2L2KB

Solution nmr structure of the r/g stem loop rna-adar2 dsrbm2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
PSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/rna
molecule keywords Adenosine deaminase
total genus 14
structure length 71
sequence length 71
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l2kB00
4DV0E 2B3TB 4M2ZA 1RQ0A 4JI2E 1J5EE 4GKJE 2LBSB 2L3CA 1XNRE 3ADGA 1FKAE 2EZ6A 4LF9E 4DR7E 4DR2E 4DKKA 4LF7E 5LMNE 1I94E 4JI3E 1DI2A 4JI4E 2UUCE 1T4OA 2UUAE 4DR1E 1STUA 1QU6A 1YYWA 2LTRA 4LFAE 1WHNA 2CPNA 2NUGA 1N36E 1PKPA 4X62E 4X64E 4AQYE 3C4BA 4JI7E 4DV4E 4GKKE 4LF5E 4YY3E 4YHHE 1IBKE 2F4VE 2LJHA 1IBLE 3HTXA 2N3GA 2RTXA 4DUYE 1N34E 4X8WA 1GQEA 5LMUE 1XMOE 1XMQE 2DIXA 1N33E 5CFFE 4B3SE 4JI1E 4DV7E 4DV6E 2L3JA 1O0WA 2UXBE 2DB2A 2RSMA 3J7Yp 4B3ME 3VYYA 2LRSA 4DR5E 1HNXE 1FJGE 4DV1E 2NUEA 2HHHE 2JY9A 3ADLA 1UHZA 2RS7A 1J26A 1UILA 3LLHA 4OOGC 4X66E 1HNZE 4B3RE 4DR4E 2ZM6E 4JV5E 4DUZE 2UXDE 4JI5E 1YZ9A 4LFBE 4B3TE 2LUQA 1RC7A 1T4NA 4WFTA 1X47A 3T1YE 1YYOA 4DV5E 3ADIA 4KHPE 4OX9E 3ADJA 1IBME 2MDRA 2LUPB 3VYXA 2RS6A 3T1HE 1EKZA 2UUBE 1WHQA 2JVAA 4JI6E 2LTSA 4K0KE 2B7TA 2IHR1 4NXME 1N32E 1HNWE 2B7VA 2L2KB 4DV2E 4DV3E 2E5LE 4WYQB 2NUFA 2L2NA 2NA2A 4LF8E 2DMYA 4M30A 2VQFE 1XNQE 1HR0E 1ZBTA 1X49A 2UU9E 1T4LB 4DR3E 3OTOE 2UXCE 3P1XA 4JI8E 2L2MA 4LF4E 4LFCE 1YYKA 4DR6E 4NXNE 5BR8E 4JYAE 4X65E 2L33A 2KHXA 2YT4A 4LF6E 2VQEE 1X48A 4JI0E 3C4TA 5IWAE 2N3HA
chains in the Genus database with same CATH superfamily
2L6MA 2EPOA 2BB8A 5AE1A 1J5EE 2LBSB 4GKJE 3THNA 5IV8B 5KL4A 2GPIA 4LF9E 2EORA 2N8XA 3FIGA 4LF7E 2FTXB 2R1FA 4JI4E 3THOB 1T4OA 2RQLA 3VK6A 4DR1E 1STUA 1A1GA 1UBDC 4LFAE 2NUGA 2EOIA 2EMCA 1T38A 3MHSC 1GZ6A 2K4VA 1A1JA 4YHHE 3EPLA 1IBKE 2EQ3A 4BHBA 2EPCA 5AASA 2EN8A 2EQ0A 3EPHA 1N34E 3RMPA 4X8WA 1LLMC 1A1IA 2LV2A 1N33E 1DGCA 1G2DC 4F9AB 4ZYEA 1ZBQA 4Q28A 4L5NC 2YSPA 4F2JC 2B9DA 1HNXE 2NUEA 2EPAA 3F6GA 2JY9A 2HHHE 3ADLA 1UHZA 2MKDA 1RMDA 1ZR9A 4X66E 4B3RE 2KONA 2ZM6E 1YUIA 2YWQA 4JI5E 4BHCA 4LFBE 2EPKX 2EM2A 3KWRA 1X47A 2ODRC 2LO3A 1A1HA 2MDRA 1WHQA 2EMHA 2PRTA 4O4KA 1YSAC 4NXME 1N32E 2B7VA 2L2KB 1JK1A 3JU0A 3IWBA 4N4RB 3K6QA 5KL5A 4LU9A 2EN1A 2EPXA 1P47A 2CTDA 2E72A 4IS1C 3J81C 4ZYGA 2EL6A 3BGHA 2WBUA 2LJUA 1WRJA 4R2AA 3ECRA 2V86A 5LLQA 3IWCA 4JI8E 3EQ1A 2MDGA 2ENAA 2L8TA 5IXMB 2KHXA 1YFHA 1N3GA 4FK5C 4I8OA 5IWAE 2EN2A 4WSPA 4R2PA 3JTZA 4DV0E 3BBGA 5A6BD 4JI2E 3M99B 1XNRE 2FGGA 4MLQA 5F3WA 5LMNE 1I94E 1DI2A 2UUAE 5TSEA 1BB8A 1QU6A 1WHNA 1N36E 1PJSA 1X3CA 4WXCA 1MEYC 5T6JA 2EPNA 4R2CA 3TQMA 2YTGA 1BBGA 3C4BA 4M9VC 4JI7E 1JK2A 2M1SA 2V85A 2Q8UA 2EM8A 2VRDA 3MSWA 2DMIA 2V8QB 3C6KA 1PJTA 1KJKA 3UK3C 1PJQA 1WJPA 1YPNA 4TUGA 1XMOE 3EPJA 1YUJA 1XMQE 2D9HA 4R2QA 4M0VA 2EE8A 1TF6A 4BCAA 2L3JA 1BBOA 4WSGA 2LMZA 2DB2A 4B3ME 5KL7A 1FJGE 4DV1E 1SR9A 3OMLA 5AC4A 1J26A 1EH6A 4BC7A 3JAMC 2LE2A 1HNZE 4DR4E 2YTNA 2EMBA 2YZTA 2JP9A 2E1MA 2YTJA 4R8OA 1T4NA 1A1LA 2EPPA 2ENCA 2V83A 4OX9E 2EOQA 5LL6R 2ELZA 1IBME 1X5WA 2LUPB 2RS6A 3T1HE 4O24A 2VF1A 2MC5A 4X9JA 2UUBE 5ADZA 4K0KE 1IQSA 2EMIA 5A6BA 4DV2E 3C6MA 1PDAA 2EOSA 2EPZA 3H09A 4WYQB 2NUFA 4P7DA 2EMAA 3BF2A 2L2NA 2VQFE 1WXRA 1XNQE 1HR0E 1ZBTA 1X49A 2UU9E 2DGCA 3AV0A 4DR3E 5AC5A 3OTOE 2ENHA 2L92A 2EM7A 1AAYA 1EH8A 4LF4E 1IMUA 4LFCE 1YYKA 2EOZA 2I9IA 2YTEA 2WZOA 4NXNE 2GHFA 4X65E 1X6EA 2VQEE 2EM4A 2YRMA 2EL5A 1IQOA 2YU8A 2RSIA 1RQ0A 1B69A 2JOXA 2L3CA 4ZYHA 3ADGA 1G2FC 2CSHA 4KWYA 2M9AA 4R2RA 2EZ6A 4DR7E 4DR2E 4HTGA 2I13A 2LTRA 3J7AG 2EJ4A 2G7HA 4GEQB 2HC5A 1PKPA 3ZOQB 4KZSA 1TN9A 4O5GA 4AQYE 4X64E 1ZAAC 2F8BA 3HXLA 4O43A 4RH8A 2EMGA 3KZYA 4LF5E 4YY3E 4L8NA 4TUIA 4F9CB 2EPUA 2LJHA 3MHHC 3HTXA 2YTOA 1NCSA 2EMZA 3HPSA 1GQEA 1GTKA 5LMUE 1QNTA 4F6NA 2MC6A 4HEIA 4Q35B 2EPMX 1T39A 4B3SE 4JI1E 1EH7A 4DV7E 4DV6E 2J7JA 4GZNC 2JPAA 2UXBE 2EM6A 3J7Yp 3KZZA 5KL6A 3VYYA 2ADRA 1X6FA 3HPZA 5IT9C 1ZU1A 2YRHA 2RS7A 2M4IA 1UILA 2LCEA 4JV5E 2EMYA 4DUZE 2EMLA 2JR1A 2EOYA 2V89A 4BMJA 2LUQA 4WPYA 2EOMA 4BC9A 3BIDA 3T1YE 2JOBA 3ADIA 2YRKA 2DSYA 4F6MA 3AUZA 2EM0A 5A69A 2ELYA 1EKZA 4JI6E 2EOFA 2LTSA 2YTIA 1HNWE 2YTDA 2E5LE 2EPRA 2LT7A 1MGTA 2NA2A 4LF8E 2EWLA 2DMYA 2YTPA 2EP3A 2WBTA 5A6JA 1T4LB 2HGHA 4P78A 2EM9A 2EN7A 2L2MA 5AE3A 1Z1BA 3DJWA 2CT1A 5BR8E 5A2QC 4R2EA 4LF6E 1TF3A 4WX9A 4JI0E 2GLIA 2N3HA 2HJJA 4DMIA 2B3TB 4M2ZA 2JWOA 2EOHA 1FKAE 2EN3A 2KOUA 3VHTB 4DKKA 4JI3E 2NABA 2UUCE 4ZYDA 1YYWA 2DRPA 5KL2A 2CPNA 2EPLX 2EOEA 2YTQA 4X62E 1AH5A 5FLXC 4DV4E 4GKKE 2MKNA 3HQ1A 2V88A 4F54A 1UN6B 4WXDA 2F4VE 3EPKA 3L00A 4MLVA 2DLKA 2YPNA 1IBLE 4F9BB 1KYQA 5A6AA 4LTYA 2N3GA 2RTXA 4DUYE 1F2IG 2K7IA 2EMXA 2YU5A 3QG5C 2DIXA 3DF6A 1A1FA 5CFFE 4RHBB 2EOJA 1O0WA 2WCC3 1A1KA 2RSMA 2EMKA 2WBSA 4BS9A 4NZVA 2LRSA 4DR5E 4BBYA 4R03A 5AE2A 2H36X 4IJDA 2EM5A 2EN4A 2ODRD 3LLHA 4OOGC 2V87A 4NHRA 3IWDA 2EM3A 1NEIA 2UXDE 2EL4A 1YZ9A 4B3TE 2EOXA 1RC7A 2EQ1A 2M7QA 3J80C 2YTFA 3F6HA 4WFTA 1YYOA 4DV5E 4KHPE 2YSOA 3ADJA 2EOOA 1X6HA 3VYXA 3LMLA 2BBGA 2JVAA 2B7TA 2IHR1 4DV3E 1L4SA 5KL3A 2JXPA 2VE7C 4M30A 2JYAA 4R2DA 2EMFA 2EMWA 2RPCA 1SFEA 2A25A 2EN6A 2UXCE 2LVHA 3P1XA 4R2SA 4J8ZA 4DR6E 4JYAE 2L33A 2YT4A 2R76A 5DNYA 1DQ3A 1X48A 2FV4B 5A6KA 3C4TA 2DLQA
chains in the Genus database with same CATH topology
2L6MA 3JTZA 2B3TB 4DV0E 4M2ZA 2JWOA 1RQ0A 4JI2E 5AE1A 1J5EE 2LBSB 4GKJE 2JOXA 2L3CA 1XNRE 3ADGA 1FKAE 2EZ6A 2FGGA 4LF9E 2KOUA 3FIGA 4DR2E 5F3WA 4DKKA 4I8OA 5LMNE 4LF7E 1I94E 4B3RE 2FTXB 4JI3E 1DI2A 4JI4E 2UUCE 1T4OA 3VK6A 2UUAE 4DR1E 1STUA 1QU6A 1YYWA 2LTRA 4LFAE 3J7AG 1WHNA 2CPNA 2G7HA 2NUGA 4GEQB 1N36E 1PKPA 3ZOQB 4KZSA 4DMIA 5T6JA 4X62E 4X64E 4AQYE 5FLXC 2F8BA 3C4BA 1GZ6A 2K4VA 4JI7E 2M1SA 3HXLA 2V85A 4DV4E 3MSWA 4GKKE 3HQ1A 4LF5E 2V88A 4F54A 4YY3E 4YHHE 4L8NA 1IBKE 2V8QB 5AASA 2F4VE 4TUIA 4F9CB 2LJHA 1IBLE 3HTXA 4F9BB 3HPSA 4LTYA 2N3GA 2RTXA 4DUYE 3RMPA 1N34E 4X8WA 1GQEA 4TUGA 5LMUE 1XMOE 1XMQE 2MC6A 2DIXA 3DF6A 1N33E 4M0VA 4F9AB 5CFFE 4B3SE 4JI1E 4DV7E 4BCAA 2L3JA 1O0WA 4DV6E 1ZBQA 4Q28A 2LMZA 2UXBE 2DB2A 2RSMA 3J7Yp 4B3ME 4BS9A 3VYYA 4L5NC 2LRSA 4DR5E 4BBYA 4R03A 2B9DA 5AE2A 2H36X 1HNXE 1FJGE 4DV1E 1SR9A 2NUEA 3OMLA 3F6GA 2JY9A 3HPZA 2HHHE 3ADLA 5IT9C 1UHZA 2RS7A 1J26A 2M4IA 4BC7A 1UILA 2ODRD 3LLHA 2LE2A 2V87A 4OOGC 2KONA 3IWDA 3JAMC 4X66E 2ZM6E 1HNZE 4DR4E 4DUZE 4JV5E 2UXDE 2JR1A 4JI5E 1YZ9A 2V89A 4LFBE 2YZTA 4BMJA 4B3TE 2LUQA 2E1MA 4R8OA 4WPYA 4BC9A 1T4NA 3J80C 2M7QA 1RC7A 3KWRA 4WFTA 3F6HA 1X47A 3T1YE 2JOBA 2ODRC 4DV5E 1YYOA 2V83A 4OX9E 3ADIA 4KHPE 2DSYA 3ADJA 5LL6R 1IBME 2MDRA 3AUZA 2LUPB 3VYXA 2RS6A 3T1HE 1EKZA 2VF1A 1WHQA 2MC5A 3LMLA 5ADZA 2UUBE 2JVAA 4JI6E 2LTSA 4K0KE 2B7TA 2IHR1 4NXME 1N32E 1HNWE 2B7VA 2L2KB 3JU0A 4DV2E 3IWBA 4DV3E 2E5LE 3H09A 3K6QA 4WYQB 4LU9A 2NUFA 4P7DA 2L2NA 2VE7C 2NA2A 4LF8E 2EWLA 2DMYA 4M30A 2VQFE 3J81C 1WXRA 1XNQE 1HR0E 1ZBTA 1X49A 2UU9E 1T4LB 3AV0A 4DR3E 3OTOE 4P78A 2L92A 2V86A 3IWCA 2UXCE 3P1XA 4JI8E 2L2MA 4LF4E 2L8TA 4DR7E 4LFCE 5AE3A 4J8ZA 1YYKA 4DR6E 3DJWA 2WZOA 4NXNE 5BR8E 5A2QC 4JYAE 4X65E 2L33A 2KHXA 2YT4A 4LF6E 5DNYA 2VQEE 1DQ3A 1X48A 2FV4B 4JI0E 3C4TA 5IWAE 2N3HA 4WSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 E;  2B3T B;  4M2Z A;  1RQ0 A;  4JI2 E;  1J5E E;  4GKJ E;  2LBS B;  2L3C A;  1XNR E;  3ADG A;  1FKA E;  2EZ6 A;  4LF9 E;  4DR7 E;  4DR2 E;  4DKK A;  4LF7 E;  5LMN E;  1I94 E;  4JI3 E;  1DI2 A;  4JI4 E;  2UUC E;  1T4O A;  2UUA E;  4DR1 E;  1STU A;  1QU6 A;  1YYW A;  2LTR A;  4LFA E;  1WHN A;  2CPN A;  2NUG A;  1N36 E;  1PKP A;  4X62 E;  4X64 E;  4AQY E;  3C4B A;  4JI7 E;  4DV4 E;  4GKK E;  4LF5 E;  4YY3 E;  4YHH E;  1IBK E;  2F4V E;  2LJH A;  1IBL E;  3HTX A;  2N3G A;  2RTX A;  4DUY E;  1N34 E;  4X8W A;  1GQE A;  5LMU E;  1XMO E;  1XMQ E;  2DIX A;  1N33 E;  5CFF E;  4B3S E;  4JI1 E;  4DV7 E;  4DV6 E;  2L3J A;  1O0W A;  2UXB E;  2DB2 A;  2RSM A;  3J7Y p;  4B3M E;  3VYY A;  2LRS A;  4DR5 E;  1HNX E;  1FJG E;  4DV1 E;  2NUE A;  2HHH E;  2JY9 A;  3ADL A;  1UHZ A;  2RS7 A;  1J26 A;  1UIL A;  3LLH A;  4OOG C;  4X66 E;  1HNZ E;  4B3R E;  4DR4 E;  2ZM6 E;  4JV5 E;  4DUZ E;  2UXD E;  4JI5 E;  1YZ9 A;  4LFB E;  4B3T E;  2LUQ A;  1RC7 A;  1T4N A;  4WFT A;  1X47 A;  3T1Y E;  1YYO A;  4DV5 E;  3ADI A;  4KHP E;  4OX9 E;  3ADJ A;  1IBM E;  2MDR A;  2LUP B;  3VYX A;  2RS6 A;  3T1H E;  1EKZ A;  2UUB E;  1WHQ A;  2JVA A;  4JI6 E;  2LTS A;  4K0K E;  2B7T A;  2IHR 1;  4NXM E;  1N32 E;  1HNW E;  2B7V A;  2L2K B;  4DV2 E;  4DV3 E;  2E5L E;  4WYQ B;  2NUF A;  2L2N A;  2NA2 A;  4LF8 E;  2DMY A;  4M30 A;  2VQF E;  1XNQ E;  1HR0 E;  1ZBT A;  1X49 A;  2UU9 E;  1T4L B;  4DR3 E;  3OTO E;  2UXC E;  3P1X A;  4JI8 E;  2L2M A;  4LF4 E;  4LFC E;  1YYK A;  4DR6 E;  4NXN E;  5BR8 E;  4JYA E;  4X65 E;  2L33 A;  2KHX A;  2YT4 A;  4LF6 E;  2VQE E;  1X48 A;  4JI0 E;  3C4T A;  5IWA E;  2N3H A; 
#chains in the Genus database with same CATH topology
 2L6M A;  2EPO A;  2BB8 A;  5AE1 A;  1J5E E;  2LBS B;  4GKJ E;  3THN A;  5IV8 B;  5KL4 A;  2GPI A;  4LF9 E;  2EOR A;  2N8X A;  3FIG A;  4LF7 E;  2FTX B;  2R1F A;  4JI4 E;  3THO B;  1T4O A;  2RQL A;  3VK6 A;  4DR1 E;  1STU A;  1A1G A;  1UBD C;  4LFA E;  2NUG A;  2EOI A;  2EMC A;  1T38 A;  3MHS C;  1GZ6 A;  2K4V A;  1A1J A;  4YHH E;  3EPL A;  1IBK E;  2EQ3 A;  4BHB A;  2EPC A;  5AAS A;  2EN8 A;  2EQ0 A;  3EPH A;  1N34 E;  3RMP A;  4X8W A;  1LLM C;  1A1I A;  2LV2 A;  1N33 E;  1DGC A;  1G2D C;  4F9A B;  4ZYE A;  1ZBQ A;  4Q28 A;  4L5N C;  2YSP A;  4F2J C;  2B9D A;  1HNX E;  2NUE A;  2EPA A;  3F6G A;  2JY9 A;  2HHH E;  3ADL A;  1UHZ A;  2MKD A;  1RMD A;  1ZR9 A;  4X66 E;  4B3R E;  2KON A;  2ZM6 E;  1YUI A;  2YWQ A;  4JI5 E;  4BHC A;  4LFB E;  2EPK X;  2EM2 A;  3KWR A;  1X47 A;  2ODR C;  2LO3 A;  1A1H A;  2MDR A;  1WHQ A;  2EMH A;  2PRT A;  4O4K A;  1YSA C;  4NXM E;  1N32 E;  2B7V A;  2L2K B;  1JK1 A;  3JU0 A;  3IWB A;  4N4R B;  3K6Q A;  5KL5 A;  4LU9 A;  2EN1 A;  2EPX A;  1P47 A;  2CTD A;  2E72 A;  4IS1 C;  3J81 C;  4ZYG A;  2EL6 A;  3BGH A;  2WBU A;  2LJU A;  1WRJ A;  4R2A A;  3ECR A;  2V86 A;  5LLQ A;  3IWC A;  4JI8 E;  3EQ1 A;  2MDG A;  2ENA A;  2L8T A;  5IXM B;  2KHX A;  1YFH A;  1N3G A;  4FK5 C;  4I8O A;  5IWA E;  2EN2 A;  4WSP A;  4R2P A;  3JTZ A;  4DV0 E;  3BBG A;  5A6B D;  4JI2 E;  3M99 B;  1XNR E;  2FGG A;  4MLQ A;  5F3W A;  5LMN E;  1I94 E;  1DI2 A;  2UUA E;  5TSE A;  1BB8 A;  1QU6 A;  1WHN A;  1N36 E;  1PJS A;  1X3C A;  4WXC A;  1MEY C;  5T6J A;  2EPN A;  4R2C A;  3TQM A;  2YTG A;  1BBG A;  3C4B A;  4M9V C;  4JI7 E;  1JK2 A;  2M1S A;  2V85 A;  2Q8U A;  2EM8 A;  2VRD A;  3MSW A;  2DMI A;  2V8Q B;  3C6K A;  1PJT A;  1KJK A;  3UK3 C;  1PJQ A;  1WJP A;  1YPN A;  4TUG A;  1XMO E;  3EPJ A;  1YUJ A;  1XMQ E;  2D9H A;  4R2Q A;  4M0V A;  2EE8 A;  1TF6 A;  4BCA A;  2L3J A;  1BBO A;  4WSG A;  2LMZ A;  2DB2 A;  4B3M E;  5KL7 A;  1FJG E;  4DV1 E;  1SR9 A;  3OML A;  5AC4 A;  1J26 A;  1EH6 A;  4BC7 A;  3JAM C;  2LE2 A;  1HNZ E;  4DR4 E;  2YTN A;  2EMB A;  2YZT A;  2JP9 A;  2E1M A;  2YTJ A;  4R8O A;  1T4N A;  1A1L A;  2EPP A;  2ENC A;  2V83 A;  4OX9 E;  2EOQ A;  5LL6 R;  2ELZ A;  1IBM E;  1X5W A;  2LUP B;  2RS6 A;  3T1H E;  4O24 A;  2VF1 A;  2MC5 A;  4X9J A;  2UUB E;  5ADZ A;  4K0K E;  1IQS A;  2EMI A;  5A6B A;  4DV2 E;  3C6M A;  1PDA A;  2EOS A;  2EPZ A;  3H09 A;  4WYQ B;  2NUF A;  4P7D A;  2EMA A;  3BF2 A;  2L2N A;  2VQF E;  1WXR A;  1XNQ E;  1HR0 E;  1ZBT A;  1X49 A;  2UU9 E;  2DGC A;  3AV0 A;  4DR3 E;  5AC5 A;  3OTO E;  2ENH A;  2L92 A;  2EM7 A;  1AAY A;  1EH8 A;  4LF4 E;  1IMU A;  4LFC E;  1YYK A;  2EOZ A;  2I9I A;  2YTE A;  2WZO A;  4NXN E;  2GHF A;  4X65 E;  1X6E A;  2VQE E;  2EM4 A;  2YRM A;  2EL5 A;  1IQO A;  2YU8 A;  2RSI A;  1RQ0 A;  1B69 A;  2JOX A;  2L3C A;  4ZYH A;  3ADG A;  1G2F C;  2CSH A;  4KWY A;  2M9A A;  4R2R A;  2EZ6 A;  4DR7 E;  4DR2 E;  4HTG A;  2I13 A;  2LTR A;  3J7A G;  2EJ4 A;  2G7H A;  4GEQ B;  2HC5 A;  1PKP A;  3ZOQ B;  4KZS A;  1TN9 A;  4O5G A;  4AQY E;  4X64 E;  1ZAA C;  2F8B A;  3HXL A;  4O43 A;  4RH8 A;  2EMG A;  3KZY A;  4LF5 E;  4YY3 E;  4L8N A;  4TUI A;  4F9C B;  2EPU A;  2LJH A;  3MHH C;  3HTX A;  2YTO A;  1NCS A;  2EMZ A;  3HPS A;  1GQE A;  1GTK A;  5LMU E;  1QNT A;  4F6N A;  2MC6 A;  4HEI A;  4Q35 B;  2EPM X;  1T39 A;  4B3S E;  4JI1 E;  1EH7 A;  4DV7 E;  4DV6 E;  2J7J A;  4GZN C;  2JPA A;  2UXB E;  2EM6 A;  3J7Y p;  3KZZ A;  5KL6 A;  3VYY A;  2ADR A;  1X6F A;  3HPZ A;  5IT9 C;  1ZU1 A;  2YRH A;  2RS7 A;  2M4I A;  1UIL A;  2LCE A;  4JV5 E;  2EMY A;  4DUZ E;  2EML A;  2JR1 A;  2EOY A;  2V89 A;  4BMJ A;  2LUQ A;  4WPY A;  2EOM A;  4BC9 A;  3BID A;  3T1Y E;  2JOB A;  3ADI A;  2YRK A;  2DSY A;  4F6M A;  3AUZ A;  2EM0 A;  5A69 A;  2ELY A;  1EKZ A;  4JI6 E;  2EOF A;  2LTS A;  2YTI A;  1HNW E;  2YTD A;  2E5L E;  2EPR A;  2LT7 A;  1MGT A;  2NA2 A;  4LF8 E;  2EWL A;  2DMY A;  2YTP A;  2EP3 A;  2WBT A;  5A6J A;  1T4L B;  2HGH A;  4P78 A;  2EM9 A;  2EN7 A;  2L2M A;  5AE3 A;  1Z1B A;  3DJW A;  2CT1 A;  5BR8 E;  5A2Q C;  4R2E A;  4LF6 E;  1TF3 A;  4WX9 A;  4JI0 E;  2GLI A;  2N3H A;  2HJJ A;  4DMI A;  2B3T B;  4M2Z A;  2JWO A;  2EOH A;  1FKA E;  2EN3 A;  2KOU A;  3VHT B;  4DKK A;  4JI3 E;  2NAB A;  2UUC E;  4ZYD A;  1YYW A;  2DRP A;  5KL2 A;  2CPN A;  2EPL X;  2EOE A;  2YTQ A;  4X62 E;  1AH5 A;  5FLX C;  4DV4 E;  4GKK E;  2MKN A;  3HQ1 A;  2V88 A;  4F54 A;  1UN6 B;  4WXD A;  2F4V E;  3EPK A;  3L00 A;  4MLV A;  2DLK A;  2YPN A;  1IBL E;  4F9B B;  1KYQ A;  5A6A A;  4LTY A;  2N3G A;  2RTX A;  4DUY E;  1F2I G;  2K7I A;  2EMX A;  2YU5 A;  3QG5 C;  2DIX A;  3DF6 A;  1A1F A;  5CFF E;  4RHB B;  2EOJ A;  1O0W A;  2WCC 3;  1A1K A;  2RSM A;  2EMK A;  2WBS A;  4BS9 A;  4NZV A;  2LRS A;  4DR5 E;  4BBY A;  4R03 A;  5AE2 A;  2H36 X;  4IJD A;  2EM5 A;  2EN4 A;  2ODR D;  3LLH A;  4OOG C;  2V87 A;  4NHR A;  3IWD A;  2EM3 A;  1NEI A;  2UXD E;  2EL4 A;  1YZ9 A;  4B3T E;  2EOX A;  1RC7 A;  2EQ1 A;  2M7Q A;  3J80 C;  2YTF A;  3F6H A;  4WFT A;  1YYO A;  4DV5 E;  4KHP E;  2YSO A;  3ADJ A;  2EOO A;  1X6H A;  3VYX A;  3LML A;  2BBG A;  2JVA A;  2B7T A;  2IHR 1;  4DV3 E;  1L4S A;  5KL3 A;  2JXP A;  2VE7 C;  4M30 A;  2JYA A;  4R2D A;  2EMF A;  2EMW A;  2RPC A;  1SFE A;  2A25 A;  2EN6 A;  2UXC E;  2LVH A;  3P1X A;  4R2S A;  4J8Z A;  4DR6 E;  4JYA E;  2L33 A;  2YT4 A;  2R76 A;  5DNY A;  1DQ3 A;  1X48 A;  2FV4 B;  5A6K A;  3C4T A;  2DLQ A; 
#chains in the Genus database with same CATH homology
 2L6M A;  3JTZ A;  2B3T B;  4DV0 E;  4M2Z A;  2JWO A;  1RQ0 A;  4JI2 E;  5AE1 A;  1J5E E;  2LBS B;  4GKJ E;  2JOX A;  2L3C A;  1XNR E;  3ADG A;  1FKA E;  2EZ6 A;  2FGG A;  4LF9 E;  2KOU A;  3FIG A;  4DR2 E;  5F3W A;  4DKK A;  4I8O A;  5LMN E;  4LF7 E;  1I94 E;  4B3R E;  2FTX B;  4JI3 E;  1DI2 A;  4JI4 E;  2UUC E;  1T4O A;  3VK6 A;  2UUA E;  4DR1 E;  1STU A;  1QU6 A;  1YYW A;  2LTR A;  4LFA E;  3J7A G;  1WHN A;  2CPN A;  2G7H A;  2NUG A;  4GEQ B;  1N36 E;  1PKP A;  3ZOQ B;  4KZS A;  4DMI A;  5T6J A;  4X62 E;  4X64 E;  4AQY E;  5FLX C;  2F8B A;  3C4B A;  1GZ6 A;  2K4V A;  4JI7 E;  2M1S A;  3HXL A;  2V85 A;  4DV4 E;  3MSW A;  4GKK E;  3HQ1 A;  4LF5 E;  2V88 A;  4F54 A;  4YY3 E;  4YHH E;  4L8N A;  1IBK E;  2V8Q B;  5AAS A;  2F4V E;  4TUI A;  4F9C B;  2LJH A;  1IBL E;  3HTX A;  4F9B B;  3HPS A;  4LTY A;  2N3G A;  2RTX A;  4DUY E;  3RMP A;  1N34 E;  4X8W A;  1GQE A;  4TUG A;  5LMU E;  1XMO E;  1XMQ E;  2MC6 A;  2DIX A;  3DF6 A;  1N33 E;  4M0V A;  4F9A B;  5CFF E;  4B3S E;  4JI1 E;  4DV7 E;  4BCA A;  2L3J A;  1O0W A;  4DV6 E;  1ZBQ A;  4Q28 A;  2LMZ A;  2UXB E;  2DB2 A;  2RSM A;  3J7Y p;  4B3M E;  4BS9 A;  3VYY A;  4L5N C;  2LRS A;  4DR5 E;  4BBY A;  4R03 A;  2B9D A;  5AE2 A;  2H36 X;  1HNX E;  1FJG E;  4DV1 E;  1SR9 A;  2NUE A;  3OML A;  3F6G A;  2JY9 A;  3HPZ A;  2HHH E;  3ADL A;  5IT9 C;  1UHZ A;  2RS7 A;  1J26 A;  2M4I A;  4BC7 A;  1UIL A;  2ODR D;  3LLH A;  2LE2 A;  2V87 A;  4OOG C;  2KON A;  3IWD A;  3JAM C;  4X66 E;  2ZM6 E;  1HNZ E;  4DR4 E;  4DUZ E;  4JV5 E;  2UXD E;  2JR1 A;  4JI5 E;  1YZ9 A;  2V89 A;  4LFB E;  2YZT A;  4BMJ A;  4B3T E;  2LUQ A;  2E1M A;  4R8O A;  4WPY A;  4BC9 A;  1T4N A;  3J80 C;  2M7Q A;  1RC7 A;  3KWR A;  4WFT A;  3F6H A;  1X47 A;  3T1Y E;  2JOB A;  2ODR C;  4DV5 E;  1YYO A;  2V83 A;  4OX9 E;  3ADI A;  4KHP E;  2DSY A;  3ADJ A;  5LL6 R;  1IBM E;  2MDR A;  3AUZ A;  2LUP B;  3VYX A;  2RS6 A;  3T1H E;  1EKZ A;  2VF1 A;  1WHQ A;  2MC5 A;  3LML A;  5ADZ A;  2UUB E;  2JVA A;  4JI6 E;  2LTS A;  4K0K E;  2B7T A;  2IHR 1;  4NXM E;  1N32 E;  1HNW E;  2B7V A;  2L2K B;  3JU0 A;  4DV2 E;  3IWB A;  4DV3 E;  2E5L E;  3H09 A;  3K6Q A;  4WYQ B;  4LU9 A;  2NUF A;  4P7D A;  2L2N A;  2VE7 C;  2NA2 A;  4LF8 E;  2EWL A;  2DMY A;  4M30 A;  2VQF E;  3J81 C;  1WXR A;  1XNQ E;  1HR0 E;  1ZBT A;  1X49 A;  2UU9 E;  1T4L B;  3AV0 A;  4DR3 E;  3OTO E;  4P78 A;  2L92 A;  2V86 A;  3IWC A;  2UXC E;  3P1X A;  4JI8 E;  2L2M A;  4LF4 E;  2L8T A;  4DR7 E;  4LFC E;  5AE3 A;  4J8Z A;  1YYK A;  4DR6 E;  3DJW A;  2WZO A;  4NXN E;  5BR8 E;  5A2Q C;  4JYA E;  4X65 E;  2L33 A;  2KHX A;  2YT4 A;  4LF6 E;  5DNY A;  2VQE E;  1DQ3 A;  1X48 A;  2FV4 B;  4JI0 E;  3C4T A;  5IWA E;  2N3H A;  4WSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...