2L2SA

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 13
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2l2sA00
1D7IA 1JVWA 2M2AA 3KABA 3O5PA 4J4OA 3UQBA 1F40A 4LAXA 2OFNA 2XP4A 2Y78A 2RUCA 1U79A 4W9PA 2KR7A 4DRPA 3WH0A 4TYOA 4W9QA 2KE0A 3JXVA 3PRBA 4BF8A 5B8IC 5D75A 1KT1A 3O5FA 1FJDA 2KI3A 4C02B 4QIBA 5J6EA 2M08A 4ODNA 2AWGA 4ODMA 4IPXA 4DZ2A 2PPNA 1FKFA 1ZCNA 3B7XA 3NRKA 4QT2A 5BXJA 1PBKA 3O5IA 2FAPA 1L1PA 4ITZA 4DH0A 3JYJA 1ROTA 1BL4A 2PV3A 1J4HA 4JFIA 1FKHA 1Y0OA 3MDYB 2PV1A 1JNSA 4TW6A 2MLXA 1NMVA 2VCDA 3KAFA 4LAVA 4ODPA 4DRMA 2XP3A 5HTGA 5I98A 4DROA 1Q6UA 2N87A 1N1AA 3O5RA 3CGMA 2ZQSA 4TW7A 1FKRA 3KACA 2ITKA 1NSGA 2ZR5A 4U86A 1NMWA 3VAWA 4DRNA 4R0XA 2PPPA 2MLZA 4J4NA 5HW7A 3UI4A 1B6CA 1D6OA 1FD9A 1EYMA 1FKLA 3NTPA 2LKNA 3KCEA 2MPHA 3O5OA 4JFMA 4DRQA 2RSEA 3JYMA 4IQCA 4TX0A 3RFWA 1W26A 4IQ2A 5HW8A 1KT0A 4ODRA 1PINA 3UI6A 5HUAA 3IK8A 1FKDA 3O5JA 2D9FA 3NI6A 3UQIA 2JZVA 3UQAA 4ODOA 3H9RB 2PPOA 4DRKA 5DITA 4ODQA 2DG9A 3EY6A 1Q6IA 4ODKA 1J4RA 4JFKA 2XP6A 2KFWA 3PA7A 4LAYA 5GPGA 2LPVA 1ZK6A 2XP5A 3LUOA 1EQ3A 4DZ3A 2XPBA 5HW6A 2XPAA 4DRHA 1R9HA 2LJ4A 3IHZA 4MSPA 3UF8A 3O5MA 5HWBA 3TC5A 1FKJA 5HKGA 5DIVA 3CGNA 2PBCA 1M5YA 3I6CA 2M1IA 2KGJA 2RUDA 5DIUA 1ROUA 2Q5AA 2ZQVA 3O5EA 1TCOC 1HXVA 4GIVA 4JFJA 2F21A 4DRJA 4GGQA 3FAPA 1F8AB 1J4IA 4G2PA 4LAWA 3O5GA 4N19A 1QZ2A 2DG4A 4DT4A 3TDBA 2LGOA 5HT1A 1D7JA 4G50A 1FKBA 5HWCA 2XP8A 4FN2A 1T11A 3KAIA 2K8IA 3IKDA 4NNRA 3UI5A 2L2SA 1YW5A 2VN1A 1D7HA 2UZ5A 2F4EA 2RUQA 1P5QA 1A7XA 2RURA 3KADA 4FAPA 1FKKA 1FAPA 2XP9A 2DG3A 2RQSA 1FKGA 2PV2A 2ZQTA 3KZ7A 3O5DA 2MF9A 2F2DA 1YATA 4JFLA 3TCZA 4DRIA 1FKIA 2KO7A 4TW8A 1C9HA 1JNTA 3OOBA 4W9OA 1FKSA 3RGCA 2ZR6A 3PRDA 1Q6HA 4QT3A 1J6YA 3KAHA 3O5KA 4O2TA 2MNTA 4JYSA 3ODKA 4DIPA 3IKGA 1BKFA 2IF4A 2ZQUA 2ZR4A 1Q1CA 2XP7A 4MGVA 4U85A 1FKTA 1QPLA 2FKEA 4TNSA 1QPFA 3O5QA 4ODLA 3KAGA 3O5LA 4U84A 3GPKA 2MLYA
chains in the Genus database with same CATH superfamily
3WD2A 1F40A 2B31A 4DWSB 2OFNA 3AS3A 3CHEA 3PRBA 4MNJA 5JH8A 2YBTA 3O5FA 1ZBCA 4ODNA 1FKFA 1ZCNA 3B7XA 3NRKA 2OLHA 2PV3A 1E15A 4HBEA 1Y0OA 3MDYB 4JFIA 1JNSA 4AY1A 4PTMA 1XRVA 3CGMA 2ITKA 1X6LA 1NSGA 1HKMA 4MAVA 4U86A 1NWSA 3ARYA 2MLZA 4QZVB 2P4VA 1EYMA 1EHNA 3NTPA 4NZCA 2MPHA 3JYMA 4DWSD 3AS1A 2DPEA 5HUAA 3IK8A 1GRJA 3H9RB 1ZL1A 4R5EA 2DG9A 2O9OA 4WKFA 2XP6A 4LAYA 1ZK6A 1EQ3A 1GOIA 2XPBA 4DRHA 1R9HA 1GPFA 3TC5A 5DIVA 1K9TA 1LL7A 1M5YA 3B9AA 1WNOA 2ZQVA 3O5EA 1HXVA 4GIVA 2QF8A 4JFJA 4Q7NA 4Z2LA 3TDBA 1T11A 3KAIA 3IKDA 2UZ5A 2A3EA 4FAPA 1LJYA 2XP9A 3KZ7A 3O5DA 4JFLA 1HKIA 1NWRA 2F2DA 3TCZA 2AOSA 4MNMA 1WB0A 1FKSA 1NWTA 3CZ8A 1ZBKA 1Q6HA 3KAHA 3AROA 2O92A 1BKFA 2XP7A 2DSVA 1FKTA 4TNSA 3WD3A 3FY1A 2WK2A 3KAGA 4ODLA 3O5PA 5DO2A 2M2AA 5HBFA 3UQBA 1W9VA 3RM9A 3WD4A 1U79A 4W9PA 4W9QA 2KE0A 4BF8A 1LL4A 3G6LA 1FFRA 1H0IA 4C02B 4Z2JA 5J6EA 1W1TA 1GUVA 1SYTA 4DZ2A 3ARSA 4L72B 4HBOA 4ITZA 1ROTA 3OA5A 2WLYA 4P8VA 2PV1A 2B5UB 1NMVA 4ODPA 4DRMA 2XP3A 5HTGA 4DROA 2N87A 1N1AA 3O5RA 4KQZA 1FKRA 1JNEA 3ARRA 2ZR5A 1NMWA 3VAWA 3AQUA 4ML4A 4J4NA 5HW7A 1D6OA 1FD9A 2LKNA 3O5OA 3AS0A 3RFWA 1JCHB 4ODRA 1PINA 2D9FA 3UQAA 2WM0A 4ODOA 2PPOA 3ARXA 1LG1A 3EY6A 1EDQA 1Q6IA 4P8UA 5GPGA 2LPVA 3ARTA 4HARA 4DZ3A 5HW6A 3IHZA 4Z2HA 3UF8A 3O5MA 2IUZA 3ARVA 5HWBA 1E6PA 3WKZA 2PBCA 2KGJA 2RUDA 3B9EA 4WJXA 4DWSA 1J4IA 3ALFA 1QZ2A 2DG4A 2DT2A 4DT4A 2DSUA 2LGOA 5HT1A 3EIPA 4FN2A 3WQVA 3UI5A 2VN1A 2F4EA 1P5QA 1A7XA 3KADA 4WKHA 1FKKA 1FAPA 2MF9A 1FKIA 2KO7A 1C9HA 4W9OA 4URIA 3RGCA 1OWQA 3AS2A 3PRDA 4MPKA 5GPRA 1TFVA 4L3NA 4MNLA 1QPFA 3O5QA 4U84A 4DRKA 4S3KA 1JVWA 3KABA 2WLZA 4P8XA 1HKJA 1O6IA 2Y78A 2PI6A 1E9LA 4DRPA 4TYOA 1ITXA 3JXVA 1HJVA 2ESCA 5D75A 1ZB5A 1FJDA 2ETNA 2KI3A 4QIBA 1ZBVA 1HKKA 2AWGA 3CHCA 3ARQA 4P8WA 2PPNA 2A3CA 4QT2A 5BXJA 3O5IA 1HJWA 2FAPA 3GTYX 2G8ZA 4DH0A 3JYJA 3GU0A 1FKHA 4Z2IA 2EULA 4TW6A 2MLXA 3KAFA 2VCDA 1Q6UA 3B8SA 2ZQSA 4WK9A 4MNKA 3RMEA 5DEZA 4R0XA 2YBUA 3WIJA 3UI4A 1B6CA 2DT0A 3RM8A 4IT4A 3KCEA 1NWUA 4JFMA 4DRQA 2RSEA 4TX0A 4IQ2A 5HW8A 4KR0B 1FKDA 3NI6A 3RM4A 1FFQA 5DITA 4ODKA 4JFKA 1OGGA 2KFWA 3PA7A 3LUOA 3WQWA 5HKGA 3CGNA 5DIUA 1ROUA 2Q5AA 3ARUA 3QOKA 2F21A 4GGQA 3FAPA 3WL0A 1F8AB 1LQ0A 4G2PA 1W9PA 1VF8A 1D7JA 4G50A 1FKBA 5HWCA 2XP8A 4NNRA 2A3AA 2DT3A 2G41A 1YW5A 2RURA 1XHGA 2DG3A 4NSBA 2RQSA 4XAKA 2PV2A 4MTVA 3W4RA 2DSWA 1ZU8A 1JNTA 3CHDA 1H0GA 3PRAA 4QT3A 1E6NA 1W1VA 4O2TA 4Q22A 4DIPA 3ODKA 4WKAA 3IKGA 2IF4A 4S3JA 2FDMA 2ZQUA 2ZR4A 1Q1CA 4MGVA 4U85A 1CTNA 4ZPWR 1QPLA 2FKEA 1KFWA 3O5LA 1OGBA 2MLYA 1D7IA 3CH9A 4J4OA 4LAXA 3ARWA 2XP4A 2RUCA 2KR7A 2A3BA 3WH0A 5B8IC 1KT1A 1RD6A 3WL1A 1HJXA 2M08A 4IT6A 1UR8A 4ODMA 1E44A 4IPXA 4LGXA 1PBKA 1L1PA 4ZPTR 1BL4A 1J4HA 1WAWA 4LAVA 1SR0A 1J6YA 5I98A 5GQBA 4Z2KA 3CHFA 3PR9A 4TW7A 3ARZA 3KACA 4DWSC 2DSZA 4UDMA 5DF0A 1EIBA 3ARPA 2PPPA 3WD1A 1FKLA 4IQCA 1W26A 3FXYA 1KT0A 3UI6A 1E6RA 3O5JA 4W5UA 3UQIA 1X6NA 2JZVA 1IX5A 3ALGA 4ODQA 1J4RA 1LG2A 2XP5A 2DT1A 4ZPVR 4ZS6A 1LL6A 2XPAA 2LJ4A 4MSPA 3G6MA 1JNDA 1FKJA 1W1PA 3I6CA 2M1IA 1TCOC 4DRJA 4LAWA 1D2KA 2PN0A 3O5GA 4N19A 1E6ZA 2K8IA 1UR9A 2L2SA 1D7HA 2RUQA 1NH6A 2ZQTA 1FKGA 4DRNA 1ZBWA 4DRIA 1YATA 4WIWA 4TW8A 3WD0A 3OOBA 1W1YA 2ZR6A 3B9DA 3O5KA 2MNTA 4JYSA 3BMBA 1W9UA 2F23A 3BXWA 4Z2GA 3GPKA
chains in the Genus database with same CATH topology
3WD2A 1F40A 2B31A 4DWSB 2OFNA 3AS3A 3CHEA 3PRBA 4MNJA 5JH8A 2YBTA 3O5FA 1ZBCA 4ODNA 1FKFA 1ZCNA 3B7XA 3NRKA 2OLHA 2PV3A 1E15A 4HBEA 1Y0OA 3MDYB 4JFIA 1JNSA 4AY1A 4PTMA 1XRVA 3CGMA 2ITKA 1X6LA 1NSGA 1HKMA 4MAVA 4U86A 1NWSA 3ARYA 2MLZA 4QZVB 1EYMA 1EHNA 3NTPA 4NZCA 2MPHA 3JYMA 4DWSD 3AS1A 2DPEA 5HUAA 3IK8A 3H9RB 1ZL1A 4R5EA 2DG9A 2O9OA 4WKFA 2XP6A 4LAYA 1ZK6A 1EQ3A 1GOIA 2XPBA 4DRHA 1R9HA 1GPFA 3TC5A 5DIVA 1K9TA 1LL7A 1M5YA 3B9AA 1WNOA 2ZQVA 3O5EA 1HXVA 4GIVA 2QF8A 4JFJA 4Q7NA 4Z2LA 3TDBA 1T11A 3KAIA 3IKDA 2UZ5A 2A3EA 4FAPA 1LJYA 2XP9A 3KZ7A 4JFLA 3O5DA 1HKIA 1NWRA 2F2DA 3TCZA 2AOSA 4MNMA 1WB0A 1FKSA 1NWTA 3CZ8A 1ZBKA 1Q6HA 3KAHA 3AROA 2O92A 1BKFA 2XP7A 2DSVA 1FKTA 4TNSA 3WD3A 3FY1A 2WK2A 3KAGA 4ODLA 3O5PA 5DO2A 2M2AA 5HBFA 3UQBA 1W9VA 3RM9A 3WD4A 1U79A 4W9PA 4W9QA 2KE0A 4BF8A 1LL4A 3G6LA 1FFRA 1H0IA 4C02B 4Z2JA 5J6EA 1W1TA 1GUVA 1SYTA 4DZ2A 3ARSA 4L72B 4HBOA 4ITZA 1ROTA 3OA5A 2WLYA 4P8VA 2PV1A 1NMVA 4ODPA 4DRMA 2XP3A 5HTGA 4DROA 2N87A 1N1AA 3O5RA 4KQZA 1FKRA 1JNEA 3ARRA 2ZR5A 1NMWA 3VAWA 3AQUA 4ML4A 4J4NA 5HW7A 1D6OA 1FD9A 2LKNA 3O5OA 3AS0A 3RFWA 4ODRA 1PINA 2D9FA 3UQAA 2WM0A 4ODOA 2PPOA 3ARXA 1LG1A 3EY6A 1EDQA 1Q6IA 4P8UA 5GPGA 2LPVA 3ARTA 4HARA 4DZ3A 5HW6A 3IHZA 4Z2HA 3UF8A 3O5MA 2IUZA 3ARVA 5HWBA 1E6PA 3WKZA 2PBCA 2KGJA 2RUDA 3B9EA 4WJXA 4DWSA 1J4IA 3ALFA 1QZ2A 2DG4A 2DT2A 4DT4A 2DSUA 2LGOA 5HT1A 4FN2A 3WQVA 3UI5A 2VN1A 2F4EA 1P5QA 1A7XA 3KADA 4WKHA 1FKKA 1FAPA 2MF9A 1FKIA 2KO7A 1C9HA 4W9OA 4URIA 3RGCA 1OWQA 3AS2A 3PRDA 4MPKA 5GPRA 1TFVA 4L3NA 4MNLA 1QPFA 3O5QA 4U84A 4DRKA 4S3KA 1JVWA 3KABA 2WLZA 4P8XA 1HKJA 1O6IA 2Y78A 2PI6A 1E9LA 4DRPA 4TYOA 1ITXA 3JXVA 1HJVA 2ESCA 5D75A 1ZB5A 1FJDA 2KI3A 4QIBA 1ZBVA 1HKKA 2AWGA 3CHCA 3ARQA 4P8WA 2PPNA 2A3CA 4QT2A 5BXJA 3O5IA 1HJWA 2FAPA 2G8ZA 4DH0A 3JYJA 1FKHA 4Z2IA 4TW6A 2MLXA 3KAFA 2VCDA 1Q6UA 3B8SA 2ZQSA 4WK9A 4MNKA 3RMEA 5DEZA 4R0XA 2YBUA 3WIJA 3UI4A 1B6CA 2DT0A 3RM8A 4IT4A 3KCEA 1NWUA 4JFMA 4DRQA 2RSEA 4TX0A 4IQ2A 5HW8A 4KR0B 1FKDA 3NI6A 3RM4A 1FFQA 5DITA 4ODKA 4JFKA 1OGGA 2KFWA 3PA7A 3LUOA 3WQWA 5HKGA 3CGNA 5DIUA 1ROUA 2Q5AA 3ARUA 3QOKA 2F21A 4GGQA 3FAPA 3WL0A 1F8AB 1LQ0A 4G2PA 1W9PA 1VF8A 1D7JA 4G50A 1FKBA 5HWCA 2XP8A 4NNRA 2A3AA 2DT3A 2G41A 1YW5A 2RURA 1XHGA 2DG3A 4NSBA 2RQSA 4XAKA 2PV2A 4MTVA 3W4RA 2DSWA 1ZU8A 1JNTA 3CHDA 1H0GA 3PRAA 4QT3A 1E6NA 1W1VA 4O2TA 4Q22A 4DIPA 3ODKA 4WKAA 3IKGA 2IF4A 4S3JA 2FDMA 2ZQUA 2ZR4A 1Q1CA 4MGVA 4U85A 1CTNA 4ZPWR 1QPLA 2FKEA 1KFWA 3O5LA 1OGBA 2MLYA 1D7IA 3CH9A 4J4OA 4LAXA 3ARWA 2XP4A 2RUCA 2KR7A 2A3BA 3WH0A 5B8IC 1KT1A 1RD6A 3WL1A 1HJXA 2M08A 4IT6A 1UR8A 4ODMA 4IPXA 4LGXA 1PBKA 1L1PA 4ZPTR 1BL4A 1J4HA 1WAWA 4LAVA 1SR0A 1J6YA 5I98A 5GQBA 4Z2KA 3CHFA 3PR9A 4TW7A 3ARZA 3KACA 4DWSC 2DSZA 5DF0A 1EIBA 3ARPA 2PPPA 3WD1A 1FKLA 4IQCA 1W26A 3FXYA 1KT0A 3UI6A 1E6RA 3O5JA 4W5UA 3UQIA 1X6NA 2JZVA 1IX5A 3ALGA 4ODQA 1J4RA 1LG2A 2XP5A 2DT1A 4ZPVR 4ZS6A 1LL6A 2XPAA 2LJ4A 4MSPA 3G6MA 1JNDA 1FKJA 1W1PA 3I6CA 2M1IA 1TCOC 4DRJA 4LAWA 1D2KA 3O5GA 4N19A 1E6ZA 2K8IA 1UR9A 2L2SA 1D7HA 2RUQA 1NH6A 2ZQTA 1FKGA 4DRNA 1ZBWA 4DRIA 1YATA 4WIWA 4TW8A 3WD0A 3OOBA 1W1YA 2ZR6A 3B9DA 3O5KA 2MNTA 4JYSA 1W9UA 3BXWA 4Z2GA 3GPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7I A;  1JVW A;  2M2A A;  3KAB A;  3O5P A;  4J4O A;  3UQB A;  1F40 A;  4LAX A;  2OFN A;  2XP4 A;  2Y78 A;  2RUC A;  1U79 A;  4W9P A;  2KR7 A;  4DRP A;  3WH0 A;  4TYO A;  4W9Q A;  2KE0 A;  3JXV A;  3PRB A;  4BF8 A;  5B8I C;  5D75 A;  1KT1 A;  3O5F A;  1FJD A;  2KI3 A;  4C02 B;  4QIB A;  5J6E A;  2M08 A;  4ODN A;  2AWG A;  4ODM A;  4IPX A;  4DZ2 A;  2PPN A;  1FKF A;  1ZCN A;  3B7X A;  3NRK A;  4QT2 A;  5BXJ A;  1PBK A;  3O5I A;  2FAP A;  1L1P A;  4ITZ A;  4DH0 A;  3JYJ A;  1ROT A;  1BL4 A;  2PV3 A;  1J4H A;  4JFI A;  1FKH A;  1Y0O A;  3MDY B;  2PV1 A;  1JNS A;  4TW6 A;  2MLX A;  1NMV A;  2VCD A;  3KAF A;  4LAV A;  4ODP A;  4DRM A;  2XP3 A;  5HTG A;  5I98 A;  4DRO A;  1Q6U A;  2N87 A;  1N1A A;  3O5R A;  3CGM A;  2ZQS A;  4TW7 A;  1FKR A;  3KAC A;  2ITK A;  1NSG A;  2ZR5 A;  4U86 A;  1NMW A;  3VAW A;  4DRN A;  4R0X A;  2PPP A;  2MLZ A;  4J4N A;  5HW7 A;  3UI4 A;  1B6C A;  1D6O A;  1FD9 A;  1EYM A;  1FKL A;  3NTP A;  2LKN A;  3KCE A;  2MPH A;  3O5O A;  4JFM A;  4DRQ A;  2RSE A;  3JYM A;  4IQC A;  4TX0 A;  3RFW A;  1W26 A;  4IQ2 A;  5HW8 A;  1KT0 A;  4ODR A;  1PIN A;  3UI6 A;  5HUA A;  3IK8 A;  1FKD A;  3O5J A;  2D9F A;  3NI6 A;  3UQI A;  2JZV A;  3UQA A;  4ODO A;  3H9R B;  2PPO A;  4DRK A;  5DIT A;  4ODQ A;  2DG9 A;  3EY6 A;  1Q6I A;  4ODK A;  1J4R A;  4JFK A;  2XP6 A;  2KFW A;  3PA7 A;  4LAY A;  5GPG A;  2LPV A;  1ZK6 A;  2XP5 A;  3LUO A;  1EQ3 A;  4DZ3 A;  2XPB A;  5HW6 A;  2XPA A;  4DRH A;  1R9H A;  2LJ4 A;  3IHZ A;  4MSP A;  3UF8 A;  3O5M A;  5HWB A;  3TC5 A;  1FKJ A;  5HKG A;  5DIV A;  3CGN A;  2PBC A;  1M5Y A;  3I6C A;  2M1I A;  2KGJ A;  2RUD A;  5DIU A;  1ROU A;  2Q5A A;  2ZQV A;  3O5E A;  1TCO C;  1HXV A;  4GIV A;  4JFJ A;  2F21 A;  4DRJ A;  4GGQ A;  3FAP A;  1F8A B;  1J4I A;  4G2P A;  4LAW A;  3O5G A;  4N19 A;  1QZ2 A;  2DG4 A;  4DT4 A;  3TDB A;  2LGO A;  5HT1 A;  1D7J A;  4G50 A;  1FKB A;  5HWC A;  2XP8 A;  4FN2 A;  1T11 A;  3KAI A;  2K8I A;  3IKD A;  4NNR A;  3UI5 A;  2L2S A;  1YW5 A;  2VN1 A;  1D7H A;  2UZ5 A;  2F4E A;  2RUQ A;  1P5Q A;  1A7X A;  2RUR A;  3KAD A;  4FAP A;  1FKK A;  1FAP A;  2XP9 A;  2DG3 A;  2RQS A;  1FKG A;  2PV2 A;  2ZQT A;  3KZ7 A;  3O5D A;  2MF9 A;  2F2D A;  1YAT A;  4JFL A;  3TCZ A;  4DRI A;  1FKI A;  2KO7 A;  4TW8 A;  1C9H A;  1JNT A;  3OOB A;  4W9O A;  1FKS A;  3RGC A;  2ZR6 A;  3PRD A;  1Q6H A;  4QT3 A;  1J6Y A;  3KAH A;  3O5K A;  4O2T A;  2MNT A;  4JYS A;  3ODK A;  4DIP A;  3IKG A;  1BKF A;  2IF4 A;  2ZQU A;  2ZR4 A;  1Q1C A;  2XP7 A;  4MGV A;  4U85 A;  1FKT A;  1QPL A;  2FKE A;  4TNS A;  1QPF A;  3O5Q A;  4ODL A;  3KAG A;  3O5L A;  4U84 A;  3GPK A;  2MLY A; 
#chains in the Genus database with same CATH topology
 3WD2 A;  1F40 A;  2B31 A;  4DWS B;  2OFN A;  3AS3 A;  3CHE A;  3PRB A;  4MNJ A;  5JH8 A;  2YBT A;  3O5F A;  1ZBC A;  4ODN A;  1FKF A;  1ZCN A;  3B7X A;  3NRK A;  2OLH A;  2PV3 A;  1E15 A;  4HBE A;  1Y0O A;  3MDY B;  4JFI A;  1JNS A;  4AY1 A;  4PTM A;  1XRV A;  3CGM A;  2ITK A;  1X6L A;  1NSG A;  1HKM A;  4MAV A;  4U86 A;  1NWS A;  3ARY A;  2MLZ A;  4QZV B;  2P4V A;  1EYM A;  1EHN A;  3NTP A;  4NZC A;  2MPH A;  3JYM A;  4DWS D;  3AS1 A;  2DPE A;  5HUA A;  3IK8 A;  1GRJ A;  3H9R B;  1ZL1 A;  4R5E A;  2DG9 A;  2O9O A;  4WKF A;  2XP6 A;  4LAY A;  1ZK6 A;  1EQ3 A;  1GOI A;  2XPB A;  4DRH A;  1R9H A;  1GPF A;  3TC5 A;  5DIV A;  1K9T A;  1LL7 A;  1M5Y A;  3B9A A;  1WNO A;  2ZQV A;  3O5E A;  1HXV A;  4GIV A;  2QF8 A;  4JFJ A;  4Q7N A;  4Z2L A;  3TDB A;  1T11 A;  3KAI A;  3IKD A;  2UZ5 A;  2A3E A;  4FAP A;  1LJY A;  2XP9 A;  3KZ7 A;  3O5D A;  4JFL A;  1HKI A;  1NWR A;  2F2D A;  3TCZ A;  2AOS A;  4MNM A;  1WB0 A;  1FKS A;  1NWT A;  3CZ8 A;  1ZBK A;  1Q6H A;  3KAH A;  3ARO A;  2O92 A;  1BKF A;  2XP7 A;  2DSV A;  1FKT A;  4TNS A;  3WD3 A;  3FY1 A;  2WK2 A;  3KAG A;  4ODL A;  3O5P A;  5DO2 A;  2M2A A;  5HBF A;  3UQB A;  1W9V A;  3RM9 A;  3WD4 A;  1U79 A;  4W9P A;  4W9Q A;  2KE0 A;  4BF8 A;  1LL4 A;  3G6L A;  1FFR A;  1H0I A;  4C02 B;  4Z2J A;  5J6E A;  1W1T A;  1GUV A;  1SYT A;  4DZ2 A;  3ARS A;  4L72 B;  4HBO A;  4ITZ A;  1ROT A;  3OA5 A;  2WLY A;  4P8V A;  2PV1 A;  2B5U B;  1NMV A;  4ODP A;  4DRM A;  2XP3 A;  5HTG A;  4DRO A;  2N87 A;  1N1A A;  3O5R A;  4KQZ A;  1FKR A;  1JNE A;  3ARR A;  2ZR5 A;  1NMW A;  3VAW A;  3AQU A;  4ML4 A;  4J4N A;  5HW7 A;  1D6O A;  1FD9 A;  2LKN A;  3O5O A;  3AS0 A;  3RFW A;  1JCH B;  4ODR A;  1PIN A;  2D9F A;  3UQA A;  2WM0 A;  4ODO A;  2PPO A;  3ARX A;  1LG1 A;  3EY6 A;  1EDQ A;  1Q6I A;  4P8U A;  5GPG A;  2LPV A;  3ART A;  4HAR A;  4DZ3 A;  5HW6 A;  3IHZ A;  4Z2H A;  3UF8 A;  3O5M A;  2IUZ A;  3ARV A;  5HWB A;  1E6P A;  3WKZ A;  2PBC A;  2KGJ A;  2RUD A;  3B9E A;  4WJX A;  4DWS A;  1J4I A;  3ALF A;  1QZ2 A;  2DG4 A;  2DT2 A;  4DT4 A;  2DSU A;  2LGO A;  5HT1 A;  3EIP A;  4FN2 A;  3WQV A;  3UI5 A;  2VN1 A;  2F4E A;  1P5Q A;  1A7X A;  3KAD A;  4WKH A;  1FKK A;  1FAP A;  2MF9 A;  1FKI A;  2KO7 A;  1C9H A;  4W9O A;  4URI A;  3RGC A;  1OWQ A;  3AS2 A;  3PRD A;  4MPK A;  5GPR A;  1TFV A;  4L3N A;  4MNL A;  1QPF A;  3O5Q A;  4U84 A;  4DRK A;  4S3K A;  1JVW A;  3KAB A;  2WLZ A;  4P8X A;  1HKJ A;  1O6I A;  2Y78 A;  2PI6 A;  1E9L A;  4DRP A;  4TYO A;  1ITX A;  3JXV A;  1HJV A;  2ESC A;  5D75 A;  1ZB5 A;  1FJD A;  2ETN A;  2KI3 A;  4QIB A;  1ZBV A;  1HKK A;  2AWG A;  3CHC A;  3ARQ A;  4P8W A;  2PPN A;  2A3C A;  4QT2 A;  5BXJ A;  3O5I A;  1HJW A;  2FAP A;  3GTY X;  2G8Z A;  4DH0 A;  3JYJ A;  3GU0 A;  1FKH A;  4Z2I A;  2EUL A;  4TW6 A;  2MLX A;  3KAF A;  2VCD A;  1Q6U A;  3B8S A;  2ZQS A;  4WK9 A;  4MNK A;  3RME A;  5DEZ A;  4R0X A;  2YBU A;  3WIJ A;  3UI4 A;  1B6C A;  2DT0 A;  3RM8 A;  4IT4 A;  3KCE A;  1NWU A;  4JFM A;  4DRQ A;  2RSE A;  4TX0 A;  4IQ2 A;  5HW8 A;  4KR0 B;  1FKD A;  3NI6 A;  3RM4 A;  1FFQ A;  5DIT A;  4ODK A;  4JFK A;  1OGG A;  2KFW A;  3PA7 A;  3LUO A;  3WQW A;  5HKG A;  3CGN A;  5DIU A;  1ROU A;  2Q5A A;  3ARU A;  3QOK A;  2F21 A;  4GGQ A;  3FAP A;  3WL0 A;  1F8A B;  1LQ0 A;  4G2P A;  1W9P A;  1VF8 A;  1D7J A;  4G50 A;  1FKB A;  5HWC A;  2XP8 A;  4NNR A;  2A3A A;  2DT3 A;  2G41 A;  1YW5 A;  2RUR A;  1XHG A;  2DG3 A;  4NSB A;  2RQS A;  4XAK A;  2PV2 A;  4MTV A;  3W4R A;  2DSW A;  1ZU8 A;  1JNT A;  3CHD A;  1H0G A;  3PRA A;  4QT3 A;  1E6N A;  1W1V A;  4O2T A;  4Q22 A;  4DIP A;  3ODK A;  4WKA A;  3IKG A;  2IF4 A;  4S3J A;  2FDM A;  2ZQU A;  2ZR4 A;  1Q1C A;  4MGV A;  4U85 A;  1CTN A;  4ZPW R;  1QPL A;  2FKE A;  1KFW A;  3O5L A;  1OGB A;  2MLY A;  1D7I A;  3CH9 A;  4J4O A;  4LAX A;  3ARW A;  2XP4 A;  2RUC A;  2KR7 A;  2A3B A;  3WH0 A;  5B8I C;  1KT1 A;  1RD6 A;  3WL1 A;  1HJX A;  2M08 A;  4IT6 A;  1UR8 A;  4ODM A;  1E44 A;  4IPX A;  4LGX A;  1PBK A;  1L1P A;  4ZPT R;  1BL4 A;  1J4H A;  1WAW A;  4LAV A;  1SR0 A;  1J6Y A;  5I98 A;  5GQB A;  4Z2K A;  3CHF A;  3PR9 A;  4TW7 A;  3ARZ A;  3KAC A;  4DWS C;  2DSZ A;  4UDM A;  5DF0 A;  1EIB A;  3ARP A;  2PPP A;  3WD1 A;  1FKL A;  4IQC A;  1W26 A;  3FXY A;  1KT0 A;  3UI6 A;  1E6R A;  3O5J A;  4W5U A;  3UQI A;  1X6N A;  2JZV A;  1IX5 A;  3ALG A;  4ODQ A;  1J4R A;  1LG2 A;  2XP5 A;  2DT1 A;  4ZPV R;  4ZS6 A;  1LL6 A;  2XPA A;  2LJ4 A;  4MSP A;  3G6M A;  1JND A;  1FKJ A;  1W1P A;  3I6C A;  2M1I A;  1TCO C;  4DRJ A;  4LAW A;  1D2K A;  2PN0 A;  3O5G A;  4N19 A;  1E6Z A;  2K8I A;  1UR9 A;  2L2S A;  1D7H A;  2RUQ A;  1NH6 A;  2ZQT A;  1FKG A;  4DRN A;  1ZBW A;  4DRI A;  1YAT A;  4WIW A;  4TW8 A;  3WD0 A;  3OOB A;  1W1Y A;  2ZR6 A;  3B9D A;  3O5K A;  2MNT A;  4JYS A;  3BMB A;  1W9U A;  2F23 A;  3BXW A;  4Z2G A;  3GPK A; 
#chains in the Genus database with same CATH homology
 3WD2 A;  1F40 A;  2B31 A;  4DWS B;  2OFN A;  3AS3 A;  3CHE A;  3PRB A;  4MNJ A;  5JH8 A;  2YBT A;  3O5F A;  1ZBC A;  4ODN A;  1FKF A;  1ZCN A;  3B7X A;  3NRK A;  2OLH A;  2PV3 A;  1E15 A;  4HBE A;  1Y0O A;  3MDY B;  4JFI A;  1JNS A;  4AY1 A;  4PTM A;  1XRV A;  3CGM A;  2ITK A;  1X6L A;  1NSG A;  1HKM A;  4MAV A;  4U86 A;  1NWS A;  3ARY A;  2MLZ A;  4QZV B;  1EYM A;  1EHN A;  3NTP A;  4NZC A;  2MPH A;  3JYM A;  4DWS D;  3AS1 A;  2DPE A;  5HUA A;  3IK8 A;  3H9R B;  1ZL1 A;  4R5E A;  2DG9 A;  2O9O A;  4WKF A;  2XP6 A;  4LAY A;  1ZK6 A;  1EQ3 A;  1GOI A;  2XPB A;  4DRH A;  1R9H A;  1GPF A;  3TC5 A;  5DIV A;  1K9T A;  1LL7 A;  1M5Y A;  3B9A A;  1WNO A;  2ZQV A;  3O5E A;  1HXV A;  4GIV A;  2QF8 A;  4JFJ A;  4Q7N A;  4Z2L A;  3TDB A;  1T11 A;  3KAI A;  3IKD A;  2UZ5 A;  2A3E A;  4FAP A;  1LJY A;  2XP9 A;  3KZ7 A;  4JFL A;  3O5D A;  1HKI A;  1NWR A;  2F2D A;  3TCZ A;  2AOS A;  4MNM A;  1WB0 A;  1FKS A;  1NWT A;  3CZ8 A;  1ZBK A;  1Q6H A;  3KAH A;  3ARO A;  2O92 A;  1BKF A;  2XP7 A;  2DSV A;  1FKT A;  4TNS A;  3WD3 A;  3FY1 A;  2WK2 A;  3KAG A;  4ODL A;  3O5P A;  5DO2 A;  2M2A A;  5HBF A;  3UQB A;  1W9V A;  3RM9 A;  3WD4 A;  1U79 A;  4W9P A;  4W9Q A;  2KE0 A;  4BF8 A;  1LL4 A;  3G6L A;  1FFR A;  1H0I A;  4C02 B;  4Z2J A;  5J6E A;  1W1T A;  1GUV A;  1SYT A;  4DZ2 A;  3ARS A;  4L72 B;  4HBO A;  4ITZ A;  1ROT A;  3OA5 A;  2WLY A;  4P8V A;  2PV1 A;  1NMV A;  4ODP A;  4DRM A;  2XP3 A;  5HTG A;  4DRO A;  2N87 A;  1N1A A;  3O5R A;  4KQZ A;  1FKR A;  1JNE A;  3ARR A;  2ZR5 A;  1NMW A;  3VAW A;  3AQU A;  4ML4 A;  4J4N A;  5HW7 A;  1D6O A;  1FD9 A;  2LKN A;  3O5O A;  3AS0 A;  3RFW A;  4ODR A;  1PIN A;  2D9F A;  3UQA A;  2WM0 A;  4ODO A;  2PPO A;  3ARX A;  1LG1 A;  3EY6 A;  1EDQ A;  1Q6I A;  4P8U A;  5GPG A;  2LPV A;  3ART A;  4HAR A;  4DZ3 A;  5HW6 A;  3IHZ A;  4Z2H A;  3UF8 A;  3O5M A;  2IUZ A;  3ARV A;  5HWB A;  1E6P A;  3WKZ A;  2PBC A;  2KGJ A;  2RUD A;  3B9E A;  4WJX A;  4DWS A;  1J4I A;  3ALF A;  1QZ2 A;  2DG4 A;  2DT2 A;  4DT4 A;  2DSU A;  2LGO A;  5HT1 A;  4FN2 A;  3WQV A;  3UI5 A;  2VN1 A;  2F4E A;  1P5Q A;  1A7X A;  3KAD A;  4WKH A;  1FKK A;  1FAP A;  2MF9 A;  1FKI A;  2KO7 A;  1C9H A;  4W9O A;  4URI A;  3RGC A;  1OWQ A;  3AS2 A;  3PRD A;  4MPK A;  5GPR A;  1TFV A;  4L3N A;  4MNL A;  1QPF A;  3O5Q A;  4U84 A;  4DRK A;  4S3K A;  1JVW A;  3KAB A;  2WLZ A;  4P8X A;  1HKJ A;  1O6I A;  2Y78 A;  2PI6 A;  1E9L A;  4DRP A;  4TYO A;  1ITX A;  3JXV A;  1HJV A;  2ESC A;  5D75 A;  1ZB5 A;  1FJD A;  2KI3 A;  4QIB A;  1ZBV A;  1HKK A;  2AWG A;  3CHC A;  3ARQ A;  4P8W A;  2PPN A;  2A3C A;  4QT2 A;  5BXJ A;  3O5I A;  1HJW A;  2FAP A;  2G8Z A;  4DH0 A;  3JYJ A;  1FKH A;  4Z2I A;  4TW6 A;  2MLX A;  3KAF A;  2VCD A;  1Q6U A;  3B8S A;  2ZQS A;  4WK9 A;  4MNK A;  3RME A;  5DEZ A;  4R0X A;  2YBU A;  3WIJ A;  3UI4 A;  1B6C A;  2DT0 A;  3RM8 A;  4IT4 A;  3KCE A;  1NWU A;  4JFM A;  4DRQ A;  2RSE A;  4TX0 A;  4IQ2 A;  5HW8 A;  4KR0 B;  1FKD A;  3NI6 A;  3RM4 A;  1FFQ A;  5DIT A;  4ODK A;  4JFK A;  1OGG A;  2KFW A;  3PA7 A;  3LUO A;  3WQW A;  5HKG A;  3CGN A;  5DIU A;  1ROU A;  2Q5A A;  3ARU A;  3QOK A;  2F21 A;  4GGQ A;  3FAP A;  3WL0 A;  1F8A B;  1LQ0 A;  4G2P A;  1W9P A;  1VF8 A;  1D7J A;  4G50 A;  1FKB A;  5HWC A;  2XP8 A;  4NNR A;  2A3A A;  2DT3 A;  2G41 A;  1YW5 A;  2RUR A;  1XHG A;  2DG3 A;  4NSB A;  2RQS A;  4XAK A;  2PV2 A;  4MTV A;  3W4R A;  2DSW A;  1ZU8 A;  1JNT A;  3CHD A;  1H0G A;  3PRA A;  4QT3 A;  1E6N A;  1W1V A;  4O2T A;  4Q22 A;  4DIP A;  3ODK A;  4WKA A;  3IKG A;  2IF4 A;  4S3J A;  2FDM A;  2ZQU A;  2ZR4 A;  1Q1C A;  4MGV A;  4U85 A;  1CTN A;  4ZPW R;  1QPL A;  2FKE A;  1KFW A;  3O5L A;  1OGB A;  2MLY A;  1D7I A;  3CH9 A;  4J4O A;  4LAX A;  3ARW A;  2XP4 A;  2RUC A;  2KR7 A;  2A3B A;  3WH0 A;  5B8I C;  1KT1 A;  1RD6 A;  3WL1 A;  1HJX A;  2M08 A;  4IT6 A;  1UR8 A;  4ODM A;  4IPX A;  4LGX A;  1PBK A;  1L1P A;  4ZPT R;  1BL4 A;  1J4H A;  1WAW A;  4LAV A;  1SR0 A;  1J6Y A;  5I98 A;  5GQB A;  4Z2K A;  3CHF A;  3PR9 A;  4TW7 A;  3ARZ A;  3KAC A;  4DWS C;  2DSZ A;  5DF0 A;  1EIB A;  3ARP A;  2PPP A;  3WD1 A;  1FKL A;  4IQC A;  1W26 A;  3FXY A;  1KT0 A;  3UI6 A;  1E6R A;  3O5J A;  4W5U A;  3UQI A;  1X6N A;  2JZV A;  1IX5 A;  3ALG A;  4ODQ A;  1J4R A;  1LG2 A;  2XP5 A;  2DT1 A;  4ZPV R;  4ZS6 A;  1LL6 A;  2XPA A;  2LJ4 A;  4MSP A;  3G6M A;  1JND A;  1FKJ A;  1W1P A;  3I6C A;  2M1I A;  1TCO C;  4DRJ A;  4LAW A;  1D2K A;  3O5G A;  4N19 A;  1E6Z A;  2K8I A;  1UR9 A;  2L2S A;  1D7H A;  2RUQ A;  1NH6 A;  2ZQT A;  1FKG A;  4DRN A;  1ZBW A;  4DRI A;  1YAT A;  4WIW A;  4TW8 A;  3WD0 A;  3OOB A;  1W1Y A;  2ZR6 A;  3B9D A;  3O5K A;  2MNT A;  4JYS A;  1W9U A;  3BXW A;  4Z2G A;  3GPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...