2L2KB

Solution nmr structure of the r/g stem loop rna-adar2 dsrbm2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
b'PSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/rna
total genus 14
structure length 71
sequence length 71
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l2kB00
3VYXA 4M30A 2L33A 4WFTA 1O0WA 2N3GA 4JV5E 4B3TE 1FKAE 4GKKE 1N34E 2NUEA 4DR3E 2LJHA 2ZM6E 2LUQA 1HNZE 2UUCE 4OOGC 4JI8E 1PKPA 4DV3E 1RQ0A 4DR5E 1T4NA 4LFCE 2CPNA 1STUA 2L2KB 1UHZA 4DV4E 3HTXA 1N33E 2UXDE 4LF4E 1ZBTA 1XNRE 3VYYA 2UUBE 2L2MA 4JI6E 5IWAE 1X48A 4DKKA 1IBLE 2LBSB 2LUPB 4LF7E 2DB2A 3T1HE 2NA2A 1RC7A 3P1XA 2UXBE 2JY9A 4JI0E 2UUAE 1EKZA 4JI4E 4DV1E 2B3TB 2MDRA 4YY3E 1XMQE 1QU6A 4X64E 1YYWA 2LRSA 1UILA 1T4LB 5CFFE 4KHPE 1X49A 1WHQA 4JI7E 2VQEE 4DR6E 1XMOE 4DV6E 1HR0E 2DIXA 4LF8E 1YYKA 4DR2E 1T4OA 4JI1E 2L3JA 2N3HA 2YT4A 1YZ9A 3ADJA 2L3CA 1HNWE 4DV7E 1N36E 3C4BA 1WHNA 4DV2E 4X65E 4B3ME 4DUYE 5BR8E 2RS6A 1HNXE 3T1YE 4JI5E 4M2ZA 4X8WA 5LMUE 4YHHE 4GKJE 2KHXA 1IBKE 2NUGA 4B3RE 1YYOA 2RS7A 4K0KE 4DUZE 4NXME 2RSMA 3ADIA 4DR1E 1I94E 2UXCE 1DI2A 2EZ6A 4OX9E 3ADGA 4AQYE 2F4VE 1X47A 4DV0E 2IHR1 4DR7E 2JVAA 2B7TA 2L2NA 2HHHE 1N32E 2LTRA 2E5LE 4B3SE 4LFBE 3C4TA 4JI2E 2RTXA 4X66E 3LLHA 4X62E 4LFAE 4WYQB 1J26A 4NXNE 3OTOE 4JI3E 1J5EE 2LTSA 4LF5E 1GQEA 4LF9E 2UU9E 4JYAE 3J7Yp 1FJGE 3ADLA 4LF6E 1IBME 1XNQE 2B7VA 2NUFA 2DMYA 5LMNE 2VQFE 4DR4E 4DV5E
chains in the Genus database with same CATH superfamily
4WPYA 3F6HA 4GEQB 2I9IA 1O0WA 2DRPA 1MGTA 4GKKE 2CTDA 1IQSA 4F2JC 2EN4A 2VF1A 2BBGA 3HQ1A 4OOGC 4IJDA 4N4RB 2JOXA 2E1MA 3DJWA 4DR5E 2EPRA 1STUA 2M7QA 2LMZA 3JTZA 2PRTA 2M1SA 4LF4E 1ZBTA 2MKDA 2J7JA 2L2MA 1X48A 3LMLA 4WSPA 2EMKA 4DKKA 2YRKA 2LT7A 2EMIA 5A2QC 1RC7A 1WJPA 2UXBE 2JY9A 1A1JA 3BIDA 2EQ1A 1QU6A 3C6KA 4DMIA 1MEYC 2ENCA 2LRSA 1BB8A 4TUGA 4LTYA 1T4LB 1GZ6A 4R03A 5KL2A 2FV4B 2DLKA 4DR6E 2NABA 1NEIA 1HNWE 2ODRD 1ZU1A 4RHBB 4BMJA 5KL3A 2R1FA 2K7IA 4X65E 2A25A 5BR8E 2EMHA 2ELZA 1A1LA 4WX9A 4X8WA 5LMUE 1YFHA 1IBKE 2NUGA 1Z1BA 5AC5A 4B3RE 2EM2A 4R2EA 2EM9A 1EH6A 2RSMA 2EORA 4DR1E 1I94E 2EQ0A 1G2FC 1SR9A 2JWOA 2EN2A 2LV2A 5DNYA 2EOQA 4DR7E 2EM8A 2L2NA 2EL4A 4LFBE 5IT9C 2EMAA 4IS1C 4JI2E 4X66E 1J26A 2EM6A 2EMXA 3OTOE 1PJTA 1J5EE 1TF6A 1GQEA 2UU9E 4JYAE 1SFEA 3FIGA 5ADZA 1FJGE 1X5WA 4M9VC 1X6EA 3BF2A 2NUFA 2EMWA 2EL5A 5AE2A 2L6MA 1UBDC 3ADIA 2YZTA 2KOUA 4ZYHA 1AAYA 1WXRA 2MKNA 4WFTA 2L92A 1FKAE 4L5NC 2NUEA 3EPHA 2EM7A 2ELYA 2ZM6E 3OMLA 1PKPA 3QG5C 4BC7A 3MHSC 2EOZA 1ZR9A 2CPNA 2EPPA 4P7DA 2M4IA 1A1FA 2UXDE 1JK2A 2UUBE 2B9DA 2EN6A 4JI6E 1PJSA 1IBLE 2EOFA 2V83A 2YRMA 2YRHA 2RPCA 5T6JA 5IV8B 1LLMC 2DB2A 3T1HE 3P1XA 2EOMA 2EMBA 2EQ3A 2UUAE 4JI4E 1NCSA 2DMIA 5A6AA 2N8XA 1G2DC 2LO3A 2JP9A 4R2AA 1YYWA 3BGHA 2HC5A 2EOHA 4KWYA 1AH5A 1F2IG 2EOYA 1XMOE 4O43A 1HR0E 4FK5C 4ZYGA 2H36X 4O24A 4LF8E 2V87A 2YU8A 4ZYDA 2N3HA 2YT4A 2EN7A 4WXDA 2EN3A 2HJJA 3IWDA 4B3ME 4DUYE 3VHTB 4F6NA 5KL4A 3DF6A 1HNXE 2V85A 1IQOA 3EPJA 4M2ZA 4YHHE 3M99B 4F9BB 4R2PA 1L4SA 2D9HA 2Q8UA 4BS9A 5FLXC 2UXCE 2VRDA 1T39A 3THOB 1T38A 4RH8A 2ENHA 4AQYE 2F4VE 1X47A 4R8OA 2IHR1 3VK6A 2EN1A 4ZYEA 2B7TA 1A1HA 1B69A 4B3SE 2EJ4A 3AUZA 1KYQA 4R2CA 2LVHA 2YTJA 4O5GA 4LFAE 2LTSA 2EE8A 4BCAA 1YPNA 3J7Yp 2EPZA 3HXLA 2MC5A 2B7VA 5IXMB 4X9JA 2DGCA 2EOSA 2YTIA 2JR1A 4M30A 4NHRA 1X3CA 4R2QA 2YWQA 4JV5E 2G7HA 4B3TE 2EM5A 1N34E 3MSWA 4DR3E 2LJHA 4BHBA 4L8NA 1DQ3A 4JI8E 1HNZE 4DV3E 1RQ0A 1T4NA 2YTGA 4LFCE 3IWCA 1UHZA 4DV4E 1N33E 4MLVA 2EMYA 1XNRE 3VYYA 1PDAA 5AC4A 3EQ1A 1YUJA 3KWRA 2LBSB 3IWBA 4Q35B 2NA2A 2YTEA 5TSEA 2WBUA 2EPXA 2RSIA 1EKZA 4P78A 4F9AB 1A1KA 4YY3E 2WBSA 2JXPA 4X64E 4GZNC 3RMPA 2WZOA 1ZAAC 1EH7A 3THNA 4Q28A 5LLQA 2YTFA 4R2RA 2VQEE 1WHQA 4JI7E 5A6JA 4DV6E 2R76A 4TUIA 2DIXA 1YYKA 2DSYA 2EMLA 1T4OA 5AE1A 2VE7C 4DR2E 4JI1E 2L3JA 1IMUA 5AASA 2E72A 2L3CA 4DV7E 1P47A 2CSHA 1N36E 1JK1A 1WHNA 4I8OA 4DV2E 3EPLA 2YTNA 3TQMA 3T1YE 1BBOA 4JI5E 5A6BA 2KHXA 2EPNA 2FTXB 5KL5A 2YTPA 1YYOA 4DUZE 2GHFA 4BBYA 1A1IA 2V86A 4KZSA 1A1GA 2EZ6A 1DGCA 2YSOA 2YTDA 2EOOA 2HHHE 1N32E 2EPOA 2WCC3 2EOEA 2EM0A 2RTXA 3LLHA 4WYQB 2EN8A 4NXNE 4BC9A 2FGGA 3K6QA 4LF5E 2EMZA 4R2DA 2ENAA 4LF9E 2EOJA 5F3WA 4LF6E 1IBME 2L8TA 2GPIA 1XNQE 4R2SA 2EPCA 3ZOQB 5A69A 5LMNE 5A6KA 4DV5E 1X6HA 3VYXA 3MHHC 2L33A 2BB8A 2EPLX 1KJKA 5KL7A 2N3GA 2V89A 2LUQA 3C6MA 2UUCE 3J80C 2EMFA 2YTQA 2L2KB 2DLQA 3H09A 4HEIA 3HTXA 2LJUA 3HPSA 2LE2A 3AV0A 2EM4A 3J7AG 4WSGA 3L00A 3F6GA 5IWAE 2EPMX 2LUPB 4LF7E 2YU5A 2EL6A 2EMGA 2KONA 2RQLA 3EPKA 4F6MA 2EPUA 2HGHA 1YUIA 1X6FA 4JI0E 5KL6A 4DV1E 2JOBA 2B3TB 2MDRA 4F9CB 1XMQE 4MLQA 1WRJA 3KZZA 2EP3A 2CT1A 4BHCA 2EOIA 2MC6A 1EH8A 1UILA 3HPZA 5CFFE 2LCEA 4O4KA 2EM3A 4KHPE 1X49A 2I13A 5LL6R 2YPNA 4HTGA 2MDGA 2YSPA 1RMDA 3JU0A 1YZ9A 3ADJA 2JPAA 3C4BA 2EMCA 2JYAA 1UN6B 2WBTA 2RS6A 2EWLA 1TF3A 4GKJE 2RS7A 2K4VA 2YTOA 4K0KE 2GLIA 3UK3C 1YSAC 2EOXA 5A6BD 2V88A 4NXME 2ADRA 1QNTA 4WXCA 1DI2A 1ZBQA 4OX9E 1TN9A 3ADGA 4NZVA 3J81C 4DV0E 2JVAA 3ECRA 2EPAA 2LTRA 2E5LE 1PJQA 3C4TA 4M0VA 3JAMC 4J8ZA 4X62E 3BBGA 4F54A 4JI3E 2ODRC 4LU9A 1N3GA 3ADLA 2V8QB 2EPKX 1GTKA 1BBGA 2DMYA 2M9AA 5AE3A 2F8BA 2VQFE 4DR4E 3KZYA
chains in the Genus database with same CATH topology
2KOUA 4WPYA 3F6HA 4M30A 1WXRA 2L33A 3VYXA 4GEQB 4WFTA 2L92A 1O0WA 2N3GA 4JV5E 2G7HA 1FKAE 4L5NC 1N34E 4B3TE 3MSWA 4DR3E 2NUEA 4GKKE 2LJHA 2V89A 2LUQA 2ZM6E 2VF1A 3OMLA 1DQ3A 3HQ1A 4L8NA 4OOGC 1PKPA 4JI8E 1HNZE 2UUCE 4BC7A 3J80C 2JOXA 4DV3E 2E1MA 1RQ0A 3DJWA 4DR5E 1T4NA 4LFCE 2CPNA 3IWCA 1STUA 2M7QA 4P7DA 2L2KB 2LMZA 3JTZA 1UHZA 3H09A 4DV4E 2M4IA 3HTXA 1N33E 2M1SA 2UXDE 4LF4E 1ZBTA 3HPSA 1XNRE 2LE2A 3VYYA 3AV0A 2UUBE 2L2MA 2B9DA 3J7AG 3F6GA 4JI6E 1X48A 3LMLA 3KWRA 4WSPA 4DKKA 2V83A 5IWAE 2LBSB 1IBLE 3IWBA 5T6JA 2LUPB 4LF7E 5A2QC 2DB2A 3T1HE 2NA2A 1RC7A 2KONA 3P1XA 2UXBE 2JY9A 4JI0E 2UUAE 1EKZA 4JI4E 4P78A 4F9AB 4DV1E 2JOBA 2B3TB 2MDRA 4F9CB 4YY3E 1XMQE 1QU6A 4X64E 3RMPA 2WZOA 4DMIA 1YYWA 2LRSA 2MC6A 1UILA 4TUGA 4LTYA 4Q28A 3HPZA 1GZ6A 1T4LB 4R03A 5CFFE 4KHPE 2FV4B 1X49A 1WHQA 4JI7E 2VQEE 4DR6E 1XMOE 4DV6E 4TUIA 1HR0E 2DIXA 2H36X 5LL6R 4LF8E 1YYKA 2DSYA 5AE1A 1T4OA 2V87A 2VE7C 4DR2E 4JI1E 2L3JA 2N3HA 2YT4A 5AASA 3JU0A 1YZ9A 3ADJA 2L3CA 1HNWE 4DV7E 2ODRD 1N36E 3C4BA 1WHNA 4BMJA 4I8OA 3IWDA 4DV2E 4X65E 4B3ME 4DUYE 5BR8E 3DF6A 2RS6A 1HNXE 2V85A 3T1YE 2EWLA 4JI5E 4M2ZA 4X8WA 5LMUE 4YHHE 4GKJE 2KHXA 2FTXB 1IBKE 2NUGA 4F9BB 4B3RE 4DV5E 1YYOA 2RS7A 2K4VA 4K0KE 4DR4E 4DUZE 2V88A 4NXME 2RSMA 4BBYA 4DR1E 2V86A 4KZSA 1I94E 4BS9A 3ADIA 5FLXC 2UXCE 1DI2A 1SR9A 2EZ6A 1ZBQA 4OX9E 3ADGA 4AQYE 2JWOA 3J81C 2F4VE 1X47A 4DV0E 4R8OA 5DNYA 2IHR1 3VK6A 4DR7E 2JVAA 2B7TA 2L2NA 2HHHE 1N32E 2LTRA 2E5LE 4B3SE 4LFBE 3AUZA 3C4TA 5IT9C 4M0VA 3JAMC 4JI2E 2RTXA 4J8ZA 4X66E 3LLHA 4X62E 4LFAE 4WYQB 1J26A 4NXNE 4BC9A 3OTOE 4F54A 2FGGA 3K6QA 2LTSA 1J5EE 4BCAA 2ODRC 4LU9A 1GQEA 4JI3E 2UU9E 4LF5E 4LF9E 4JYAE 3FIGA 5ADZA 3J7Yp 5F3WA 1FJGE 3ADLA 4LF6E 2V8QB 1IBME 2L8TA 3HXLA 1XNQE 2MC5A 2B7VA 2NUFA 2DMYA 3ZOQB 5LMNE 5AE3A 2F8BA 5AE2A 2JR1A 2L6MA 2VQFE 2YZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYX A;  4M30 A;  2L33 A;  4WFT A;  1O0W A;  2N3G A;  4JV5 E;  4B3T E;  1FKA E;  4GKK E;  1N34 E;  2NUE A;  4DR3 E;  2LJH A;  2ZM6 E;  2LUQ A;  1HNZ E;  2UUC E;  4OOG C;  4JI8 E;  1PKP A;  4DV3 E;  1RQ0 A;  4DR5 E;  1T4N A;  4LFC E;  2CPN A;  1STU A;  2L2K B;  1UHZ A;  4DV4 E;  3HTX A;  1N33 E;  2UXD E;  4LF4 E;  1ZBT A;  1XNR E;  3VYY A;  2UUB E;  2L2M A;  4JI6 E;  5IWA E;  1X48 A;  4DKK A;  1IBL E;  2LBS B;  2LUP B;  4LF7 E;  2DB2 A;  3T1H E;  2NA2 A;  1RC7 A;  3P1X A;  2UXB E;  2JY9 A;  4JI0 E;  2UUA E;  1EKZ A;  4JI4 E;  4DV1 E;  2B3T B;  2MDR A;  4YY3 E;  1XMQ E;  1QU6 A;  4X64 E;  1YYW A;  2LRS A;  1UIL A;  1T4L B;  5CFF E;  4KHP E;  1X49 A;  1WHQ A;  4JI7 E;  2VQE E;  4DR6 E;  1XMO E;  4DV6 E;  1HR0 E;  2DIX A;  4LF8 E;  1YYK A;  4DR2 E;  1T4O A;  4JI1 E;  2L3J A;  2N3H A;  2YT4 A;  1YZ9 A;  3ADJ A;  2L3C A;  1HNW E;  4DV7 E;  1N36 E;  3C4B A;  1WHN A;  4DV2 E;  4X65 E;  4B3M E;  4DUY E;  5BR8 E;  2RS6 A;  1HNX E;  3T1Y E;  4JI5 E;  4M2Z A;  4X8W A;  5LMU E;  4YHH E;  4GKJ E;  2KHX A;  1IBK E;  2NUG A;  4B3R E;  1YYO A;  2RS7 A;  4K0K E;  4DUZ E;  4NXM E;  2RSM A;  3ADI A;  4DR1 E;  1I94 E;  2UXC E;  1DI2 A;  2EZ6 A;  4OX9 E;  3ADG A;  4AQY E;  2F4V E;  1X47 A;  4DV0 E;  2IHR 1;  4DR7 E;  2JVA A;  2B7T A;  2L2N A;  2HHH E;  1N32 E;  2LTR A;  2E5L E;  4B3S E;  4LFB E;  3C4T A;  4JI2 E;  2RTX A;  4X66 E;  3LLH A;  4X62 E;  4LFA E;  4WYQ B;  1J26 A;  4NXN E;  3OTO E;  4JI3 E;  1J5E E;  2LTS A;  4LF5 E;  1GQE A;  4LF9 E;  2UU9 E;  4JYA E;  3J7Y p;  1FJG E;  3ADL A;  4LF6 E;  1IBM E;  1XNQ E;  2B7V A;  2NUF A;  2DMY A;  5LMN E;  2VQF E;  4DR4 E;  4DV5 E; 
#chains in the Genus database with same CATH topology
 4WPY A;  3F6H A;  4GEQ B;  2I9I A;  1O0W A;  2DRP A;  1MGT A;  4GKK E;  2CTD A;  1IQS A;  4F2J C;  2EN4 A;  2VF1 A;  2BBG A;  3HQ1 A;  4OOG C;  4IJD A;  4N4R B;  2JOX A;  2E1M A;  3DJW A;  4DR5 E;  2EPR A;  1STU A;  2M7Q A;  2LMZ A;  3JTZ A;  2PRT A;  2M1S A;  4LF4 E;  1ZBT A;  2MKD A;  2J7J A;  2L2M A;  1X48 A;  3LML A;  4WSP A;  2EMK A;  4DKK A;  2YRK A;  2LT7 A;  2EMI A;  5A2Q C;  1RC7 A;  1WJP A;  2UXB E;  2JY9 A;  1A1J A;  3BID A;  2EQ1 A;  1QU6 A;  3C6K A;  4DMI A;  1MEY C;  2ENC A;  2LRS A;  1BB8 A;  4TUG A;  4LTY A;  1T4L B;  1GZ6 A;  4R03 A;  5KL2 A;  2FV4 B;  2DLK A;  4DR6 E;  2NAB A;  1NEI A;  1HNW E;  2ODR D;  1ZU1 A;  4RHB B;  4BMJ A;  5KL3 A;  2R1F A;  2K7I A;  4X65 E;  2A25 A;  5BR8 E;  2EMH A;  2ELZ A;  1A1L A;  4WX9 A;  4X8W A;  5LMU E;  1YFH A;  1IBK E;  2NUG A;  1Z1B A;  5AC5 A;  4B3R E;  2EM2 A;  4R2E A;  2EM9 A;  1EH6 A;  2RSM A;  2EOR A;  4DR1 E;  1I94 E;  2EQ0 A;  1G2F C;  1SR9 A;  2JWO A;  2EN2 A;  2LV2 A;  5DNY A;  2EOQ A;  4DR7 E;  2EM8 A;  2L2N A;  2EL4 A;  4LFB E;  5IT9 C;  2EMA A;  4IS1 C;  4JI2 E;  4X66 E;  1J26 A;  2EM6 A;  2EMX A;  3OTO E;  1PJT A;  1J5E E;  1TF6 A;  1GQE A;  2UU9 E;  4JYA E;  1SFE A;  3FIG A;  5ADZ A;  1FJG E;  1X5W A;  4M9V C;  1X6E A;  3BF2 A;  2NUF A;  2EMW A;  2EL5 A;  5AE2 A;  2L6M A;  1UBD C;  3ADI A;  2YZT A;  2KOU A;  4ZYH A;  1AAY A;  1WXR A;  2MKN A;  4WFT A;  2L92 A;  1FKA E;  4L5N C;  2NUE A;  3EPH A;  2EM7 A;  2ELY A;  2ZM6 E;  3OML A;  1PKP A;  3QG5 C;  4BC7 A;  3MHS C;  2EOZ A;  1ZR9 A;  2CPN A;  2EPP A;  4P7D A;  2M4I A;  1A1F A;  2UXD E;  1JK2 A;  2UUB E;  2B9D A;  2EN6 A;  4JI6 E;  1PJS A;  1IBL E;  2EOF A;  2V83 A;  2YRM A;  2YRH A;  2RPC A;  5T6J A;  5IV8 B;  1LLM C;  2DB2 A;  3T1H E;  3P1X A;  2EOM A;  2EMB A;  2EQ3 A;  2UUA E;  4JI4 E;  1NCS A;  2DMI A;  5A6A A;  2N8X A;  1G2D C;  2LO3 A;  2JP9 A;  4R2A A;  1YYW A;  3BGH A;  2HC5 A;  2EOH A;  4KWY A;  1AH5 A;  1F2I G;  2EOY A;  1XMO E;  4O43 A;  1HR0 E;  4FK5 C;  4ZYG A;  2H36 X;  4O24 A;  4LF8 E;  2V87 A;  2YU8 A;  4ZYD A;  2N3H A;  2YT4 A;  2EN7 A;  4WXD A;  2EN3 A;  2HJJ A;  3IWD A;  4B3M E;  4DUY E;  3VHT B;  4F6N A;  5KL4 A;  3DF6 A;  1HNX E;  2V85 A;  1IQO A;  3EPJ A;  4M2Z A;  4YHH E;  3M99 B;  4F9B B;  4R2P A;  1L4S A;  2D9H A;  2Q8U A;  4BS9 A;  5FLX C;  2UXC E;  2VRD A;  1T39 A;  3THO B;  1T38 A;  4RH8 A;  2ENH A;  4AQY E;  2F4V E;  1X47 A;  4R8O A;  2IHR 1;  3VK6 A;  2EN1 A;  4ZYE A;  2B7T A;  1A1H A;  1B69 A;  4B3S E;  2EJ4 A;  3AUZ A;  1KYQ A;  4R2C A;  2LVH A;  2YTJ A;  4O5G A;  4LFA E;  2LTS A;  2EE8 A;  4BCA A;  1YPN A;  3J7Y p;  2EPZ A;  3HXL A;  2MC5 A;  2B7V A;  5IXM B;  4X9J A;  2DGC A;  2EOS A;  2YTI A;  2JR1 A;  4M30 A;  4NHR A;  1X3C A;  4R2Q A;  2YWQ A;  4JV5 E;  2G7H A;  4B3T E;  2EM5 A;  1N34 E;  3MSW A;  4DR3 E;  2LJH A;  4BHB A;  4L8N A;  1DQ3 A;  4JI8 E;  1HNZ E;  4DV3 E;  1RQ0 A;  1T4N A;  2YTG A;  4LFC E;  3IWC A;  1UHZ A;  4DV4 E;  1N33 E;  4MLV A;  2EMY A;  1XNR E;  3VYY A;  1PDA A;  5AC4 A;  3EQ1 A;  1YUJ A;  3KWR A;  2LBS B;  3IWB A;  4Q35 B;  2NA2 A;  2YTE A;  5TSE A;  2WBU A;  2EPX A;  2RSI A;  1EKZ A;  4P78 A;  4F9A B;  1A1K A;  4YY3 E;  2WBS A;  2JXP A;  4X64 E;  4GZN C;  3RMP A;  2WZO A;  1ZAA C;  1EH7 A;  3THN A;  4Q28 A;  5LLQ A;  2YTF A;  4R2R A;  2VQE E;  1WHQ A;  4JI7 E;  5A6J A;  4DV6 E;  2R76 A;  4TUI A;  2DIX A;  1YYK A;  2DSY A;  2EML A;  1T4O A;  5AE1 A;  2VE7 C;  4DR2 E;  4JI1 E;  2L3J A;  1IMU A;  5AAS A;  2E72 A;  2L3C A;  4DV7 E;  1P47 A;  2CSH A;  1N36 E;  1JK1 A;  1WHN A;  4I8O A;  4DV2 E;  3EPL A;  2YTN A;  3TQM A;  3T1Y E;  1BBO A;  4JI5 E;  5A6B A;  2KHX A;  2EPN A;  2FTX B;  5KL5 A;  2YTP A;  1YYO A;  4DUZ E;  2GHF A;  4BBY A;  1A1I A;  2V86 A;  4KZS A;  1A1G A;  2EZ6 A;  1DGC A;  2YSO A;  2YTD A;  2EOO A;  2HHH E;  1N32 E;  2EPO A;  2WCC 3;  2EOE A;  2EM0 A;  2RTX A;  3LLH A;  4WYQ B;  2EN8 A;  4NXN E;  4BC9 A;  2FGG A;  3K6Q A;  4LF5 E;  2EMZ A;  4R2D A;  2ENA A;  4LF9 E;  2EOJ A;  5F3W A;  4LF6 E;  1IBM E;  2L8T A;  2GPI A;  1XNQ E;  4R2S A;  2EPC A;  3ZOQ B;  5A69 A;  5LMN E;  5A6K A;  4DV5 E;  1X6H A;  3VYX A;  3MHH C;  2L33 A;  2BB8 A;  2EPL X;  1KJK A;  5KL7 A;  2N3G A;  2V89 A;  2LUQ A;  3C6M A;  2UUC E;  3J80 C;  2EMF A;  2YTQ A;  2L2K B;  2DLQ A;  3H09 A;  4HEI A;  3HTX A;  2LJU A;  3HPS A;  2LE2 A;  3AV0 A;  2EM4 A;  3J7A G;  4WSG A;  3L00 A;  3F6G A;  5IWA E;  2EPM X;  2LUP B;  4LF7 E;  2YU5 A;  2EL6 A;  2EMG A;  2KON A;  2RQL A;  3EPK A;  4F6M A;  2EPU A;  2HGH A;  1YUI A;  1X6F A;  4JI0 E;  5KL6 A;  4DV1 E;  2JOB A;  2B3T B;  2MDR A;  4F9C B;  1XMQ E;  4MLQ A;  1WRJ A;  3KZZ A;  2EP3 A;  2CT1 A;  4BHC A;  2EOI A;  2MC6 A;  1EH8 A;  1UIL A;  3HPZ A;  5CFF E;  2LCE A;  4O4K A;  2EM3 A;  4KHP E;  1X49 A;  2I13 A;  5LL6 R;  2YPN A;  4HTG A;  2MDG A;  2YSP A;  1RMD A;  3JU0 A;  1YZ9 A;  3ADJ A;  2JPA A;  3C4B A;  2EMC A;  2JYA A;  1UN6 B;  2WBT A;  2RS6 A;  2EWL A;  1TF3 A;  4GKJ E;  2RS7 A;  2K4V A;  2YTO A;  4K0K E;  2GLI A;  3UK3 C;  1YSA C;  2EOX A;  5A6B D;  2V88 A;  4NXM E;  2ADR A;  1QNT A;  4WXC A;  1DI2 A;  1ZBQ A;  4OX9 E;  1TN9 A;  3ADG A;  4NZV A;  3J81 C;  4DV0 E;  2JVA A;  3ECR A;  2EPA A;  2LTR A;  2E5L E;  1PJQ A;  3C4T A;  4M0V A;  3JAM C;  4J8Z A;  4X62 E;  3BBG A;  4F54 A;  4JI3 E;  2ODR C;  4LU9 A;  1N3G A;  3ADL A;  2V8Q B;  2EPK X;  1GTK A;  1BBG A;  2DMY A;  2M9A A;  5AE3 A;  2F8B A;  2VQF E;  4DR4 E;  3KZY A; 
#chains in the Genus database with same CATH homology
 2KOU A;  4WPY A;  3F6H A;  4M30 A;  1WXR A;  2L33 A;  3VYX A;  4GEQ B;  4WFT A;  2L92 A;  1O0W A;  2N3G A;  4JV5 E;  2G7H A;  1FKA E;  4L5N C;  1N34 E;  4B3T E;  3MSW A;  4DR3 E;  2NUE A;  4GKK E;  2LJH A;  2V89 A;  2LUQ A;  2ZM6 E;  2VF1 A;  3OML A;  1DQ3 A;  3HQ1 A;  4L8N A;  4OOG C;  1PKP A;  4JI8 E;  1HNZ E;  2UUC E;  4BC7 A;  3J80 C;  2JOX A;  4DV3 E;  2E1M A;  1RQ0 A;  3DJW A;  4DR5 E;  1T4N A;  4LFC E;  2CPN A;  3IWC A;  1STU A;  2M7Q A;  4P7D A;  2L2K B;  2LMZ A;  3JTZ A;  1UHZ A;  3H09 A;  4DV4 E;  2M4I A;  3HTX A;  1N33 E;  2M1S A;  2UXD E;  4LF4 E;  1ZBT A;  3HPS A;  1XNR E;  2LE2 A;  3VYY A;  3AV0 A;  2UUB E;  2L2M A;  2B9D A;  3J7A G;  3F6G A;  4JI6 E;  1X48 A;  3LML A;  3KWR A;  4WSP A;  4DKK A;  2V83 A;  5IWA E;  2LBS B;  1IBL E;  3IWB A;  5T6J A;  2LUP B;  4LF7 E;  5A2Q C;  2DB2 A;  3T1H E;  2NA2 A;  1RC7 A;  2KON A;  3P1X A;  2UXB E;  2JY9 A;  4JI0 E;  2UUA E;  1EKZ A;  4JI4 E;  4P78 A;  4F9A B;  4DV1 E;  2JOB A;  2B3T B;  2MDR A;  4F9C B;  4YY3 E;  1XMQ E;  1QU6 A;  4X64 E;  3RMP A;  2WZO A;  4DMI A;  1YYW A;  2LRS A;  2MC6 A;  1UIL A;  4TUG A;  4LTY A;  4Q28 A;  3HPZ A;  1GZ6 A;  1T4L B;  4R03 A;  5CFF E;  4KHP E;  2FV4 B;  1X49 A;  1WHQ A;  4JI7 E;  2VQE E;  4DR6 E;  1XMO E;  4DV6 E;  4TUI A;  1HR0 E;  2DIX A;  2H36 X;  5LL6 R;  4LF8 E;  1YYK A;  2DSY A;  5AE1 A;  1T4O A;  2V87 A;  2VE7 C;  4DR2 E;  4JI1 E;  2L3J A;  2N3H A;  2YT4 A;  5AAS A;  3JU0 A;  1YZ9 A;  3ADJ A;  2L3C A;  1HNW E;  4DV7 E;  2ODR D;  1N36 E;  3C4B A;  1WHN A;  4BMJ A;  4I8O A;  3IWD A;  4DV2 E;  4X65 E;  4B3M E;  4DUY E;  5BR8 E;  3DF6 A;  2RS6 A;  1HNX E;  2V85 A;  3T1Y E;  2EWL A;  4JI5 E;  4M2Z A;  4X8W A;  5LMU E;  4YHH E;  4GKJ E;  2KHX A;  2FTX B;  1IBK E;  2NUG A;  4F9B B;  4B3R E;  4DV5 E;  1YYO A;  2RS7 A;  2K4V A;  4K0K E;  4DR4 E;  4DUZ E;  2V88 A;  4NXM E;  2RSM A;  4BBY A;  4DR1 E;  2V86 A;  4KZS A;  1I94 E;  4BS9 A;  3ADI A;  5FLX C;  2UXC E;  1DI2 A;  1SR9 A;  2EZ6 A;  1ZBQ A;  4OX9 E;  3ADG A;  4AQY E;  2JWO A;  3J81 C;  2F4V E;  1X47 A;  4DV0 E;  4R8O A;  5DNY A;  2IHR 1;  3VK6 A;  4DR7 E;  2JVA A;  2B7T A;  2L2N A;  2HHH E;  1N32 E;  2LTR A;  2E5L E;  4B3S E;  4LFB E;  3AUZ A;  3C4T A;  5IT9 C;  4M0V A;  3JAM C;  4JI2 E;  2RTX A;  4J8Z A;  4X66 E;  3LLH A;  4X62 E;  4LFA E;  4WYQ B;  1J26 A;  4NXN E;  4BC9 A;  3OTO E;  4F54 A;  2FGG A;  3K6Q A;  2LTS A;  1J5E E;  4BCA A;  2ODR C;  4LU9 A;  1GQE A;  4JI3 E;  2UU9 E;  4LF5 E;  4LF9 E;  4JYA E;  3FIG A;  5ADZ A;  3J7Y p;  5F3W A;  1FJG E;  3ADL A;  4LF6 E;  2V8Q B;  1IBM E;  2L8T A;  3HXL A;  1XNQ E;  2MC5 A;  2B7V A;  2NUF A;  2DMY A;  3ZOQ B;  5LMN E;  5AE3 A;  2F8B A;  5AE2 A;  2JR1 A;  2L6M A;  2VQF E;  2YZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...