH3 A;  3U6M A;  1PJQ A;  4B7F A;  4M9S A;  3U61 A;  4LFC M;  1R2Z A;  4LF4 M;  4D82 A;  2ERC A;  1J09 A;  4RF1 A;  1OQY A;  5H37 D;  1PM5 A;  5FSW A;  2F5N A;  4F1I A;  4HLQ A;  3PXG A;  4IBE A;  4KT0 F;  3K1J A;  2DWM A;  1XXH E;  2VF7 A;  2X4A A;  4DUZ M;  3SAT A;  2LHG A;  4RNA A;  1R6B X;  4DR7 M;  4GIP A;  2RRU A;  3NWL A;  3HX3 A;  5EXS A;  1QAN A;  4LGM A;  3T6P A;  3VK8 A;  1JB0 F;  2BWB A;  4MGK E;  1G59 A;  4IJF A;  3FE3 A;  2MGW A;  3SYL A;  3TL4 X;  1IBK M;  3FTE A;  4AW4 A;  3E9S A;  5KPT A;  4L16 A;  4OVZ B;  2XF3 A;  4NRV A;  3ZH9 B;  4IBK A;  3J7A S;  1NO1 A;  4X62 M;  3HU3 A;  2F5P A;  4DR4 M;  3SAU A;  4MGI E;  2DAI A;  2FE8 A;  5FTJ A;  5EP3 A;  2X49 A;  2WZJ A;  5FLX S;  1D2N A;  3J7B A;  4LJ4 A;  3IEC A;  1P3Q Q;  1HQY E;  2KW0 A;  3RGP A;  4GHL A;  1QZE A;  1GAB A;  3GLG E;  2QQ8 A;  3MHV C;  5IT9 S;  1TDH A;  1YLA A;  1L2D A;  1QQW A;  5DYI A;  4JV5 M;  1QAM A;  3FUV A;  2E5L M;  2AHM A;  3HZJ A;  3QYB A;  2D7H A;  4FD2 A;  1IN4 A;  4KOD A;  1IXS B;  2XEP A;  3KP0 E;  3J80 S;  3K9O A;  1WGN A;  2R46 A;  2KXE A;  3IG5 A;  2LVA A;  1KSF X;  4LF8 M;  4LJ7 A;  3UK6 A;  5EQT A;  4FCV A;  8CAT A;  2D7E A;  3KDS E;  3VFD A;  1G3I A;  2V1U A;  3HWS A;  3U6P A;  5ITX A;  2J7O A;  2KEB A;  3TE6 A;  1NY5 A;  3LQR A;  2P5T A;  3WHK A; 
#chains in the Genus database with same CATH homology
 1DO2 A;  2K9D A;  2OOB A;  1TTE A;  2QSF X;  2OO9 A;  1C7Y A;  2JNH A;  2DAK A;  2LVN C;  1R4G A;  1SG9 A;  2JZ1 A;  4HEO A;  2DEN A;  2ZTD A;  1ZV1 A;  3LCU A;  1TR8 A;  1WGL A;  1JR3 E;  1DO0 A;  5DFL A;  1CUK A;  4GEW A;  1OAI A;  3E21 A;  1OKS A;  5JI2 E;  2DI0 A;  1IM2 A;  1WIV A;  4WP2 A;  3MMP A;  2EKK A;  1NV9 A;  1VDL A;  1VEG A;  1EFU B;  2DAE A;  3FRH A;  1E94 E;  2DAM A;  4UN2 B;  2QNJ A;  1KYI A;  2HWJ A;  3E46 A;  1VQ1 A;  1GO5 A;  1V92 A;  2JY5 A;  2JUJ A;  3BBZ A;  2QHO B;  1G4A E;  1HJP A;  2MR9 A;  4G3O A;  2KNV A;  3LCV B;  1WHC A;  2DAG A;  3IHP A;  2JP7 A;  2JY7 A;  3K9P A;  2L2D A;  1OQY A;  1UFZ A;  2EKF A;  4F1I A;  1T43 A;  2JY8 A;  1XXH E;  4DBG B;  1ZMU A;  2MRO B;  3F92 A;  3GLH E;  2H5X A;  2RRU A;  2KHH A;  1NV8 A;  3H4J A;  3T6P A;  1Y8G A;  2BWB A;  1IXS A;  3FE3 A;  2DHY A;  2MGW A;  1WR1 B;  1F4I A;  1VEJ A;  2LVO C;  2CWB A;  1HT2 E;  2O25 A;  1PGY A;  2ZTC A;  4Q7J A;  2DAI A;  2HAK A;  2WZJ A;  4R71 A;  3B89 A;  2G3Q A;  3IEC A;  1P3Q Q;  2CP8 A;  1Q02 A;  1HQY E;  2DKL A;  2LTU A;  1QZE A;  3GLI E;  1WJ7 A;  1ZMV A;  3GLG E;  2DNA A;  2LBC A;  1YLA A;  1G41 A;  4F2L A;  2DZL A;  2OOA A;  1A5T A;  3GLF E;  2BWE A;  2LVQ D;  1IFY A;  1HT1 E;  2LVP C;  1XB2 B;  3K9O A;  1WGN A;  2KNA A;  2KNZ A;  2JY6 B;  2MJ5 B;  2LVA A;  1BVS A;  2R0I A;  2JZ0 A;  1MN3 A;  1ZMW A;  1G3I A;  3FRI A;  1OTR A;  1AIP C;  2K0B X;  2L4E A;  1DV0 A;  1T6O A;  1VEK A;  1VG5 A;  2EJS A;  2L4F A;  2B3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...