2L2SA

Solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
117
structure length
117
Chain Sequence
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 13
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2l2sA00
4IQ2A 1TCOC 2L2SA 2M08A 3KABA 3RFWA 1D6OA 2LKNA 5HWCA 2RUQA 1FKGA 3KAGA 3NRKA 1YATA 4GIVA 2M2AA 4JFJA 4W9QA 3JXVA 4W9PA 3WH0A 3KAIA 4JFKA 1FKSA 3UF8A 4ITZA 2RSEA 2XP6A 1PBKA 4G50A 3IK8A 2K8IA 3UI6A 2DG4A 3KCEA 1F40A 2JZVA 2FAPA 2UZ5A 1KT0A 3O5OA 3O5MA 3NI6A 4J4NA 5HT1A 2RUDA 1FKRA 2F4EA 4JFMA 3LUOA 4LAVA 3O5PA 1C9HA 1M5YA 4TNSA 1JVWA 5HUAA 3UQBA 5D75A 3O5GA 1J4IA 1U79A 1T11A 4IQCA 3O5QA 4ODPA 2LJ4A 1HXVA 2VCDA 2DG9A 3ODKA 1NSGA 2ZR6A 3KAHA 5HTGA 4TW6A 4DRHA 3B7XA 3UI4A 2LPVA 1BL4A 4TYOA 1FKIA 2MNTA 2XP4A 2XP3A 3IKGA 3O5JA 3PA7A 4LAYA 5B8IC 4ODMA 5GPGA 3O5LA 5BXJA 2XP5A 5HW8A 1FJDA 1W26A 2KI3A 3KADA 2PV2A 3IHZA 3JYJA 1B6CA 1FKJA 2D9FA 4QT3A 1J6YA 1R9HA 3RGCA 4DRKA 3UQAA 1Y0OA 1EYMA 3O5DA 4JFIA 4U85A 5I98A 4GGQA 2DG3A 2LGOA 2MLZA 4JYSA 1PINA 2MLYA 2MLXA 2XP9A 5J6EA 1QPFA 2KR7A 4TX0A 3TCZA 4J4OA 4LAXA 3CGNA 4ODKA 4DZ2A 1D7IA 1YW5A 4ODQA 4ODRA 4U86A 4DIPA 5HKGA 3KZ7A 3GPKA 4FAPA 1ROUA 3FAPA 4BF8A 5HW6A 2M1IA 1FKKA 4W9OA 4LAWA 1NMWA 2MPHA 2PBCA 1P5QA 2MF9A 2XPBA 3EY6A 5HW7A 2KE0A 2AWGA 1JNTA 1Q6HA 2ZQSA 1J4RA 4ODNA 1Q1CA 1QPLA 4JFLA 1FKTA 2F2DA 3I6CA 1Q6UA 3TDBA 3TC5A 1JNSA 1ZCNA 2OFNA 4DT4A 2ITKA 1FD9A 2ZQUA 2PPNA 4DRNA 1KT1A 1NMVA 1Q6IA 1J4HA 4N19A 2VN1A 2Q5AA 1F8AB 3PRDA 3O5IA 4QIBA 1BKFA 4G2PA 2KFWA 2RQSA 2PPPA 3O5FA 4U84A 1L1PA 2PV1A 3O5KA 2ZQVA 4ODLA 2XPAA 4DRPA 1FKDA 2RUCA 2ZQTA 3MDYB 4DRJA 2ZR5A 4DH0A 1FKHA 1QZ2A 4DRIA 2PPOA 1D7JA 1N1AA 4O2TA 1FKFA 1FAPA 1D7HA 4DRMA 3PRBA 4DRQA 1EQ3A 4IPXA 2FKEA 2F21A 3CGMA 4C02B 3O5EA 2KO7A 2RURA 4TW8A 2N87A 2ZR4A 3UI5A 2KGJA 2PV3A 5DIVA 1ZK6A 3O5RA 1FKLA 4NNRA 3UQIA 4QT2A 5HWBA 2XP8A 2Y78A 2IF4A 4MGVA 5DIUA 1ROTA 3IKDA 4DZ3A 1A7XA 1FKBA 4TW7A 3H9RB 3OOBA 4MSPA 3VAWA 2XP7A 3KACA 3NTPA 4DROA 5DITA 3KAFA 3JYMA 4FN2A 4ODOA 4R0XA
chains in the Genus database with same CATH superfamily
1W1YA 2M08A 3KABA 3W4RA 1FKGA 1FFRA 3NRKA 1YATA 3WH0A 2M2AA 3UF8A 4ITZA 1ZU8A 2RSEA 3UI6A 2DG4A 3KCEA 3O5MA 1KT0A 2RUDA 4JFMA 3O5PA 2DSWA 3ARQA 1NWTA 4WKHA 3ARSA 3O5GA 1W1PA 4ODPA 1H0IA 3KAHA 4TW6A 1D2KA 3UI4A 1BL4A 2G41A 2MNTA 2OLHA 4LAYA 3CHCA 5B8IC 5BXJA 1GOIA 1FJDA 3JYJA 1FKJA 3O5DA 4Z2JA 1E15A 5J6EA 4MNMA 4ODKA 3WD4A 4ODRA 1EDQA 1H0GA 4FAPA 1ROUA 3RM4A 1E6ZA 4IT6A 3WD1A 2M1IA 4MAVA 2PBCA 1P5QA 2MF9A 3EY6A 1J4RA 3TDBA 4KR0B 1HJWA 1FD9A 1KT1A 4N19A 2DSVA 1KFWA 2Q5AA 1F8AB 3PRDA 2F23A 3AROA 1FKDA 1OWQA 2DT3A 4DH0A 2B31A 4DRIA 2PPOA 1E6NA 1CTNA 1FKFA 5HBFA 3CHEA 1HJXA 3ARYA 4DWSB 2O92A 3O5EA 3ARXA 4Q22A 1WNOA 4TW8A 1OGGA 2KGJA 4ZPVR 4NNRA 4MGVA 5DIUA 2DSZA 3IKDA 1X6NA 3OA5A 1FKBA 3VAWA 3NTPA 4DROA 1LG2A 3JYMA 4IQ2A 3GU0A 3RFWA 3WL1A 1D6OA 5HWCA 1E6RA 4DRMA 4JFJA 4W9PA 4DRKA 1JCHB 4R5EA 2XP6A 1IX5A 1PBKA 1F40A 2A3EA 4MNKA 4ZPTR 3ARZA 1FKRA 2DSUA 2DPEA 1ZBWA 3ALFA 1LL7A 1M5YA 5JH8A 5HUAA 1J4IA 1U79A 4IQCA 3O5QA 3ARPA 2VCDA 5HTGA 5GQBA 2DT2A 3B7XA 4TYOA 1FKIA 1ZB5A 3IKGA 3O5JA 4S3JA 2PV2A 1W1TA 4MNLA 2PN0A 3QOKA 4U85A 5I98A 1W9VA 4Z2HA 2MLYA 2XP9A 3ARWA 2O9OA 4KQZA 1QPFA 4TX0A 3TCZA 4J4OA 4LAXA 3CGNA 4ODQA 4U86A 4DIPA 3KZ7A 3AS3A 1HKJA 1FKKA 3PR9A 1E44A 5HW7A 2WM0A 1UR9A 2KE0A 2AWGA 1HKIA 1JNTA 1Q6HA 4ODNA 1QPLA 4JFLA 2AOSA 1Q6UA 4DT4A 2OFNA 3RMEA 2ZQUA 3WD2A 2PPNA 1NMVA 1Q6IA 4DWSA 4IT4A 1BKFA 2KFWA 1W9PA 4PTMA 4ODLA 2RUCA 2ZQTA 4L3NA 2ZR5A 4DRJA 2P4VA 1QZ2A 1SYTA 1D7JA 1N1AA 1LL4A 3PRAA 1NH6A 1FAPA 2FKEA 2F21A 3CGMA 4P8VA 3AS0A 3UI5A 2PV3A 3B9EA 1FKLA 4HBOA 4QT2A 2WLZA 4WKFA 4Z2KA 1A7XA 4TW7A 3WIJA 3WL0A 3H9RB 2XP7A 3KACA 2B5UB 4WK9A 3KAFA 1EIBA 2ESCA 1GUVA 4ODOA 1UR8A 1O6IA 1K9TA 2EULA 2LKNA 3KAGA 4GIVA 3KAIA 1FKSA 2ETNA 1VF8A 2K8IA 4NZCA 2YBTA 2JZVA 2FAPA 4J4NA 3NI6A 4L72B 3LUOA 4TNSA 4MPKA 4ZPWR 1JVWA 3UQBA 1T11A 2LJ4A 3FXYA 1HXVA 1LG1A 1NSGA 2LPVA 2FDMA 1NWRA 3GTYX 1ITXA 2XP3A 3PA7A 2G8ZA 4ODMA 3O5LA 1W26A 2KI3A 3KADA 4HBEA 4QT3A 1J6YA 2D9FA 1R9HA 1LQ0A 3UQAA 1EYMA 1NWSA 4JFIA 3BXWA 4GGQA 2LGOA 3B8SA 4JYSA 4NSBA 2MLXA 1WB0A 5DO2A 1ZBVA 3AQUA 1YW5A 3GPKA 2A3BA 4QZVB 3FAPA 1GPFA 4W9OA 4LAWA 3RM9A 2ZQSA 4WJXA 1W9UA 3I6CA 3TC5A 2ITKA 3CH9A 2DT0A 1GRJA 3ALGA 4Z2IA 1HKMA 4P8XA 1ZL1A 3G6LA 3B9AA 1FFQA 2PPPA 3O5FA 4U84A 2PV1A 3O5KA 4DRPA 2XPAA 3MDYB 1XHGA 3CZ8A 3RM8A 5GPRA 3WQWA 1D7HA 3PRBA 1EQ3A 4XAKA 4Z2LA 4C02B 2KO7A 2RURA 1OGBA 3CHFA 1X6LA 3O5RA 5HWBA 2XP8A 2IF4A 4DZ3A 4MSPA 3OOBA 4DWSC 4MNJA 4FN2A 4R0XA 1TCOC 2L2SA 4UDMA 2RUQA 4W9QA 1LJYA 3JXVA 1ZBCA 4JFKA 2PI6A 4G50A 3IK8A 1E6PA 3EIPA 2UZ5A 5HT1A 3O5OA 1JNDA 2F4EA 4LAVA 2IUZA 1C9HA 3AS1A 3ARTA 5D75A 5DF0A 4MTVA 1TFVA 1EHNA 2DG9A 3ODKA 2A3AA 2ZR6A 4DRHA 1W1VA 4P8WA 2XP4A 3CHDA 5GPGA 2XP5A 5HW8A 1SR0A 2QF8A 3ARUA 3IHZA 1B6CA 3RGCA 3WD3A 1Y0OA 2DG3A 3ARRA 3ARVA 2MLZA 1PINA 4LGXA 1HJVA 5DEZA 2KR7A 4DZ2A 1D7IA 5HKGA 2WK2A 4Z2GA 4BF8A 2A3CA 5HW6A 4ML4A 3AS2A 1NMWA 2MPHA 2XPBA 3FY1A 2WLYA 4WIWA 4WKAA 1Q1CA 1FKTA 2YBUA 2F2DA 3WD0A 3WQVA 1ZCNA 1JNSA 4DRNA 3BMBA 1J4HA 2VN1A 1RD6A 1WAWA 3O5IA 3WKZA 4QIBA 1XRVA 4G2PA 4ZS6A 2RQSA 4HARA 1L1PA 3B9DA 2ZQVA 1LL6A 4DWSD 4S3KA 1FKHA 4O2TA 4P8UA 4DRQA 4IPXA 4AY1A 2DT1A 2N87A 2ZR4A 5DIVA 1ZBKA 1ZK6A 1NWUA 4URIA 1HKKA 3UQIA 1JNEA 2Y78A 4W5UA 3G6MA 1ROTA 5DITA 1E9LA 4Q7NA
chains in the Genus database with same CATH topology
1W1YA 2M08A 3KABA 3W4RA 1FKGA 1FFRA 3NRKA 1YATA 3WH0A 2M2AA 3UF8A 4ITZA 1ZU8A 2RSEA 3UI6A 2DG4A 3KCEA 3O5MA 1KT0A 2RUDA 4JFMA 3O5PA 2DSWA 3ARQA 1NWTA 4WKHA 3ARSA 3O5GA 1W1PA 4ODPA 1H0IA 3KAHA 4TW6A 1D2KA 3UI4A 1BL4A 2G41A 2MNTA 2OLHA 4LAYA 3CHCA 5B8IC 5BXJA 1GOIA 1FJDA 3JYJA 1FKJA 3O5DA 4Z2JA 1E15A 5J6EA 4MNMA 4ODKA 3WD4A 4ODRA 1EDQA 1H0GA 4FAPA 1ROUA 3RM4A 1E6ZA 4IT6A 3WD1A 2M1IA 4MAVA 2PBCA 1P5QA 2MF9A 3EY6A 1J4RA 3TDBA 4KR0B 1HJWA 1FD9A 1KT1A 4N19A 2DSVA 1KFWA 2Q5AA 1F8AB 3PRDA 3AROA 1FKDA 1OWQA 2DT3A 4DH0A 2B31A 4DRIA 2PPOA 1E6NA 1CTNA 1FKFA 5HBFA 3CHEA 1HJXA 3ARYA 4DWSB 2O92A 3O5EA 3ARXA 4Q22A 1WNOA 4TW8A 1OGGA 2KGJA 4ZPVR 4NNRA 4MGVA 5DIUA 2DSZA 3IKDA 1X6NA 3OA5A 1FKBA 3VAWA 3NTPA 4DROA 1LG2A 3JYMA 4IQ2A 3RFWA 3WL1A 1D6OA 5HWCA 1E6RA 4DRMA 4JFJA 4W9PA 4DRKA 4R5EA 2XP6A 1IX5A 1PBKA 1F40A 2A3EA 4MNKA 4ZPTR 3ARZA 1FKRA 2DSUA 2DPEA 1ZBWA 3ALFA 1LL7A 1M5YA 5JH8A 5HUAA 1J4IA 1U79A 4IQCA 3O5QA 3ARPA 2VCDA 5HTGA 5GQBA 2DT2A 3B7XA 4TYOA 1FKIA 1ZB5A 3IKGA 3O5JA 4S3JA 2PV2A 1W1TA 4MNLA 3QOKA 4U85A 5I98A 1W9VA 4Z2HA 2MLYA 2XP9A 3ARWA 2O9OA 4KQZA 1QPFA 4TX0A 3TCZA 4J4OA 4LAXA 3CGNA 4ODQA 4U86A 4DIPA 3KZ7A 3AS3A 1HKJA 1FKKA 3PR9A 5HW7A 2WM0A 1UR9A 2KE0A 2AWGA 1HKIA 1JNTA 1Q6HA 4ODNA 1QPLA 4JFLA 2AOSA 1Q6UA 4DT4A 2OFNA 3RMEA 2ZQUA 3WD2A 2PPNA 1NMVA 1Q6IA 4DWSA 4IT4A 1BKFA 2KFWA 1W9PA 4PTMA 4ODLA 2RUCA 2ZQTA 4L3NA 2ZR5A 4DRJA 1QZ2A 1SYTA 1D7JA 1N1AA 1LL4A 3PRAA 1NH6A 1FAPA 2FKEA 2F21A 3CGMA 4P8VA 3AS0A 3UI5A 2PV3A 3B9EA 1FKLA 4HBOA 4QT2A 2WLZA 4WKFA 4Z2KA 1A7XA 4TW7A 3WIJA 3WL0A 3H9RB 2XP7A 3KACA 4WK9A 3KAFA 1EIBA 2ESCA 1GUVA 4ODOA 1UR8A 1O6IA 1K9TA 2LKNA 3KAGA 4GIVA 3KAIA 1FKSA 1VF8A 2K8IA 4NZCA 2YBTA 2JZVA 2FAPA 4J4NA 3NI6A 4L72B 3LUOA 4TNSA 4MPKA 4ZPWR 1JVWA 3UQBA 1T11A 2LJ4A 3FXYA 1HXVA 1LG1A 1NSGA 2LPVA 2FDMA 1NWRA 1ITXA 2XP3A 3PA7A 2G8ZA 4ODMA 3O5LA 1W26A 2KI3A 3KADA 4HBEA 4QT3A 1J6YA 2D9FA 1R9HA 1LQ0A 3UQAA 1EYMA 1NWSA 4JFIA 3BXWA 4GGQA 2LGOA 3B8SA 4JYSA 4NSBA 2MLXA 1WB0A 5DO2A 1ZBVA 3AQUA 1YW5A 3GPKA 2A3BA 4QZVB 3FAPA 1GPFA 4W9OA 4LAWA 3RM9A 2ZQSA 4WJXA 1W9UA 3I6CA 3TC5A 2ITKA 3CH9A 2DT0A 3ALGA 4Z2IA 1HKMA 4P8XA 1ZL1A 3G6LA 3B9AA 1FFQA 2PPPA 3O5FA 4U84A 2PV1A 3O5KA 4DRPA 2XPAA 3MDYB 1XHGA 3CZ8A 3RM8A 5GPRA 3WQWA 1D7HA 3PRBA 1EQ3A 4XAKA 4Z2LA 4C02B 2KO7A 2RURA 1OGBA 3CHFA 1X6LA 3O5RA 5HWBA 2XP8A 2IF4A 4DZ3A 4MSPA 3OOBA 4DWSC 4MNJA 4FN2A 4R0XA 1TCOC 2L2SA 2RUQA 4W9QA 1LJYA 3JXVA 1ZBCA 4JFKA 2PI6A 4G50A 3IK8A 1E6PA 2UZ5A 5HT1A 3O5OA 1JNDA 2F4EA 4LAVA 2IUZA 1C9HA 3AS1A 3ARTA 5D75A 5DF0A 4MTVA 1TFVA 1EHNA 2DG9A 3ODKA 2A3AA 2ZR6A 4DRHA 1W1VA 4P8WA 2XP4A 3CHDA 5GPGA 2XP5A 5HW8A 1SR0A 2QF8A 3ARUA 3IHZA 1B6CA 3RGCA 3WD3A 1Y0OA 2DG3A 3ARRA 3ARVA 2MLZA 1PINA 4LGXA 1HJVA 5DEZA 2KR7A 4DZ2A 1D7IA 5HKGA 2WK2A 4Z2GA 4BF8A 2A3CA 5HW6A 4ML4A 3AS2A 1NMWA 2MPHA 2XPBA 3FY1A 2WLYA 4WIWA 4WKAA 1Q1CA 1FKTA 2YBUA 2F2DA 3WD0A 3WQVA 1ZCNA 1JNSA 4DRNA 1J4HA 2VN1A 1RD6A 1WAWA 3O5IA 3WKZA 4QIBA 1XRVA 4G2PA 4ZS6A 2RQSA 4HARA 1L1PA 3B9DA 2ZQVA 1LL6A 4DWSD 4S3KA 1FKHA 4O2TA 4P8UA 4DRQA 4IPXA 4AY1A 2DT1A 2N87A 2ZR4A 5DIVA 1ZBKA 1ZK6A 1NWUA 4URIA 1HKKA 3UQIA 1JNEA 2Y78A 4W5UA 3G6MA 1ROTA 5DITA 1E9LA 4Q7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQ2 A;  1TCO C;  2L2S A;  2M08 A;  3KAB A;  3RFW A;  1D6O A;  2LKN A;  5HWC A;  2RUQ A;  1FKG A;  3KAG A;  3NRK A;  1YAT A;  4GIV A;  2M2A A;  4JFJ A;  4W9Q A;  3JXV A;  4W9P A;  3WH0 A;  3KAI A;  4JFK A;  1FKS A;  3UF8 A;  4ITZ A;  2RSE A;  2XP6 A;  1PBK A;  4G50 A;  3IK8 A;  2K8I A;  3UI6 A;  2DG4 A;  3KCE A;  1F40 A;  2JZV A;  2FAP A;  2UZ5 A;  1KT0 A;  3O5O A;  3O5M A;  3NI6 A;  4J4N A;  5HT1 A;  2RUD A;  1FKR A;  2F4E A;  4JFM A;  3LUO A;  4LAV A;  3O5P A;  1C9H A;  1M5Y A;  4TNS A;  1JVW A;  5HUA A;  3UQB A;  5D75 A;  3O5G A;  1J4I A;  1U79 A;  1T11 A;  4IQC A;  3O5Q A;  4ODP A;  2LJ4 A;  1HXV A;  2VCD A;  2DG9 A;  3ODK A;  1NSG A;  2ZR6 A;  3KAH A;  5HTG A;  4TW6 A;  4DRH A;  3B7X A;  3UI4 A;  2LPV A;  1BL4 A;  4TYO A;  1FKI A;  2MNT A;  2XP4 A;  2XP3 A;  3IKG A;  3O5J A;  3PA7 A;  4LAY A;  5B8I C;  4ODM A;  5GPG A;  3O5L A;  5BXJ A;  2XP5 A;  5HW8 A;  1FJD A;  1W26 A;  2KI3 A;  3KAD A;  2PV2 A;  3IHZ A;  3JYJ A;  1B6C A;  1FKJ A;  2D9F A;  4QT3 A;  1J6Y A;  1R9H A;  3RGC A;  4DRK A;  3UQA A;  1Y0O A;  1EYM A;  3O5D A;  4JFI A;  4U85 A;  5I98 A;  4GGQ A;  2DG3 A;  2LGO A;  2MLZ A;  4JYS A;  1PIN A;  2MLY A;  2MLX A;  2XP9 A;  5J6E A;  1QPF A;  2KR7 A;  4TX0 A;  3TCZ A;  4J4O A;  4LAX A;  3CGN A;  4ODK A;  4DZ2 A;  1D7I A;  1YW5 A;  4ODQ A;  4ODR A;  4U86 A;  4DIP A;  5HKG A;  3KZ7 A;  3GPK A;  4FAP A;  1ROU A;  3FAP A;  4BF8 A;  5HW6 A;  2M1I A;  1FKK A;  4W9O A;  4LAW A;  1NMW A;  2MPH A;  2PBC A;  1P5Q A;  2MF9 A;  2XPB A;  3EY6 A;  5HW7 A;  2KE0 A;  2AWG A;  1JNT A;  1Q6H A;  2ZQS A;  1J4R A;  4ODN A;  1Q1C A;  1QPL A;  4JFL A;  1FKT A;  2F2D A;  3I6C A;  1Q6U A;  3TDB A;  3TC5 A;  1JNS A;  1ZCN A;  2OFN A;  4DT4 A;  2ITK A;  1FD9 A;  2ZQU A;  2PPN A;  4DRN A;  1KT1 A;  1NMV A;  1Q6I A;  1J4H A;  4N19 A;  2VN1 A;  2Q5A A;  1F8A B;  3PRD A;  3O5I A;  4QIB A;  1BKF A;  4G2P A;  2KFW A;  2RQS A;  2PPP A;  3O5F A;  4U84 A;  1L1P A;  2PV1 A;  3O5K A;  2ZQV A;  4ODL A;  2XPA A;  4DRP A;  1FKD A;  2RUC A;  2ZQT A;  3MDY B;  4DRJ A;  2ZR5 A;  4DH0 A;  1FKH A;  1QZ2 A;  4DRI A;  2PPO A;  1D7J A;  1N1A A;  4O2T A;  1FKF A;  1FAP A;  1D7H A;  4DRM A;  3PRB A;  4DRQ A;  1EQ3 A;  4IPX A;  2FKE A;  2F21 A;  3CGM A;  4C02 B;  3O5E A;  2KO7 A;  2RUR A;  4TW8 A;  2N87 A;  2ZR4 A;  3UI5 A;  2KGJ A;  2PV3 A;  5DIV A;  1ZK6 A;  3O5R A;  1FKL A;  4NNR A;  3UQI A;  4QT2 A;  5HWB A;  2XP8 A;  2Y78 A;  2IF4 A;  4MGV A;  5DIU A;  1ROT A;  3IKD A;  4DZ3 A;  1A7X A;  1FKB A;  4TW7 A;  3H9R B;  3OOB A;  4MSP A;  3VAW A;  2XP7 A;  3KAC A;  3NTP A;  4DRO A;  5DIT A;  3KAF A;  3JYM A;  4FN2 A;  4ODO A;  4R0X A; 
#chains in the Genus database with same CATH topology
 1W1Y A;  2M08 A;  3KAB A;  3W4R A;  1FKG A;  1FFR A;  3NRK A;  1YAT A;  3WH0 A;  2M2A A;  3UF8 A;  4ITZ A;  1ZU8 A;  2RSE A;  3UI6 A;  2DG4 A;  3KCE A;  3O5M A;  1KT0 A;  2RUD A;  4JFM A;  3O5P A;  2DSW A;  3ARQ A;  1NWT A;  4WKH A;  3ARS A;  3O5G A;  1W1P A;  4ODP A;  1H0I A;  3KAH A;  4TW6 A;  1D2K A;  3UI4 A;  1BL4 A;  2G41 A;  2MNT A;  2OLH A;  4LAY A;  3CHC A;  5B8I C;  5BXJ A;  1GOI A;  1FJD A;  3JYJ A;  1FKJ A;  3O5D A;  4Z2J A;  1E15 A;  5J6E A;  4MNM A;  4ODK A;  3WD4 A;  4ODR A;  1EDQ A;  1H0G A;  4FAP A;  1ROU A;  3RM4 A;  1E6Z A;  4IT6 A;  3WD1 A;  2M1I A;  4MAV A;  2PBC A;  1P5Q A;  2MF9 A;  3EY6 A;  1J4R A;  3TDB A;  4KR0 B;  1HJW A;  1FD9 A;  1KT1 A;  4N19 A;  2DSV A;  1KFW A;  2Q5A A;  1F8A B;  3PRD A;  2F23 A;  3ARO A;  1FKD A;  1OWQ A;  2DT3 A;  4DH0 A;  2B31 A;  4DRI A;  2PPO A;  1E6N A;  1CTN A;  1FKF A;  5HBF A;  3CHE A;  1HJX A;  3ARY A;  4DWS B;  2O92 A;  3O5E A;  3ARX A;  4Q22 A;  1WNO A;  4TW8 A;  1OGG A;  2KGJ A;  4ZPV R;  4NNR A;  4MGV A;  5DIU A;  2DSZ A;  3IKD A;  1X6N A;  3OA5 A;  1FKB A;  3VAW A;  3NTP A;  4DRO A;  1LG2 A;  3JYM A;  4IQ2 A;  3GU0 A;  3RFW A;  3WL1 A;  1D6O A;  5HWC A;  1E6R A;  4DRM A;  4JFJ A;  4W9P A;  4DRK A;  1JCH B;  4R5E A;  2XP6 A;  1IX5 A;  1PBK A;  1F40 A;  2A3E A;  4MNK A;  4ZPT R;  3ARZ A;  1FKR A;  2DSU A;  2DPE A;  1ZBW A;  3ALF A;  1LL7 A;  1M5Y A;  5JH8 A;  5HUA A;  1J4I A;  1U79 A;  4IQC A;  3O5Q A;  3ARP A;  2VCD A;  5HTG A;  5GQB A;  2DT2 A;  3B7X A;  4TYO A;  1FKI A;  1ZB5 A;  3IKG A;  3O5J A;  4S3J A;  2PV2 A;  1W1T A;  4MNL A;  2PN0 A;  3QOK A;  4U85 A;  5I98 A;  1W9V A;  4Z2H A;  2MLY A;  2XP9 A;  3ARW A;  2O9O A;  4KQZ A;  1QPF A;  4TX0 A;  3TCZ A;  4J4O A;  4LAX A;  3CGN A;  4ODQ A;  4U86 A;  4DIP A;  3KZ7 A;  3AS3 A;  1HKJ A;  1FKK A;  3PR9 A;  1E44 A;  5HW7 A;  2WM0 A;  1UR9 A;  2KE0 A;  2AWG A;  1HKI A;  1JNT A;  1Q6H A;  4ODN A;  1QPL A;  4JFL A;  2AOS A;  1Q6U A;  4DT4 A;  2OFN A;  3RME A;  2ZQU A;  3WD2 A;  2PPN A;  1NMV A;  1Q6I A;  4DWS A;  4IT4 A;  1BKF A;  2KFW A;  1W9P A;  4PTM A;  4ODL A;  2RUC A;  2ZQT A;  4L3N A;  2ZR5 A;  4DRJ A;  2P4V A;  1QZ2 A;  1SYT A;  1D7J A;  1N1A A;  1LL4 A;  3PRA A;  1NH6 A;  1FAP A;  2FKE A;  2F21 A;  3CGM A;  4P8V A;  3AS0 A;  3UI5 A;  2PV3 A;  3B9E A;  1FKL A;  4HBO A;  4QT2 A;  2WLZ A;  4WKF A;  4Z2K A;  1A7X A;  4TW7 A;  3WIJ A;  3WL0 A;  3H9R B;  2XP7 A;  3KAC A;  2B5U B;  4WK9 A;  3KAF A;  1EIB A;  2ESC A;  1GUV A;  4ODO A;  1UR8 A;  1O6I A;  1K9T A;  2EUL A;  2LKN A;  3KAG A;  4GIV A;  3KAI A;  1FKS A;  2ETN A;  1VF8 A;  2K8I A;  4NZC A;  2YBT A;  2JZV A;  2FAP A;  4J4N A;  3NI6 A;  4L72 B;  3LUO A;  4TNS A;  4MPK A;  4ZPW R;  1JVW A;  3UQB A;  1T11 A;  2LJ4 A;  3FXY A;  1HXV A;  1LG1 A;  1NSG A;  2LPV A;  2FDM A;  1NWR A;  3GTY X;  1ITX A;  2XP3 A;  3PA7 A;  2G8Z A;  4ODM A;  3O5L A;  1W26 A;  2KI3 A;  3KAD A;  4HBE A;  4QT3 A;  1J6Y A;  2D9F A;  1R9H A;  1LQ0 A;  3UQA A;  1EYM A;  1NWS A;  4JFI A;  3BXW A;  4GGQ A;  2LGO A;  3B8S A;  4JYS A;  4NSB A;  2MLX A;  1WB0 A;  5DO2 A;  1ZBV A;  3AQU A;  1YW5 A;  3GPK A;  2A3B A;  4QZV B;  3FAP A;  1GPF A;  4W9O A;  4LAW A;  3RM9 A;  2ZQS A;  4WJX A;  1W9U A;  3I6C A;  3TC5 A;  2ITK A;  3CH9 A;  2DT0 A;  1GRJ A;  3ALG A;  4Z2I A;  1HKM A;  4P8X A;  1ZL1 A;  3G6L A;  3B9A A;  1FFQ A;  2PPP A;  3O5F A;  4U84 A;  2PV1 A;  3O5K A;  4DRP A;  2XPA A;  3MDY B;  1XHG A;  3CZ8 A;  3RM8 A;  5GPR A;  3WQW A;  1D7H A;  3PRB A;  1EQ3 A;  4XAK A;  4Z2L A;  4C02 B;  2KO7 A;  2RUR A;  1OGB A;  3CHF A;  1X6L A;  3O5R A;  5HWB A;  2XP8 A;  2IF4 A;  4DZ3 A;  4MSP A;  3OOB A;  4DWS C;  4MNJ A;  4FN2 A;  4R0X A;  1TCO C;  2L2S A;  4UDM A;  2RUQ A;  4W9Q A;  1LJY A;  3JXV A;  1ZBC A;  4JFK A;  2PI6 A;  4G50 A;  3IK8 A;  1E6P A;  3EIP A;  2UZ5 A;  5HT1 A;  3O5O A;  1JND A;  2F4E A;  4LAV A;  2IUZ A;  1C9H A;  3AS1 A;  3ART A;  5D75 A;  5DF0 A;  4MTV A;  1TFV A;  1EHN A;  2DG9 A;  3ODK A;  2A3A A;  2ZR6 A;  4DRH A;  1W1V A;  4P8W A;  2XP4 A;  3CHD A;  5GPG A;  2XP5 A;  5HW8 A;  1SR0 A;  2QF8 A;  3ARU A;  3IHZ A;  1B6C A;  3RGC A;  3WD3 A;  1Y0O A;  2DG3 A;  3ARR A;  3ARV A;  2MLZ A;  1PIN A;  4LGX A;  1HJV A;  5DEZ A;  2KR7 A;  4DZ2 A;  1D7I A;  5HKG A;  2WK2 A;  4Z2G A;  4BF8 A;  2A3C A;  5HW6 A;  4ML4 A;  3AS2 A;  1NMW A;  2MPH A;  2XPB A;  3FY1 A;  2WLY A;  4WIW A;  4WKA A;  1Q1C A;  1FKT A;  2YBU A;  2F2D A;  3WD0 A;  3WQV A;  1ZCN A;  1JNS A;  4DRN A;  3BMB A;  1J4H A;  2VN1 A;  1RD6 A;  1WAW A;  3O5I A;  3WKZ A;  4QIB A;  1XRV A;  4G2P A;  4ZS6 A;  2RQS A;  4HAR A;  1L1P A;  3B9D A;  2ZQV A;  1LL6 A;  4DWS D;  4S3K A;  1FKH A;  4O2T A;  4P8U A;  4DRQ A;  4IPX A;  4AY1 A;  2DT1 A;  2N87 A;  2ZR4 A;  5DIV A;  1ZBK A;  1ZK6 A;  1NWU A;  4URI A;  1HKK A;  3UQI A;  1JNE A;  2Y78 A;  4W5U A;  3G6M A;  1ROT A;  5DIT A;  1E9L A;  4Q7N A; 
#chains in the Genus database with same CATH homology
 1W1Y A;  2M08 A;  3KAB A;  3W4R A;  1FKG A;  1FFR A;  3NRK A;  1YAT A;  3WH0 A;  2M2A A;  3UF8 A;  4ITZ A;  1ZU8 A;  2RSE A;  3UI6 A;  2DG4 A;  3KCE A;  3O5M A;  1KT0 A;  2RUD A;  4JFM A;  3O5P A;  2DSW A;  3ARQ A;  1NWT A;  4WKH A;  3ARS A;  3O5G A;  1W1P A;  4ODP A;  1H0I A;  3KAH A;  4TW6 A;  1D2K A;  3UI4 A;  1BL4 A;  2G41 A;  2MNT A;  2OLH A;  4LAY A;  3CHC A;  5B8I C;  5BXJ A;  1GOI A;  1FJD A;  3JYJ A;  1FKJ A;  3O5D A;  4Z2J A;  1E15 A;  5J6E A;  4MNM A;  4ODK A;  3WD4 A;  4ODR A;  1EDQ A;  1H0G A;  4FAP A;  1ROU A;  3RM4 A;  1E6Z A;  4IT6 A;  3WD1 A;  2M1I A;  4MAV A;  2PBC A;  1P5Q A;  2MF9 A;  3EY6 A;  1J4R A;  3TDB A;  4KR0 B;  1HJW A;  1FD9 A;  1KT1 A;  4N19 A;  2DSV A;  1KFW A;  2Q5A A;  1F8A B;  3PRD A;  3ARO A;  1FKD A;  1OWQ A;  2DT3 A;  4DH0 A;  2B31 A;  4DRI A;  2PPO A;  1E6N A;  1CTN A;  1FKF A;  5HBF A;  3CHE A;  1HJX A;  3ARY A;  4DWS B;  2O92 A;  3O5E A;  3ARX A;  4Q22 A;  1WNO A;  4TW8 A;  1OGG A;  2KGJ A;  4ZPV R;  4NNR A;  4MGV A;  5DIU A;  2DSZ A;  3IKD A;  1X6N A;  3OA5 A;  1FKB A;  3VAW A;  3NTP A;  4DRO A;  1LG2 A;  3JYM A;  4IQ2 A;  3RFW A;  3WL1 A;  1D6O A;  5HWC A;  1E6R A;  4DRM A;  4JFJ A;  4W9P A;  4DRK A;  4R5E A;  2XP6 A;  1IX5 A;  1PBK A;  1F40 A;  2A3E A;  4MNK A;  4ZPT R;  3ARZ A;  1FKR A;  2DSU A;  2DPE A;  1ZBW A;  3ALF A;  1LL7 A;  1M5Y A;  5JH8 A;  5HUA A;  1J4I A;  1U79 A;  4IQC A;  3O5Q A;  3ARP A;  2VCD A;  5HTG A;  5GQB A;  2DT2 A;  3B7X A;  4TYO A;  1FKI A;  1ZB5 A;  3IKG A;  3O5J A;  4S3J A;  2PV2 A;  1W1T A;  4MNL A;  3QOK A;  4U85 A;  5I98 A;  1W9V A;  4Z2H A;  2MLY A;  2XP9 A;  3ARW A;  2O9O A;  4KQZ A;  1QPF A;  4TX0 A;  3TCZ A;  4J4O A;  4LAX A;  3CGN A;  4ODQ A;  4U86 A;  4DIP A;  3KZ7 A;  3AS3 A;  1HKJ A;  1FKK A;  3PR9 A;  5HW7 A;  2WM0 A;  1UR9 A;  2KE0 A;  2AWG A;  1HKI A;  1JNT A;  1Q6H A;  4ODN A;  1QPL A;  4JFL A;  2AOS A;  1Q6U A;  4DT4 A;  2OFN A;  3RME A;  2ZQU A;  3WD2 A;  2PPN A;  1NMV A;  1Q6I A;  4DWS A;  4IT4 A;  1BKF A;  2KFW A;  1W9P A;  4PTM A;  4ODL A;  2RUC A;  2ZQT A;  4L3N A;  2ZR5 A;  4DRJ A;  1QZ2 A;  1SYT A;  1D7J A;  1N1A A;  1LL4 A;  3PRA A;  1NH6 A;  1FAP A;  2FKE A;  2F21 A;  3CGM A;  4P8V A;  3AS0 A;  3UI5 A;  2PV3 A;  3B9E A;  1FKL A;  4HBO A;  4QT2 A;  2WLZ A;  4WKF A;  4Z2K A;  1A7X A;  4TW7 A;  3WIJ A;  3WL0 A;  3H9R B;  2XP7 A;  3KAC A;  4WK9 A;  3KAF A;  1EIB A;  2ESC A;  1GUV A;  4ODO A;  1UR8 A;  1O6I A;  1K9T A;  2LKN A;  3KAG A;  4GIV A;  3KAI A;  1FKS A;  1VF8 A;  2K8I A;  4NZC A;  2YBT A;  2JZV A;  2FAP A;  4J4N A;  3NI6 A;  4L72 B;  3LUO A;  4TNS A;  4MPK A;  4ZPW R;  1JVW A;  3UQB A;  1T11 A;  2LJ4 A;  3FXY A;  1HXV A;  1LG1 A;  1NSG A;  2LPV A;  2FDM A;  1NWR A;  1ITX A;  2XP3 A;  3PA7 A;  2G8Z A;  4ODM A;  3O5L A;  1W26 A;  2KI3 A;  3KAD A;  4HBE A;  4QT3 A;  1J6Y A;  2D9F A;  1R9H A;  1LQ0 A;  3UQA A;  1EYM A;  1NWS A;  4JFI A;  3BXW A;  4GGQ A;  2LGO A;  3B8S A;  4JYS A;  4NSB A;  2MLX A;  1WB0 A;  5DO2 A;  1ZBV A;  3AQU A;  1YW5 A;  3GPK A;  2A3B A;  4QZV B;  3FAP A;  1GPF A;  4W9O A;  4LAW A;  3RM9 A;  2ZQS A;  4WJX A;  1W9U A;  3I6C A;  3TC5 A;  2ITK A;  3CH9 A;  2DT0 A;  3ALG A;  4Z2I A;  1HKM A;  4P8X A;  1ZL1 A;  3G6L A;  3B9A A;  1FFQ A;  2PPP A;  3O5F A;  4U84 A;  2PV1 A;  3O5K A;  4DRP A;  2XPA A;  3MDY B;  1XHG A;  3CZ8 A;  3RM8 A;  5GPR A;  3WQW A;  1D7H A;  3PRB A;  1EQ3 A;  4XAK A;  4Z2L A;  4C02 B;  2KO7 A;  2RUR A;  1OGB A;  3CHF A;  1X6L A;  3O5R A;  5HWB A;  2XP8 A;  2IF4 A;  4DZ3 A;  4MSP A;  3OOB A;  4DWS C;  4MNJ A;  4FN2 A;  4R0X A;  1TCO C;  2L2S A;  2RUQ A;  4W9Q A;  1LJY A;  3JXV A;  1ZBC A;  4JFK A;  2PI6 A;  4G50 A;  3IK8 A;  1E6P A;  2UZ5 A;  5HT1 A;  3O5O A;  1JND A;  2F4E A;  4LAV A;  2IUZ A;  1C9H A;  3AS1 A;  3ART A;  5D75 A;  5DF0 A;  4MTV A;  1TFV A;  1EHN A;  2DG9 A;  3ODK A;  2A3A A;  2ZR6 A;  4DRH A;  1W1V A;  4P8W A;  2XP4 A;  3CHD A;  5GPG A;  2XP5 A;  5HW8 A;  1SR0 A;  2QF8 A;  3ARU A;  3IHZ A;  1B6C A;  3RGC A;  3WD3 A;  1Y0O A;  2DG3 A;  3ARR A;  3ARV A;  2MLZ A;  1PIN A;  4LGX A;  1HJV A;  5DEZ A;  2KR7 A;  4DZ2 A;  1D7I A;  5HKG A;  2WK2 A;  4Z2G A;  4BF8 A;  2A3C A;  5HW6 A;  4ML4 A;  3AS2 A;  1NMW A;  2MPH A;  2XPB A;  3FY1 A;  2WLY A;  4WIW A;  4WKA A;  1Q1C A;  1FKT A;  2YBU A;  2F2D A;  3WD0 A;  3WQV A;  1ZCN A;  1JNS A;  4DRN A;  1J4H A;  2VN1 A;  1RD6 A;  1WAW A;  3O5I A;  3WKZ A;  4QIB A;  1XRV A;  4G2P A;  4ZS6 A;  2RQS A;  4HAR A;  1L1P A;  3B9D A;  2ZQV A;  1LL6 A;  4DWS D;  4S3K A;  1FKH A;  4O2T A;  4P8U A;  4DRQ A;  4IPX A;  4AY1 A;  2DT1 A;  2N87 A;  2ZR4 A;  5DIV A;  1ZBK A;  1ZK6 A;  1NWU A;  4URI A;  1HKK A;  3UQI A;  1JNE A;  2Y78 A;  4W5U A;  3G6M A;  1ROT A;  5DIT A;  1E9L A;  4Q7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...