2L2SA

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 13
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2l2sA00
3O5GA 4W9PA 2FKEA 5DITA 3WH0A 1Y0OA 2ZQUA 5B8IC 3NRKA 1KT0A 2MLXA 3O5IA 3KACA 4DRKA 4W9QA 4N19A 3FAPA 1T11A 3O5PA 4DRQA 2OFNA 1Q6IA 4O2TA 5HW6A 2PPPA 3UQBA 2UZ5A 2ZR4A 1FKJA 1FKGA 4J4OA 1FKTA 3O5OA 1NMVA 3MDYB 4C02B 1D7IA 2JZVA 1ZCNA 4TW7A 3IHZA 1L1PA 1QPLA 4TX0A 4DROA 4ODMA 2ZQVA 4DZ3A 4ODQA 1D7JA 1B6CA 1R9HA 2RUDA 1A7XA 2RUCA 5DIVA 3O5MA 4TW6A 4R0XA 3PRBA 1FKFA 1YW5A 2PV3A 1QZ2A 5DIUA 2F2DA 4ODOA 2XPAA 4TW8A 2XP6A 3EY6A 3O5FA 2RSEA 1YATA 2D9FA 1FKDA 2KI3A 3TC5A 4DRNA 1M5YA 3ODKA 4FAPA 2N87A 1Q1CA 3KCEA 3KZ7A 4G50A 4ODKA 3TCZA 2RUQA 4DRJA 2XP4A 4ODNA 4DZ2A 2PBCA 4DT4A 2MLZA 3O5LA 3IK8A 2RQSA 4U85A 1EYMA 5GPGA 5HW8A 2ZQTA 4JFIA 2M08A 3O5EA 5HT1A 2VN1A 1JVWA 4U84A 4TYOA 4QT3A 5HWBA 1J6YA 3JYJA 1U79A 3OOBA 2XP5A 4IPXA 5HTGA 3RGCA 2ITKA 3UQAA 4DRPA 3UI6A 1FKBA 1Q6HA 2PV1A 1QPFA 3O5KA 3O5QA 1F40A 1F8AB 3IKGA 4JFJA 1ROUA 4JFKA 4W9OA 5HKGA 4NNRA 4LAWA 1W26A 4JFLA 4DRMA 2RURA 3O5JA 4DH0A 2KE0A 2LPVA 4GIVA 5HWCA 1FD9A 3CGNA 1BKFA 1J4RA 2F21A 3KAGA 1FAPA 2MNTA 4IQCA 1J4HA 5BXJA 3UI4A 3TDBA 5J6EA 1PINA 1ROTA 1FKIA 2KGJA 2M1IA 3KADA 2MLYA 3PRDA 2AWGA 4MGVA 3JXVA 4QT2A 1FKSA 4ITZA 5I98A 2L2SA 2DG9A 3JYMA 1FKHA 1NMWA 4ODRA 1JNSA 1Q6UA 1FKLA 1NSGA 4ODPA 3B7XA 2LJ4A 2K8IA 2MPHA 4LAXA 4ODLA 3I6CA 3NTPA 1TCOC 2DG3A 4FN2A 1D7HA 4DIPA 3UF8A 4TNSA 5HUAA 4DRIA 2XPBA 1FJDA 3KAFA 3UQIA 1JNTA 3NI6A 3GPKA 1FKKA 2VCDA 2XP7A 1PBKA 3KABA 1C9HA 2F4EA 2ZR5A 3IKDA 4MSPA 4DRHA 4G2PA 3VAWA 4BF8A 4IQ2A 2ZQSA 5HW7A 1BL4A 3PA7A 4GGQA 5D75A 2KO7A 2XP3A 2PV2A 3CGMA 1FKRA 4QIBA 2Y78A 4JFMA 1D6OA 4U86A 2Q5AA 2LGOA 1J4IA 1P5QA 4J4NA 2XP8A 2LKNA 2DG4A 2PPNA 1N1AA 1ZK6A 1EQ3A 2MF9A 3H9RB 2KFWA 4LAVA 2M2AA 1HXVA 2KR7A 4JYSA 2PPOA 4LAYA 3UI5A 3LUOA 1KT1A 2XP9A 3O5DA 3RFWA 3KAHA 3KAIA 3O5RA 2ZR6A 2FAPA 2IF4A
chains in the Genus database with same CATH superfamily
3WD1A 1Y0OA 2PN0A 3CH9A 2MLXA 1IX5A 4URIA 2ETNA 4P8XA 1EIBA 1T11A 3O5PA 4O2TA 3UQBA 2ZR4A 1D7IA 1WAWA 3QOKA 1L1PA 4ZPTR 3WQWA 2ZQVA 5DEZA 1WNOA 1E6ZA 2A3AA 1R9HA 5DIVA 3B9AA 1HJWA 3WIJA 2DT0A 3ARTA 4R0XA 3PRBA 4HBEA 4WKHA 1QZ2A 1E6NA 3O5FA 1M5YA 1HKIA 3KCEA 4DWSA 2G41A 4DRJA 2XP4A 2PBCA 3O5LA 2RQSA 4JFIA 1ZL1A 4DWSD 5GPRA 1RD6A 4TYOA 3GTYX 3UI6A 1FKBA 1W1PA 2O9OA 4ZS6A 1Q6HA 1GOIA 1F40A 3O5QA 4W9OA 1OGGA 4DRMA 3O5JA 1FAPA 1LL7A 4IQCA 5BXJA 1W1VA 1PINA 2KGJA 1EHNA 3CHDA 2A3BA 3JXVA 4Z2LA 3ARRA 2L2SA 4ODRA 1Q6UA 1NSGA 2K8IA 2YBTA 4ML4A 5JH8A 1GPFA 4DRIA 3ARYA 1NWSA 1W1TA 2A3EA 1JCHB 1FKKA 4QZVB 1JNEA 3ALFA 3KABA 4MPKA 3ARVA 2Y78A 1N1AA 1ZK6A 1SYTA 3H9RB 4JYSA 1LG2A 2DSVA 4MNMA 4WJXA 3UI5A 1KT1A 3O5DA 1LL4A 2ZR6A 2FAPA 1J4IA 3O5GA 4W9PA 2ZQUA 3NRKA 3FAPA 3WQVA 4DRQA 2UZ5A 4C02B 3WKZA 1OGBA 1HKMA 4MNKA 1ZCNA 4TW7A 4ODQA 4TW6A 2DT2A 4L3NA 3ARQA 2PV3A 2P4VA 2DSZA 2F2DA 3EY6A 2RSEA 1YATA 2D9FA 4DRNA 3B8SA 4AY1A 1E9LA 2YBUA 4HBOA 4ODKA 1W9UA 2RUQA 3TCZA 3G6MA 4ZPVR 4ZPWR 2MLZA 3IK8A 4IT6A 1FFQA 5GPGA 1NWTA 2WLYA 2ZQTA 5HT1A 4WKFA 4QT3A 3JYJA 4IPXA 2DSWA 3UQAA 4DRPA 4DWSB 1TFVA 4JFJA 3AS0A 1W26A 2RURA 4MTVA 5GQBA 4P8WA 2MNTA 4WK9A 2WK2A 1HJVA 2O92A 5J6EA 3KADA 3PRDA 4QT2A 5DF0A 1FKSA 2DG9A 1FKHA 1JNSA 1FKLA 3AS1A 5HBFA 3B7XA 4LAXA 4MNJA 4ODLA 1TCOC 4FN2A 1K9TA 4TNSA 1FJDA 3KAFA 3NI6A 1FFRA 1PBKA 2F4EA 4MSPA 4DRHA 4LGXA 4G2PA 4WIWA 3CHFA 2PV2A 4Z2HA 3AQUA 2DSUA 4NZCA 2PPNA 1CTNA 2KFWA 4IT4A 4Z2KA 3RFWA 2B31A 2IF4A 2FKEA 5DITA 1KT0A 3O5IA 3KACA 3OA5A 2DT3A 4DRKA 4W9QA 1XHGA 2OLHA 1HKJA 4N19A 2OFNA 5HW6A 2PPPA 4J4OA 1FKJA 1FKGA 1FKTA 1NMVA 3MDYB 3RM4A 2JZVA 3FXYA 4MNLA 4DROA 1EDQA 4ODMA 4DZ3A 1D7JA 3WD3A 2RUDA 2RUCA 3O5MA 1NWRA 4DWSC 1FKFA 5DIUA 4TW8A 1W9PA 4KQZA 2KI3A 3FY1A 1W1YA 3ODKA 4FAPA 1Q1CA 3BMBA 4G50A 1E15A 1X6NA 3PR9A 3AS3A 4ODNA 4DZ2A 3RM8A 4U85A 1EYMA 2M08A 3O5EA 2VN1A 5DO2A 1LG1A 3OOBA 1U79A 1OWQA 3ARUA 2FDMA 2G8ZA 2ITKA 2WM0A 3O5KA 2PV1A 1GUVA 1F8AB 3IKGA 3W4RA 1ROUA 4JFKA 2KE0A 2LPVA 4GIVA 4Z2JA 1FD9A 3ALGA 1J4RA 3KAGA 4HARA 3ARXA 1J4HA 3UI4A 4MAVA 3TDBA 4NSBA 2AWGA 4MGVA 5I98A 2ESCA 1NMWA 4P8VA 4ODPA 4Q7NA 2A3CA 2MPHA 3CHCA 1VF8A 3I6CA 1O6IA 3NTPA 4DIPA 3UF8A 5HUAA 1ZBKA 1JNDA 1HKKA 4L72B 3VAWA 1XRVA 4BF8A 5HW7A 2ZQSA 2KO7A 3WD0A 3CGMA 4JFMA 1WB0A 1D6OA 3B9EA 4U86A 2XP8A 2DT1A 3GU0A 1HXVA 2M2AA 4S3KA 2PPOA 4LAYA 1H0GA 1LL6A 3WH0A 5B8IC 1D2KA 1Q6IA 1E6PA 3O5OA 2QF8A 3ARZA 4S3JA 4W5UA 3IHZA 1QPLA 1NWUA 4TX0A 1H0IA 4Z2GA 1B6CA 1A7XA 1E44A 1YW5A 4ODOA 2XPAA 2DPEA 2XP6A 1KFWA 1FKDA 3TC5A 3ARWA 3WL1A 2N87A 3KZ7A 1ZU8A 4Q22A 1GRJA 3WL0A 4DT4A 2AOSA 3AS2A 4UDMA 3PRAA 1X6LA 5HW8A 3CZ8A 4U84A 1JVWA 3ARPA 1ITXA 5HWBA 1J6YA 3B9DA 2XP5A 3CHEA 2EULA 5HTGA 3RGCA 3G6LA 2WLZA 1ZBCA 1QPFA 4R5EA 5HKGA 4PTMA 4NNRA 4LAWA 4JFLA 4KR0B 4DH0A 5HWCA 4P8UA 3CGNA 1HJXA 1BKFA 2F21A 1UR9A 3RM9A 1ZBVA 1ROTA 3AROA 1FKIA 2M1IA 2MLYA 1SR0A 2IUZA 4ITZA 4WKAA 3BXWA 3JYMA 2F23A 2LJ4A 1LQ0A 3ARSA 2DG3A 1D7HA 3EIPA 2XPBA 3UQIA 1JNTA 1E6RA 3GPKA 2VCDA 1LJYA 2XP7A 1C9HA 1ZBWA 1W9VA 2ZR5A 3IKDA 4XAKA 3WD2A 2B5UB 4IQ2A 2PI6A 1BL4A 3PA7A 4GGQA 3RMEA 5D75A 2XP3A 1FKRA 4Z2IA 4QIBA 1ZB5A 2LGOA 2Q5AA 1P5QA 4J4NA 2LKNA 2DG4A 1EQ3A 2MF9A 4LAVA 2KR7A 3LUOA 2XP9A 1NH6A 1UR8A 3KAHA 3KAIA 3O5RA 3WD4A
chains in the Genus database with same CATH topology
3WD1A 1Y0OA 3CH9A 2MLXA 1IX5A 4URIA 4P8XA 1EIBA 1T11A 3O5PA 4O2TA 3UQBA 2ZR4A 1D7IA 1WAWA 3QOKA 1L1PA 4ZPTR 3WQWA 2ZQVA 5DEZA 1WNOA 1E6ZA 2A3AA 1R9HA 5DIVA 3B9AA 1HJWA 3WIJA 2DT0A 3ARTA 4R0XA 3PRBA 4HBEA 4WKHA 1QZ2A 1E6NA 3O5FA 1M5YA 1HKIA 3KCEA 4DWSA 2G41A 4DRJA 2XP4A 2PBCA 3O5LA 2RQSA 4JFIA 1ZL1A 4DWSD 5GPRA 1RD6A 4TYOA 3UI6A 1FKBA 1W1PA 2O9OA 4ZS6A 1Q6HA 1GOIA 1F40A 3O5QA 4W9OA 1OGGA 4DRMA 3O5JA 1FAPA 1LL7A 4IQCA 5BXJA 1W1VA 1PINA 2KGJA 1EHNA 3CHDA 2A3BA 3JXVA 4Z2LA 3ARRA 2L2SA 4ODRA 1Q6UA 1NSGA 2K8IA 2YBTA 4ML4A 5JH8A 1GPFA 4DRIA 3ARYA 1NWSA 1W1TA 2A3EA 4QZVB 1FKKA 1JNEA 3ALFA 3KABA 4MPKA 3ARVA 2Y78A 1N1AA 1ZK6A 1SYTA 3H9RB 4JYSA 1LG2A 2DSVA 4MNMA 4WJXA 3UI5A 1KT1A 3O5DA 1LL4A 2ZR6A 2FAPA 1J4IA 3O5GA 4W9PA 2ZQUA 3NRKA 3FAPA 3WQVA 4DRQA 2UZ5A 4C02B 3WKZA 1OGBA 1HKMA 4MNKA 1ZCNA 4TW7A 4ODQA 4TW6A 2DT2A 4L3NA 3ARQA 2PV3A 2DSZA 2F2DA 3EY6A 2RSEA 1YATA 2D9FA 4DRNA 3B8SA 4AY1A 1E9LA 2YBUA 4HBOA 4ODKA 1W9UA 2RUQA 3TCZA 3G6MA 4ZPVR 4ZPWR 2MLZA 3IK8A 4IT6A 1FFQA 5GPGA 1NWTA 2WLYA 2ZQTA 5HT1A 4WKFA 4QT3A 3JYJA 4IPXA 2DSWA 3UQAA 4DRPA 4DWSB 1TFVA 4JFJA 3AS0A 1W26A 2RURA 4MTVA 5GQBA 4P8WA 2MNTA 4WK9A 2WK2A 1HJVA 2O92A 5J6EA 3KADA 3PRDA 4QT2A 5DF0A 1FKSA 2DG9A 1FKHA 1JNSA 1FKLA 3AS1A 5HBFA 3B7XA 4LAXA 4MNJA 4ODLA 1TCOC 4FN2A 1K9TA 4TNSA 1FJDA 3KAFA 3NI6A 1FFRA 1PBKA 2F4EA 4MSPA 4DRHA 4LGXA 4G2PA 4WIWA 3CHFA 2PV2A 4Z2HA 3AQUA 2DSUA 4NZCA 2PPNA 1CTNA 2KFWA 4IT4A 4Z2KA 3RFWA 2B31A 2IF4A 2FKEA 5DITA 1KT0A 3O5IA 3KACA 3OA5A 2DT3A 4DRKA 4W9QA 1XHGA 2OLHA 1HKJA 4N19A 2OFNA 5HW6A 2PPPA 4J4OA 1FKJA 1FKGA 1FKTA 1NMVA 3MDYB 3RM4A 2JZVA 3FXYA 4MNLA 4DROA 1EDQA 4ODMA 4DZ3A 1D7JA 3WD3A 2RUDA 2RUCA 3O5MA 1NWRA 4DWSC 1FKFA 5DIUA 4TW8A 1W9PA 4KQZA 2KI3A 3FY1A 1W1YA 3ODKA 4FAPA 1Q1CA 4G50A 1E15A 1X6NA 3PR9A 3AS3A 4ODNA 4DZ2A 3RM8A 4U85A 1EYMA 2M08A 3O5EA 2VN1A 5DO2A 1LG1A 3OOBA 1U79A 1OWQA 3ARUA 2FDMA 2G8ZA 2ITKA 2WM0A 3O5KA 2PV1A 1GUVA 1F8AB 3IKGA 3W4RA 1ROUA 4JFKA 2KE0A 2LPVA 4GIVA 4Z2JA 1FD9A 3ALGA 1J4RA 3KAGA 4HARA 3ARXA 1J4HA 3UI4A 4MAVA 3TDBA 4NSBA 2AWGA 4MGVA 5I98A 2ESCA 1NMWA 4P8VA 4ODPA 4Q7NA 2A3CA 2MPHA 3CHCA 1VF8A 3I6CA 1O6IA 3NTPA 4DIPA 3UF8A 5HUAA 1ZBKA 1JNDA 1HKKA 4L72B 3VAWA 1XRVA 4BF8A 5HW7A 2ZQSA 2KO7A 3WD0A 3CGMA 4JFMA 1WB0A 1D6OA 3B9EA 4U86A 2XP8A 2DT1A 1HXVA 2M2AA 4S3KA 2PPOA 4LAYA 1H0GA 1LL6A 3WH0A 5B8IC 1D2KA 1Q6IA 1E6PA 3O5OA 2QF8A 3ARZA 4S3JA 4W5UA 3IHZA 1QPLA 1NWUA 4TX0A 1H0IA 4Z2GA 1B6CA 1A7XA 1YW5A 4ODOA 2XPAA 2DPEA 2XP6A 1KFWA 1FKDA 3TC5A 3ARWA 3WL1A 2N87A 3KZ7A 1ZU8A 4Q22A 3WL0A 4DT4A 2AOSA 3AS2A 3PRAA 1X6LA 5HW8A 3CZ8A 4U84A 1JVWA 3ARPA 1ITXA 5HWBA 1J6YA 3B9DA 2XP5A 3CHEA 5HTGA 3RGCA 3G6LA 2WLZA 1ZBCA 1QPFA 4R5EA 5HKGA 4PTMA 4NNRA 4LAWA 4JFLA 4KR0B 4DH0A 5HWCA 4P8UA 3CGNA 1HJXA 1BKFA 2F21A 1UR9A 3RM9A 1ZBVA 1ROTA 3AROA 1FKIA 2M1IA 2MLYA 1SR0A 2IUZA 4ITZA 4WKAA 3BXWA 3JYMA 2LJ4A 1LQ0A 3ARSA 2DG3A 1D7HA 2XPBA 3UQIA 1JNTA 1E6RA 3GPKA 2VCDA 1LJYA 2XP7A 1C9HA 1ZBWA 1W9VA 2ZR5A 3IKDA 4XAKA 3WD2A 4IQ2A 2PI6A 1BL4A 3PA7A 4GGQA 3RMEA 5D75A 2XP3A 1FKRA 4Z2IA 4QIBA 1ZB5A 2LGOA 2Q5AA 1P5QA 4J4NA 2LKNA 2DG4A 1EQ3A 2MF9A 4LAVA 2KR7A 3LUOA 2XP9A 1NH6A 1UR8A 3KAHA 3KAIA 3O5RA 3WD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5G A;  4W9P A;  2FKE A;  5DIT A;  3WH0 A;  1Y0O A;  2ZQU A;  5B8I C;  3NRK A;  1KT0 A;  2MLX A;  3O5I A;  3KAC A;  4DRK A;  4W9Q A;  4N19 A;  3FAP A;  1T11 A;  3O5P A;  4DRQ A;  2OFN A;  1Q6I A;  4O2T A;  5HW6 A;  2PPP A;  3UQB A;  2UZ5 A;  2ZR4 A;  1FKJ A;  1FKG A;  4J4O A;  1FKT A;  3O5O A;  1NMV A;  3MDY B;  4C02 B;  1D7I A;  2JZV A;  1ZCN A;  4TW7 A;  3IHZ A;  1L1P A;  1QPL A;  4TX0 A;  4DRO A;  4ODM A;  2ZQV A;  4DZ3 A;  4ODQ A;  1D7J A;  1B6C A;  1R9H A;  2RUD A;  1A7X A;  2RUC A;  5DIV A;  3O5M A;  4TW6 A;  4R0X A;  3PRB A;  1FKF A;  1YW5 A;  2PV3 A;  1QZ2 A;  5DIU A;  2F2D A;  4ODO A;  2XPA A;  4TW8 A;  2XP6 A;  3EY6 A;  3O5F A;  2RSE A;  1YAT A;  2D9F A;  1FKD A;  2KI3 A;  3TC5 A;  4DRN A;  1M5Y A;  3ODK A;  4FAP A;  2N87 A;  1Q1C A;  3KCE A;  3KZ7 A;  4G50 A;  4ODK A;  3TCZ A;  2RUQ A;  4DRJ A;  2XP4 A;  4ODN A;  4DZ2 A;  2PBC A;  4DT4 A;  2MLZ A;  3O5L A;  3IK8 A;  2RQS A;  4U85 A;  1EYM A;  5GPG A;  5HW8 A;  2ZQT A;  4JFI A;  2M08 A;  3O5E A;  5HT1 A;  2VN1 A;  1JVW A;  4U84 A;  4TYO A;  4QT3 A;  5HWB A;  1J6Y A;  3JYJ A;  1U79 A;  3OOB A;  2XP5 A;  4IPX A;  5HTG A;  3RGC A;  2ITK A;  3UQA A;  4DRP A;  3UI6 A;  1FKB A;  1Q6H A;  2PV1 A;  1QPF A;  3O5K A;  3O5Q A;  1F40 A;  1F8A B;  3IKG A;  4JFJ A;  1ROU A;  4JFK A;  4W9O A;  5HKG A;  4NNR A;  4LAW A;  1W26 A;  4JFL A;  4DRM A;  2RUR A;  3O5J A;  4DH0 A;  2KE0 A;  2LPV A;  4GIV A;  5HWC A;  1FD9 A;  3CGN A;  1BKF A;  1J4R A;  2F21 A;  3KAG A;  1FAP A;  2MNT A;  4IQC A;  1J4H A;  5BXJ A;  3UI4 A;  3TDB A;  5J6E A;  1PIN A;  1ROT A;  1FKI A;  2KGJ A;  2M1I A;  3KAD A;  2MLY A;  3PRD A;  2AWG A;  4MGV A;  3JXV A;  4QT2 A;  1FKS A;  4ITZ A;  5I98 A;  2L2S A;  2DG9 A;  3JYM A;  1FKH A;  1NMW A;  4ODR A;  1JNS A;  1Q6U A;  1FKL A;  1NSG A;  4ODP A;  3B7X A;  2LJ4 A;  2K8I A;  2MPH A;  4LAX A;  4ODL A;  3I6C A;  3NTP A;  1TCO C;  2DG3 A;  4FN2 A;  1D7H A;  4DIP A;  3UF8 A;  4TNS A;  5HUA A;  4DRI A;  2XPB A;  1FJD A;  3KAF A;  3UQI A;  1JNT A;  3NI6 A;  3GPK A;  1FKK A;  2VCD A;  2XP7 A;  1PBK A;  3KAB A;  1C9H A;  2F4E A;  2ZR5 A;  3IKD A;  4MSP A;  4DRH A;  4G2P A;  3VAW A;  4BF8 A;  4IQ2 A;  2ZQS A;  5HW7 A;  1BL4 A;  3PA7 A;  4GGQ A;  5D75 A;  2KO7 A;  2XP3 A;  2PV2 A;  3CGM A;  1FKR A;  4QIB A;  2Y78 A;  4JFM A;  1D6O A;  4U86 A;  2Q5A A;  2LGO A;  1J4I A;  1P5Q A;  4J4N A;  2XP8 A;  2LKN A;  2DG4 A;  2PPN A;  1N1A A;  1ZK6 A;  1EQ3 A;  2MF9 A;  3H9R B;  2KFW A;  4LAV A;  2M2A A;  1HXV A;  2KR7 A;  4JYS A;  2PPO A;  4LAY A;  3UI5 A;  3LUO A;  1KT1 A;  2XP9 A;  3O5D A;  3RFW A;  3KAH A;  3KAI A;  3O5R A;  2ZR6 A;  2FAP A;  2IF4 A; 
#chains in the Genus database with same CATH topology
 3WD1 A;  1Y0O A;  2PN0 A;  3CH9 A;  2MLX A;  1IX5 A;  4URI A;  2ETN A;  4P8X A;  1EIB A;  1T11 A;  3O5P A;  4O2T A;  3UQB A;  2ZR4 A;  1D7I A;  1WAW A;  3QOK A;  1L1P A;  4ZPT R;  3WQW A;  2ZQV A;  5DEZ A;  1WNO A;  1E6Z A;  2A3A A;  1R9H A;  5DIV A;  3B9A A;  1HJW A;  3WIJ A;  2DT0 A;  3ART A;  4R0X A;  3PRB A;  4HBE A;  4WKH A;  1QZ2 A;  1E6N A;  3O5F A;  1M5Y A;  1HKI A;  3KCE A;  4DWS A;  2G41 A;  4DRJ A;  2XP4 A;  2PBC A;  3O5L A;  2RQS A;  4JFI A;  1ZL1 A;  4DWS D;  5GPR A;  1RD6 A;  4TYO A;  3GTY X;  3UI6 A;  1FKB A;  1W1P A;  2O9O A;  4ZS6 A;  1Q6H A;  1GOI A;  1F40 A;  3O5Q A;  4W9O A;  1OGG A;  4DRM A;  3O5J A;  1FAP A;  1LL7 A;  4IQC A;  5BXJ A;  1W1V A;  1PIN A;  2KGJ A;  1EHN A;  3CHD A;  2A3B A;  3JXV A;  4Z2L A;  3ARR A;  2L2S A;  4ODR A;  1Q6U A;  1NSG A;  2K8I A;  2YBT A;  4ML4 A;  5JH8 A;  1GPF A;  4DRI A;  3ARY A;  1NWS A;  1W1T A;  2A3E A;  1JCH B;  1FKK A;  4QZV B;  1JNE A;  3ALF A;  3KAB A;  4MPK A;  3ARV A;  2Y78 A;  1N1A A;  1ZK6 A;  1SYT A;  3H9R B;  4JYS A;  1LG2 A;  2DSV A;  4MNM A;  4WJX A;  3UI5 A;  1KT1 A;  3O5D A;  1LL4 A;  2ZR6 A;  2FAP A;  1J4I A;  3O5G A;  4W9P A;  2ZQU A;  3NRK A;  3FAP A;  3WQV A;  4DRQ A;  2UZ5 A;  4C02 B;  3WKZ A;  1OGB A;  1HKM A;  4MNK A;  1ZCN A;  4TW7 A;  4ODQ A;  4TW6 A;  2DT2 A;  4L3N A;  3ARQ A;  2PV3 A;  2P4V A;  2DSZ A;  2F2D A;  3EY6 A;  2RSE A;  1YAT A;  2D9F A;  4DRN A;  3B8S A;  4AY1 A;  1E9L A;  2YBU A;  4HBO A;  4ODK A;  1W9U A;  2RUQ A;  3TCZ A;  3G6M A;  4ZPV R;  4ZPW R;  2MLZ A;  3IK8 A;  4IT6 A;  1FFQ A;  5GPG A;  1NWT A;  2WLY A;  2ZQT A;  5HT1 A;  4WKF A;  4QT3 A;  3JYJ A;  4IPX A;  2DSW A;  3UQA A;  4DRP A;  4DWS B;  1TFV A;  4JFJ A;  3AS0 A;  1W26 A;  2RUR A;  4MTV A;  5GQB A;  4P8W A;  2MNT A;  4WK9 A;  2WK2 A;  1HJV A;  2O92 A;  5J6E A;  3KAD A;  3PRD A;  4QT2 A;  5DF0 A;  1FKS A;  2DG9 A;  1FKH A;  1JNS A;  1FKL A;  3AS1 A;  5HBF A;  3B7X A;  4LAX A;  4MNJ A;  4ODL A;  1TCO C;  4FN2 A;  1K9T A;  4TNS A;  1FJD A;  3KAF A;  3NI6 A;  1FFR A;  1PBK A;  2F4E A;  4MSP A;  4DRH A;  4LGX A;  4G2P A;  4WIW A;  3CHF A;  2PV2 A;  4Z2H A;  3AQU A;  2DSU A;  4NZC A;  2PPN A;  1CTN A;  2KFW A;  4IT4 A;  4Z2K A;  3RFW A;  2B31 A;  2IF4 A;  2FKE A;  5DIT A;  1KT0 A;  3O5I A;  3KAC A;  3OA5 A;  2DT3 A;  4DRK A;  4W9Q A;  1XHG A;  2OLH A;  1HKJ A;  4N19 A;  2OFN A;  5HW6 A;  2PPP A;  4J4O A;  1FKJ A;  1FKG A;  1FKT A;  1NMV A;  3MDY B;  3RM4 A;  2JZV A;  3FXY A;  4MNL A;  4DRO A;  1EDQ A;  4ODM A;  4DZ3 A;  1D7J A;  3WD3 A;  2RUD A;  2RUC A;  3O5M A;  1NWR A;  4DWS C;  1FKF A;  5DIU A;  4TW8 A;  1W9P A;  4KQZ A;  2KI3 A;  3FY1 A;  1W1Y A;  3ODK A;  4FAP A;  1Q1C A;  3BMB A;  4G50 A;  1E15 A;  1X6N A;  3PR9 A;  3AS3 A;  4ODN A;  4DZ2 A;  3RM8 A;  4U85 A;  1EYM A;  2M08 A;  3O5E A;  2VN1 A;  5DO2 A;  1LG1 A;  3OOB A;  1U79 A;  1OWQ A;  3ARU A;  2FDM A;  2G8Z A;  2ITK A;  2WM0 A;  3O5K A;  2PV1 A;  1GUV A;  1F8A B;  3IKG A;  3W4R A;  1ROU A;  4JFK A;  2KE0 A;  2LPV A;  4GIV A;  4Z2J A;  1FD9 A;  3ALG A;  1J4R A;  3KAG A;  4HAR A;  3ARX A;  1J4H A;  3UI4 A;  4MAV A;  3TDB A;  4NSB A;  2AWG A;  4MGV A;  5I98 A;  2ESC A;  1NMW A;  4P8V A;  4ODP A;  4Q7N A;  2A3C A;  2MPH A;  3CHC A;  1VF8 A;  3I6C A;  1O6I A;  3NTP A;  4DIP A;  3UF8 A;  5HUA A;  1ZBK A;  1JND A;  1HKK A;  4L72 B;  3VAW A;  1XRV A;  4BF8 A;  5HW7 A;  2ZQS A;  2KO7 A;  3WD0 A;  3CGM A;  4JFM A;  1WB0 A;  1D6O A;  3B9E A;  4U86 A;  2XP8 A;  2DT1 A;  3GU0 A;  1HXV A;  2M2A A;  4S3K A;  2PPO A;  4LAY A;  1H0G A;  1LL6 A;  3WH0 A;  5B8I C;  1D2K A;  1Q6I A;  1E6P A;  3O5O A;  2QF8 A;  3ARZ A;  4S3J A;  4W5U A;  3IHZ A;  1QPL A;  1NWU A;  4TX0 A;  1H0I A;  4Z2G A;  1B6C A;  1A7X A;  1E44 A;  1YW5 A;  4ODO A;  2XPA A;  2DPE A;  2XP6 A;  1KFW A;  1FKD A;  3TC5 A;  3ARW A;  3WL1 A;  2N87 A;  3KZ7 A;  1ZU8 A;  4Q22 A;  1GRJ A;  3WL0 A;  4DT4 A;  2AOS A;  3AS2 A;  4UDM A;  3PRA A;  1X6L A;  5HW8 A;  3CZ8 A;  4U84 A;  1JVW A;  3ARP A;  1ITX A;  5HWB A;  1J6Y A;  3B9D A;  2XP5 A;  3CHE A;  2EUL A;  5HTG A;  3RGC A;  3G6L A;  2WLZ A;  1ZBC A;  1QPF A;  4R5E A;  5HKG A;  4PTM A;  4NNR A;  4LAW A;  4JFL A;  4KR0 B;  4DH0 A;  5HWC A;  4P8U A;  3CGN A;  1HJX A;  1BKF A;  2F21 A;  1UR9 A;  3RM9 A;  1ZBV A;  1ROT A;  3ARO A;  1FKI A;  2M1I A;  2MLY A;  1SR0 A;  2IUZ A;  4ITZ A;  4WKA A;  3BXW A;  3JYM A;  2F23 A;  2LJ4 A;  1LQ0 A;  3ARS A;  2DG3 A;  1D7H A;  3EIP A;  2XPB A;  3UQI A;  1JNT A;  1E6R A;  3GPK A;  2VCD A;  1LJY A;  2XP7 A;  1C9H A;  1ZBW A;  1W9V A;  2ZR5 A;  3IKD A;  4XAK A;  3WD2 A;  2B5U B;  4IQ2 A;  2PI6 A;  1BL4 A;  3PA7 A;  4GGQ A;  3RME A;  5D75 A;  2XP3 A;  1FKR A;  4Z2I A;  4QIB A;  1ZB5 A;  2LGO A;  2Q5A A;  1P5Q A;  4J4N A;  2LKN A;  2DG4 A;  1EQ3 A;  2MF9 A;  4LAV A;  2KR7 A;  3LUO A;  2XP9 A;  1NH6 A;  1UR8 A;  3KAH A;  3KAI A;  3O5R A;  3WD4 A; 
#chains in the Genus database with same CATH homology
 3WD1 A;  1Y0O A;  3CH9 A;  2MLX A;  1IX5 A;  4URI A;  4P8X A;  1EIB A;  1T11 A;  3O5P A;  4O2T A;  3UQB A;  2ZR4 A;  1D7I A;  1WAW A;  3QOK A;  1L1P A;  4ZPT R;  3WQW A;  2ZQV A;  5DEZ A;  1WNO A;  1E6Z A;  2A3A A;  1R9H A;  5DIV A;  3B9A A;  1HJW A;  3WIJ A;  2DT0 A;  3ART A;  4R0X A;  3PRB A;  4HBE A;  4WKH A;  1QZ2 A;  1E6N A;  3O5F A;  1M5Y A;  1HKI A;  3KCE A;  4DWS A;  2G41 A;  4DRJ A;  2XP4 A;  2PBC A;  3O5L A;  2RQS A;  4JFI A;  1ZL1 A;  4DWS D;  5GPR A;  1RD6 A;  4TYO A;  3UI6 A;  1FKB A;  1W1P A;  2O9O A;  4ZS6 A;  1Q6H A;  1GOI A;  1F40 A;  3O5Q A;  4W9O A;  1OGG A;  4DRM A;  3O5J A;  1FAP A;  1LL7 A;  4IQC A;  5BXJ A;  1W1V A;  1PIN A;  2KGJ A;  1EHN A;  3CHD A;  2A3B A;  3JXV A;  4Z2L A;  3ARR A;  2L2S A;  4ODR A;  1Q6U A;  1NSG A;  2K8I A;  2YBT A;  4ML4 A;  5JH8 A;  1GPF A;  4DRI A;  3ARY A;  1NWS A;  1W1T A;  2A3E A;  4QZV B;  1FKK A;  1JNE A;  3ALF A;  3KAB A;  4MPK A;  3ARV A;  2Y78 A;  1N1A A;  1ZK6 A;  1SYT A;  3H9R B;  4JYS A;  1LG2 A;  2DSV A;  4MNM A;  4WJX A;  3UI5 A;  1KT1 A;  3O5D A;  1LL4 A;  2ZR6 A;  2FAP A;  1J4I A;  3O5G A;  4W9P A;  2ZQU A;  3NRK A;  3FAP A;  3WQV A;  4DRQ A;  2UZ5 A;  4C02 B;  3WKZ A;  1OGB A;  1HKM A;  4MNK A;  1ZCN A;  4TW7 A;  4ODQ A;  4TW6 A;  2DT2 A;  4L3N A;  3ARQ A;  2PV3 A;  2DSZ A;  2F2D A;  3EY6 A;  2RSE A;  1YAT A;  2D9F A;  4DRN A;  3B8S A;  4AY1 A;  1E9L A;  2YBU A;  4HBO A;  4ODK A;  1W9U A;  2RUQ A;  3TCZ A;  3G6M A;  4ZPV R;  4ZPW R;  2MLZ A;  3IK8 A;  4IT6 A;  1FFQ A;  5GPG A;  1NWT A;  2WLY A;  2ZQT A;  5HT1 A;  4WKF A;  4QT3 A;  3JYJ A;  4IPX A;  2DSW A;  3UQA A;  4DRP A;  4DWS B;  1TFV A;  4JFJ A;  3AS0 A;  1W26 A;  2RUR A;  4MTV A;  5GQB A;  4P8W A;  2MNT A;  4WK9 A;  2WK2 A;  1HJV A;  2O92 A;  5J6E A;  3KAD A;  3PRD A;  4QT2 A;  5DF0 A;  1FKS A;  2DG9 A;  1FKH A;  1JNS A;  1FKL A;  3AS1 A;  5HBF A;  3B7X A;  4LAX A;  4MNJ A;  4ODL A;  1TCO C;  4FN2 A;  1K9T A;  4TNS A;  1FJD A;  3KAF A;  3NI6 A;  1FFR A;  1PBK A;  2F4E A;  4MSP A;  4DRH A;  4LGX A;  4G2P A;  4WIW A;  3CHF A;  2PV2 A;  4Z2H A;  3AQU A;  2DSU A;  4NZC A;  2PPN A;  1CTN A;  2KFW A;  4IT4 A;  4Z2K A;  3RFW A;  2B31 A;  2IF4 A;  2FKE A;  5DIT A;  1KT0 A;  3O5I A;  3KAC A;  3OA5 A;  2DT3 A;  4DRK A;  4W9Q A;  1XHG A;  2OLH A;  1HKJ A;  4N19 A;  2OFN A;  5HW6 A;  2PPP A;  4J4O A;  1FKJ A;  1FKG A;  1FKT A;  1NMV A;  3MDY B;  3RM4 A;  2JZV A;  3FXY A;  4MNL A;  4DRO A;  1EDQ A;  4ODM A;  4DZ3 A;  1D7J A;  3WD3 A;  2RUD A;  2RUC A;  3O5M A;  1NWR A;  4DWS C;  1FKF A;  5DIU A;  4TW8 A;  1W9P A;  4KQZ A;  2KI3 A;  3FY1 A;  1W1Y A;  3ODK A;  4FAP A;  1Q1C A;  4G50 A;  1E15 A;  1X6N A;  3PR9 A;  3AS3 A;  4ODN A;  4DZ2 A;  3RM8 A;  4U85 A;  1EYM A;  2M08 A;  3O5E A;  2VN1 A;  5DO2 A;  1LG1 A;  3OOB A;  1U79 A;  1OWQ A;  3ARU A;  2FDM A;  2G8Z A;  2ITK A;  2WM0 A;  3O5K A;  2PV1 A;  1GUV A;  1F8A B;  3IKG A;  3W4R A;  1ROU A;  4JFK A;  2KE0 A;  2LPV A;  4GIV A;  4Z2J A;  1FD9 A;  3ALG A;  1J4R A;  3KAG A;  4HAR A;  3ARX A;  1J4H A;  3UI4 A;  4MAV A;  3TDB A;  4NSB A;  2AWG A;  4MGV A;  5I98 A;  2ESC A;  1NMW A;  4P8V A;  4ODP A;  4Q7N A;  2A3C A;  2MPH A;  3CHC A;  1VF8 A;  3I6C A;  1O6I A;  3NTP A;  4DIP A;  3UF8 A;  5HUA A;  1ZBK A;  1JND A;  1HKK A;  4L72 B;  3VAW A;  1XRV A;  4BF8 A;  5HW7 A;  2ZQS A;  2KO7 A;  3WD0 A;  3CGM A;  4JFM A;  1WB0 A;  1D6O A;  3B9E A;  4U86 A;  2XP8 A;  2DT1 A;  1HXV A;  2M2A A;  4S3K A;  2PPO A;  4LAY A;  1H0G A;  1LL6 A;  3WH0 A;  5B8I C;  1D2K A;  1Q6I A;  1E6P A;  3O5O A;  2QF8 A;  3ARZ A;  4S3J A;  4W5U A;  3IHZ A;  1QPL A;  1NWU A;  4TX0 A;  1H0I A;  4Z2G A;  1B6C A;  1A7X A;  1YW5 A;  4ODO A;  2XPA A;  2DPE A;  2XP6 A;  1KFW A;  1FKD A;  3TC5 A;  3ARW A;  3WL1 A;  2N87 A;  3KZ7 A;  1ZU8 A;  4Q22 A;  3WL0 A;  4DT4 A;  2AOS A;  3AS2 A;  3PRA A;  1X6L A;  5HW8 A;  3CZ8 A;  4U84 A;  1JVW A;  3ARP A;  1ITX A;  5HWB A;  1J6Y A;  3B9D A;  2XP5 A;  3CHE A;  5HTG A;  3RGC A;  3G6L A;  2WLZ A;  1ZBC A;  1QPF A;  4R5E A;  5HKG A;  4PTM A;  4NNR A;  4LAW A;  4JFL A;  4KR0 B;  4DH0 A;  5HWC A;  4P8U A;  3CGN A;  1HJX A;  1BKF A;  2F21 A;  1UR9 A;  3RM9 A;  1ZBV A;  1ROT A;  3ARO A;  1FKI A;  2M1I A;  2MLY A;  1SR0 A;  2IUZ A;  4ITZ A;  4WKA A;  3BXW A;  3JYM A;  2LJ4 A;  1LQ0 A;  3ARS A;  2DG3 A;  1D7H A;  2XPB A;  3UQI A;  1JNT A;  1E6R A;  3GPK A;  2VCD A;  1LJY A;  2XP7 A;  1C9H A;  1ZBW A;  1W9V A;  2ZR5 A;  3IKD A;  4XAK A;  3WD2 A;  4IQ2 A;  2PI6 A;  1BL4 A;  3PA7 A;  4GGQ A;  3RME A;  5D75 A;  2XP3 A;  1FKR A;  4Z2I A;  4QIB A;  1ZB5 A;  2LGO A;  2Q5A A;  1P5Q A;  4J4N A;  2LKN A;  2DG4 A;  1EQ3 A;  2MF9 A;  4LAV A;  2KR7 A;  3LUO A;  2XP9 A;  1NH6 A;  1UR8 A;  3KAH A;  3KAI A;  3O5R A;  3WD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...