2L2SA

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
rcsb
molecule keywords Peptidyl-prolyl cis-trans isomerase
molecule tags Isomerase
source organism Burkholderia pseudomallei
total genus 13
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2l2sA00
2RQSA 2VCDA 3I6CA 4DT4A 2LGOA 2ZR4A 1ZK6A 3IKGA 1PBKA 4JFJA 2UZ5A 2KO7A 1NMWA 2LJ4A 3KACA 3KZ7A 1R9HA 1KT1A 5GPGA 1FKTA 4ODRA 4GIVA 4TYOA 2AWGA 3O5QA 4O2TA 5HW6A 4DRPA 1Y0OA 4MGVA 2XP9A 1T11A 3TCZA 3NTPA 2ZQUA 2MNTA 4W9PA 3O5OA 2PV1A 3O5EA 5J6EA 1J6YA 1FKSA 3MDYB 1NMVA 3O5MA 3KADA 1Q6UA 3CGMA 4DRJA 2XP3A 1ZCNA 2RUCA 3NI6A 4IQCA 3O5KA 3FAPA 3UI4A 2JZVA 5DITA 2KGJA 2KE0A 2PPOA 4GGQA 2OFNA 4R0XA 4DIPA 3KABA 2Q5AA 1Q6HA 3NRKA 3LUOA 4LAVA 4TW8A 1BKFA 2ZR5A 3RFWA 3RGCA 1HXVA 1TCOC 1FKGA 2MLYA 3CGNA 1N1AA 3O5GA 4ITZA 2FAPA 2KR7A 2MLZA 2N87A 2PPPA 4DRIA 5D75A 3UQAA 1FJDA 3O5LA 4NNRA 1FKDA 1D7JA 2D9FA 1EYMA 1J4RA 4JYSA 2XP6A 4ODOA 4DRKA 2Y78A 5I98A 1C9HA 1FKJA 1PINA 3KAHA 3KAFA 2PPNA 3ODKA 3PA7A 2ZQSA 4W9QA 1FKFA 2XP7A 2LPVA 2IF4A 3O5IA 4LAXA 4TNSA 4DRNA 3TC5A 4IQ2A 1B6CA 1QPLA 3KCEA 3O5RA 4DRMA 4TX0A 1QPFA 4ODKA 1BL4A 2PBCA 2RSEA 4FN2A 5HW7A 1Q1CA 3PRDA 4TW6A 2PV3A 3IHZA 5DIVA 3TDBA 5HUAA 1FAPA 4ODLA 3JYMA 1F8AB 1FKIA 2K8IA 1M5YA 2M08A 2VN1A 3JXVA 4IPXA 1D7HA 3PRBA 4FAPA 1P5QA 3UQBA 4JFMA 1Q6IA 1W26A 2FKEA 4U85A 2XPAA 3OOBA 2XP8A 4DRQA 1L1PA 2RUQA 1JVWA 2F2DA 1FKHA 2DG4A 3H9RB 4DRHA 1U79A 2XPBA 2PV2A 2LKNA 3O5JA 3IK8A 1F40A 4QIBA 4JFKA 4QT2A 2XP4A 4JFIA 4U84A 4N19A 4DZ3A 4MSPA 1QZ2A 4DZ2A 4DROA 1JNSA 5HWCA 3O5PA 2L2SA 4J4NA 4JFLA 3UI5A 1J4IA 1YW5A 4G2PA 2M1IA 4W9OA 5DIUA 3WH0A 2XP5A 4C02B 4QT3A 4ODPA 3VAWA 2KI3A 2F21A 5HT1A 4J4OA 4LAYA 3KAGA 3O5DA 1FD9A 2F4EA 1FKKA 1KT0A 1NSGA 1ROTA 5HKGA 3UQIA 5HWBA 5BXJA 1D7IA 2ZQTA 4ODNA 4ODMA 1JNTA 1A7XA 4U86A 2ITKA 1D6OA 3IKDA 3UF8A 3UI6A 5B8IC 1ROUA 2ZR6A 2MPHA 1YATA 4LAWA 3O5FA 2MF9A 1J4HA 2M2AA 4ODQA 2RUDA 3EY6A 2DG9A 5HW8A 3KAIA 1FKRA 5HTGA 2RURA 4DH0A 1FKBA 4TW7A 2DG3A 2MLXA 2ZQVA 4G50A 2KFWA 3GPKA 1EQ3A 3B7XA 1FKLA 3JYJA 4BF8A
chains in the Genus database with same CATH superfamily
1ZU8A 2RQSA 3I6CA 2ESCA 3RM9A 1PBKA 4JFJA 2UZ5A 3ARSA 3AS0A 4TYOA 4DRPA 1Y0OA 2MNTA 1FKSA 1NMVA 3WL0A 2XP3A 2RUCA 1ZBKA 4P8UA 1LL4A 3O5KA 1GPFA 2JZVA 2DPEA 2Q5AA 4QZVB 4DWSD 1HXVA 1KFWA 4ITZA 4ZS6A 3ARQA 1D7JA 2D9FA 1GUVA 4MAVA 4MNMA 4WKFA 4DRKA 4Z2GA 1O6IA 1NWRA 2PPNA 4W9QA 1JNDA 2XP7A 4IT6A 2WK2A 4LAXA 1HKMA 3ARPA 3TC5A 4IQ2A 1TFVA 3AQUA 2A3BA 2PBCA 3CHCA 1LL7A 1GRJA 2RSEA 4IT4A 3PRDA 1SYTA 5DIVA 4ZPVR 2K8IA 1M5YA 2VN1A 3JXVA 3PRAA 4IPXA 1E15A 4WJXA 1P5QA 3UQBA 4UDMA 3B8SA 2RUQA 2P4VA 4Q7NA 2DG4A 3H9RB 4Z2LA 2PV2A 1F40A 1HJWA 3ALFA 3UI5A 4JFLA 4C02B 5HT1A 1W1PA 3O5DA 1FD9A 1ZBCA 1KT0A 4ZPWR 3UQIA 4ODMA 3WD1A 3ARXA 3UF8A 3UI6A 3ARTA 4LAWA 3O5FA 4PTMA 4HARA 4ZPTR 4ODQA 2RUDA 3EY6A 1X6LA 1FKRA 2RURA 2MLXA 1W1YA 3GPKA 2DT1A 4NZCA 1E6NA 2VCDA 2LGOA 1ZL1A 3AS3A 1WB0A 2LJ4A 1R9HA 1FKTA 5DEZA 2AWGA 3O5QA 4O2TA 4P8XA 3CHFA 3NTPA 2ZQUA 3CZ8A 5JH8A 3CHEA 1Q6UA 2DSVA 2A3EA 3CGMA 3RM4A 1FFRA 2KGJA 4GGQA 1ZBWA 3LUOA 1BKFA 3CGNA 2MLYA 1N1AA 2KR7A 3UQAA 2PPPA 5D75A 3O5LA 2DT3A 1GOIA 1EYMA 1WAWA 2XP6A 5I98A 3ARVA 3KAHA 3AROA 3KAFA 3WIJA 3PA7A 1ZBVA 3O5IA 1SR0A 3WL1A 1QPLA 3KCEA 1XHGA 3RMEA 4ODKA 4FN2A 5HW7A 1Q1CA 3PR9A 1E6PA 1FAPA 4ODLA 1EHNA 1FKIA 2B31A 4FAPA 4L3NA 4JFMA 1Q6IA 3OOBA 1JVWA 1OGBA 2F2DA 4DRHA 1W9UA 4MPKA 4L72B 4QIBA 4JFKA 4QT2A 4JFIA 4U84A 4DZ2A 1QZ2A 3FY1A 1LJYA 1YW5A 4MNLA 4W9OA 5DIUA 3WKZA 1UR9A 4QT3A 4ODPA 4WK9A 4Q22A 2QF8A 1FFQA 4J4OA 3KAGA 1NSGA 5HWBA 1UR8A 1D7IA 5BXJA 2ZQTA 1A7XA 5B8IC 1ZB5A 4ML4A 4W5UA 2MF9A 2DG9A 3WQVA 4DH0A 1HJXA 2DG3A 2PI6A 4G50A 2KFWA 1EQ3A 1HKIA 1W1TA 3W4RA 4DWSC 4DT4A 1ZK6A 4S3JA 2KO7A 1XRVA 3KZ7A 2YBUA 1VF8A 3BXWA 4GIVA 4ODRA 2XP9A 1T11A 1W1VA 3TCZA 4MNJA 2PV1A 2DSZA 1W9VA 3O5MA 3KADA 1NH6A 1HKJA 1ZCNA 3NI6A 4IQCA 5DITA 2KE0A 4R0XA 3G6LA 2G41A 1Q6HA 3NRKA 5HBFA 4LAVA 3RFWA 2ZR5A 3RGCA 1FKGA 2MLZA 2N87A 1FJDA 3GTYX 1H0IA 3ALGA 2PN0A 4ODOA 4JYSA 1J4RA 1K9TA 1NWSA 2Y78A 4KR0B 1FKJA 3ODKA 4WIWA 2ZQSA 1OWQA 2DSWA 1RD6A 1LL6A 4TNSA 4HBOA 2O92A 1E44A 1B6CA 2AOSA 3O5RA 4Z2IA 4TX0A 1QPFA 3WD4A 1BL4A 2DT0A 4TW6A 3TDBA 1X6NA 3JYMA 1F8AB 2M08A 3B9AA 1D7HA 2WM0A 4S3KA 4DWSB 1W26A 4DRQA 1OGGA 1U79A 2LKNA 3IK8A 1HKKA 4Z2HA 4MSPA 5HWCA 3EIPA 2L2SA 3O5PA 4G2PA 3WH0A 3ARZA 1CTNA 3VAWA 2KI3A 2F21A 2F4EA 1FKKA 3ARYA 5HKGA 4Z2JA 4U86A 1JNTA 4P8WA 3WD2A 1D6OA 2ZR6A 1YATA 1J4HA 2M2AA 4R5EA 5HW8A 5HTGA 1E9LA 1FKBA 3WD0A 4MTVA 1FKLA 3RM8A 3JYJA 4BF8A 2O9OA 3CHDA 3IKGA 2ZR4A 1NMWA 3KACA 3G6MA 1WNOA 1KT1A 2OLHA 5GPGA 5HW6A 1E6RA 4MGVA 4W9PA 1E6ZA 3O5OA 1JNEA 3O5EA 5J6EA 1J6YA 3MDYB 1W9PA 1NWTA 4DRJA 3AS2A 5GQBA 3WD3A 3FAPA 3UI4A 2PPOA 4DIPA 2OFNA 3AS1A 3KABA 5GPRA 2F23A 4P8VA 4TW8A 3GU0A 1TCOC 3O5GA 2FAPA 4DRIA 4NNRA 1FKDA 3CH9A 2A3AA 4HBEA 4URIA 3WQWA 3FXYA 1C9HA 1PINA 1LQ0A 1IX5A 5DF0A 2FDMA 3B9EA 2ETNA 1FKFA 2LPVA 2IF4A 3ARWA 4DRNA 5DO2A 4DRMA 1EDQA 4LGXA 2PV3A 2WLZA 3IHZA 5HUAA 3PRBA 1LG1A 1LG2A 2FKEA 4U85A 4WKAA 2XPAA 4Z2KA 2XP8A 1L1PA 3ARUA 2G8ZA 1D2KA 1FKHA 1NWUA 4AY1A 2XPBA 3O5JA 2XP4A 4DZ3A 4N19A 1JNSA 4DROA 1H0GA 4J4NA 2WLYA 1J4IA 1HJVA 2M1IA 2XP5A 1EIBA 3OA5A 1ITXA 2YBTA 4LAYA 2DT2A 4KQZA 4WKHA 2EULA 1ROTA 4NSBA 3BMBA 3QOKA 1JCHB 4ODNA 2ITKA 3IKDA 1ROUA 2MPHA 3B9DA 2DSUA 2IUZA 2B5UB 3KAIA 4DWSA 4XAKA 4TW7A 2ZQVA 3ARRA 4MNKA 3B7XA 2A3CA
chains in the Genus database with same CATH topology
1ZU8A 2RQSA 3I6CA 2ESCA 3RM9A 1PBKA 4JFJA 2UZ5A 3ARSA 3AS0A 4TYOA 4DRPA 1Y0OA 2MNTA 1FKSA 1NMVA 3WL0A 2XP3A 2RUCA 1ZBKA 4P8UA 1LL4A 3O5KA 1GPFA 2JZVA 2DPEA 2Q5AA 4QZVB 4DWSD 1HXVA 1KFWA 4ITZA 4ZS6A 3ARQA 1D7JA 2D9FA 1GUVA 4MAVA 4MNMA 4WKFA 4DRKA 4Z2GA 1O6IA 1NWRA 2PPNA 4W9QA 1JNDA 2XP7A 4IT6A 2WK2A 4LAXA 1HKMA 3ARPA 3TC5A 4IQ2A 1TFVA 3AQUA 2A3BA 2PBCA 3CHCA 1LL7A 4IT4A 2RSEA 3PRDA 1SYTA 5DIVA 4ZPVR 2K8IA 1M5YA 2VN1A 3JXVA 3PRAA 4IPXA 1E15A 4WJXA 1P5QA 3UQBA 3B8SA 2RUQA 4Q7NA 2DG4A 3H9RB 4Z2LA 2PV2A 1F40A 1HJWA 3ALFA 3UI5A 4JFLA 4C02B 5HT1A 1W1PA 3O5DA 1FD9A 1ZBCA 1KT0A 4ZPWR 3UQIA 4ODMA 3WD1A 3ARXA 3UF8A 3UI6A 3ARTA 4LAWA 3O5FA 4PTMA 4HARA 4ZPTR 4ODQA 2RUDA 3EY6A 1X6LA 1FKRA 2RURA 2MLXA 1W1YA 3GPKA 2DT1A 4NZCA 1E6NA 2VCDA 2LGOA 1ZL1A 3AS3A 1WB0A 2LJ4A 1R9HA 1FKTA 5DEZA 2AWGA 3O5QA 4O2TA 4P8XA 3CHFA 3NTPA 2ZQUA 3CZ8A 5JH8A 3CHEA 1Q6UA 2DSVA 2A3EA 3CGMA 3RM4A 1FFRA 2KGJA 4GGQA 1ZBWA 3LUOA 1BKFA 3CGNA 2MLYA 1N1AA 2KR7A 3UQAA 2PPPA 5D75A 3O5LA 2DT3A 1GOIA 1EYMA 1WAWA 2XP6A 5I98A 3ARVA 3KAHA 3AROA 3KAFA 3WIJA 3PA7A 1ZBVA 3O5IA 1SR0A 3WL1A 1QPLA 3KCEA 1XHGA 3RMEA 4ODKA 4FN2A 5HW7A 1Q1CA 3PR9A 1E6PA 1FAPA 4ODLA 1EHNA 1FKIA 2B31A 4FAPA 4L3NA 4JFMA 1Q6IA 3OOBA 1JVWA 1OGBA 2F2DA 4DRHA 1W9UA 4MPKA 4L72B 4QIBA 4JFKA 4QT2A 4JFIA 4U84A 4DZ2A 1QZ2A 3FY1A 1LJYA 1YW5A 4MNLA 4W9OA 5DIUA 3WKZA 1UR9A 4QT3A 4ODPA 4WK9A 4Q22A 2QF8A 1FFQA 4J4OA 3KAGA 1NSGA 5HWBA 1UR8A 1D7IA 5BXJA 2ZQTA 1A7XA 5B8IC 1ZB5A 4ML4A 4W5UA 2MF9A 2DG9A 3WQVA 4DH0A 1HJXA 2DG3A 2PI6A 4G50A 2KFWA 1EQ3A 1HKIA 1W1TA 3W4RA 4DWSC 4DT4A 1ZK6A 4S3JA 2KO7A 1XRVA 3KZ7A 2YBUA 1VF8A 3BXWA 4GIVA 4ODRA 2XP9A 1T11A 1W1VA 3TCZA 4MNJA 2PV1A 2DSZA 1W9VA 3O5MA 3KADA 1NH6A 1HKJA 1ZCNA 3NI6A 4IQCA 5DITA 2KE0A 4R0XA 3G6LA 2G41A 1Q6HA 3NRKA 5HBFA 4LAVA 3RFWA 2ZR5A 3RGCA 1FKGA 2MLZA 2N87A 1FJDA 1H0IA 3ALGA 4ODOA 4JYSA 1J4RA 1K9TA 1NWSA 2Y78A 4KR0B 1FKJA 3ODKA 4WIWA 2ZQSA 1OWQA 2DSWA 1RD6A 1LL6A 4TNSA 4HBOA 2O92A 1B6CA 2AOSA 3O5RA 4Z2IA 4TX0A 1QPFA 3WD4A 1BL4A 2DT0A 4TW6A 3TDBA 1X6NA 3JYMA 1F8AB 2M08A 3B9AA 1D7HA 2WM0A 4S3KA 4DWSB 1W26A 4DRQA 1OGGA 1U79A 2LKNA 3IK8A 1HKKA 4Z2HA 4MSPA 5HWCA 3O5PA 2L2SA 4G2PA 3WH0A 3ARZA 1CTNA 3VAWA 2KI3A 2F21A 2F4EA 1FKKA 3ARYA 5HKGA 4Z2JA 4U86A 1JNTA 4P8WA 3WD2A 1D6OA 2ZR6A 1YATA 1J4HA 2M2AA 4R5EA 5HW8A 5HTGA 1E9LA 1FKBA 3WD0A 4MTVA 1FKLA 3RM8A 3JYJA 4BF8A 2O9OA 3CHDA 3IKGA 2ZR4A 1NMWA 3KACA 3G6MA 1WNOA 1KT1A 2OLHA 5GPGA 5HW6A 1E6RA 4MGVA 4W9PA 1E6ZA 3O5OA 1JNEA 3O5EA 5J6EA 1J6YA 3MDYB 1W9PA 1NWTA 4DRJA 3AS2A 5GQBA 3WD3A 3FAPA 3UI4A 2PPOA 4DIPA 2OFNA 3AS1A 3KABA 5GPRA 4P8VA 4TW8A 1TCOC 3O5GA 2FAPA 4DRIA 4NNRA 1FKDA 3CH9A 2A3AA 4HBEA 4URIA 3WQWA 3FXYA 1C9HA 1PINA 1LQ0A 1IX5A 5DF0A 2FDMA 3B9EA 1FKFA 2LPVA 2IF4A 3ARWA 4DRNA 5DO2A 4DRMA 1EDQA 4LGXA 2PV3A 2WLZA 3IHZA 5HUAA 3PRBA 1LG1A 1LG2A 2FKEA 4U85A 4WKAA 2XPAA 4Z2KA 2XP8A 1L1PA 3ARUA 2G8ZA 1D2KA 1FKHA 1NWUA 4AY1A 2XPBA 3O5JA 2XP4A 4DZ3A 4N19A 1JNSA 4DROA 1H0GA 4J4NA 2WLYA 1J4IA 1HJVA 2M1IA 2XP5A 1EIBA 3OA5A 1ITXA 2YBTA 4LAYA 2DT2A 4KQZA 4WKHA 1ROTA 4NSBA 3QOKA 4ODNA 2ITKA 3IKDA 1ROUA 2MPHA 3B9DA 2DSUA 2IUZA 3KAIA 4DWSA 4XAKA 4TW7A 2ZQVA 3ARRA 4MNKA 3B7XA 2A3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQS A;  2VCD A;  3I6C A;  4DT4 A;  2LGO A;  2ZR4 A;  1ZK6 A;  3IKG A;  1PBK A;  4JFJ A;  2UZ5 A;  2KO7 A;  1NMW A;  2LJ4 A;  3KAC A;  3KZ7 A;  1R9H A;  1KT1 A;  5GPG A;  1FKT A;  4ODR A;  4GIV A;  4TYO A;  2AWG A;  3O5Q A;  4O2T A;  5HW6 A;  4DRP A;  1Y0O A;  4MGV A;  2XP9 A;  1T11 A;  3TCZ A;  3NTP A;  2ZQU A;  2MNT A;  4W9P A;  3O5O A;  2PV1 A;  3O5E A;  5J6E A;  1J6Y A;  1FKS A;  3MDY B;  1NMV A;  3O5M A;  3KAD A;  1Q6U A;  3CGM A;  4DRJ A;  2XP3 A;  1ZCN A;  2RUC A;  3NI6 A;  4IQC A;  3O5K A;  3FAP A;  3UI4 A;  2JZV A;  5DIT A;  2KGJ A;  2KE0 A;  2PPO A;  4GGQ A;  2OFN A;  4R0X A;  4DIP A;  3KAB A;  2Q5A A;  1Q6H A;  3NRK A;  3LUO A;  4LAV A;  4TW8 A;  1BKF A;  2ZR5 A;  3RFW A;  3RGC A;  1HXV A;  1TCO C;  1FKG A;  2MLY A;  3CGN A;  1N1A A;  3O5G A;  4ITZ A;  2FAP A;  2KR7 A;  2MLZ A;  2N87 A;  2PPP A;  4DRI A;  5D75 A;  3UQA A;  1FJD A;  3O5L A;  4NNR A;  1FKD A;  1D7J A;  2D9F A;  1EYM A;  1J4R A;  4JYS A;  2XP6 A;  4ODO A;  4DRK A;  2Y78 A;  5I98 A;  1C9H A;  1FKJ A;  1PIN A;  3KAH A;  3KAF A;  2PPN A;  3ODK A;  3PA7 A;  2ZQS A;  4W9Q A;  1FKF A;  2XP7 A;  2LPV A;  2IF4 A;  3O5I A;  4LAX A;  4TNS A;  4DRN A;  3TC5 A;  4IQ2 A;  1B6C A;  1QPL A;  3KCE A;  3O5R A;  4DRM A;  4TX0 A;  1QPF A;  4ODK A;  1BL4 A;  2PBC A;  2RSE A;  4FN2 A;  5HW7 A;  1Q1C A;  3PRD A;  4TW6 A;  2PV3 A;  3IHZ A;  5DIV A;  3TDB A;  5HUA A;  1FAP A;  4ODL A;  3JYM A;  1F8A B;  1FKI A;  2K8I A;  1M5Y A;  2M08 A;  2VN1 A;  3JXV A;  4IPX A;  1D7H A;  3PRB A;  4FAP A;  1P5Q A;  3UQB A;  4JFM A;  1Q6I A;  1W26 A;  2FKE A;  4U85 A;  2XPA A;  3OOB A;  2XP8 A;  4DRQ A;  1L1P A;  2RUQ A;  1JVW A;  2F2D A;  1FKH A;  2DG4 A;  3H9R B;  4DRH A;  1U79 A;  2XPB A;  2PV2 A;  2LKN A;  3O5J A;  3IK8 A;  1F40 A;  4QIB A;  4JFK A;  4QT2 A;  2XP4 A;  4JFI A;  4U84 A;  4N19 A;  4DZ3 A;  4MSP A;  1QZ2 A;  4DZ2 A;  4DRO A;  1JNS A;  5HWC A;  3O5P A;  2L2S A;  4J4N A;  4JFL A;  3UI5 A;  1J4I A;  1YW5 A;  4G2P A;  2M1I A;  4W9O A;  5DIU A;  3WH0 A;  2XP5 A;  4C02 B;  4QT3 A;  4ODP A;  3VAW A;  2KI3 A;  2F21 A;  5HT1 A;  4J4O A;  4LAY A;  3KAG A;  3O5D A;  1FD9 A;  2F4E A;  1FKK A;  1KT0 A;  1NSG A;  1ROT A;  5HKG A;  3UQI A;  5HWB A;  5BXJ A;  1D7I A;  2ZQT A;  4ODN A;  4ODM A;  1JNT A;  1A7X A;  4U86 A;  2ITK A;  1D6O A;  3IKD A;  3UF8 A;  3UI6 A;  5B8I C;  1ROU A;  2ZR6 A;  2MPH A;  1YAT A;  4LAW A;  3O5F A;  2MF9 A;  1J4H A;  2M2A A;  4ODQ A;  2RUD A;  3EY6 A;  2DG9 A;  5HW8 A;  3KAI A;  1FKR A;  5HTG A;  2RUR A;  4DH0 A;  1FKB A;  4TW7 A;  2DG3 A;  2MLX A;  2ZQV A;  4G50 A;  2KFW A;  3GPK A;  1EQ3 A;  3B7X A;  1FKL A;  3JYJ A;  4BF8 A; 
#chains in the Genus database with same CATH topology
 1ZU8 A;  2RQS A;  3I6C A;  2ESC A;  3RM9 A;  1PBK A;  4JFJ A;  2UZ5 A;  3ARS A;  3AS0 A;  4TYO A;  4DRP A;  1Y0O A;  2MNT A;  1FKS A;  1NMV A;  3WL0 A;  2XP3 A;  2RUC A;  1ZBK A;  4P8U A;  1LL4 A;  3O5K A;  1GPF A;  2JZV A;  2DPE A;  2Q5A A;  4QZV B;  4DWS D;  1HXV A;  1KFW A;  4ITZ A;  4ZS6 A;  3ARQ A;  1D7J A;  2D9F A;  1GUV A;  4MAV A;  4MNM A;  4WKF A;  4DRK A;  4Z2G A;  1O6I A;  1NWR A;  2PPN A;  4W9Q A;  1JND A;  2XP7 A;  4IT6 A;  2WK2 A;  4LAX A;  1HKM A;  3ARP A;  3TC5 A;  4IQ2 A;  1TFV A;  3AQU A;  2A3B A;  2PBC A;  3CHC A;  1LL7 A;  1GRJ A;  2RSE A;  4IT4 A;  3PRD A;  1SYT A;  5DIV A;  4ZPV R;  2K8I A;  1M5Y A;  2VN1 A;  3JXV A;  3PRA A;  4IPX A;  1E15 A;  4WJX A;  1P5Q A;  3UQB A;  4UDM A;  3B8S A;  2RUQ A;  2P4V A;  4Q7N A;  2DG4 A;  3H9R B;  4Z2L A;  2PV2 A;  1F40 A;  1HJW A;  3ALF A;  3UI5 A;  4JFL A;  4C02 B;  5HT1 A;  1W1P A;  3O5D A;  1FD9 A;  1ZBC A;  1KT0 A;  4ZPW R;  3UQI A;  4ODM A;  3WD1 A;  3ARX A;  3UF8 A;  3UI6 A;  3ART A;  4LAW A;  3O5F A;  4PTM A;  4HAR A;  4ZPT R;  4ODQ A;  2RUD A;  3EY6 A;  1X6L A;  1FKR A;  2RUR A;  2MLX A;  1W1Y A;  3GPK A;  2DT1 A;  4NZC A;  1E6N A;  2VCD A;  2LGO A;  1ZL1 A;  3AS3 A;  1WB0 A;  2LJ4 A;  1R9H A;  1FKT A;  5DEZ A;  2AWG A;  3O5Q A;  4O2T A;  4P8X A;  3CHF A;  3NTP A;  2ZQU A;  3CZ8 A;  5JH8 A;  3CHE A;  1Q6U A;  2DSV A;  2A3E A;  3CGM A;  3RM4 A;  1FFR A;  2KGJ A;  4GGQ A;  1ZBW A;  3LUO A;  1BKF A;  3CGN A;  2MLY A;  1N1A A;  2KR7 A;  3UQA A;  2PPP A;  5D75 A;  3O5L A;  2DT3 A;  1GOI A;  1EYM A;  1WAW A;  2XP6 A;  5I98 A;  3ARV A;  3KAH A;  3ARO A;  3KAF A;  3WIJ A;  3PA7 A;  1ZBV A;  3O5I A;  1SR0 A;  3WL1 A;  1QPL A;  3KCE A;  1XHG A;  3RME A;  4ODK A;  4FN2 A;  5HW7 A;  1Q1C A;  3PR9 A;  1E6P A;  1FAP A;  4ODL A;  1EHN A;  1FKI A;  2B31 A;  4FAP A;  4L3N A;  4JFM A;  1Q6I A;  3OOB A;  1JVW A;  1OGB A;  2F2D A;  4DRH A;  1W9U A;  4MPK A;  4L72 B;  4QIB A;  4JFK A;  4QT2 A;  4JFI A;  4U84 A;  4DZ2 A;  1QZ2 A;  3FY1 A;  1LJY A;  1YW5 A;  4MNL A;  4W9O A;  5DIU A;  3WKZ A;  1UR9 A;  4QT3 A;  4ODP A;  4WK9 A;  4Q22 A;  2QF8 A;  1FFQ A;  4J4O A;  3KAG A;  1NSG A;  5HWB A;  1UR8 A;  1D7I A;  5BXJ A;  2ZQT A;  1A7X A;  5B8I C;  1ZB5 A;  4ML4 A;  4W5U A;  2MF9 A;  2DG9 A;  3WQV A;  4DH0 A;  1HJX A;  2DG3 A;  2PI6 A;  4G50 A;  2KFW A;  1EQ3 A;  1HKI A;  1W1T A;  3W4R A;  4DWS C;  4DT4 A;  1ZK6 A;  4S3J A;  2KO7 A;  1XRV A;  3KZ7 A;  2YBU A;  1VF8 A;  3BXW A;  4GIV A;  4ODR A;  2XP9 A;  1T11 A;  1W1V A;  3TCZ A;  4MNJ A;  2PV1 A;  2DSZ A;  1W9V A;  3O5M A;  3KAD A;  1NH6 A;  1HKJ A;  1ZCN A;  3NI6 A;  4IQC A;  5DIT A;  2KE0 A;  4R0X A;  3G6L A;  2G41 A;  1Q6H A;  3NRK A;  5HBF A;  4LAV A;  3RFW A;  2ZR5 A;  3RGC A;  1FKG A;  2MLZ A;  2N87 A;  1FJD A;  3GTY X;  1H0I A;  3ALG A;  2PN0 A;  4ODO A;  4JYS A;  1J4R A;  1K9T A;  1NWS A;  2Y78 A;  4KR0 B;  1FKJ A;  3ODK A;  4WIW A;  2ZQS A;  1OWQ A;  2DSW A;  1RD6 A;  1LL6 A;  4TNS A;  4HBO A;  2O92 A;  1E44 A;  1B6C A;  2AOS A;  3O5R A;  4Z2I A;  4TX0 A;  1QPF A;  3WD4 A;  1BL4 A;  2DT0 A;  4TW6 A;  3TDB A;  1X6N A;  3JYM A;  1F8A B;  2M08 A;  3B9A A;  1D7H A;  2WM0 A;  4S3K A;  4DWS B;  1W26 A;  4DRQ A;  1OGG A;  1U79 A;  2LKN A;  3IK8 A;  1HKK A;  4Z2H A;  4MSP A;  5HWC A;  3EIP A;  2L2S A;  3O5P A;  4G2P A;  3WH0 A;  3ARZ A;  1CTN A;  3VAW A;  2KI3 A;  2F21 A;  2F4E A;  1FKK A;  3ARY A;  5HKG A;  4Z2J A;  4U86 A;  1JNT A;  4P8W A;  3WD2 A;  1D6O A;  2ZR6 A;  1YAT A;  1J4H A;  2M2A A;  4R5E A;  5HW8 A;  5HTG A;  1E9L A;  1FKB A;  3WD0 A;  4MTV A;  1FKL A;  3RM8 A;  3JYJ A;  4BF8 A;  2O9O A;  3CHD A;  3IKG A;  2ZR4 A;  1NMW A;  3KAC A;  3G6M A;  1WNO A;  1KT1 A;  2OLH A;  5GPG A;  5HW6 A;  1E6R A;  4MGV A;  4W9P A;  1E6Z A;  3O5O A;  1JNE A;  3O5E A;  5J6E A;  1J6Y A;  3MDY B;  1W9P A;  1NWT A;  4DRJ A;  3AS2 A;  5GQB A;  3WD3 A;  3FAP A;  3UI4 A;  2PPO A;  4DIP A;  2OFN A;  3AS1 A;  3KAB A;  5GPR A;  2F23 A;  4P8V A;  4TW8 A;  3GU0 A;  1TCO C;  3O5G A;  2FAP A;  4DRI A;  4NNR A;  1FKD A;  3CH9 A;  2A3A A;  4HBE A;  4URI A;  3WQW A;  3FXY A;  1C9H A;  1PIN A;  1LQ0 A;  1IX5 A;  5DF0 A;  2FDM A;  3B9E A;  2ETN A;  1FKF A;  2LPV A;  2IF4 A;  3ARW A;  4DRN A;  5DO2 A;  4DRM A;  1EDQ A;  4LGX A;  2PV3 A;  2WLZ A;  3IHZ A;  5HUA A;  3PRB A;  1LG1 A;  1LG2 A;  2FKE A;  4U85 A;  4WKA A;  2XPA A;  4Z2K A;  2XP8 A;  1L1P A;  3ARU A;  2G8Z A;  1D2K A;  1FKH A;  1NWU A;  4AY1 A;  2XPB A;  3O5J A;  2XP4 A;  4DZ3 A;  4N19 A;  1JNS A;  4DRO A;  1H0G A;  4J4N A;  2WLY A;  1J4I A;  1HJV A;  2M1I A;  2XP5 A;  1EIB A;  3OA5 A;  1ITX A;  2YBT A;  4LAY A;  2DT2 A;  4KQZ A;  4WKH A;  2EUL A;  1ROT A;  4NSB A;  3BMB A;  3QOK A;  1JCH B;  4ODN A;  2ITK A;  3IKD A;  1ROU A;  2MPH A;  3B9D A;  2DSU A;  2IUZ A;  2B5U B;  3KAI A;  4DWS A;  4XAK A;  4TW7 A;  2ZQV A;  3ARR A;  4MNK A;  3B7X A;  2A3C A; 
#chains in the Genus database with same CATH homology
 1ZU8 A;  2RQS A;  3I6C A;  2ESC A;  3RM9 A;  1PBK A;  4JFJ A;  2UZ5 A;  3ARS A;  3AS0 A;  4TYO A;  4DRP A;  1Y0O A;  2MNT A;  1FKS A;  1NMV A;  3WL0 A;  2XP3 A;  2RUC A;  1ZBK A;  4P8U A;  1LL4 A;  3O5K A;  1GPF A;  2JZV A;  2DPE A;  2Q5A A;  4QZV B;  4DWS D;  1HXV A;  1KFW A;  4ITZ A;  4ZS6 A;  3ARQ A;  1D7J A;  2D9F A;  1GUV A;  4MAV A;  4MNM A;  4WKF A;  4DRK A;  4Z2G A;  1O6I A;  1NWR A;  2PPN A;  4W9Q A;  1JND A;  2XP7 A;  4IT6 A;  2WK2 A;  4LAX A;  1HKM A;  3ARP A;  3TC5 A;  4IQ2 A;  1TFV A;  3AQU A;  2A3B A;  2PBC A;  3CHC A;  1LL7 A;  4IT4 A;  2RSE A;  3PRD A;  1SYT A;  5DIV A;  4ZPV R;  2K8I A;  1M5Y A;  2VN1 A;  3JXV A;  3PRA A;  4IPX A;  1E15 A;  4WJX A;  1P5Q A;  3UQB A;  3B8S A;  2RUQ A;  4Q7N A;  2DG4 A;  3H9R B;  4Z2L A;  2PV2 A;  1F40 A;  1HJW A;  3ALF A;  3UI5 A;  4JFL A;  4C02 B;  5HT1 A;  1W1P A;  3O5D A;  1FD9 A;  1ZBC A;  1KT0 A;  4ZPW R;  3UQI A;  4ODM A;  3WD1 A;  3ARX A;  3UF8 A;  3UI6 A;  3ART A;  4LAW A;  3O5F A;  4PTM A;  4HAR A;  4ZPT R;  4ODQ A;  2RUD A;  3EY6 A;  1X6L A;  1FKR A;  2RUR A;  2MLX A;  1W1Y A;  3GPK A;  2DT1 A;  4NZC A;  1E6N A;  2VCD A;  2LGO A;  1ZL1 A;  3AS3 A;  1WB0 A;  2LJ4 A;  1R9H A;  1FKT A;  5DEZ A;  2AWG A;  3O5Q A;  4O2T A;  4P8X A;  3CHF A;  3NTP A;  2ZQU A;  3CZ8 A;  5JH8 A;  3CHE A;  1Q6U A;  2DSV A;  2A3E A;  3CGM A;  3RM4 A;  1FFR A;  2KGJ A;  4GGQ A;  1ZBW A;  3LUO A;  1BKF A;  3CGN A;  2MLY A;  1N1A A;  2KR7 A;  3UQA A;  2PPP A;  5D75 A;  3O5L A;  2DT3 A;  1GOI A;  1EYM A;  1WAW A;  2XP6 A;  5I98 A;  3ARV A;  3KAH A;  3ARO A;  3KAF A;  3WIJ A;  3PA7 A;  1ZBV A;  3O5I A;  1SR0 A;  3WL1 A;  1QPL A;  3KCE A;  1XHG A;  3RME A;  4ODK A;  4FN2 A;  5HW7 A;  1Q1C A;  3PR9 A;  1E6P A;  1FAP A;  4ODL A;  1EHN A;  1FKI A;  2B31 A;  4FAP A;  4L3N A;  4JFM A;  1Q6I A;  3OOB A;  1JVW A;  1OGB A;  2F2D A;  4DRH A;  1W9U A;  4MPK A;  4L72 B;  4QIB A;  4JFK A;  4QT2 A;  4JFI A;  4U84 A;  4DZ2 A;  1QZ2 A;  3FY1 A;  1LJY A;  1YW5 A;  4MNL A;  4W9O A;  5DIU A;  3WKZ A;  1UR9 A;  4QT3 A;  4ODP A;  4WK9 A;  4Q22 A;  2QF8 A;  1FFQ A;  4J4O A;  3KAG A;  1NSG A;  5HWB A;  1UR8 A;  1D7I A;  5BXJ A;  2ZQT A;  1A7X A;  5B8I C;  1ZB5 A;  4ML4 A;  4W5U A;  2MF9 A;  2DG9 A;  3WQV A;  4DH0 A;  1HJX A;  2DG3 A;  2PI6 A;  4G50 A;  2KFW A;  1EQ3 A;  1HKI A;  1W1T A;  3W4R A;  4DWS C;  4DT4 A;  1ZK6 A;  4S3J A;  2KO7 A;  1XRV A;  3KZ7 A;  2YBU A;  1VF8 A;  3BXW A;  4GIV A;  4ODR A;  2XP9 A;  1T11 A;  1W1V A;  3TCZ A;  4MNJ A;  2PV1 A;  2DSZ A;  1W9V A;  3O5M A;  3KAD A;  1NH6 A;  1HKJ A;  1ZCN A;  3NI6 A;  4IQC A;  5DIT A;  2KE0 A;  4R0X A;  3G6L A;  2G41 A;  1Q6H A;  3NRK A;  5HBF A;  4LAV A;  3RFW A;  2ZR5 A;  3RGC A;  1FKG A;  2MLZ A;  2N87 A;  1FJD A;  1H0I A;  3ALG A;  4ODO A;  4JYS A;  1J4R A;  1K9T A;  1NWS A;  2Y78 A;  4KR0 B;  1FKJ A;  3ODK A;  4WIW A;  2ZQS A;  1OWQ A;  2DSW A;  1RD6 A;  1LL6 A;  4TNS A;  4HBO A;  2O92 A;  1B6C A;  2AOS A;  3O5R A;  4Z2I A;  4TX0 A;  1QPF A;  3WD4 A;  1BL4 A;  2DT0 A;  4TW6 A;  3TDB A;  1X6N A;  3JYM A;  1F8A B;  2M08 A;  3B9A A;  1D7H A;  2WM0 A;  4S3K A;  4DWS B;  1W26 A;  4DRQ A;  1OGG A;  1U79 A;  2LKN A;  3IK8 A;  1HKK A;  4Z2H A;  4MSP A;  5HWC A;  3O5P A;  2L2S A;  4G2P A;  3WH0 A;  3ARZ A;  1CTN A;  3VAW A;  2KI3 A;  2F21 A;  2F4E A;  1FKK A;  3ARY A;  5HKG A;  4Z2J A;  4U86 A;  1JNT A;  4P8W A;  3WD2 A;  1D6O A;  2ZR6 A;  1YAT A;  1J4H A;  2M2A A;  4R5E A;  5HW8 A;  5HTG A;  1E9L A;  1FKB A;  3WD0 A;  4MTV A;  1FKL A;  3RM8 A;  3JYJ A;  4BF8 A;  2O9O A;  3CHD A;  3IKG A;  2ZR4 A;  1NMW A;  3KAC A;  3G6M A;  1WNO A;  1KT1 A;  2OLH A;  5GPG A;  5HW6 A;  1E6R A;  4MGV A;  4W9P A;  1E6Z A;  3O5O A;  1JNE A;  3O5E A;  5J6E A;  1J6Y A;  3MDY B;  1W9P A;  1NWT A;  4DRJ A;  3AS2 A;  5GQB A;  3WD3 A;  3FAP A;  3UI4 A;  2PPO A;  4DIP A;  2OFN A;  3AS1 A;  3KAB A;  5GPR A;  4P8V A;  4TW8 A;  1TCO C;  3O5G A;  2FAP A;  4DRI A;  4NNR A;  1FKD A;  3CH9 A;  2A3A A;  4HBE A;  4URI A;  3WQW A;  3FXY A;  1C9H A;  1PIN A;  1LQ0 A;  1IX5 A;  5DF0 A;  2FDM A;  3B9E A;  1FKF A;  2LPV A;  2IF4 A;  3ARW A;  4DRN A;  5DO2 A;  4DRM A;  1EDQ A;  4LGX A;  2PV3 A;  2WLZ A;  3IHZ A;  5HUA A;  3PRB A;  1LG1 A;  1LG2 A;  2FKE A;  4U85 A;  4WKA A;  2XPA A;  4Z2K A;  2XP8 A;  1L1P A;  3ARU A;  2G8Z A;  1D2K A;  1FKH A;  1NWU A;  4AY1 A;  2XPB A;  3O5J A;  2XP4 A;  4DZ3 A;  4N19 A;  1JNS A;  4DRO A;  1H0G A;  4J4N A;  2WLY A;  1J4I A;  1HJV A;  2M1I A;  2XP5 A;  1EIB A;  3OA5 A;  1ITX A;  2YBT A;  4LAY A;  2DT2 A;  4KQZ A;  4WKH A;  1ROT A;  4NSB A;  3QOK A;  4ODN A;  2ITK A;  3IKD A;  1ROU A;  2MPH A;  3B9D A;  2DSU A;  2IUZ A;  3KAI A;  4DWS A;  4XAK A;  4TW7 A;  2ZQV A;  3ARR A;  4MNK A;  3B7X A;  2A3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...