2L2DA

Solution nmr structure of human uba-like domain of otud7a_11_83, nesg target ht6304a/ocsp target otud7a_11_83/sgc-toronto
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
SAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The amino-terminal UBA domain of OTUD7A
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords OTU domain-containing protein 7A
total genus 17
structure length 73
sequence length 73
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l2dA00
3GLGE 2RRUA 4F1IA 4G3OA 1ZMVA 5DFLA 2DAGA 2DAIA 1WR1B 1BVSA 2LVQD 2MJ5B 2ZTDA 1XXHE 3MMPA 2KNAA 3K9OA 2LVNC 1KYIA 2JY5A 1MN3A 2DAEA 2DI0A 1DV0A 2R0IA 1WGNA 1VEGA 2JZ0A 2JNHA 3GLIE 1DO0A 2OOAA 2KNZA 1ZMUA 2WZJA 5JI2E 4WP2A 3K9PA 2MROB 1TTEA 2MGWA 1HJPA 2EKFA 2OO9A 4UN2B 2DHYA 1Q02A 4HEOA 1DO2A 1VG5A 2K9DA 2EKKA 1VDLA 4DBGB 2BWBA 1HT1E 1A5TA 1HQYE 4F2LA 3E46A 1ZV1A 4GEWA 2CWBA 3BBZA 1SG9A 2LVOC 1PGYA 2HAKA 2JUJA 2JZ1A 2ZTCA 1HT2E 2JY6B 2L2DA 3IECA 1WIVA 2JY8A 3IHPA 3LCVB 1IFYA 2HWJA 2QSFX 3T6PA 2EJSA 2KNVA 2QNJA 2LVPC 2H5XA 3B89A 1Y8GA 1TR8A 1ZMWA 2L4FA 2LTUA 3H4JA 2DKLA 1VQ1A 1R4GA 1T43A 1OKSA 2JP7A 1IM2A 1NV9A 2O25A 3GLFE 1XB2B 1CUKA 3FE3A 1IXSA 2JY7A 2G3QA 1OQYA 1C7YA 2BWEA 3F92A 3FRHA 2LBCA 1T6OA 1QZEA 2DAMA 1JR3E 1OAIA 1VEKA 3GLHE 1G41A 1AIPC 1G3IA 2CP8A 2K0BX 2DZLA 2DNAA 1E94E 2B3TA 2QHOB 2OOBA 1NV8A 2KHHA 2MR9A 2DENA 1F4IA 1EFUB 1V92A 1G4AE 1GO5A 1UFZA 2L4EA 3FRIA 4R71A 3E21A 1P3QQ 2LVAA 1WJ7A 1VEJA 1OTRA 1WHCA 2DAKA 4Q7JA 1WGLA 3LCUA 1YLAA
chains in the Genus database with same CATH superfamily
5DYIA 1PJQA 2YR0A 1ZMVA 1Z6TA 1KFVA 5DFLA 3GLGB 3SMSA 4B3TM 4REZA 3HJQA 3B7ZA 2QBYA 2DAIA 2MJ5B 4B3SM 5DNYA 2KNAA 4IBCA 2LVNC 1Q3BA 2KRKA 4IBFA 3TWKA 3C3DA 4GC5A 4NRWA 1SXJE 3HJ8A 3SYLA 2DAEA 3VK8A 1R6BX 2XH9A 3KP1E 1DGHB 2R0IA 3PVSA 4PT5A 5LMNM 1VEGA 3U60B 2UUBM 1MU5A 4MGZE 3VKGA 2DWNA 2JWSA 4LJ7A 1OAOC 4DUZM 2HHHM 4IBJA 4IBIA 2Z8YM 3HHXA 3WHLA 2F4VM 1ZMUA 3KFUG 4IIWA 4NXMM 4DV3M 1ZQ9A 4L4UA 4RKUF 4WP2A 3SYKA 2RGHA 1GVNA 1IN5A 3C58A 2YQZA 4G4RA 1TTEA 1IN4A 3TWMA 1E9RA 2R65A 3UZUA 4KHPM 2OO9A 1EIJA 2QCUA 4CGYB 2VQFM 2H1RA 3FYDA 2R46A 1NY6A 1NNUC 1Q02A 1QZMA 3AOEC 4GMQA 5ITTA 2J5YA 1NO1A 1DO2A 3AV0A 4LJ5A 1E32A 2FNAA 3FTCA 4RF1A 1HNZM 4JI3M 4BBAA 1E9SA 1HT1E 4QNMA 3J7BA 4F2LA 4JN6A 5DYGA 2UXCM 1ORYB 4QNRA 2CWBA 4X64M 5F3WA 1SG9A 3KW6A 4I8OA 5EJCA 4CHTB 3J80S 1PGYA 2XZFA 3SATA 1OFHA 3SHGB 4GC9A 4QHSA 1YE9A 2L2DA 2QP9X 3U61B 2X49A 3IHPA 2ZANA 3GQ5A 4B7FA 1I94M 4NRVA 2HWJA 4B08A 3T6PA 3AOGA 3FTDA 2LHCA 3M6AA 3U6SA 2QNJA 4DR5M 3TWLA 3NBXX 3K1JA 3GLFB 1DGHA 3U6PA 1K3XA 2CEAA 3ZQJA 4G4OA 1ZMWA 2L4FA 1H6UA 2XEPA 2V6ZM 2DKLA 1FJGM 3KDSE 4RF0A 1T43A 1OKSA 1SXJB 1PJIA 4MGHA 2Y0TA 4JI2M 1Z5AA 2FS1A 3ZH9B 1GKIA 4GRIA 1G71A 4FWHA 2JY7A 2CV2A 4RNAA 2Z4RA 4B3RM 2BWEA 1IBMM 5IWAM 4NC6A 4DV7M 1EE8A 3F92A 2LBCA 3FRHA 4FWDA 1PJSA 1PRBA 5E6JA 4JI8M 5GKNA 3HU3A 3GLGA 1G41A 4L78A 4YHHM 2DNAA 4W5WA 2B3TA 4LJ8A 5ITXE 2CFOA 2MR9A 4DV0M 2DENA 4OX9M 1IQPA 4P17A 4WW0A 1G4AE 4M0WA 4FCWA 2UUCM 4LY6A 1ZAEA 2DVWB 4ITQA 3L29A 3D8BA 2DXIA 4LG2A 4L6V6 3J81S 3KP0E 4AQYM 2VF8A 3C9PA 3BOSA 3TPZA 2O5RA 4M9SA 1P3QQ 2HCBA 1OIZA 4B7GA 3T15A 3CF0A 4Q7JA 1WGLA 3CF2A 3U61A 2G5GX 2KDLA 4IBDA 5EXTA 3ZC7B 1N36M 4PCZA 3JAMS 4G3OA 4LZJA 2L09A 1SXJD 2DAGA 4JYAM 3JR4A 3GPUA 4JI0M 1BVSA 2LVQD 1N33M 4BB9A 4B7HA 3HGIA 3K9OA 1Z59A 3LW5F 1PJTA 3DFZA 5FSWA 2JY5A 3DOAA 3PXGA 1D2NA 3UJNA 4D81A 4OVZB 1MN3A 4R3DA 2JZ0A 3U6EA 2OOAA 2Z3XA 3SASA 3HKPA 4M9ZA 4MGIE 1HQCA 5JI2E 2DWMA 3AOEA 2J7NA 4BLCA 4AKGA 3U6QA 1NSFA 1TH3A 2R44A 1UM8A 3U6MA 4I4LA 4MB7A 1Z5CA 4DV5M 2RKOA 4ZPXA 2DZNB 4LF9M 4JI7M 1MJGM 4A3VB 2DHYA 1IY2A 2ZM6M 1SXJC 4HEOA 3GRVA 2F5QA 1VG5A 3GLFA 2EKKA 5EXSA 3I4YA 4QHTA 3KS4A 2XSZA 2BWBA 1D0MA 2XF3A 4FCTA 1A5TA 2FFJA 1XMOM 1Q3CA 2BJWA 3FUTA 1R2YA 3GRYA 4EIWA 2CHGA 3JR5A 3BBZA 1V34A 2W82A 3LQRA 1J7KA 4KODA 5E26A 1N75A 3FTEA 2KZUA 2ZTCA 1HT2E 3KOXE 3Q8XA 3ZCBB 1LTMA 2JY6B 4DR3M 2JY8A 2C99A 1GL7A 2P5TA 3QAUA 1G8PA 2QSFX 5IREB 2CV0A 4B3MM 2EJSA 2CRUA 2M5ZA 4OVZA 3CGWA 1Y8GA 1TR8A 4GKJM 4AZFA 1OJLA 2OPFA 1HNWM 3THGA 2Z4SA 3LVWA 3MJ5A 4LRSA 1IM2A 1GABA 3GLFE 1NHWC 1XB2B 1XHBA 1CUKA 3B7NA 1TF0B 3FE3A 1IXSA 1SXJA 1KSFX 1D0KA 1MX0A 1Q39A 2V1CA 5ITRA 2VQEM 4KLNA 1TH4A 3AJIB 3C3EA 4DR1M 1XXHB 7CATA 3EIEA 4JXJA 1JR3E 1OAIA 2QBYB 3KVWA 2X8AA 1L1ZA 5EXPA 3GLHB 2L7HA 3GPXA 3ILKA 1XNRM 2WSEF 1QAQA 3U5ZB 3TQSA 1L2BA 5L8RF 1XC8A 4GKKM 1V33A 1E94E 2ZAOA 1QDRA 2QHOB 2OOBA 2KHHA 2ZAMA 3L27A 2F5OA 2JA2A 4DR4M 2C5RA 1TH2A 4GHLA 2FH0A 1L8QA 3VFDA 3IG5A 3UMMA 1GO5A 1DGBA 4OU7A 1N34M 2F5NA 2C9CA 2L4EA 4I5SA 4KT0F 3W67A 2UUAM 2R4JA 2XFTA 1S3SA 4LJ4A 2F5SA 3AL0C 3TL4X 5KQ8A 3FUXA 3QWLA 1QANA 1NY5A 4IBBA 4MM3B 3PNYA 2D7EA 1VEJA 2ERCA 2C96A 2DAKA 3J27B 3R9XB 5KPRA 1PM5A 3LCUA 2CV1A 2F5PA 3HY5A 5EXXA 2CHVA 2KEBA 4FVMA 8CATA 4AW4A 3A45A 3HZJA 3W0FA 4MH0E 3K2LA 2UU9M 2ZTDA 1XXHE 4GHAA 5A2QS 3PFIA 3MMPA 2JXNA 1KYIA 1N77A 4PDGA 2DI0A 3LQQA 4NXNM 2UXDM 2D7GA 4LJAA 1WGNA 3HWSA 2JNHA 3W68A 1OFIA 4IBKA 5H37D 2KXEA 2R6FA 1L2CA 2AHMA 4LFBM 5FTLA 3MK6A 3DA1A 2KNZA 4FW9A 1QUTA 3K9PA 4Y28F 4IBEA 1K82A 3QYEA 3CTWB 3KSJA 3TE6A 2MGWA 4LF4M 3OTOM 4UN2B 4X66M 3VDUA 2Y20A 4JI5M 2APLA 5KPTA 2YNMD 3EIHA 4FD2A 2K9DA 5BPVA 3GLIA 4Z6YA 2DWLA 1IBKM 3SBJA 2FE8A 1G59A 2R45A 1HQYE 2Y21A 1N78A 3IG8A 5FTNA 2QENA 3T38A 1TDZA 3M0EA 4YY3M 3A46A 1K3WA 2D7HA 2EO2A 2LVOC 2XGNA 1IN8A 2JUJA 4AG6A 2YFQA 3Q8GA 4X65M 1WIVA 4LJ9A 4K0KM 1NJFA 2HKJA 2I7PA 4L8RC 3NWLA 3GLHA 5FLXS 2KNVA 2DWZB 2X4AA 5ITQA 3GRRA 2QZ4A 4II7A 3U6LA 4XBOA 2LTUA 4XGIA 3H4JA 4DR6M 3HHYA 5FTMA 2QQ8A 1LV7A 3V76A 1I4WA 2EA0A 1IXZA 2UXBM 3GPPA 2KRUA 2G3QA 2A5YB 3FD9A 1OQYA 3FKEA 5EQTA 3FYCA 4PDIA 3I51A 1XMQM 1L1TA 1IXSB 4LCBA 1T6OA 4ANRA 3UGJA 3VKHA 3SAUA 4LF5M 3HU2A 1NJGA 1R5LA 2DAMA 3GLHE 4IBGA 4DR7M 4LF6M 5EP2A 3UK6A 3RE8A 2DZLA 5EP4A 4GH9A 1NV8A 4HLQA 4LFCM 1J5EM 2R18A 1W5SA 3U5ZA 1V92A 3KOZE 3U6DA 3SARA 1UFZA 4DV6M 3FRIA 3I4VA 4L15A 1L2DA 3KS8A 1NHGC 3GP1A 3I04M 1J09A 2LWXA 3SMPA 2M60A 2XFSA 2L6OA 1DGGA 1PJJA 3E21A 1IBLM 4OW0A 4QOZC 3T1HM 3M7GA 1IY0A 3GO8A 1WJ7A 1VDDA 1WHCA 3HHZA 1JR3A 2V1UA 5C18A 5EP1A 1X37A 1YLAA 3GLGE 2E5LM 2RRUA 4F1IA 3K8ZA 1WXQA 1T3TA 4X62M 2CHQA 3SFZA 3K92A 5KO3A 2KZSA 3R8FA 3D8LA 1DGFA 1WR1B 3KOWE 3LMMA 3KXEC 2RGOA 1QUSA 3VDPA 1HNXM 4WURA 4DV4M 3U60A 1XWIA 2L7IA 2Z7JA 3H4MA 4NSRA 1QDTA 2C98A 3FUWA 3FUVA 4HL4A 5FTJA 1OIPA 1GLNA 4AKIA 4XK8F 2LXEA 1RU3A 2FOIC 1GL6A 3GLIB 5ITUA 1DV0A 1YUBA 4D82A 1QAMA 4D80A 2HL7A 3GQ4A 5BR8M 3I01M 1W5TA 2BNKA 3AKZA 1JB0F 4IJEA 1DO0A 3GLIE 4CISA 1AUAA 4LGMA 1FNNA 4GIPA 3B9PA 2R62A 4MGYE 2WZJA 1HR0M 4LGYA 4KO8A 3LVVA 2LHGA 2K47A 4FCVA 3FUUA 3SC3A 4M9XA 2MROB 4FWGA 2LH0A 1NNJA 2OQ4A 3L25A 5IT9S 3GQ3A 2G8LA 1HJPA 1Z5BA 2EKFA 3AFHA 3HU1A 4MGKE 3L28A 2KW0A 4NOOB 4PD2A 5KQDA 1QVRA 4R7GA 3VK7A 2LNHC 3L2AA 1N32M 1D0LA 2XSZD 3FTFA 3A42A 3J2PB 2GQFA 3RGPA 4G6ZA 4G4QA 1R2ZA 4DBGB 1VDLA 1JQJC 1TDHA 2GNOA 4DUYM 3J7AS 2QPAA 2VIIA 4GITA 4S12A 3B74A 3GPYA 2CUZA 4CIZA 3A98B 5JI3E 3L26A 4AI6A 3E46A 2CE7A 2K6BA 4M0DA 5EP3A 3SAVA 1ZV1A 4GEWA 3GRUA 1IXRC 4QOSA 3QYBA 1XXHA 2XZUA 4AKHA 2HAKA 2WSCF 2VF7A 3KSXA 2JZ1A 5ITYA 2C9OA 3E4RA 3IECA 2WSFF 3W0LB 3LCVB 1IFYA 3U6CA 4I81A 2LVPC 2H5XA 3B89A 4NSOB 1QAOA 5FTKA 4P16A 3E9SA 3BXWA 4DV2M 4LF8M 1QYRA 4LZZA 2ZBKB 3U6OA 1R7RA 1C1KA 4L16A 3B7QA 2Y0QA 3PNVA 5KPZA 1VQ1A 1R4GA 3T1YM 1IN7A 2JP7A 3MHVC 1NV9A 2O25A 2I7NA 3VLFB 1NVMA 2XLJA 2DZOB 3NBIA 3SHFA 4DV1M 1GJSA 3KOYE 1C7YA 4LF7M 5LMUM 4G4NA 1JR3D 4LJ6A 5ITXA 4JV5M 3WHKA 1IY1A 3SAWA 1QZEA 2EUCA 1YSYA 1VEKA 4Z8XA 4IJFA 5IZ7D 2O01F 4JI6M 1AIPC 1G3IA 2CP8A 2J7OA 4LRTA 3RFWA 3RGSA 2K0BX 2DHRA 2BJVA 4TUWA 3HX3A 3HJSA 2NQ8C 1F4IA 4CJ6A 1XNQM 1EFUB 2R4EA 4NL4H 2MH8A 2KA6B 3HHWA 4LFAM 4AG5A 2N35A 4R71A 1QQWA 3DZDA 1GJTA 4DR2M 4JI4M 2Q2EB 3CF6E 5C1BA 2LVAA 4JI1M 1OTRA 2VDBB 1IN6A 1TGUA
chains in the Genus database with same CATH topology
3GLGE 2RRUA 4F1IA 4G3OA 1ZMVA 5DFLA 2DAGA 2DAIA 1WR1B 1BVSA 2LVQD 2MJ5B 2ZTDA 1XXHE 3MMPA 2KNAA 3K9OA 2LVNC 1KYIA 2JY5A 1MN3A 2DAEA 2DI0A 1DV0A 2R0IA 1WGNA 1VEGA 2JZ0A 2JNHA 3GLIE 1DO0A 2OOAA 2KNZA 1ZMUA 2WZJA 5JI2E 4WP2A 3K9PA 2MROB 1TTEA 2MGWA 1HJPA 2EKFA 2OO9A 4UN2B 2DHYA 1Q02A 4HEOA 1DO2A 1VG5A 2K9DA 2EKKA 1VDLA 4DBGB 2BWBA 1HT1E 1A5TA 1HQYE 4F2LA 3E46A 1ZV1A 4GEWA 2CWBA 3BBZA 1SG9A 2LVOC 1PGYA 2HAKA 2JUJA 2JZ1A 2ZTCA 1HT2E 2JY6B 2L2DA 3IECA 1WIVA 2JY8A 3IHPA 3LCVB 1IFYA 2HWJA 2QSFX 3T6PA 2EJSA 2KNVA 2QNJA 2LVPC 2H5XA 3B89A 1Y8GA 1TR8A 1ZMWA 2L4FA 2LTUA 3H4JA 2DKLA 1VQ1A 1R4GA 1T43A 1OKSA 2JP7A 1IM2A 1NV9A 2O25A 3GLFE 1XB2B 1CUKA 3FE3A 1IXSA 2JY7A 2G3QA 1OQYA 1C7YA 2BWEA 3F92A 3FRHA 2LBCA 1T6OA 1QZEA 2DAMA 1JR3E 1OAIA 1VEKA 3GLHE 1G41A 1AIPC 1G3IA 2CP8A 2K0BX 2DZLA 2DNAA 1E94E 2B3TA 2QHOB 2OOBA 1NV8A 2KHHA 2MR9A 2DENA 1F4IA 1EFUB 1V92A 1G4AE 1GO5A 1UFZA 2L4EA 3FRIA 4R71A 3E21A 1P3QQ 2LVAA 1WJ7A 1VEJA 1OTRA 1WHCA 2DAKA 4Q7JA 1WGLA 3LCUA 1YLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLG E;  2RRU A;  4F1I A;  4G3O A;  1ZMV A;  5DFL A;  2DAG A;  2DAI A;  1WR1 B;  1BVS A;  2LVQ D;  2MJ5 B;  2ZTD A;  1XXH E;  3MMP A;  2KNA A;  3K9O A;  2LVN C;  1KYI A;  2JY5 A;  1MN3 A;  2DAE A;  2DI0 A;  1DV0 A;  2R0I A;  1WGN A;  1VEG A;  2JZ0 A;  2JNH A;  3GLI E;  1DO0 A;  2OOA A;  2KNZ A;  1ZMU A;  2WZJ A;  5JI2 E;  4WP2 A;  3K9P A;  2MRO B;  1TTE A;  2MGW A;  1HJP A;  2EKF A;  2OO9 A;  4UN2 B;  2DHY A;  1Q02 A;  4HEO A;  1DO2 A;  1VG5 A;  2K9D A;  2EKK A;  1VDL A;  4DBG B;  2BWB A;  1HT1 E;  1A5T A;  1HQY E;  4F2L A;  3E46 A;  1ZV1 A;  4GEW A;  2CWB A;  3BBZ A;  1SG9 A;  2LVO C;  1PGY A;  2HAK A;  2JUJ A;  2JZ1 A;  2ZTC A;  1HT2 E;  2JY6 B;  2L2D A;  3IEC A;  1WIV A;  2JY8 A;  3IHP A;  3LCV B;  1IFY A;  2HWJ A;  2QSF X;  3T6P A;  2EJS A;  2KNV A;  2QNJ A;  2LVP C;  2H5X A;  3B89 A;  1Y8G A;  1TR8 A;  1ZMW A;  2L4F A;  2LTU A;  3H4J A;  2DKL A;  1VQ1 A;  1R4G A;  1T43 A;  1OKS A;  2JP7 A;  1IM2 A;  1NV9 A;  2O25 A;  3GLF E;  1XB2 B;  1CUK A;  3FE3 A;  1IXS A;  2JY7 A;  2G3Q A;  1OQY A;  1C7Y A;  2BWE A;  3F92 A;  3FRH A;  2LBC A;  1T6O A;  1QZE A;  2DAM A;  1JR3 E;  1OAI A;  1VEK A;  3GLH E;  1G41 A;  1AIP C;  1G3I A;  2CP8 A;  2K0B X;  2DZL A;  2DNA A;  1E94 E;  2B3T A;  2QHO B;  2OOB A;  1NV8 A;  2KHH A;  2MR9 A;  2DEN A;  1F4I A;  1EFU B;  1V92 A;  1G4A E;  1GO5 A;  1UFZ A;  2L4E A;  3FRI A;  4R71 A;  3E21 A;  1P3Q Q;  2LVA A;  1WJ7 A;  1VEJ A;  1OTR A;  1WHC A;  2DAK A;  4Q7J A;  1WGL A;  3LCU A;  1YLA A; 
#chains in the Genus database with same CATH topology
 5DYI A;  1PJQ A;  2YR0 A;  1ZMV A;  1Z6T A;  1KFV A;  5DFL A;  3GLG B;  3SMS A;  4B3T M;  4REZ A;  3HJQ A;  3B7Z A;  2QBY A;  2DAI A;  2MJ5 B;  4B3S M;  5DNY A;  2KNA A;  4IBC A;  2LVN C;  1Q3B A;  2KRK A;  4IBF A;  3TWK A;  3C3D A;  4GC5 A;  4NRW A;  1SXJ E;  3HJ8 A;  3SYL A;  2DAE A;  3VK8 A;  1R6B X;  2XH9 A;  3KP1 E;  1DGH B;  2R0I A;  3PVS A;  4PT5 A;  5LMN M;  1VEG A;  3U60 B;  2UUB M;  1MU5 A;  4MGZ E;  3VKG A;  2DWN A;  2JWS A;  4LJ7 A;  1OAO C;  4DUZ M;  2HHH M;  4IBJ A;  4IBI A;  2Z8Y M;  3HHX A;  3WHL A;  2F4V M;  1ZMU A;  3KFU G;  4IIW A;  4NXM M;  4DV3 M;  1ZQ9 A;  4L4U A;  4RKU F;  4WP2 A;  3SYK A;  2RGH A;  1GVN A;  1IN5 A;  3C58 A;  2YQZ A;  4G4R A;  1TTE A;  1IN4 A;  3TWM A;  1E9R A;  2R65 A;  3UZU A;  4KHP M;  2OO9 A;  1EIJ A;  2QCU A;  4CGY B;  2VQF M;  2H1R A;  3FYD A;  2R46 A;  1NY6 A;  1NNU C;  1Q02 A;  1QZM A;  3AOE C;  4GMQ A;  5ITT A;  2J5Y A;  1NO1 A;  1DO2 A;  3AV0 A;  4LJ5 A;  1E32 A;  2FNA A;  3FTC A;  4RF1 A;  1HNZ M;  4JI3 M;  4BBA A;  1E9S A;  1HT1 E;  4QNM A;  3J7B A;  4F2L A;  4JN6 A;  5DYG A;  2UXC M;  1ORY B;  4QNR A;  2CWB A;  4X64 M;  5F3W A;  1SG9 A;  3KW6 A;  4I8O A;  5EJC A;  4CHT B;  3J80 S;  1PGY A;  2XZF A;  3SAT A;  1OFH A;  3SHG B;  4GC9 A;  4QHS A;  1YE9 A;  2L2D A;  2QP9 X;  3U61 B;  2X49 A;  3IHP A;  2ZAN A;  3GQ5 A;  4B7F A;  1I94 M;  4NRV A;  2HWJ A;  4B08 A;  3T6P A;  3AOG A;  3FTD A;  2LHC A;  3M6A A;  3U6S A;  2QNJ A;  4DR5 M;  3TWL A;  3NBX X;  3K1J A;  3GLF B;  1DGH A;  3U6P A;  1K3X A;  2CEA A;  3ZQJ A;  4G4O A;  1ZMW A;  2L4F A;  1H6U A;  2XEP A;  2V6Z M;  2DKL A;  1FJG M;  3KDS E;  4RF0 A;  1T43 A;  1OKS A;  1SXJ B;  1PJI A;  4MGH A;  2Y0T A;  4JI2 M;  1Z5A A;  2FS1 A;  3ZH9 B;  1GKI A;  4GRI A;  1G71 A;  4FWH A;  2JY7 A;  2CV2 A;  4RNA A;  2Z4R A;  4B3R M;  2BWE A;  1IBM M;  5IWA M;  4NC6 A;  4DV7 M;  1EE8 A;  3F92 A;  2LBC A;  3FRH A;  4FWD A;  1PJS A;  1PRB A;  5E6J A;  4JI8 M;  5GKN A;  3HU3 A;  3GLG A;  1G41 A;  4L78 A;  4YHH M;  2DNA A;  4W5W A;  2B3T A;  4LJ8 A;  5ITX E;  2CFO A;  2MR9 A;  4DV0 M;  2DEN A;  4OX9 M;  1IQP A;  4P17 A;  4WW0 A;  1G4A E;  4M0W A;  4FCW A;  2UUC M;  4LY6 A;  1ZAE A;  2DVW B;  4ITQ A;  3L29 A;  3D8B A;  2DXI A;  4LG2 A;  4L6V 6;  3J81 S;  3KP0 E;  4AQY M;  2VF8 A;  3C9P A;  3BOS A;  3TPZ A;  2O5R A;  4M9S A;  1P3Q Q;  2HCB A;  1OIZ A;  4B7G A;  3T15 A;  3CF0 A;  4Q7J A;  1WGL A;  3CF2 A;  3U61 A;  2G5G X;  2KDL A;  4IBD A;  5EXT A;  3ZC7 B;  1N36 M;  4PCZ A;  3JAM S;  4G3O A;  4LZJ A;  2L09 A;  1SXJ D;  2DAG A;  4JYA M;  3JR4 A;  3GPU A;  4JI0 M;  1BVS A;  2LVQ D;  1N33 M;  4BB9 A;  4B7H A;  3HGI A;  3K9O A;  1Z59 A;  3LW5 F;  1PJT A;  3DFZ A;  5FSW A;  2JY5 A;  3DOA A;  3PXG A;  1D2N A;  3UJN A;  4D81 A;  4OVZ B;  1MN3 A;  4R3D A;  2JZ0 A;  3U6E A;  2OOA A;  2Z3X A;  3SAS A;  3HKP A;  4M9Z A;  4MGI E;  1HQC A;  5JI2 E;  2DWM A;  3AOE A;  2J7N A;  4BLC A;  4AKG A;  3U6Q A;  1NSF A;  1TH3 A;  2R44 A;  1UM8 A;  3U6M A;  4I4L A;  4MB7 A;  1Z5C A;  4DV5 M;  2RKO A;  4ZPX A;  2DZN B;  4LF9 M;  4JI7 M;  1MJG M;  4A3V B;  2DHY A;  1IY2 A;  2ZM6 M;  1SXJ C;  4HEO A;  3GRV A;  2F5Q A;  1VG5 A;  3GLF A;  2EKK A;  5EXS A;  3I4Y A;  4QHT A;  3KS4 A;  2XSZ A;  2BWB A;  1D0M A;  2XF3 A;  4FCT A;  1A5T A;  2FFJ A;  1XMO M;  1Q3C A;  2BJW A;  3FUT A;  1R2Y A;  3GRY A;  4EIW A;  2CHG A;  3JR5 A;  3BBZ A;  1V34 A;  2W82 A;  3LQR A;  1J7K A;  4KOD A;  5E26 A;  1N75 A;  3FTE A;  2KZU A;  2ZTC A;  1HT2 E;  3KOX E;  3Q8X A;  3ZCB B;  1LTM A;  2JY6 B;  4DR3 M;  2JY8 A;  2C99 A;  1GL7 A;  2P5T A;  3QAU A;  1G8P A;  2QSF X;  5IRE B;  2CV0 A;  4B3M M;  2EJS A;  2CRU A;  2M5Z A;  4OVZ A;  3CGW A;  1Y8G A;  1TR8 A;  4GKJ M;  4AZF A;  1OJL A;  2OPF A;  1HNW M;  3THG A;  2Z4S A;  3LVW A;  3MJ5 A;  4LRS A;  1IM2 A;  1GAB A;  3GLF E;  1NHW C;  1XB2 B;  1XHB A;  1CUK A;  3B7N A;  1TF0 B;  3FE3 A;  1IXS A;  1SXJ A;  1KSF X;  1D0K A;  1MX0 A;  1Q39 A;  2V1C A;  5ITR A;  2VQE M;  4KLN A;  1TH4 A;  3AJI B;  3C3E A;  4DR1 M;  1XXH B;  7CAT A;  3EIE A;  4JXJ A;  1JR3 E;  1OAI A;  2QBY B;  3KVW A;  2X8A A;  1L1Z A;  5EXP A;  3GLH B;  2L7H A;  3GPX A;  3ILK A;  1XNR M;  2WSE F;  1QAQ A;  3U5Z B;  3TQS A;  1L2B A;  5L8R F;  1XC8 A;  4GKK M;  1V33 A;  1E94 E;  2ZAO A;  1QDR A;  2QHO B;  2OOB A;  2KHH A;  2ZAM A;  3L27 A;  2F5O A;  2JA2 A;  4DR4 M;  2C5R A;  1TH2 A;  4GHL A;  2FH0 A;  1L8Q A;  3VFD A;  3IG5 A;  3UMM A;  1GO5 A;  1DGB A;  4OU7 A;  1N34 M;  2F5N A;  2C9C A;  2L4E A;  4I5S A;  4KT0 F;  3W67 A;  2UUA M;  2R4J A;  2XFT A;  1S3S A;  4LJ4 A;  2F5S A;  3AL0 C;  3TL4 X;  5KQ8 A;  3FUX A;  3QWL A;  1QAN A;  1NY5 A;  4IBB A;  4MM3 B;  3PNY A;  2D7E A;  1VEJ A;  2ERC A;  2C96 A;  2DAK A;  3J27 B;  3R9X B;  5KPR A;  1PM5 A;  3LCU A;  2CV1 A;  2F5P A;  3HY5 A;  5EXX A;  2CHV A;  2KEB A;  4FVM A;  8CAT A;  4AW4 A;  3A45 A;  3HZJ A;  3W0F A;  4MH0 E;  3K2L A;  2UU9 M;  2ZTD A;  1XXH E;  4GHA A;  5A2Q S;  3PFI A;  3MMP A;  2JXN A;  1KYI A;  1N77 A;  4PDG A;  2DI0 A;  3LQQ A;  4NXN M;  2UXD M;  2D7G A;  4LJA A;  1WGN A;  3HWS A;  2JNH A;  3W68 A;  1OFI A;  4IBK A;  5H37 D;  2KXE A;  2R6F A;  1L2C A;  2AHM A;  4LFB M;  5FTL A;  3MK6 A;  3DA1 A;  2KNZ A;  4FW9 A;  1QUT A;  3K9P A;  4Y28 F;  4IBE A;  1K82 A;  3QYE A;  3CTW B;  3KSJ A;  3TE6 A;  2MGW A;  4LF4 M;  3OTO M;  4UN2 B;  4X66 M;  3VDU A;  2Y20 A;  4JI5 M;  2APL A;  5KPT A;  2YNM D;  3EIH A;  4FD2 A;  2K9D A;  5BPV A;  3GLI A;  4Z6Y A;  2DWL A;  1IBK M;  3SBJ A;  2FE8 A;  1G59 A;  2R45 A;  1HQY E;  2Y21 A;  1N78 A;  3IG8 A;  5FTN A;  2QEN A;  3T38 A;  1TDZ A;  3M0E A;  4YY3 M;  3A46 A;  1K3W A;  2D7H A;  2EO2 A;  2LVO C;  2XGN A;  1IN8 A;  2JUJ A;  4AG6 A;  2YFQ A;  3Q8G A;  4X65 M;  1WIV A;  4LJ9 A;  4K0K M;  1NJF A;  2HKJ A;  2I7P A;  4L8R C;  3NWL A;  3GLH A;  5FLX S;  2KNV A;  2DWZ B;  2X4A A;  5ITQ A;  3GRR A;  2QZ4 A;  4II7 A;  3U6L A;  4XBO A;  2LTU A;  4XGI A;  3H4J A;  4DR6 M;  3HHY A;  5FTM A;  2QQ8 A;  1LV7 A;  3V76 A;  1I4W A;  2EA0 A;  1IXZ A;  2UXB M;  3GPP A;  2KRU A;  2G3Q A;  2A5Y B;  3FD9 A;  1OQY A;  3FKE A;  5EQT A;  3FYC A;  4PDI A;  3I51 A;  1XMQ M;  1L1T A;  1IXS B;  4LCB A;  1T6O A;  4ANR A;  3UGJ A;  3VKH A;  3SAU A;  4LF5 M;  3HU2 A;  1NJG A;  1R5L A;  2DAM A;  3GLH E;  4IBG A;  4DR7 M;  4LF6 M;  5EP2 A;  3UK6 A;  3RE8 A;  2DZL A;  5EP4 A;  4GH9 A;  1NV8 A;  4HLQ A;  4LFC M;  1J5E M;  2R18 A;  1W5S A;  3U5Z A;  1V92 A;  3KOZ E;  3U6D A;  3SAR A;  1UFZ A;  4DV6 M;  3FRI A;  3I4V A;  4L15 A;  1L2D A;  3KS8 A;  1NHG C;  3GP1 A;  3I04 M;  1J09 A;  2LWX A;  3SMP A;  2M60 A;  2XFS A;  2L6O A;  1DGG A;  1PJJ A;  3E21 A;  1IBL M;  4OW0 A;  4QOZ C;  3T1H M;  3M7G A;  1IY0 A;  3GO8 A;  1WJ7 A;  1VDD A;  1WHC A;  3HHZ A;  1JR3 A;  2V1U A;  5C18 A;  5EP1 A;  1X37 A;  1YLA A;  3GLG E;  2E5L M;  2RRU A;  4F1I A;  3K8Z A;  1WXQ A;  1T3T A;  4X62 M;  2CHQ A;  3SFZ A;  3K92 A;  5KO3 A;  2KZS A;  3R8F A;  3D8L A;  1DGF A;  1WR1 B;  3KOW E;  3LMM A;  3KXE C;  2RGO A;  1QUS A;  3VDP A;  1HNX M;  4WUR A;  4DV4 M;  3U60 A;  1XWI A;  2L7I A;  2Z7J A;  3H4M A;  4NSR A;  1QDT A;  2C98 A;  3FUW A;  3FUV A;  4HL4 A;  5FTJ A;  1OIP A;  1GLN A;  4AKI A;  4XK8 F;  2LXE A;  1RU3 A;  2FOI C;  1GL6 A;  3GLI B;  5ITU A;  1DV0 A;  1YUB A;  4D82 A;  1QAM A;  4D80 A;  2HL7 A;  3GQ4 A;  5BR8 M;  3I01 M;  1W5T A;  2BNK A;  3AKZ A;  1JB0 F;  4IJE A;  1DO0 A;  3GLI E;  4CIS A;  1AUA A;  4LGM A;  1FNN A;  4GIP A;  3B9P A;  2R62 A;  4MGY E;  2WZJ A;  1HR0 M;  4LGY A;  4KO8 A;  3LVV A;  2LHG A;  2K47 A;  4FCV A;  3FUU A;  3SC3 A;  4M9X A;  2MRO B;  4FWG A;  2LH0 A;  1NNJ A;  2OQ4 A;  3L25 A;  5IT9 S;  3GQ3 A;  2G8L A;  1HJP A;  1Z5B A;  2EKF A;  3AFH A;  3HU1 A;  4MGK E;  3L28 A;  2KW0 A;  4NOO B;  4PD2 A;  5KQD A;  1QVR A;  4R7G A;  3VK7 A;  2LNH C;  3L2A A;  1N32 M;  1D0L A;  2XSZ D;  3FTF A;  3A42 A;  3J2P B;  2GQF A;  3RGP A;  4G6Z A;  4G4Q A;  1R2Z A;  4DBG B;  1VDL A;  1JQJ C;  1TDH A;  2GNO A;  4DUY M;  3J7A S;  2QPA A;  2VII A;  4GIT A;  4S12 A;  3B74 A;  3GPY A;  2CUZ A;  4CIZ A;  3A98 B;  5JI3 E;  3L26 A;  4AI6 A;  3E46 A;  2CE7 A;  2K6B A;  4M0D A;  5EP3 A;  3SAV A;  1ZV1 A;  4GEW A;  3GRU A;  1IXR C;  4QOS A;  3QYB A;  1XXH A;  2XZU A;  4AKH A;  2HAK A;  2WSC F;  2VF7 A;  3KSX A;  2JZ1 A;  5ITY A;  2C9O A;  3E4R A;  3IEC A;  2WSF F;  3W0L B;  3LCV B;  1IFY A;  3U6C A;  4I81 A;  2LVP C;  2H5X A;  3B89 A;  4NSO B;  1QAO A;  5FTK A;  4P16 A;  3E9S A;  3BXW A;  4DV2 M;  4LF8 M;  1QYR A;  4LZZ A;  2ZBK B;  3U6O A;  1R7R A;  1C1K A;  4L16 A;  3B7Q A;  2Y0Q A;  3PNV A;  5KPZ A;  1VQ1 A;  1R4G A;  3T1Y M;  1IN7 A;  2JP7 A;  3MHV C;  1NV9 A;  2O25 A;  2I7N A;  3VLF B;  1NVM A;  2XLJ A;  2DZO B;  3NBI A;  3SHF A;  4DV1 M;  1GJS A;  3KOY E;  1C7Y A;  4LF7 M;  5LMU M;  4G4N A;  1JR3 D;  4LJ6 A;  5ITX A;  4JV5 M;  3WHK A;  1IY1 A;  3SAW A;  1QZE A;  2EUC A;  1YSY A;  1VEK A;  4Z8X A;  4IJF A;  5IZ7 D;  2O01 F;  4JI6 M;  1AIP C;  1G3I A;  2CP8 A;  2J7O A;  4LRT A;  3RFW A;  3RGS A;  2K0B X;  2DHR A;  2BJV A;  4TUW A;  3HX3 A;  3HJS A;  2NQ8 C;  1F4I A;  4CJ6 A;  1XNQ M;  1EFU B;  2R4E A;  4NL4 H;  2MH8 A;  2KA6 B;  3HHW A;  4LFA M;  4AG5 A;  2N35 A;  4R71 A;  1QQW A;  3DZD A;  1GJT A;  4DR2 M;  4JI4 M;  2Q2E B;  3CF6 E;  5C1B A;  2LVA A;  4JI1 M;  1OTR A;  2VDB B;  1IN6 A;  1TGU A; 
#chains in the Genus database with same CATH homology
 3GLG E;  2RRU A;  4F1I A;  4G3O A;  1ZMV A;  5DFL A;  2DAG A;  2DAI A;  1WR1 B;  1BVS A;  2LVQ D;  2MJ5 B;  2ZTD A;  1XXH E;  3MMP A;  2KNA A;  3K9O A;  2LVN C;  1KYI A;  2JY5 A;  1MN3 A;  2DAE A;  2DI0 A;  1DV0 A;  2R0I A;  1WGN A;  1VEG A;  2JZ0 A;  2JNH A;  3GLI E;  1DO0 A;  2OOA A;  2KNZ A;  1ZMU A;  2WZJ A;  5JI2 E;  4WP2 A;  3K9P A;  2MRO B;  1TTE A;  2MGW A;  1HJP A;  2EKF A;  2OO9 A;  4UN2 B;  2DHY A;  1Q02 A;  4HEO A;  1DO2 A;  1VG5 A;  2K9D A;  2EKK A;  1VDL A;  4DBG B;  2BWB A;  1HT1 E;  1A5T A;  1HQY E;  4F2L A;  3E46 A;  1ZV1 A;  4GEW A;  2CWB A;  3BBZ A;  1SG9 A;  2LVO C;  1PGY A;  2HAK A;  2JUJ A;  2JZ1 A;  2ZTC A;  1HT2 E;  2JY6 B;  2L2D A;  3IEC A;  1WIV A;  2JY8 A;  3IHP A;  3LCV B;  1IFY A;  2HWJ A;  2QSF X;  3T6P A;  2EJS A;  2KNV A;  2QNJ A;  2LVP C;  2H5X A;  3B89 A;  1Y8G A;  1TR8 A;  1ZMW A;  2L4F A;  2LTU A;  3H4J A;  2DKL A;  1VQ1 A;  1R4G A;  1T43 A;  1OKS A;  2JP7 A;  1IM2 A;  1NV9 A;  2O25 A;  3GLF E;  1XB2 B;  1CUK A;  3FE3 A;  1IXS A;  2JY7 A;  2G3Q A;  1OQY A;  1C7Y A;  2BWE A;  3F92 A;  3FRH A;  2LBC A;  1T6O A;  1QZE A;  2DAM A;  1JR3 E;  1OAI A;  1VEK A;  3GLH E;  1G41 A;  1AIP C;  1G3I A;  2CP8 A;  2K0B X;  2DZL A;  2DNA A;  1E94 E;  2B3T A;  2QHO B;  2OOB A;  1NV8 A;  2KHH A;  2MR9 A;  2DEN A;  1F4I A;  1EFU B;  1V92 A;  1G4A E;  1GO5 A;  1UFZ A;  2L4E A;  3FRI A;  4R71 A;  3E21 A;  1P3Q Q;  2LVA A;  1WJ7 A;  1VEJ A;  1OTR A;  1WHC A;  2DAK A;  4Q7J A;  1WGL A;  3LCU A;  1YLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...