2L2SA

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
117
structure length
117
Chain Sequence
b'GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 13
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2l2sA00
4JFIA 1KT0A 2RUDA 5B8IC 1FKDA 1A7XA 3H9RB 1JVWA 1ROTA 1Q6UA 2OFNA 1NSGA 2N87A 1TCOC 2XP5A 1FKFA 2XP6A 2ZQVA 4ODQA 5HWCA 2KO7A 1J4IA 1ZCNA 3KADA 4W9QA 2PV2A 2PPOA 2UZ5A 3PRBA 2D9FA 3VAWA 1NMWA 3KCEA 1FKSA 1Y0OA 2ZR6A 2LJ4A 2ZR5A 3GPKA 4LAVA 1F8AB 4U84A 4TNSA 5HW7A 1KT1A 2RQSA 2VCDA 4DRNA 2PPPA 2AWGA 3O5FA 3JXVA 2MF9A 2MNTA 3O5DA 5D75A 3IHZA 4ODMA 5HUAA 5I98A 1NMVA 1QZ2A 2PV3A 2RUQA 2RUCA 2F2DA 4JFMA 5DITA 5HT1A 4TW7A 4W9OA 1D7IA 3UQIA 2LPVA 4IQCA 2LKNA 3O5RA 4TX0A 2DG4A 5DIUA 3UI6A 2XP8A 3O5PA 5DIVA 3UI5A 4DRPA 2ZQTA 4DH0A 2K8IA 4NNRA 2ZR4A 3CGNA 4ODNA 5GPGA 4DT4A 4FAPA 5BXJA 2KI3A 3TCZA 4DROA 2XPBA 2MLXA 2ZQUA 4JFKA 2MLYA 4QIBA 4TYOA 3UI4A 4JFLA 3O5LA 1FKGA 1YATA 1QPLA 1W26A 3KAGA 4G2PA 4DRQA 4GGQA 4TW6A 3IKGA 3JYJA 3NRKA 1FKKA 2L2SA 1FKJA 3FAPA 2KGJA 4LAWA 4DRMA 3KABA 3PA7A 4ITZA 2FAPA 3CGMA 3KAHA 1D7HA 1BL4A 2F21A 2MLZA 3IKDA 3PRDA 4W9PA 3TC5A 1FD9A 1FJDA 2XP3A 3NI6A 1Q1CA 4ODLA 1FKIA 2XP7A 4ODRA 4QT2A 3RFWA 4DIPA 1EYMA 3O5QA 2PV1A 2Q5AA 2DG9A 4G50A 4DRKA 1M5YA 3IK8A 3UF8A 1QPFA 3O5IA 3TDBA 5HW6A 2XPAA 5J6EA 1L1PA 1JNTA 2RURA 3O5KA 1J6YA 1FKLA 4J4NA 3UQAA 1J4HA 1FKTA 1R9HA 4J4OA 4QT3A 1BKFA 3EY6A 2M08A 2Y78A 3O5JA 4TW8A 1ZK6A 5HWBA 1YW5A 4LAXA 5HW8A 1FKHA 4ODPA 4MSPA 3NTPA 2DG3A 4GIVA 4MGVA 4R0XA 2M2AA 3OOBA 2VN1A 3LUOA 3O5EA 3O5MA 2RSEA 1D6OA 2XP4A 3RGCA 1F40A 4JFJA 3KAFA 3KACA 4IQ2A 1FAPA 2F4EA 2IF4A 2KE0A 3JYMA 4IPXA 1FKRA 2KR7A 2MPHA 4ODOA 5HKGA 4O2TA 2M1IA 4U86A 1J4RA 1U79A 2KFWA 5HTGA 1C9HA 1D7JA 4U85A 3UQBA 2LGOA 1EQ3A 1JNSA 3ODKA 1T11A 4C02B 3MDYB 1Q6IA 2PPNA 3KZ7A 1B6CA 4LAYA 3I6CA 3WH0A 2PBCA 3O5OA 4DZ3A 3B7XA 3O5GA 4DZ2A 2ITKA 1Q6HA 4FN2A 3KAIA 1FKBA 1PINA 4N19A 4DRJA 1N1AA 4BF8A 4DRIA 4DRHA 2FKEA 4JYSA 1ROUA 2ZQSA 1PBKA 2JZVA 4ODKA 1HXVA 2XP9A 1P5QA
chains in the Genus database with same CATH superfamily
2QF8A 4HARA 4JFIA 4S3KA 1LL6A 1XHGA 4ZPTR 3CH9A 1FKDA 1JVWA 4ZS6A 2N87A 3AS3A 1XRVA 4Z2KA 1KFWA 1JNEA 1NWUA 4W9QA 1HJXA 2PPOA 3GU0A 3RMEA 1FKSA 3GPKA 4LAVA 1KT1A 1EHNA 4ZPWR 2F23A 2VCDA 4DWSD 2PPPA 2AOSA 2AWGA 1NWTA 1W1TA 3IHZA 1JNDA 2B5UB 4W9OA 3AQUA 3ARWA 1SR0A 4WIWA 4IQCA 2LKNA 1ITXA 2DG4A 3AS2A 3WQVA 2XP8A 2ZQTA 4DT4A 3ALGA 3TCZA 2PN0A 2MLXA 2ZQUA 3EIPA 3G6LA 4MNJA 3UI4A 4R5EA 1W26A 3W4RA 4DRQA 3RM8A 1NWRA 3KABA 3PA7A 2F21A 3PRDA 1FJDA 4HBEA 2ESCA 3B9EA 3CHCA 1Q1CA 3G6MA 3ARTA 2XP7A 4ODRA 1EYMA 3BXWA 4G50A 1E6ZA 4KR0B 3TDBA 5J6EA 3WL1A 1ZBCA 1FKLA 3UQAA 1ZBKA 1R9HA 3PR9A 3O5JA 1GPFA 2DSWA 5HWBA 3ARZA 1VF8A 4MSPA 1OWQA 2WK2A 1D6OA 1F40A 4JFJA 2B31A 3KACA 2EULA 2F4EA 2WM0A 3JYMA 4WKFA 4O2TA 1U79A 5HTGA 2LGOA 3ODKA 3ARPA 3MDYB 1Q6IA 3I6CA 4NZCA 4NSBA 3B7XA 1Q6HA 3KAIA 1PINA 4L72B 4BF8A 1LQ0A 1W1YA 2ZQSA 1HXVA 3WIJA 4ODKA 3GTYX 2A3AA 5B8IC 1LJYA 1A7XA 4KQZA 1ROTA 1NSGA 1TCOC 2XP5A 1FKFA 4DWSB 1ZCNA 3KADA 1JCHB 2PV2A 3ARVA 2UZ5A 4DWSA 2D9FA 3AS0A 3ARRA 1Y0OA 4Z2JA 2LJ4A 2ZR5A 5GQBA 1FFRA 3O5FA 4WK9A 5HBFA 4TW7A 3WKZA 2A3BA 2WLYA 2LPVA 1E44A 2DT1A 2IUZA 2P4VA 5DIUA 3O5PA 1W1VA 3CGNA 4P8UA 4FAPA 3BMBA 3B8SA 4DROA 4Z2IA 4QIBA 3WQWA 4HBOA 1QPLA 4G2PA 3WD2A 1CTNA 4GGQA 4MTVA 1FKJA 4J4OA 2FAPA 3CGMA 3KAHA 3WL0A 2DT3A 4ODLA 5DO2A 3O5QA 2PV1A 3UF8A 3AROA 3O5IA 2XPAA 3ARUA 1JNTA 2RURA 3O5KA 2M08A 4Q7NA 4TW8A 1ZK6A 2G8ZA 1HKKA 4MPKA 3NTPA 4MGVA 4R0XA 2M2AA 2VN1A 1LG2A 1GRJA 3LUOA 2RSEA 1WAWA 1GUVA 1FAPA 4LGXA 2MPHA 4ODOA 2M1IA 4C02B 3KZ7A 1EDQA 1W9UA 1B6CA 3WD1A 2A3EA 2PBCA 3O5OA 4DZ3A 4DZ2A 4N19A 1N1AA 3WD3A 1WB0A 3WD4A 4JYSA 1IX5A 2DT0A 1ZBVA 1UR9A 2XP9A 1W9VA 2RUDA 3H9RB 4LAWA 1Q6UA 2XP6A 5HWCA 4ODQA 1UR8A 3ARXA 1GOIA 1ZBWA 3VAWA 3KCEA 1FFQA 1WNOA 2ZR6A 4U84A 2ETNA 2DSUA 2RQSA 4DRNA 5D75A 1W1PA 5HUAA 2MNTA 4ODMA 2RUQA 2F2DA 4P8XA 4JFMA 5HT1A 3UQIA 1LG1A 3ALFA 3O5RA 1EIBA 3UI6A 5DIVA 3UI5A 3CHEA 2ZR4A 2G41A 2XPBA 1E6RA 1NWSA 4TYOA 4MNKA 3O5LA 3KAGA 1O6IA 2O92A 2PI6A 3NRKA 5JH8A 3FAPA 2KGJA 4Z2LA 4P8WA 4W9PA 4MNLA 2MLZA 3TC5A 2XP3A 4MAVA 4XAKA 1FKIA 2DSVA 2Q5AA 2WLZA 4DRKA 1M5YA 3IK8A 1QPFA 5DEZA 1HKIA 4UDMA 1J6YA 4J4NA 4S3JA 1J4HA 4QT3A 1BKFA 2Y78A 1E6PA 1OGBA 4LAXA 5HW8A 1FKHA 4ODPA 3FXYA 1H0GA 3OOBA 3O5EA 3ARSA 3KAFA 4P8VA 4IQ2A 1RD6A 4L3NA 1HJWA 2OLHA 3B9DA 4W5UA 1J4RA 1D2KA 1D7JA 3UQBA 1T11A 4PTMA 4LAYA 2DSZA 5GPRA 3O5GA 1LL7A 2ITKA 5BXJA 4DRJA 1NH6A 4DRIA 1ROUA 2MLYA 2JZVA 5DITA 4IPXA 4IT6A 3CHDA 4AY1A 1KT0A 4Z2HA 2DT2A 1E15A 3FY1A 4JFKA 2OFNA 2ZQVA 4IT4A 3WD0A 3ARYA 2KO7A 1J4IA 3ARQA 4MNMA 1HKJA 3PRBA 3B9AA 3CZ8A 1NMWA 1K9TA 1F8AB 1H0IA 1W9PA 4TNSA 5HW7A 4URIA 3JXVA 2MF9A 5I98A 3O5DA 1NMVA 1QZ2A 2PV3A 2RUCA 3RM4A 1D7IA 1ZB5A 1HKMA 4TX0A 2FDMA 4WJXA 4DRPA 4DH0A 2K8IA 4NNRA 5GPGA 4ODNA 2DPEA 3AS1A 1TFVA 2KI3A 2O9OA 1HJVA 4JFLA 1FKGA 4WKAA 1YATA 2A3CA 3PRAA 4TW6A 3IKGA 3JYJA 1FKKA 4QZVB 2L2SA 1E6NA 4DRMA 3RM9A 1OGGA 4ZPVR 4ITZA 5HW6A 1D7HA 1BL4A 1X6NA 3IKDA 1FD9A 3NI6A 4QT2A 3RFWA 4DIPA 4WKHA 1SYTA 2DG9A 1ZL1A 1L1PA 1FKTA 3EY6A 3OA5A 1YW5A 2DG3A 4GIVA 3O5MA 3RGCA 2XP4A 4Z2GA 3CHFA 1X6LA 2IF4A 2KE0A 1FKRA 2KR7A 1ZU8A 4ML4A 1LL4A 5HKGA 2YBUA 4U86A 2KFWA 1EQ3A 1C9HA 1JNSA 4U85A 5DF0A 1E9LA 2YBTA 2PPNA 3WH0A 4Q22A 4FN2A 1FKBA 3QOKA 4DRHA 2FKEA 1PBKA 4DWSC 1P5QA
chains in the Genus database with same CATH topology
2QF8A 4HARA 4JFIA 4S3KA 1LL6A 1XHGA 4ZPTR 3CH9A 1FKDA 1JVWA 4ZS6A 2N87A 3AS3A 1XRVA 4Z2KA 1KFWA 1JNEA 1NWUA 4W9QA 1HJXA 2PPOA 3RMEA 1FKSA 3GPKA 4LAVA 1KT1A 1EHNA 4ZPWR 2VCDA 4DWSD 2PPPA 2AOSA 2AWGA 1NWTA 1W1TA 3IHZA 1JNDA 4W9OA 3AQUA 3ARWA 1SR0A 4WIWA 4IQCA 2LKNA 1ITXA 2DG4A 3AS2A 3WQVA 2XP8A 2ZQTA 4DT4A 3ALGA 3TCZA 2MLXA 2ZQUA 3G6LA 4MNJA 3UI4A 4R5EA 1W26A 3W4RA 4DRQA 3RM8A 1NWRA 3KABA 3PA7A 2F21A 3PRDA 1FJDA 4HBEA 2ESCA 3B9EA 3CHCA 1Q1CA 3G6MA 3ARTA 2XP7A 4ODRA 1EYMA 3BXWA 4G50A 1E6ZA 4KR0B 3TDBA 5J6EA 3WL1A 1ZBCA 1FKLA 3UQAA 1ZBKA 1R9HA 3PR9A 3O5JA 1GPFA 2DSWA 5HWBA 3ARZA 1VF8A 4MSPA 1OWQA 2WK2A 1D6OA 1F40A 4JFJA 2B31A 3KACA 2F4EA 2WM0A 3JYMA 4WKFA 4O2TA 1U79A 5HTGA 2LGOA 3ODKA 3ARPA 3MDYB 1Q6IA 3I6CA 4NZCA 4NSBA 3B7XA 1Q6HA 3KAIA 1PINA 4L72B 4BF8A 1LQ0A 1W1YA 2ZQSA 1HXVA 3WIJA 4ODKA 2A3AA 5B8IC 1LJYA 1A7XA 4KQZA 1ROTA 1NSGA 1TCOC 2XP5A 1FKFA 4DWSB 1ZCNA 3KADA 2PV2A 3ARVA 2UZ5A 4DWSA 2D9FA 3AS0A 3ARRA 1Y0OA 4Z2JA 2LJ4A 2ZR5A 5GQBA 1FFRA 3O5FA 4WK9A 5HBFA 4TW7A 3WKZA 2A3BA 2WLYA 2LPVA 2DT1A 2IUZA 5DIUA 3O5PA 1W1VA 3CGNA 4P8UA 4FAPA 3B8SA 4DROA 4Z2IA 4QIBA 3WQWA 4HBOA 1QPLA 4G2PA 3WD2A 1CTNA 4GGQA 4MTVA 1FKJA 4J4OA 2FAPA 3CGMA 3KAHA 3WL0A 2DT3A 4ODLA 5DO2A 3O5QA 2PV1A 3UF8A 3AROA 3O5IA 2XPAA 3ARUA 1JNTA 2RURA 3O5KA 2M08A 4Q7NA 4TW8A 1ZK6A 2G8ZA 1HKKA 4MPKA 3NTPA 4MGVA 4R0XA 2M2AA 2VN1A 1LG2A 3LUOA 2RSEA 1WAWA 1GUVA 1FAPA 4LGXA 2MPHA 4ODOA 2M1IA 4C02B 3KZ7A 1EDQA 1W9UA 1B6CA 3WD1A 2A3EA 2PBCA 3O5OA 4DZ3A 4DZ2A 4N19A 1N1AA 3WD3A 1WB0A 3WD4A 4JYSA 1IX5A 2DT0A 1ZBVA 1UR9A 2XP9A 1W9VA 2RUDA 3H9RB 4LAWA 1Q6UA 2XP6A 5HWCA 4ODQA 1UR8A 3ARXA 1GOIA 1ZBWA 3VAWA 3KCEA 1FFQA 1WNOA 2ZR6A 4U84A 2DSUA 2RQSA 4DRNA 5D75A 1W1PA 5HUAA 2MNTA 4ODMA 2RUQA 2F2DA 4P8XA 4JFMA 5HT1A 3UQIA 1LG1A 3ALFA 3O5RA 1EIBA 3UI6A 5DIVA 3UI5A 3CHEA 2ZR4A 2G41A 2XPBA 1E6RA 1NWSA 4TYOA 4MNKA 3O5LA 3KAGA 1O6IA 2O92A 2PI6A 3NRKA 5JH8A 3FAPA 2KGJA 4Z2LA 4P8WA 4W9PA 4MNLA 2MLZA 3TC5A 2XP3A 4MAVA 4XAKA 1FKIA 2DSVA 2Q5AA 2WLZA 4DRKA 1M5YA 3IK8A 1QPFA 5DEZA 1HKIA 1J6YA 4J4NA 4S3JA 1J4HA 4QT3A 1BKFA 2Y78A 1E6PA 1OGBA 4LAXA 5HW8A 1FKHA 4ODPA 3FXYA 1H0GA 3OOBA 3O5EA 3ARSA 3KAFA 4P8VA 4IQ2A 1RD6A 4L3NA 1HJWA 2OLHA 3B9DA 4W5UA 1J4RA 1D2KA 1D7JA 3UQBA 1T11A 4PTMA 4LAYA 2DSZA 5GPRA 3O5GA 1LL7A 2ITKA 5BXJA 4DRJA 1NH6A 4DRIA 1ROUA 2MLYA 2JZVA 5DITA 4IPXA 4IT6A 3CHDA 4AY1A 1KT0A 4Z2HA 2DT2A 1E15A 3FY1A 4JFKA 2OFNA 2ZQVA 4IT4A 3WD0A 3ARYA 2KO7A 1J4IA 3ARQA 4MNMA 1HKJA 3PRBA 3B9AA 3CZ8A 1NMWA 1K9TA 1F8AB 1H0IA 1W9PA 4TNSA 5HW7A 4URIA 3JXVA 2MF9A 5I98A 3O5DA 1NMVA 1QZ2A 2PV3A 2RUCA 3RM4A 1D7IA 1ZB5A 1HKMA 4TX0A 2FDMA 4WJXA 4DRPA 4DH0A 2K8IA 4NNRA 5GPGA 4ODNA 2DPEA 3AS1A 1TFVA 2KI3A 2O9OA 1HJVA 4JFLA 1FKGA 4WKAA 1YATA 2A3CA 3PRAA 4TW6A 3IKGA 3JYJA 1FKKA 4QZVB 2L2SA 1E6NA 4DRMA 3RM9A 1OGGA 4ZPVR 4ITZA 5HW6A 1D7HA 1BL4A 1X6NA 3IKDA 1FD9A 3NI6A 4QT2A 3RFWA 4DIPA 4WKHA 1SYTA 2DG9A 1ZL1A 1L1PA 1FKTA 3EY6A 3OA5A 1YW5A 2DG3A 4GIVA 3O5MA 3RGCA 2XP4A 4Z2GA 3CHFA 1X6LA 2IF4A 2KE0A 1FKRA 2KR7A 1ZU8A 4ML4A 1LL4A 5HKGA 2YBUA 4U86A 2KFWA 1EQ3A 1C9HA 1JNSA 4U85A 5DF0A 1E9LA 2YBTA 2PPNA 3WH0A 4Q22A 4FN2A 1FKBA 3QOKA 4DRHA 2FKEA 1PBKA 4DWSC 1P5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFI A;  1KT0 A;  2RUD A;  5B8I C;  1FKD A;  1A7X A;  3H9R B;  1JVW A;  1ROT A;  1Q6U A;  2OFN A;  1NSG A;  2N87 A;  1TCO C;  2XP5 A;  1FKF A;  2XP6 A;  2ZQV A;  4ODQ A;  5HWC A;  2KO7 A;  1J4I A;  1ZCN A;  3KAD A;  4W9Q A;  2PV2 A;  2PPO A;  2UZ5 A;  3PRB A;  2D9F A;  3VAW A;  1NMW A;  3KCE A;  1FKS A;  1Y0O A;  2ZR6 A;  2LJ4 A;  2ZR5 A;  3GPK A;  4LAV A;  1F8A B;  4U84 A;  4TNS A;  5HW7 A;  1KT1 A;  2RQS A;  2VCD A;  4DRN A;  2PPP A;  2AWG A;  3O5F A;  3JXV A;  2MF9 A;  2MNT A;  3O5D A;  5D75 A;  3IHZ A;  4ODM A;  5HUA A;  5I98 A;  1NMV A;  1QZ2 A;  2PV3 A;  2RUQ A;  2RUC A;  2F2D A;  4JFM A;  5DIT A;  5HT1 A;  4TW7 A;  4W9O A;  1D7I A;  3UQI A;  2LPV A;  4IQC A;  2LKN A;  3O5R A;  4TX0 A;  2DG4 A;  5DIU A;  3UI6 A;  2XP8 A;  3O5P A;  5DIV A;  3UI5 A;  4DRP A;  2ZQT A;  4DH0 A;  2K8I A;  4NNR A;  2ZR4 A;  3CGN A;  4ODN A;  5GPG A;  4DT4 A;  4FAP A;  5BXJ A;  2KI3 A;  3TCZ A;  4DRO A;  2XPB A;  2MLX A;  2ZQU A;  4JFK A;  2MLY A;  4QIB A;  4TYO A;  3UI4 A;  4JFL A;  3O5L A;  1FKG A;  1YAT A;  1QPL A;  1W26 A;  3KAG A;  4G2P A;  4DRQ A;  4GGQ A;  4TW6 A;  3IKG A;  3JYJ A;  3NRK A;  1FKK A;  2L2S A;  1FKJ A;  3FAP A;  2KGJ A;  4LAW A;  4DRM A;  3KAB A;  3PA7 A;  4ITZ A;  2FAP A;  3CGM A;  3KAH A;  1D7H A;  1BL4 A;  2F21 A;  2MLZ A;  3IKD A;  3PRD A;  4W9P A;  3TC5 A;  1FD9 A;  1FJD A;  2XP3 A;  3NI6 A;  1Q1C A;  4ODL A;  1FKI A;  2XP7 A;  4ODR A;  4QT2 A;  3RFW A;  4DIP A;  1EYM A;  3O5Q A;  2PV1 A;  2Q5A A;  2DG9 A;  4G50 A;  4DRK A;  1M5Y A;  3IK8 A;  3UF8 A;  1QPF A;  3O5I A;  3TDB A;  5HW6 A;  2XPA A;  5J6E A;  1L1P A;  1JNT A;  2RUR A;  3O5K A;  1J6Y A;  1FKL A;  4J4N A;  3UQA A;  1J4H A;  1FKT A;  1R9H A;  4J4O A;  4QT3 A;  1BKF A;  3EY6 A;  2M08 A;  2Y78 A;  3O5J A;  4TW8 A;  1ZK6 A;  5HWB A;  1YW5 A;  4LAX A;  5HW8 A;  1FKH A;  4ODP A;  4MSP A;  3NTP A;  2DG3 A;  4GIV A;  4MGV A;  4R0X A;  2M2A A;  3OOB A;  2VN1 A;  3LUO A;  3O5E A;  3O5M A;  2RSE A;  1D6O A;  2XP4 A;  3RGC A;  1F40 A;  4JFJ A;  3KAF A;  3KAC A;  4IQ2 A;  1FAP A;  2F4E A;  2IF4 A;  2KE0 A;  3JYM A;  4IPX A;  1FKR A;  2KR7 A;  2MPH A;  4ODO A;  5HKG A;  4O2T A;  2M1I A;  4U86 A;  1J4R A;  1U79 A;  2KFW A;  5HTG A;  1C9H A;  1D7J A;  4U85 A;  3UQB A;  2LGO A;  1EQ3 A;  1JNS A;  3ODK A;  1T11 A;  4C02 B;  3MDY B;  1Q6I A;  2PPN A;  3KZ7 A;  1B6C A;  4LAY A;  3I6C A;  3WH0 A;  2PBC A;  3O5O A;  4DZ3 A;  3B7X A;  3O5G A;  4DZ2 A;  2ITK A;  1Q6H A;  4FN2 A;  3KAI A;  1FKB A;  1PIN A;  4N19 A;  4DRJ A;  1N1A A;  4BF8 A;  4DRI A;  4DRH A;  2FKE A;  4JYS A;  1ROU A;  2ZQS A;  1PBK A;  2JZV A;  4ODK A;  1HXV A;  2XP9 A;  1P5Q A; 
#chains in the Genus database with same CATH topology
 2QF8 A;  4HAR A;  4JFI A;  4S3K A;  1LL6 A;  1XHG A;  4ZPT R;  3CH9 A;  1FKD A;  1JVW A;  4ZS6 A;  2N87 A;  3AS3 A;  1XRV A;  4Z2K A;  1KFW A;  1JNE A;  1NWU A;  4W9Q A;  1HJX A;  2PPO A;  3GU0 A;  3RME A;  1FKS A;  3GPK A;  4LAV A;  1KT1 A;  1EHN A;  4ZPW R;  2F23 A;  2VCD A;  4DWS D;  2PPP A;  2AOS A;  2AWG A;  1NWT A;  1W1T A;  3IHZ A;  1JND A;  2B5U B;  4W9O A;  3AQU A;  3ARW A;  1SR0 A;  4WIW A;  4IQC A;  2LKN A;  1ITX A;  2DG4 A;  3AS2 A;  3WQV A;  2XP8 A;  2ZQT A;  4DT4 A;  3ALG A;  3TCZ A;  2PN0 A;  2MLX A;  2ZQU A;  3EIP A;  3G6L A;  4MNJ A;  3UI4 A;  4R5E A;  1W26 A;  3W4R A;  4DRQ A;  3RM8 A;  1NWR A;  3KAB A;  3PA7 A;  2F21 A;  3PRD A;  1FJD A;  4HBE A;  2ESC A;  3B9E A;  3CHC A;  1Q1C A;  3G6M A;  3ART A;  2XP7 A;  4ODR A;  1EYM A;  3BXW A;  4G50 A;  1E6Z A;  4KR0 B;  3TDB A;  5J6E A;  3WL1 A;  1ZBC A;  1FKL A;  3UQA A;  1ZBK A;  1R9H A;  3PR9 A;  3O5J A;  1GPF A;  2DSW A;  5HWB A;  3ARZ A;  1VF8 A;  4MSP A;  1OWQ A;  2WK2 A;  1D6O A;  1F40 A;  4JFJ A;  2B31 A;  3KAC A;  2EUL A;  2F4E A;  2WM0 A;  3JYM A;  4WKF A;  4O2T A;  1U79 A;  5HTG A;  2LGO A;  3ODK A;  3ARP A;  3MDY B;  1Q6I A;  3I6C A;  4NZC A;  4NSB A;  3B7X A;  1Q6H A;  3KAI A;  1PIN A;  4L72 B;  4BF8 A;  1LQ0 A;  1W1Y A;  2ZQS A;  1HXV A;  3WIJ A;  4ODK A;  3GTY X;  2A3A A;  5B8I C;  1LJY A;  1A7X A;  4KQZ A;  1ROT A;  1NSG A;  1TCO C;  2XP5 A;  1FKF A;  4DWS B;  1ZCN A;  3KAD A;  1JCH B;  2PV2 A;  3ARV A;  2UZ5 A;  4DWS A;  2D9F A;  3AS0 A;  3ARR A;  1Y0O A;  4Z2J A;  2LJ4 A;  2ZR5 A;  5GQB A;  1FFR A;  3O5F A;  4WK9 A;  5HBF A;  4TW7 A;  3WKZ A;  2A3B A;  2WLY A;  2LPV A;  1E44 A;  2DT1 A;  2IUZ A;  2P4V A;  5DIU A;  3O5P A;  1W1V A;  3CGN A;  4P8U A;  4FAP A;  3BMB A;  3B8S A;  4DRO A;  4Z2I A;  4QIB A;  3WQW A;  4HBO A;  1QPL A;  4G2P A;  3WD2 A;  1CTN A;  4GGQ A;  4MTV A;  1FKJ A;  4J4O A;  2FAP A;  3CGM A;  3KAH A;  3WL0 A;  2DT3 A;  4ODL A;  5DO2 A;  3O5Q A;  2PV1 A;  3UF8 A;  3ARO A;  3O5I A;  2XPA A;  3ARU A;  1JNT A;  2RUR A;  3O5K A;  2M08 A;  4Q7N A;  4TW8 A;  1ZK6 A;  2G8Z A;  1HKK A;  4MPK A;  3NTP A;  4MGV A;  4R0X A;  2M2A A;  2VN1 A;  1LG2 A;  1GRJ A;  3LUO A;  2RSE A;  1WAW A;  1GUV A;  1FAP A;  4LGX A;  2MPH A;  4ODO A;  2M1I A;  4C02 B;  3KZ7 A;  1EDQ A;  1W9U A;  1B6C A;  3WD1 A;  2A3E A;  2PBC A;  3O5O A;  4DZ3 A;  4DZ2 A;  4N19 A;  1N1A A;  3WD3 A;  1WB0 A;  3WD4 A;  4JYS A;  1IX5 A;  2DT0 A;  1ZBV A;  1UR9 A;  2XP9 A;  1W9V A;  2RUD A;  3H9R B;  4LAW A;  1Q6U A;  2XP6 A;  5HWC A;  4ODQ A;  1UR8 A;  3ARX A;  1GOI A;  1ZBW A;  3VAW A;  3KCE A;  1FFQ A;  1WNO A;  2ZR6 A;  4U84 A;  2ETN A;  2DSU A;  2RQS A;  4DRN A;  5D75 A;  1W1P A;  5HUA A;  2MNT A;  4ODM A;  2RUQ A;  2F2D A;  4P8X A;  4JFM A;  5HT1 A;  3UQI A;  1LG1 A;  3ALF A;  3O5R A;  1EIB A;  3UI6 A;  5DIV A;  3UI5 A;  3CHE A;  2ZR4 A;  2G41 A;  2XPB A;  1E6R A;  1NWS A;  4TYO A;  4MNK A;  3O5L A;  3KAG A;  1O6I A;  2O92 A;  2PI6 A;  3NRK A;  5JH8 A;  3FAP A;  2KGJ A;  4Z2L A;  4P8W A;  4W9P A;  4MNL A;  2MLZ A;  3TC5 A;  2XP3 A;  4MAV A;  4XAK A;  1FKI A;  2DSV A;  2Q5A A;  2WLZ A;  4DRK A;  1M5Y A;  3IK8 A;  1QPF A;  5DEZ A;  1HKI A;  4UDM A;  1J6Y A;  4J4N A;  4S3J A;  1J4H A;  4QT3 A;  1BKF A;  2Y78 A;  1E6P A;  1OGB A;  4LAX A;  5HW8 A;  1FKH A;  4ODP A;  3FXY A;  1H0G A;  3OOB A;  3O5E A;  3ARS A;  3KAF A;  4P8V A;  4IQ2 A;  1RD6 A;  4L3N A;  1HJW A;  2OLH A;  3B9D A;  4W5U A;  1J4R A;  1D2K A;  1D7J A;  3UQB A;  1T11 A;  4PTM A;  4LAY A;  2DSZ A;  5GPR A;  3O5G A;  1LL7 A;  2ITK A;  5BXJ A;  4DRJ A;  1NH6 A;  4DRI A;  1ROU A;  2MLY A;  2JZV A;  5DIT A;  4IPX A;  4IT6 A;  3CHD A;  4AY1 A;  1KT0 A;  4Z2H A;  2DT2 A;  1E15 A;  3FY1 A;  4JFK A;  2OFN A;  2ZQV A;  4IT4 A;  3WD0 A;  3ARY A;  2KO7 A;  1J4I A;  3ARQ A;  4MNM A;  1HKJ A;  3PRB A;  3B9A A;  3CZ8 A;  1NMW A;  1K9T A;  1F8A B;  1H0I A;  1W9P A;  4TNS A;  5HW7 A;  4URI A;  3JXV A;  2MF9 A;  5I98 A;  3O5D A;  1NMV A;  1QZ2 A;  2PV3 A;  2RUC A;  3RM4 A;  1D7I A;  1ZB5 A;  1HKM A;  4TX0 A;  2FDM A;  4WJX A;  4DRP A;  4DH0 A;  2K8I A;  4NNR A;  5GPG A;  4ODN A;  2DPE A;  3AS1 A;  1TFV A;  2KI3 A;  2O9O A;  1HJV A;  4JFL A;  1FKG A;  4WKA A;  1YAT A;  2A3C A;  3PRA A;  4TW6 A;  3IKG A;  3JYJ A;  1FKK A;  4QZV B;  2L2S A;  1E6N A;  4DRM A;  3RM9 A;  1OGG A;  4ZPV R;  4ITZ A;  5HW6 A;  1D7H A;  1BL4 A;  1X6N A;  3IKD A;  1FD9 A;  3NI6 A;  4QT2 A;  3RFW A;  4DIP A;  4WKH A;  1SYT A;  2DG9 A;  1ZL1 A;  1L1P A;  1FKT A;  3EY6 A;  3OA5 A;  1YW5 A;  2DG3 A;  4GIV A;  3O5M A;  3RGC A;  2XP4 A;  4Z2G A;  3CHF A;  1X6L A;  2IF4 A;  2KE0 A;  1FKR A;  2KR7 A;  1ZU8 A;  4ML4 A;  1LL4 A;  5HKG A;  2YBU A;  4U86 A;  2KFW A;  1EQ3 A;  1C9H A;  1JNS A;  4U85 A;  5DF0 A;  1E9L A;  2YBT A;  2PPN A;  3WH0 A;  4Q22 A;  4FN2 A;  1FKB A;  3QOK A;  4DRH A;  2FKE A;  1PBK A;  4DWS C;  1P5Q A; 
#chains in the Genus database with same CATH homology
 2QF8 A;  4HAR A;  4JFI A;  4S3K A;  1LL6 A;  1XHG A;  4ZPT R;  3CH9 A;  1FKD A;  1JVW A;  4ZS6 A;  2N87 A;  3AS3 A;  1XRV A;  4Z2K A;  1KFW A;  1JNE A;  1NWU A;  4W9Q A;  1HJX A;  2PPO A;  3RME A;  1FKS A;  3GPK A;  4LAV A;  1KT1 A;  1EHN A;  4ZPW R;  2VCD A;  4DWS D;  2PPP A;  2AOS A;  2AWG A;  1NWT A;  1W1T A;  3IHZ A;  1JND A;  4W9O A;  3AQU A;  3ARW A;  1SR0 A;  4WIW A;  4IQC A;  2LKN A;  1ITX A;  2DG4 A;  3AS2 A;  3WQV A;  2XP8 A;  2ZQT A;  4DT4 A;  3ALG A;  3TCZ A;  2MLX A;  2ZQU A;  3G6L A;  4MNJ A;  3UI4 A;  4R5E A;  1W26 A;  3W4R A;  4DRQ A;  3RM8 A;  1NWR A;  3KAB A;  3PA7 A;  2F21 A;  3PRD A;  1FJD A;  4HBE A;  2ESC A;  3B9E A;  3CHC A;  1Q1C A;  3G6M A;  3ART A;  2XP7 A;  4ODR A;  1EYM A;  3BXW A;  4G50 A;  1E6Z A;  4KR0 B;  3TDB A;  5J6E A;  3WL1 A;  1ZBC A;  1FKL A;  3UQA A;  1ZBK A;  1R9H A;  3PR9 A;  3O5J A;  1GPF A;  2DSW A;  5HWB A;  3ARZ A;  1VF8 A;  4MSP A;  1OWQ A;  2WK2 A;  1D6O A;  1F40 A;  4JFJ A;  2B31 A;  3KAC A;  2F4E A;  2WM0 A;  3JYM A;  4WKF A;  4O2T A;  1U79 A;  5HTG A;  2LGO A;  3ODK A;  3ARP A;  3MDY B;  1Q6I A;  3I6C A;  4NZC A;  4NSB A;  3B7X A;  1Q6H A;  3KAI A;  1PIN A;  4L72 B;  4BF8 A;  1LQ0 A;  1W1Y A;  2ZQS A;  1HXV A;  3WIJ A;  4ODK A;  2A3A A;  5B8I C;  1LJY A;  1A7X A;  4KQZ A;  1ROT A;  1NSG A;  1TCO C;  2XP5 A;  1FKF A;  4DWS B;  1ZCN A;  3KAD A;  2PV2 A;  3ARV A;  2UZ5 A;  4DWS A;  2D9F A;  3AS0 A;  3ARR A;  1Y0O A;  4Z2J A;  2LJ4 A;  2ZR5 A;  5GQB A;  1FFR A;  3O5F A;  4WK9 A;  5HBF A;  4TW7 A;  3WKZ A;  2A3B A;  2WLY A;  2LPV A;  2DT1 A;  2IUZ A;  5DIU A;  3O5P A;  1W1V A;  3CGN A;  4P8U A;  4FAP A;  3B8S A;  4DRO A;  4Z2I A;  4QIB A;  3WQW A;  4HBO A;  1QPL A;  4G2P A;  3WD2 A;  1CTN A;  4GGQ A;  4MTV A;  1FKJ A;  4J4O A;  2FAP A;  3CGM A;  3KAH A;  3WL0 A;  2DT3 A;  4ODL A;  5DO2 A;  3O5Q A;  2PV1 A;  3UF8 A;  3ARO A;  3O5I A;  2XPA A;  3ARU A;  1JNT A;  2RUR A;  3O5K A;  2M08 A;  4Q7N A;  4TW8 A;  1ZK6 A;  2G8Z A;  1HKK A;  4MPK A;  3NTP A;  4MGV A;  4R0X A;  2M2A A;  2VN1 A;  1LG2 A;  3LUO A;  2RSE A;  1WAW A;  1GUV A;  1FAP A;  4LGX A;  2MPH A;  4ODO A;  2M1I A;  4C02 B;  3KZ7 A;  1EDQ A;  1W9U A;  1B6C A;  3WD1 A;  2A3E A;  2PBC A;  3O5O A;  4DZ3 A;  4DZ2 A;  4N19 A;  1N1A A;  3WD3 A;  1WB0 A;  3WD4 A;  4JYS A;  1IX5 A;  2DT0 A;  1ZBV A;  1UR9 A;  2XP9 A;  1W9V A;  2RUD A;  3H9R B;  4LAW A;  1Q6U A;  2XP6 A;  5HWC A;  4ODQ A;  1UR8 A;  3ARX A;  1GOI A;  1ZBW A;  3VAW A;  3KCE A;  1FFQ A;  1WNO A;  2ZR6 A;  4U84 A;  2DSU A;  2RQS A;  4DRN A;  5D75 A;  1W1P A;  5HUA A;  2MNT A;  4ODM A;  2RUQ A;  2F2D A;  4P8X A;  4JFM A;  5HT1 A;  3UQI A;  1LG1 A;  3ALF A;  3O5R A;  1EIB A;  3UI6 A;  5DIV A;  3UI5 A;  3CHE A;  2ZR4 A;  2G41 A;  2XPB A;  1E6R A;  1NWS A;  4TYO A;  4MNK A;  3O5L A;  3KAG A;  1O6I A;  2O92 A;  2PI6 A;  3NRK A;  5JH8 A;  3FAP A;  2KGJ A;  4Z2L A;  4P8W A;  4W9P A;  4MNL A;  2MLZ A;  3TC5 A;  2XP3 A;  4MAV A;  4XAK A;  1FKI A;  2DSV A;  2Q5A A;  2WLZ A;  4DRK A;  1M5Y A;  3IK8 A;  1QPF A;  5DEZ A;  1HKI A;  1J6Y A;  4J4N A;  4S3J A;  1J4H A;  4QT3 A;  1BKF A;  2Y78 A;  1E6P A;  1OGB A;  4LAX A;  5HW8 A;  1FKH A;  4ODP A;  3FXY A;  1H0G A;  3OOB A;  3O5E A;  3ARS A;  3KAF A;  4P8V A;  4IQ2 A;  1RD6 A;  4L3N A;  1HJW A;  2OLH A;  3B9D A;  4W5U A;  1J4R A;  1D2K A;  1D7J A;  3UQB A;  1T11 A;  4PTM A;  4LAY A;  2DSZ A;  5GPR A;  3O5G A;  1LL7 A;  2ITK A;  5BXJ A;  4DRJ A;  1NH6 A;  4DRI A;  1ROU A;  2MLY A;  2JZV A;  5DIT A;  4IPX A;  4IT6 A;  3CHD A;  4AY1 A;  1KT0 A;  4Z2H A;  2DT2 A;  1E15 A;  3FY1 A;  4JFK A;  2OFN A;  2ZQV A;  4IT4 A;  3WD0 A;  3ARY A;  2KO7 A;  1J4I A;  3ARQ A;  4MNM A;  1HKJ A;  3PRB A;  3B9A A;  3CZ8 A;  1NMW A;  1K9T A;  1F8A B;  1H0I A;  1W9P A;  4TNS A;  5HW7 A;  4URI A;  3JXV A;  2MF9 A;  5I98 A;  3O5D A;  1NMV A;  1QZ2 A;  2PV3 A;  2RUC A;  3RM4 A;  1D7I A;  1ZB5 A;  1HKM A;  4TX0 A;  2FDM A;  4WJX A;  4DRP A;  4DH0 A;  2K8I A;  4NNR A;  5GPG A;  4ODN A;  2DPE A;  3AS1 A;  1TFV A;  2KI3 A;  2O9O A;  1HJV A;  4JFL A;  1FKG A;  4WKA A;  1YAT A;  2A3C A;  3PRA A;  4TW6 A;  3IKG A;  3JYJ A;  1FKK A;  4QZV B;  2L2S A;  1E6N A;  4DRM A;  3RM9 A;  1OGG A;  4ZPV R;  4ITZ A;  5HW6 A;  1D7H A;  1BL4 A;  1X6N A;  3IKD A;  1FD9 A;  3NI6 A;  4QT2 A;  3RFW A;  4DIP A;  4WKH A;  1SYT A;  2DG9 A;  1ZL1 A;  1L1P A;  1FKT A;  3EY6 A;  3OA5 A;  1YW5 A;  2DG3 A;  4GIV A;  3O5M A;  3RGC A;  2XP4 A;  4Z2G A;  3CHF A;  1X6L A;  2IF4 A;  2KE0 A;  1FKR A;  2KR7 A;  1ZU8 A;  4ML4 A;  1LL4 A;  5HKG A;  2YBU A;  4U86 A;  2KFW A;  1EQ3 A;  1C9H A;  1JNS A;  4U85 A;  5DF0 A;  1E9L A;  2YBT A;  2PPN A;  3WH0 A;  4Q22 A;  4FN2 A;  1FKB A;  3QOK A;  4DRH A;  2FKE A;  1PBK A;  4DWS C;  1P5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...