2L2SA

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 13
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2l2sA00
1Q6IA 2Y78A 1FAPA 1T11A 2RURA 2PBCA 1ZK6A 5I98A 5HKGA 4ODLA 4TW7A 3O5KA 1D7JA 1FKJA 3PRDA 4IQ2A 4ODMA 5HW7A 2PV3A 1FKSA 3KCEA 2XPBA 4DRPA 2LGOA 1FJDA 4TYOA 2ZQUA 3TDBA 2F2DA 4C02B 4QIBA 2XPAA 2ITKA 2MPHA 4JFMA 4JYSA 3NRKA 1FKFA 2PPPA 1ROUA 2RSEA 3IKGA 1YATA 3KAFA 2XP8A 4DRNA 2LKNA 4U85A 1FKRA 5BXJA 2F21A 3JXVA 4G2PA 3O5MA 3B7XA 1W26A 4DZ3A 5HTGA 1FKTA 1FKGA 1BKFA 4FN2A 4LAWA 4QT3A 1QPLA 2XP3A 3KAGA 3OOBA 2M1IA 5HT1A 3UQIA 4IQCA 1J4IA 1A7XA 1J4RA 1Q6HA 5HW8A 1C9HA 1KT1A 3O5RA 1TCOC 3LUOA 3O5JA 1BL4A 2MNTA 4BF8A 1JNSA 2N87A 3KADA 4LAXA 3O5FA 4ODRA 4GGQA 4ODQA 2KE0A 3I6CA 1NMVA 3IK8A 4JFIA 1Q1CA 2XP9A 1PBKA 2VN1A 3IHZA 3KABA 3O5LA 4DRHA 5HUAA 3MDYB 1N1AA 3PA7A 1QZ2A 4DRKA 1JVWA 3KAIA 1JNTA 2KI3A 4TW8A 4DRQA 4DZ2A 1J6YA 5J6EA 1U79A 2JZVA 3O5OA 3O5PA 2DG4A 3CGMA 2XP6A 2DG9A 2RQSA 2RUDA 4NNRA 3WH0A 4DH0A 4DRIA 1ROTA 2MLYA 4TX0A 2OFNA 2XP4A 4DRJA 2FKEA 4ODKA 2L2SA 5GPGA 2ZQSA 1KT0A 3H9RB 3O5IA 1QPFA 1Y0OA 4JFKA 3JYMA 4W9PA 4DIPA 3O5QA 2KO7A 5HW6A 1FKHA 3O5DA 2M2AA 2RUCA 3EY6A 1NSGA 4LAYA 5HWCA 3RGCA 1FKIA 3UQBA 2AWGA 2ZR5A 3IKDA 1ZCNA 1R9HA 2K8IA 4GIVA 2RUQA 4G50A 2KFWA 2MF9A 2XP7A 1EQ3A 2ZR4A 1FD9A 1M5YA 2ZQVA 4IPXA 4R0XA 1YW5A 3PRBA 5DITA 1EYMA 2XP5A 1NMWA 1HXVA 1Q6UA 4DT4A 1D7HA 2PPNA 5DIVA 3UF8A 5HWBA 2D9FA 1FKBA 1D6OA 1FKLA 2PV1A 2F4EA 3FAPA 4LAVA 3RFWA 3UI4A 4DROA 4U84A 1P5QA 2KGJA 4ODNA 4JFJA 4W9QA 1FKKA 4J4OA 4N19A 4O2TA 2LJ4A 3CGNA 4ODPA 1J4HA 5D75A 2PV2A 4DRMA 2KR7A 3O5GA 4JFLA 2ZQTA 3UQAA 3JYJA 4W9OA 3VAWA 3NI6A 2UZ5A 4MGVA 4ODOA 2MLZA 3TCZA 2M08A 2MLXA 3ODKA 4FAPA 5DIUA 1L1PA 3NTPA 3TC5A 4TNSA 4MSPA 1B6CA 2PPOA 3KZ7A 4U86A 2VCDA 3O5EA 5B8IC 1FKDA 4TW6A 2IF4A 4ITZA 1F40A 4J4NA 1F8AB 2LPVA 2Q5AA 2DG3A 3GPKA 3UI5A 3KACA 4QT2A 1PINA 3KAHA 3UI6A 1D7IA 2ZR6A 2FAPA
chains in the Genus database with same CATH superfamily
4WJXA 1FAPA 1T11A 1EHNA 1ZK6A 2A3CA 4IQ2A 1W1TA 1FKSA 5DEZA 2F2DA 2ITKA 2MPHA 1FKFA 1FFRA 1ROUA 3WQVA 4WKFA 1FKRA 2F23A 4IT6A 1H0IA 3ALGA 2WLZA 1WNOA 1FKTA 1FKGA 4LAWA 1ZB5A 1W9VA 2M1IA 4DWSA 3ARTA 1J4IA 1Q6HA 1KT1A 3O5RA 4ZPWR 1XHGA 1TCOC 2EULA 3LUOA 1BL4A 4R5EA 4BF8A 1JNSA 4LAXA 1W1PA 1NMVA 4JFIA 2XP9A 1EIBA 3IHZA 2VN1A 3O5LA 5HUAA 4AY1A 1KFWA 1JNTA 2KI3A 3CHFA 1GUVA 1JNEA 2XP6A 2RQSA 1ROTA 1HKIA 1LG1A 2ETNA 4DIPA 3O5IA 3B9AA 3O5QA 2KO7A 4MNLA 3O5DA 2M2AA 4LAYA 4P8VA 5HWCA 3WL1A 1WAWA 1R9HA 2K8IA 4GIVA 2RUQA 4Z2KA 3RM9A 2MF9A 4Z2GA 3RM8A 1EYMA 3RM4A 2B5UB 4HARA 1D2KA 2D9FA 1FKBA 1NH6A 2PV1A 2F4EA 3BXWA 4WKAA 4U84A 1HKKA 4O2TA 3CGNA 1NWSA 2KR7A 2ZQTA 2DT2A 5DO2A 1ZBKA 3NTPA 3FY1A 2A3AA 4U86A 5B8IC 1F40A 2LPVA 2Q5AA 3UI5A 3AS0A 3KACA 1PINA 3UI6A 1D7IA 2ZR6A 2FAPA 4MPKA 1ZBVA 1Q6IA 3ARRA 2RURA 3CZ8A 2PBCA 3CH9A 3CHDA 4TW7A 3PRDA 3ARPA 1E15A 1GPFA 2ZQUA 4QIBA 5GQBA 3KAFA 1LQ0A 2LKNA 4Q7NA 3G6LA 4U85A 5BXJA 3GU0A 1QPLA 2WLYA 3KAGA 3OOBA 3UQIA 4MNKA 2DSVA 4ZPVR 3BMBA 3O5JA 2MNTA 3ARQA 1NWUA 1W9PA 2KE0A 3IK8A 1PBKA 3KABA 1SYTA 3EIPA 4DZ2A 1J6YA 2JZVA 3RMEA 3O5PA 2DG4A 1E6NA 1RD6A 2MLYA 4TX0A 1HKJA 2OFNA 4DRJA 2FKEA 2L2SA 4WK9A 1QPFA 2QF8A 5HW6A 1O6IA 1NSGA 4HBOA 3RGCA 2AWGA 3IKDA 1UR9A 2B31A 2WM0A 2XP7A 2ZR4A 2ZQVA 5GPRA 4Z2LA 5DITA 3B9EA 3FAPA 2ESCA 3WD0A 2WK2A 3ARUA 4KR0B 2KGJA 2AOSA 4J4OA 1HKMA 4DRMA 3WKZA 4JFLA 3UQAA 3NI6A 2UZ5A 4MGVA 4ODOA 2MLXA 4FAPA 5DIUA 3TC5A 4KQZA 2IF4A 1HJWA 1F8AB 1W9UA 1JCHB 4QT2A 3WL0A 2Y78A 1JNDA 1WB0A 3QOKA 5I98A 4HBEA 1SR0A 5HKGA 5HW7A 1D7JA 1OWQA 4P8WA 2XPBA 2LGOA 4C02B 4JFMA 4JYSA 3NRKA 2RSEA 1YATA 4Z2JA 4G2PA 2DSUA 3O5MA 4DWSD 3G6MA 4DWSC 5HTGA 2OLHA 4P8XA 4ZPTR 3CHCA 1W1YA 4UDMA 2DT0A 4IQCA 1H0GA 1J4RA 1C9HA 1ZU8A 3KADA 4ODRA 1ITXA 3OA5A 4ODQA 4IT4A 3ARYA 3MDYB 3PA7A 3ARWA 1QZ2A 1IX5A 4DRKA 4TW8A 1HJVA 2P4VA 5J6EA 1U79A 3O5OA 4DZ3A 4DRIA 4P8UA 2DG9A 2RUDA 4MAVA 4Z2IA 4NSBA 1LL6A 4ODKA 2ZQSA 1KT0A 3H9RB 4JFKA 4W9PA 4LGXA 1HJXA 1CTNA 3EY6A 1UR8A 3WD2A 2KFWA 3AS3A 3W4RA 1LL7A 1ZBCA 2IUZA 4R0XA 4IPXA 3PRBA 2A3BA 2XP5A 1NMWA 4URIA 4DT4A 1D7HA 5DIVA 3UF8A 5HWBA 3UI4A 4LAVA 1FKLA 4DROA 1EDQA 3WD3A 1P5QA 4ODNA 4W9QA 1FKKA 2LJ4A 1J4HA 2PV2A 3AQUA 1E6RA 3WD1A 2G41A 2YBUA 3B9DA 3VAWA 2MLZA 3TCZA 4TNSA 1B6CA 4QZVB 2PPOA 2VCDA 4TW6A 4ITZA 5HBFA 3WQWA 4J4NA 4L3NA 4L72B 4ML4A 1OGBA 4WIWA 3ARVA 4ODLA 1GOIA 3ARSA 1FKJA 3O5KA 3PR9A 4ODMA 4MTVA 2PV3A 3KCEA 1E6ZA 1LG2A 4DRPA 1FJDA 4TYOA 3TDBA 3AROA 2XPAA 1TFVA 2PPPA 3IKGA 4DRNA 2XP8A 4NZCA 1LL4A 2F21A 3JXVA 3B7XA 3WD4A 1W26A 4WKHA 3ARZA 2G8ZA 4Q22A 1BKFA 4FN2A 4QT3A 2XP3A 2O9OA 4S3JA 5HT1A 2DSWA 3B8SA 1A7XA 5HW8A 2N87A 3O5FA 1ZBWA 4GGQA 3GTYX 3I6CA 1X6NA 1Q1CA 2PN0A 4DRHA 1OGGA 4MNJA 1N1AA 4ZS6A 1JVWA 3KAIA 4DRQA 2DT3A 1X6LA 4NNRA 1FFQA 3CGMA 4DH0A 4XAKA 3WH0A 3WIJA 2PI6A 2XP4A 5GPGA 1XRVA 1Y0OA 3JYMA 1ZL1A 2DSZA 1FKHA 3AS1A 2RUCA 5DF0A 1FKIA 3ARXA 3UQBA 2ZR5A 1ZCNA 4G50A 3CHEA 2O92A 2DT1A 1EQ3A 1FD9A 1M5YA 1YW5A 1VF8A 1HXVA 1Q6UA 2PPNA 4PTMA 4S3KA 1D6OA 3RFWA 5JH8A 2DPEA 3ALFA 4JFJA 4Z2HA 1E9LA 4N19A 4W5UA 1LJYA 4ODPA 5D75A 2YBTA 3O5GA 3JYJA 4W9OA 2FDMA 1K9TA 2M08A 3ODKA 1W1VA 1L1PA 4MSPA 1E6PA 3KZ7A 4DWSB 3O5EA 1FKDA 3FXYA 1GRJA 3PRAA 2A3EA 3AS2A 2DG3A 3GPKA 1E44A 1NWTA 1NWRA 3KAHA 4MNMA
chains in the Genus database with same CATH topology
4WJXA 1FAPA 1T11A 1EHNA 1ZK6A 2A3CA 4IQ2A 1W1TA 1FKSA 5DEZA 2F2DA 2ITKA 2MPHA 1FKFA 1FFRA 1ROUA 3WQVA 4WKFA 1FKRA 4IT6A 1H0IA 3ALGA 2WLZA 1WNOA 1FKTA 1FKGA 4LAWA 1ZB5A 1W9VA 2M1IA 4DWSA 3ARTA 1J4IA 1Q6HA 1KT1A 3O5RA 4ZPWR 1XHGA 1TCOC 3LUOA 4R5EA 1BL4A 4BF8A 1JNSA 4LAXA 1W1PA 1NMVA 4JFIA 2XP9A 1EIBA 3IHZA 2VN1A 3O5LA 5HUAA 4AY1A 1KFWA 1JNTA 2KI3A 3CHFA 1GUVA 1JNEA 2XP6A 2RQSA 1ROTA 1HKIA 1LG1A 4DIPA 3O5IA 3B9AA 3O5QA 2KO7A 4MNLA 3O5DA 2M2AA 4LAYA 4P8VA 5HWCA 3WL1A 1WAWA 1R9HA 2K8IA 4GIVA 2RUQA 4Z2KA 3RM9A 2MF9A 4Z2GA 3RM8A 1EYMA 3RM4A 4HARA 1D2KA 2D9FA 1FKBA 1NH6A 2PV1A 2F4EA 3BXWA 4WKAA 4U84A 1HKKA 4O2TA 3CGNA 1NWSA 2KR7A 2ZQTA 2DT2A 5DO2A 1ZBKA 3NTPA 3FY1A 2A3AA 4U86A 5B8IC 1F40A 2LPVA 2Q5AA 3UI5A 3AS0A 3KACA 1PINA 3UI6A 1D7IA 2ZR6A 2FAPA 4MPKA 1ZBVA 1Q6IA 3ARRA 2RURA 3CZ8A 2PBCA 3CH9A 3CHDA 4TW7A 3PRDA 3ARPA 1E15A 1GPFA 2ZQUA 4QIBA 5GQBA 3KAFA 1LQ0A 2LKNA 4Q7NA 3G6LA 4U85A 5BXJA 1QPLA 2WLYA 3KAGA 3OOBA 3UQIA 4MNKA 2DSVA 4ZPVR 3O5JA 2MNTA 3ARQA 1NWUA 1W9PA 2KE0A 3IK8A 1PBKA 3KABA 1SYTA 4DZ2A 1J6YA 2JZVA 3RMEA 3O5PA 2DG4A 1E6NA 1RD6A 2MLYA 4TX0A 1HKJA 2OFNA 4DRJA 2FKEA 2L2SA 4WK9A 1QPFA 2QF8A 5HW6A 1O6IA 1NSGA 4HBOA 3RGCA 2AWGA 3IKDA 1UR9A 2B31A 2WM0A 2XP7A 2ZR4A 2ZQVA 5GPRA 4Z2LA 5DITA 3B9EA 3FAPA 2ESCA 3WD0A 2WK2A 3ARUA 4KR0B 2KGJA 2AOSA 4J4OA 1HKMA 4DRMA 3WKZA 4JFLA 3UQAA 3NI6A 2UZ5A 4MGVA 4ODOA 2MLXA 4FAPA 5DIUA 3TC5A 4KQZA 2IF4A 1HJWA 1F8AB 1W9UA 4QT2A 3WL0A 2Y78A 1JNDA 1WB0A 3QOKA 5I98A 4HBEA 1SR0A 5HKGA 5HW7A 1D7JA 1OWQA 4P8WA 2XPBA 2LGOA 4C02B 4JFMA 4JYSA 3NRKA 2RSEA 1YATA 4Z2JA 4G2PA 2DSUA 3O5MA 4DWSD 3G6MA 4DWSC 5HTGA 2OLHA 4P8XA 4ZPTR 3CHCA 1W1YA 2DT0A 4IQCA 1H0GA 1J4RA 1C9HA 1ZU8A 3KADA 4ODRA 1ITXA 3OA5A 4ODQA 4IT4A 3ARYA 3MDYB 3PA7A 3ARWA 1QZ2A 1IX5A 4DRKA 4TW8A 1HJVA 5J6EA 1U79A 3O5OA 4DZ3A 4DRIA 4P8UA 2DG9A 2RUDA 4MAVA 4Z2IA 4NSBA 1LL6A 4ODKA 2ZQSA 1KT0A 3H9RB 4JFKA 4W9PA 4LGXA 1HJXA 1CTNA 3EY6A 1UR8A 3WD2A 2KFWA 3AS3A 3W4RA 1LL7A 1ZBCA 2IUZA 4R0XA 4IPXA 3PRBA 2A3BA 2XP5A 1NMWA 4URIA 4DT4A 1D7HA 5DIVA 3UF8A 5HWBA 3UI4A 4LAVA 1FKLA 4DROA 1EDQA 3WD3A 1P5QA 4ODNA 4W9QA 1FKKA 2LJ4A 1J4HA 2PV2A 3AQUA 1E6RA 3WD1A 2G41A 2YBUA 3B9DA 3VAWA 2MLZA 3TCZA 4TNSA 1B6CA 4QZVB 2PPOA 2VCDA 4TW6A 4ITZA 5HBFA 3WQWA 4J4NA 4L3NA 4L72B 4ML4A 1OGBA 4WIWA 3ARVA 4ODLA 1GOIA 3ARSA 1FKJA 3O5KA 3PR9A 4ODMA 4MTVA 2PV3A 3KCEA 1E6ZA 1LG2A 4DRPA 1FJDA 4TYOA 3TDBA 3AROA 2XPAA 1TFVA 2PPPA 3IKGA 4DRNA 2XP8A 4NZCA 1LL4A 2F21A 3JXVA 3B7XA 3WD4A 1W26A 4WKHA 3ARZA 2G8ZA 4Q22A 1BKFA 4FN2A 4QT3A 2XP3A 2O9OA 4S3JA 5HT1A 2DSWA 3B8SA 1A7XA 5HW8A 2N87A 3O5FA 1ZBWA 4GGQA 3I6CA 1X6NA 1Q1CA 4DRHA 1OGGA 4MNJA 1N1AA 4ZS6A 1JVWA 3KAIA 4DRQA 2DT3A 1X6LA 4NNRA 1FFQA 3CGMA 4DH0A 4XAKA 3WH0A 3WIJA 2PI6A 2XP4A 5GPGA 1XRVA 1Y0OA 3JYMA 1ZL1A 2DSZA 1FKHA 3AS1A 2RUCA 5DF0A 1FKIA 3ARXA 3UQBA 2ZR5A 1ZCNA 4G50A 3CHEA 2O92A 2DT1A 1EQ3A 1FD9A 1M5YA 1YW5A 1VF8A 1HXVA 1Q6UA 2PPNA 4PTMA 4S3KA 1D6OA 3RFWA 5JH8A 2DPEA 3ALFA 4JFJA 4Z2HA 1E9LA 4N19A 4W5UA 1LJYA 4ODPA 5D75A 2YBTA 3O5GA 3JYJA 4W9OA 2FDMA 1K9TA 2M08A 3ODKA 1W1VA 1L1PA 4MSPA 1E6PA 3KZ7A 4DWSB 3O5EA 1FKDA 3FXYA 3PRAA 2A3EA 3AS2A 2DG3A 3GPKA 1NWTA 1NWRA 3KAHA 4MNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6I A;  2Y78 A;  1FAP A;  1T11 A;  2RUR A;  2PBC A;  1ZK6 A;  5I98 A;  5HKG A;  4ODL A;  4TW7 A;  3O5K A;  1D7J A;  1FKJ A;  3PRD A;  4IQ2 A;  4ODM A;  5HW7 A;  2PV3 A;  1FKS A;  3KCE A;  2XPB A;  4DRP A;  2LGO A;  1FJD A;  4TYO A;  2ZQU A;  3TDB A;  2F2D A;  4C02 B;  4QIB A;  2XPA A;  2ITK A;  2MPH A;  4JFM A;  4JYS A;  3NRK A;  1FKF A;  2PPP A;  1ROU A;  2RSE A;  3IKG A;  1YAT A;  3KAF A;  2XP8 A;  4DRN A;  2LKN A;  4U85 A;  1FKR A;  5BXJ A;  2F21 A;  3JXV A;  4G2P A;  3O5M A;  3B7X A;  1W26 A;  4DZ3 A;  5HTG A;  1FKT A;  1FKG A;  1BKF A;  4FN2 A;  4LAW A;  4QT3 A;  1QPL A;  2XP3 A;  3KAG A;  3OOB A;  2M1I A;  5HT1 A;  3UQI A;  4IQC A;  1J4I A;  1A7X A;  1J4R A;  1Q6H A;  5HW8 A;  1C9H A;  1KT1 A;  3O5R A;  1TCO C;  3LUO A;  3O5J A;  1BL4 A;  2MNT A;  4BF8 A;  1JNS A;  2N87 A;  3KAD A;  4LAX A;  3O5F A;  4ODR A;  4GGQ A;  4ODQ A;  2KE0 A;  3I6C A;  1NMV A;  3IK8 A;  4JFI A;  1Q1C A;  2XP9 A;  1PBK A;  2VN1 A;  3IHZ A;  3KAB A;  3O5L A;  4DRH A;  5HUA A;  3MDY B;  1N1A A;  3PA7 A;  1QZ2 A;  4DRK A;  1JVW A;  3KAI A;  1JNT A;  2KI3 A;  4TW8 A;  4DRQ A;  4DZ2 A;  1J6Y A;  5J6E A;  1U79 A;  2JZV A;  3O5O A;  3O5P A;  2DG4 A;  3CGM A;  2XP6 A;  2DG9 A;  2RQS A;  2RUD A;  4NNR A;  3WH0 A;  4DH0 A;  4DRI A;  1ROT A;  2MLY A;  4TX0 A;  2OFN A;  2XP4 A;  4DRJ A;  2FKE A;  4ODK A;  2L2S A;  5GPG A;  2ZQS A;  1KT0 A;  3H9R B;  3O5I A;  1QPF A;  1Y0O A;  4JFK A;  3JYM A;  4W9P A;  4DIP A;  3O5Q A;  2KO7 A;  5HW6 A;  1FKH A;  3O5D A;  2M2A A;  2RUC A;  3EY6 A;  1NSG A;  4LAY A;  5HWC A;  3RGC A;  1FKI A;  3UQB A;  2AWG A;  2ZR5 A;  3IKD A;  1ZCN A;  1R9H A;  2K8I A;  4GIV A;  2RUQ A;  4G50 A;  2KFW A;  2MF9 A;  2XP7 A;  1EQ3 A;  2ZR4 A;  1FD9 A;  1M5Y A;  2ZQV A;  4IPX A;  4R0X A;  1YW5 A;  3PRB A;  5DIT A;  1EYM A;  2XP5 A;  1NMW A;  1HXV A;  1Q6U A;  4DT4 A;  1D7H A;  2PPN A;  5DIV A;  3UF8 A;  5HWB A;  2D9F A;  1FKB A;  1D6O A;  1FKL A;  2PV1 A;  2F4E A;  3FAP A;  4LAV A;  3RFW A;  3UI4 A;  4DRO A;  4U84 A;  1P5Q A;  2KGJ A;  4ODN A;  4JFJ A;  4W9Q A;  1FKK A;  4J4O A;  4N19 A;  4O2T A;  2LJ4 A;  3CGN A;  4ODP A;  1J4H A;  5D75 A;  2PV2 A;  4DRM A;  2KR7 A;  3O5G A;  4JFL A;  2ZQT A;  3UQA A;  3JYJ A;  4W9O A;  3VAW A;  3NI6 A;  2UZ5 A;  4MGV A;  4ODO A;  2MLZ A;  3TCZ A;  2M08 A;  2MLX A;  3ODK A;  4FAP A;  5DIU A;  1L1P A;  3NTP A;  3TC5 A;  4TNS A;  4MSP A;  1B6C A;  2PPO A;  3KZ7 A;  4U86 A;  2VCD A;  3O5E A;  5B8I C;  1FKD A;  4TW6 A;  2IF4 A;  4ITZ A;  1F40 A;  4J4N A;  1F8A B;  2LPV A;  2Q5A A;  2DG3 A;  3GPK A;  3UI5 A;  3KAC A;  4QT2 A;  1PIN A;  3KAH A;  3UI6 A;  1D7I A;  2ZR6 A;  2FAP A; 
#chains in the Genus database with same CATH topology
 4WJX A;  1FAP A;  1T11 A;  1EHN A;  1ZK6 A;  2A3C A;  4IQ2 A;  1W1T A;  1FKS A;  5DEZ A;  2F2D A;  2ITK A;  2MPH A;  1FKF A;  1FFR A;  1ROU A;  3WQV A;  4WKF A;  1FKR A;  2F23 A;  4IT6 A;  1H0I A;  3ALG A;  2WLZ A;  1WNO A;  1FKT A;  1FKG A;  4LAW A;  1ZB5 A;  1W9V A;  2M1I A;  4DWS A;  3ART A;  1J4I A;  1Q6H A;  1KT1 A;  3O5R A;  4ZPW R;  1XHG A;  1TCO C;  2EUL A;  3LUO A;  1BL4 A;  4R5E A;  4BF8 A;  1JNS A;  4LAX A;  1W1P A;  1NMV A;  4JFI A;  2XP9 A;  1EIB A;  3IHZ A;  2VN1 A;  3O5L A;  5HUA A;  4AY1 A;  1KFW A;  1JNT A;  2KI3 A;  3CHF A;  1GUV A;  1JNE A;  2XP6 A;  2RQS A;  1ROT A;  1HKI A;  1LG1 A;  2ETN A;  4DIP A;  3O5I A;  3B9A A;  3O5Q A;  2KO7 A;  4MNL A;  3O5D A;  2M2A A;  4LAY A;  4P8V A;  5HWC A;  3WL1 A;  1WAW A;  1R9H A;  2K8I A;  4GIV A;  2RUQ A;  4Z2K A;  3RM9 A;  2MF9 A;  4Z2G A;  3RM8 A;  1EYM A;  3RM4 A;  2B5U B;  4HAR A;  1D2K A;  2D9F A;  1FKB A;  1NH6 A;  2PV1 A;  2F4E A;  3BXW A;  4WKA A;  4U84 A;  1HKK A;  4O2T A;  3CGN A;  1NWS A;  2KR7 A;  2ZQT A;  2DT2 A;  5DO2 A;  1ZBK A;  3NTP A;  3FY1 A;  2A3A A;  4U86 A;  5B8I C;  1F40 A;  2LPV A;  2Q5A A;  3UI5 A;  3AS0 A;  3KAC A;  1PIN A;  3UI6 A;  1D7I A;  2ZR6 A;  2FAP A;  4MPK A;  1ZBV A;  1Q6I A;  3ARR A;  2RUR A;  3CZ8 A;  2PBC A;  3CH9 A;  3CHD A;  4TW7 A;  3PRD A;  3ARP A;  1E15 A;  1GPF A;  2ZQU A;  4QIB A;  5GQB A;  3KAF A;  1LQ0 A;  2LKN A;  4Q7N A;  3G6L A;  4U85 A;  5BXJ A;  3GU0 A;  1QPL A;  2WLY A;  3KAG A;  3OOB A;  3UQI A;  4MNK A;  2DSV A;  4ZPV R;  3BMB A;  3O5J A;  2MNT A;  3ARQ A;  1NWU A;  1W9P A;  2KE0 A;  3IK8 A;  1PBK A;  3KAB A;  1SYT A;  3EIP A;  4DZ2 A;  1J6Y A;  2JZV A;  3RME A;  3O5P A;  2DG4 A;  1E6N A;  1RD6 A;  2MLY A;  4TX0 A;  1HKJ A;  2OFN A;  4DRJ A;  2FKE A;  2L2S A;  4WK9 A;  1QPF A;  2QF8 A;  5HW6 A;  1O6I A;  1NSG A;  4HBO A;  3RGC A;  2AWG A;  3IKD A;  1UR9 A;  2B31 A;  2WM0 A;  2XP7 A;  2ZR4 A;  2ZQV A;  5GPR A;  4Z2L A;  5DIT A;  3B9E A;  3FAP A;  2ESC A;  3WD0 A;  2WK2 A;  3ARU A;  4KR0 B;  2KGJ A;  2AOS A;  4J4O A;  1HKM A;  4DRM A;  3WKZ A;  4JFL A;  3UQA A;  3NI6 A;  2UZ5 A;  4MGV A;  4ODO A;  2MLX A;  4FAP A;  5DIU A;  3TC5 A;  4KQZ A;  2IF4 A;  1HJW A;  1F8A B;  1W9U A;  1JCH B;  4QT2 A;  3WL0 A;  2Y78 A;  1JND A;  1WB0 A;  3QOK A;  5I98 A;  4HBE A;  1SR0 A;  5HKG A;  5HW7 A;  1D7J A;  1OWQ A;  4P8W A;  2XPB A;  2LGO A;  4C02 B;  4JFM A;  4JYS A;  3NRK A;  2RSE A;  1YAT A;  4Z2J A;  4G2P A;  2DSU A;  3O5M A;  4DWS D;  3G6M A;  4DWS C;  5HTG A;  2OLH A;  4P8X A;  4ZPT R;  3CHC A;  1W1Y A;  4UDM A;  2DT0 A;  4IQC A;  1H0G A;  1J4R A;  1C9H A;  1ZU8 A;  3KAD A;  4ODR A;  1ITX A;  3OA5 A;  4ODQ A;  4IT4 A;  3ARY A;  3MDY B;  3PA7 A;  3ARW A;  1QZ2 A;  1IX5 A;  4DRK A;  4TW8 A;  1HJV A;  2P4V A;  5J6E A;  1U79 A;  3O5O A;  4DZ3 A;  4DRI A;  4P8U A;  2DG9 A;  2RUD A;  4MAV A;  4Z2I A;  4NSB A;  1LL6 A;  4ODK A;  2ZQS A;  1KT0 A;  3H9R B;  4JFK A;  4W9P A;  4LGX A;  1HJX A;  1CTN A;  3EY6 A;  1UR8 A;  3WD2 A;  2KFW A;  3AS3 A;  3W4R A;  1LL7 A;  1ZBC A;  2IUZ A;  4R0X A;  4IPX A;  3PRB A;  2A3B A;  2XP5 A;  1NMW A;  4URI A;  4DT4 A;  1D7H A;  5DIV A;  3UF8 A;  5HWB A;  3UI4 A;  4LAV A;  1FKL A;  4DRO A;  1EDQ A;  3WD3 A;  1P5Q A;  4ODN A;  4W9Q A;  1FKK A;  2LJ4 A;  1J4H A;  2PV2 A;  3AQU A;  1E6R A;  3WD1 A;  2G41 A;  2YBU A;  3B9D A;  3VAW A;  2MLZ A;  3TCZ A;  4TNS A;  1B6C A;  4QZV B;  2PPO A;  2VCD A;  4TW6 A;  4ITZ A;  5HBF A;  3WQW A;  4J4N A;  4L3N A;  4L72 B;  4ML4 A;  1OGB A;  4WIW A;  3ARV A;  4ODL A;  1GOI A;  3ARS A;  1FKJ A;  3O5K A;  3PR9 A;  4ODM A;  4MTV A;  2PV3 A;  3KCE A;  1E6Z A;  1LG2 A;  4DRP A;  1FJD A;  4TYO A;  3TDB A;  3ARO A;  2XPA A;  1TFV A;  2PPP A;  3IKG A;  4DRN A;  2XP8 A;  4NZC A;  1LL4 A;  2F21 A;  3JXV A;  3B7X A;  3WD4 A;  1W26 A;  4WKH A;  3ARZ A;  2G8Z A;  4Q22 A;  1BKF A;  4FN2 A;  4QT3 A;  2XP3 A;  2O9O A;  4S3J A;  5HT1 A;  2DSW A;  3B8S A;  1A7X A;  5HW8 A;  2N87 A;  3O5F A;  1ZBW A;  4GGQ A;  3GTY X;  3I6C A;  1X6N A;  1Q1C A;  2PN0 A;  4DRH A;  1OGG A;  4MNJ A;  1N1A A;  4ZS6 A;  1JVW A;  3KAI A;  4DRQ A;  2DT3 A;  1X6L A;  4NNR A;  1FFQ A;  3CGM A;  4DH0 A;  4XAK A;  3WH0 A;  3WIJ A;  2PI6 A;  2XP4 A;  5GPG A;  1XRV A;  1Y0O A;  3JYM A;  1ZL1 A;  2DSZ A;  1FKH A;  3AS1 A;  2RUC A;  5DF0 A;  1FKI A;  3ARX A;  3UQB A;  2ZR5 A;  1ZCN A;  4G50 A;  3CHE A;  2O92 A;  2DT1 A;  1EQ3 A;  1FD9 A;  1M5Y A;  1YW5 A;  1VF8 A;  1HXV A;  1Q6U A;  2PPN A;  4PTM A;  4S3K A;  1D6O A;  3RFW A;  5JH8 A;  2DPE A;  3ALF A;  4JFJ A;  4Z2H A;  1E9L A;  4N19 A;  4W5U A;  1LJY A;  4ODP A;  5D75 A;  2YBT A;  3O5G A;  3JYJ A;  4W9O A;  2FDM A;  1K9T A;  2M08 A;  3ODK A;  1W1V A;  1L1P A;  4MSP A;  1E6P A;  3KZ7 A;  4DWS B;  3O5E A;  1FKD A;  3FXY A;  1GRJ A;  3PRA A;  2A3E A;  3AS2 A;  2DG3 A;  3GPK A;  1E44 A;  1NWT A;  1NWR A;  3KAH A;  4MNM A; 
#chains in the Genus database with same CATH homology
 4WJX A;  1FAP A;  1T11 A;  1EHN A;  1ZK6 A;  2A3C A;  4IQ2 A;  1W1T A;  1FKS A;  5DEZ A;  2F2D A;  2ITK A;  2MPH A;  1FKF A;  1FFR A;  1ROU A;  3WQV A;  4WKF A;  1FKR A;  4IT6 A;  1H0I A;  3ALG A;  2WLZ A;  1WNO A;  1FKT A;  1FKG A;  4LAW A;  1ZB5 A;  1W9V A;  2M1I A;  4DWS A;  3ART A;  1J4I A;  1Q6H A;  1KT1 A;  3O5R A;  4ZPW R;  1XHG A;  1TCO C;  3LUO A;  4R5E A;  1BL4 A;  4BF8 A;  1JNS A;  4LAX A;  1W1P A;  1NMV A;  4JFI A;  2XP9 A;  1EIB A;  3IHZ A;  2VN1 A;  3O5L A;  5HUA A;  4AY1 A;  1KFW A;  1JNT A;  2KI3 A;  3CHF A;  1GUV A;  1JNE A;  2XP6 A;  2RQS A;  1ROT A;  1HKI A;  1LG1 A;  4DIP A;  3O5I A;  3B9A A;  3O5Q A;  2KO7 A;  4MNL A;  3O5D A;  2M2A A;  4LAY A;  4P8V A;  5HWC A;  3WL1 A;  1WAW A;  1R9H A;  2K8I A;  4GIV A;  2RUQ A;  4Z2K A;  3RM9 A;  2MF9 A;  4Z2G A;  3RM8 A;  1EYM A;  3RM4 A;  4HAR A;  1D2K A;  2D9F A;  1FKB A;  1NH6 A;  2PV1 A;  2F4E A;  3BXW A;  4WKA A;  4U84 A;  1HKK A;  4O2T A;  3CGN A;  1NWS A;  2KR7 A;  2ZQT A;  2DT2 A;  5DO2 A;  1ZBK A;  3NTP A;  3FY1 A;  2A3A A;  4U86 A;  5B8I C;  1F40 A;  2LPV A;  2Q5A A;  3UI5 A;  3AS0 A;  3KAC A;  1PIN A;  3UI6 A;  1D7I A;  2ZR6 A;  2FAP A;  4MPK A;  1ZBV A;  1Q6I A;  3ARR A;  2RUR A;  3CZ8 A;  2PBC A;  3CH9 A;  3CHD A;  4TW7 A;  3PRD A;  3ARP A;  1E15 A;  1GPF A;  2ZQU A;  4QIB A;  5GQB A;  3KAF A;  1LQ0 A;  2LKN A;  4Q7N A;  3G6L A;  4U85 A;  5BXJ A;  1QPL A;  2WLY A;  3KAG A;  3OOB A;  3UQI A;  4MNK A;  2DSV A;  4ZPV R;  3O5J A;  2MNT A;  3ARQ A;  1NWU A;  1W9P A;  2KE0 A;  3IK8 A;  1PBK A;  3KAB A;  1SYT A;  4DZ2 A;  1J6Y A;  2JZV A;  3RME A;  3O5P A;  2DG4 A;  1E6N A;  1RD6 A;  2MLY A;  4TX0 A;  1HKJ A;  2OFN A;  4DRJ A;  2FKE A;  2L2S A;  4WK9 A;  1QPF A;  2QF8 A;  5HW6 A;  1O6I A;  1NSG A;  4HBO A;  3RGC A;  2AWG A;  3IKD A;  1UR9 A;  2B31 A;  2WM0 A;  2XP7 A;  2ZR4 A;  2ZQV A;  5GPR A;  4Z2L A;  5DIT A;  3B9E A;  3FAP A;  2ESC A;  3WD0 A;  2WK2 A;  3ARU A;  4KR0 B;  2KGJ A;  2AOS A;  4J4O A;  1HKM A;  4DRM A;  3WKZ A;  4JFL A;  3UQA A;  3NI6 A;  2UZ5 A;  4MGV A;  4ODO A;  2MLX A;  4FAP A;  5DIU A;  3TC5 A;  4KQZ A;  2IF4 A;  1HJW A;  1F8A B;  1W9U A;  4QT2 A;  3WL0 A;  2Y78 A;  1JND A;  1WB0 A;  3QOK A;  5I98 A;  4HBE A;  1SR0 A;  5HKG A;  5HW7 A;  1D7J A;  1OWQ A;  4P8W A;  2XPB A;  2LGO A;  4C02 B;  4JFM A;  4JYS A;  3NRK A;  2RSE A;  1YAT A;  4Z2J A;  4G2P A;  2DSU A;  3O5M A;  4DWS D;  3G6M A;  4DWS C;  5HTG A;  2OLH A;  4P8X A;  4ZPT R;  3CHC A;  1W1Y A;  2DT0 A;  4IQC A;  1H0G A;  1J4R A;  1C9H A;  1ZU8 A;  3KAD A;  4ODR A;  1ITX A;  3OA5 A;  4ODQ A;  4IT4 A;  3ARY A;  3MDY B;  3PA7 A;  3ARW A;  1QZ2 A;  1IX5 A;  4DRK A;  4TW8 A;  1HJV A;  5J6E A;  1U79 A;  3O5O A;  4DZ3 A;  4DRI A;  4P8U A;  2DG9 A;  2RUD A;  4MAV A;  4Z2I A;  4NSB A;  1LL6 A;  4ODK A;  2ZQS A;  1KT0 A;  3H9R B;  4JFK A;  4W9P A;  4LGX A;  1HJX A;  1CTN A;  3EY6 A;  1UR8 A;  3WD2 A;  2KFW A;  3AS3 A;  3W4R A;  1LL7 A;  1ZBC A;  2IUZ A;  4R0X A;  4IPX A;  3PRB A;  2A3B A;  2XP5 A;  1NMW A;  4URI A;  4DT4 A;  1D7H A;  5DIV A;  3UF8 A;  5HWB A;  3UI4 A;  4LAV A;  1FKL A;  4DRO A;  1EDQ A;  3WD3 A;  1P5Q A;  4ODN A;  4W9Q A;  1FKK A;  2LJ4 A;  1J4H A;  2PV2 A;  3AQU A;  1E6R A;  3WD1 A;  2G41 A;  2YBU A;  3B9D A;  3VAW A;  2MLZ A;  3TCZ A;  4TNS A;  1B6C A;  4QZV B;  2PPO A;  2VCD A;  4TW6 A;  4ITZ A;  5HBF A;  3WQW A;  4J4N A;  4L3N A;  4L72 B;  4ML4 A;  1OGB A;  4WIW A;  3ARV A;  4ODL A;  1GOI A;  3ARS A;  1FKJ A;  3O5K A;  3PR9 A;  4ODM A;  4MTV A;  2PV3 A;  3KCE A;  1E6Z A;  1LG2 A;  4DRP A;  1FJD A;  4TYO A;  3TDB A;  3ARO A;  2XPA A;  1TFV A;  2PPP A;  3IKG A;  4DRN A;  2XP8 A;  4NZC A;  1LL4 A;  2F21 A;  3JXV A;  3B7X A;  3WD4 A;  1W26 A;  4WKH A;  3ARZ A;  2G8Z A;  4Q22 A;  1BKF A;  4FN2 A;  4QT3 A;  2XP3 A;  2O9O A;  4S3J A;  5HT1 A;  2DSW A;  3B8S A;  1A7X A;  5HW8 A;  2N87 A;  3O5F A;  1ZBW A;  4GGQ A;  3I6C A;  1X6N A;  1Q1C A;  4DRH A;  1OGG A;  4MNJ A;  1N1A A;  4ZS6 A;  1JVW A;  3KAI A;  4DRQ A;  2DT3 A;  1X6L A;  4NNR A;  1FFQ A;  3CGM A;  4DH0 A;  4XAK A;  3WH0 A;  3WIJ A;  2PI6 A;  2XP4 A;  5GPG A;  1XRV A;  1Y0O A;  3JYM A;  1ZL1 A;  2DSZ A;  1FKH A;  3AS1 A;  2RUC A;  5DF0 A;  1FKI A;  3ARX A;  3UQB A;  2ZR5 A;  1ZCN A;  4G50 A;  3CHE A;  2O92 A;  2DT1 A;  1EQ3 A;  1FD9 A;  1M5Y A;  1YW5 A;  1VF8 A;  1HXV A;  1Q6U A;  2PPN A;  4PTM A;  4S3K A;  1D6O A;  3RFW A;  5JH8 A;  2DPE A;  3ALF A;  4JFJ A;  4Z2H A;  1E9L A;  4N19 A;  4W5U A;  1LJY A;  4ODP A;  5D75 A;  2YBT A;  3O5G A;  3JYJ A;  4W9O A;  2FDM A;  1K9T A;  2M08 A;  3ODK A;  1W1V A;  1L1P A;  4MSP A;  1E6P A;  3KZ7 A;  4DWS B;  3O5E A;  1FKD A;  3FXY A;  3PRA A;  2A3E A;  3AS2 A;  2DG3 A;  3GPK A;  1NWT A;  1NWR A;  3KAH A;  4MNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...