2L35A

Structure of the dap12-nkg2c transmembrane heterotrimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for intramembrane assembly of an activating immunoreceptor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords DAP12-NKG2C_TM
total genus 19
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 2l35A00
1WP8A 4NTWA 4FZ1A 4FZ0A 4NYKA 3IJ4A 3S3XA 4NTXA 2L35A 3N27A 1WP7A 3S3WA 2FB5A 4NTYA 2QTSA
chains in the Genus database with same CATH superfamily
2PI4A 1NTKH 3WU2Z 1Y4MA 3RWRD 4WBNA 5IY5B 2PF4E 2Q7GA 1EBOA 5LYJA 5LGNA 1XL6A 3K5MA 3G80A 3CJHB 3KCXA 4TUYA 4QNHB 4O2BB 4JV5B 2P4VA 4YIPA 1VQNV 3MAQA 2W6IG 1N36B 1MSDA 2LW1A 2OIEA 1M57C 5LP6C 2UUAO 3T1YB 2F1MA 5JH7A 4WFBV 1JOYA 5GONA 3LDDA 2Q7HA 2WA4A 5LHGA 2UXNA 2QKSA 1ZUQA 2EZOA 4X62B 1SQPH 4L8JA 3ZX6A 2QM7A 1OCZB 1TUEB 1JPXA 1PL4A 1K5SA 2QWQB 2XTAA 1BGYH 3LDCA 2CTRA 4TT3G 2F23A 3OMNB 2HEPA 1WNSA 3CCEV 3GVMA 2KQXA 3D36A 3A0HZ 4PA9A 1XI1A 5CA1A 3B09A 3G67A 4WCEV 1YIJV 4QGPA 1SZTA 1NS1A 3TXSA 4ZOLA 4JI7O 1VQ6V 3ZRSA 2VRZA 3DXRB 2FYUH 3JATA 3NR7A 4DV2B 3K03A 3KCYA 3CCUV 1R3KC 4BR6A 2CGNA 4HNAB 3A8TA 1KU9A 4UVCA 1SKVA 3QO8A 1CEZA 1HNXO 1XMQB 4DV2O 2ZNJA 3H01A 3SJAC 3ZHSA 4YJ3B 5EK0A 4O2AB 1H2KA 1YSCA 5JQGA 1OCZC 2DN9A 3DXRA 4X65O 4B3TO 2CH7B 4MS2A 1V9PA 2B9ZA 2KG7A 3IAYA 3FAVB 2ZD9A 5FL7G 4CS3A 3H1IH 4IIJB 4CH3A 2OCHA 1YITV 2EZPA 2CGOA 4X8AA 4IYHA 2Q68A 1AI7A 2H3OA 2A3QA 1JJ2U 3ETQA 4KHPO 4LF4B 1P4RA 2N05A 1LUVA 2ZINA 4H13B 1S5LZ 2YUAA 2UXBO 4J7JA 3ZIAG 1OCOB 4HAMA 5ITZA 2RMKB 1F7YA 4ZOLB 4FLWA 1Q82W 3A0BZ 3CEIA 1B04A 5TISZ 3OUSA 2UUBB 4EB6A 3JCUZ 3UO3A 4OPAA 5JWPA 1H2SB 4PHZA 4RUFA 4FVMA 1GKFA 2E3CA 4G2KA 4D7SA 1F51A 2Q6AA 2ARHA 2IH1C 3GWOA 1VEWA 1RSOB 3UQ8A 1H2NA 1SF9A 2Y4UA 1JR9A 2OTJV 2EIJB 5HFLA 2D3OW 2FKXA 2PTMA 5JCOA 2ZDIA 4LH7A 2ZXWC 4MSWC 4JI2B 1KB9F 2EJ7A 2Q0AA 1HNXB 2HHHO 5IJ9B 4J7ZA 1I0HA 5H9CA 2JEUA 5IDJA 2ZXWB 3DC6A 1ZLZA 1W59A 4O2BA 1MZEA 3FB8C 4TUYB 3RYCA 4H0LB 2ADQB 1BHAA 2LGWA 2P5OA 3OE7G 3CCJV 1Y74A 4I50B 3OFNG 3CWBH 3K5OA 4DR7O 5JJJB 1NH2B 5LMUO 5LHHA 4NVPA 4DR5B 4MTGA 2HP8A 1KKCA 4LBEC 5B66Z 1E1QG 2K1EA 1Z5VA 5H6RA 2BOCC 3BA9A 4DV7B 3VOUA 1O9HA 1CXZB 1V54B 1GN4A 4NXNO 1KUQA 2ITDC 3E35A 3D36C 1R73A 1AJNA 2XNDG 3AG1B 4IIJA 4AI8A 2IU3A 1VF7A 2VS0A 1OZ0A 4LF5O 2KG7B 3ZMSA 4CH5A 4J11A 4EFBA 5A9GA 4YJ2A 2OTLV 1SETA 1COWG 4O4LA 4QPJA 1HW7A 3BHPA 2EJRA 1Q3EA 5J9PC 4FZ0A 1PV0A 2HJDA 3B40A 4BW5A 4W4KA 4LF9B 4BIUA 1AR5A 5EBWC 3CYOA 5LBQA 2YI8A 4K0KO 3ETDA 4I9QA 1TUBB 1PL0A 3H1KH 4ICGA 1I7FA 1S0VA 4LNUB 1GH6A 3O65A 1THZA 1NT2B 1V54C 2RDCA 5LGTA 2HVKC 1Y76A 4JTDB 4J9YB 1S3JA 2JJ2G 3THOA 3SJCC 3CPWU 4XDKA 3FKSG 3SYPA 1VQ9V 1V55C 3H1LH 3KZIZ 4JI4O 3QO5A 1WAZA 1VMGA 1FKAO 1SA0B 1DF4A 4CS2A 2B5UA 1VQ5V 2HR3A 5CMUA 1IBLB 2XAQA 5IYZA 4LF7O 4BIZA 1VQ4V 1NR7A 1G4YB 4R6ZA 3SJBC 4WBNB 4DV6O 3K0GA 4B3SB 3UKMA 2Y48A 5FLXN 4DV0O 1FXVA 2F43G 4DR3B 1QU7A 3ZMZA 2JJ1G 3RYIA 3LSQA 3P30A 1YXBA 2HLDG 3TXQA 1VF5B 1GN2A 4RWUA 2QSAA 1S77D 3CRRA 3WB0A 5IYCO 1DF5A 1SQVH 2IH3C 5IYZB 1K7DA 1URFA 3OT7A 1QQCA 1KC8W 3CP1A 1FFTB 4TSFG 5HFMA 2L6LA 3UT5A 3JASA 4X20A 1DTOA 1M93A 4JZGA 3OM3B 5LP6B 5C8YA 1EM1A 2AZ0A 1VQ7V 2QE7G 3JSLA 3CHXA 5LXTA 3AG2B 4MTFA 4MVSA 5CBGA 3K3WA 1P84F 3MDSA 1N34B 2QTSA 3OMIB 5E79Z 2HKOA 2Q67A 3E89A 5EBMC 3IC9A 4GT1A 4P30A 2Q69A 2Q0OC 4JTAB 2GSMB 1K8AW 1TGOA 5KLVH 2GDSA 1BQZA 1L0NH 4QJFB 3IFXA 1GK9A 4CC6A 4JYYA 1QR9A 5KX5A 1SQQH 4B3MB 2R9AA 1N33B 5BMVA 4UB6Z 2UUAB 2BCCH 5A2QN 2QWOB 3A2FA 2FB5A 3JAKA 1NJIW 3AK2A 1AP6A 1HDJA 3BEHA 1XL4A 4PD4F 2WLIA 4JTCB 4GX0A 3FB5C 4TV9A 1X4TA 3TK1A 3HKBA 4DUYB 1OCRC 1T5EA 3BABA 1XMOB 2XAGA 4J7KA 1NKDA 3J81N 1A32A 2QKCA 4O4JA 1OCCC 2XOKG 2X6AA 4I4TA 2N74A 1UJWB 1JX9A 4W4LA 4LH6A 1AI6A 2WPDG 2A06H 3QF7A 1HNWB 1PPJH 2EILB 1D2DA 4MVUA 3BVOA 4DV3B 1M9NA 5L3FA 3K57A 3UT5B 5B5EZ 2EINC 1Z5WA 3KG2A 2DQ0A 1G6UA 1XNRB 1ROPA 5LOVB 4WF9V 3DGEA 1HNWO 2O57A 5IE9A 4PDRA 4WFEA 2E75B 5LMNB 4N21A 4J41A 3RYCB 4YY3B 1KMIZ 1VQLV 3OD4A 3B8MA 4PI0A 5K1PA 2LFSA 3ZHTA 3W7SA 4NTWA 2R72A 1P49A 2L35A 3HPLC 4I5SA 1K92A 4ZHQA 5GTHZ 1JQ0A 1JFFB 3SPIA 2QGNA 4NXMO 1LR1A 1NU1H 5EBLC 4RAIA 2IBZH 4RQFA 2QWNB 3RGBA 5KHIA 3E8GA 3W7TA 1VQKV 3LNMB 1RSOA 1K9MW 2VWKA 3E8HA 1P7GA 3QTCA 1QVFU 3T4DA 3F7VC 1EZJA 1WP7A 2QDOA 3FFQA 3EFFK 3FYIB 2QKAA 5JJEB 1BCCH 1BS3A 2XT9A 4RUEA 3ASOC 2GTSA 5EZYB 4FJCC 2BSKB 4X9QA 2NNUA 3STLC 2GUZA 3F7YC 3SPGA 1GM9A 2VWJA 4O4HA 4FLZA 3MHSC 1RM1C 2ZE7A 4DV3O 1GTOA 4JI3B 2ZM6B 5LL6Y 1MZFA 1HP8A 3AG3C 1XNQB 1OJHA 2P7TC 1EFRG 1JA8A 3CMEV 3RVYA 1TVKB 3B4SA 1YHQV 2Q4PA 3ASNC 4N23A 2DMXA 3FAVA 5EC2C 4PELA 1SQXH 2QEXV 4JI2O 1YEWA 4F4LA 3ABMB 3L70H 4CBCA 4KHPB 4O2AA 4YJ2B 5CN0A 1N0JA 2EIKC 3N2GA 3HKEB 5EIBD 4FZ1A 3RYFB 3ZHRA 4X88A 1NI8A 2YEVA 4HBNA 3H1HH 4AQYO 4JI4B 4X66B 4JZ2A 2E76B 2R9RB 4JAUA 3ZRWB 4LF9O 1EN6A 1AI4A 2YXLA 1NZ6A 2JGDB 3HB3B 3IGAC 1AR1B 2AZ2A 3K9AA 2QR4A 2NR5A 1W0JG 5EIBC 1R6KA 1JCHA 3JD3A 3RYHA 1M5IA 2YIBA 2W0XA 4FMTA 4GLXA 3OEEG 3E2EA 1XBLA 3STZC 4HZ3A 5L3BA 1WB8A 4PDMA 2GBOA 4FPPA 5BR8O 4OGQB 1K73W 4EEQA 4X1KB 2B1GA 3DSQA 5IJ9A 3ML0A 5B1AB 5JH7B 3K5NA 4LP8A 4DR5O 1XMOO 2DWDC 1YDXA 4LC1A 4JI6B 3I55V 1DLBA 4U7OA 3S3WA 3MHHC 1OV9A 3CJHA 4DUZB 1YI2V 4F6EA 1ZAUA 3ICXA 1VIBA 2VQFB 4JI0B 3FYEB 2X6BA 4ZIBA 4OPHA 1E79G 2YXYA 3T1HO 2WAMA 3JALB 1S76D 4LWSB 4LFCB 3TJTA 2E5LO 3NXSA 4ZI7A 4MVRA 5ITZB 5IWAB 3I56V 2WLLA 1FXKC 2LP7A 4CH4A 3CRAA 1XILA 5AG2A 4IHJB 4UCOA 1TA8A 3JARB 5KMGA 5IJ0A 1RM1B 5CA0B 4LFCO 5DN6G 4H44B 4LF7B 1GM8A 1Z2GA 3OMAB 1V55B 2PY5A 4LF8O 5IWAO 5B1AC 3WG7B 4B3SO 4RO2A 2JRIA 3QG5A 5L3EA 2V7QG 4K8ZA 4K0KB 3RYHB 1H2GA 1BT8A 5D5PA 4ABMA 2QA4V 1L8DA 4O4IB 5K1XA 4I7ZB 4IYIA 1Q8IA 1KD1W 3TCUA 4JI8B 1AVMA 3N2KB 2JGDA 3OTOO 2W6JG 2DWEC 4JASA 1H8HG 4LFBO 4MVMA 1HWYA 1RPOA 4FLVA 3OR7C 4JI5B 2YEVB 4X64O 2VQFO 3CXCU 1WPXA 4B7KA 1R3LC 4DRXA 1YCIA 4DV1B 1U96A 2AHZA 2P6JA 3ZBHA 1YJNV 4JI8O 2M7WA 5BXZA 3WFVA 4B08A 2RJZA 2AGAA 2UXCO 1FJGB 5CA1B 2ZIMA 2YC0A 3UO2A 1GO3F 2QM8A 2UUBO 3CC7V 4DV1O 4DV6B 2G38A 1B3QA 5CBHA 3I5DA 2YDEA 3U0ZA 2V1DA 3JD2A 1GMGA 1N34O 1M57B 5CA0A 4DV5O 5KMGB 1OCOC 3K5LA 3CC2V 4UCSA 2EX3A 4IHJA 3W7WA 5F2VO 3RVZA 1M4UA 4JPRA 2WLLB 5JVDB 3OW2U 2CTQA 4LF8B 3UM7A 3OGCC 2QTOA 3KKYA 4J80A 5GW7A 3UCSC 3RT3C 2BSKA 3VBBA 2CTWA 4R8CA 1PNMA 1Q6HA 1NH2D 3OAAG 2HHHB 1FAFA 4JAAA 1Y67A 5LYJB 1TAEA 4U7NA 2X0LA 1HNZO 5BZBA 1VQOV 1SESA 4TOIA 2DYRC 3AG4C 3HR0A 4UVBA 4X64B 2Y0IA 3X2QB 4BIOA 2LO1A 4DW1A 4NYKA 4P2ZA 5J2UB 1WA8A 4X1KA 4UCRA 5LA6B 1GN3A 3CCMV 2IM9A 1FXKA 2A79B 1N4CA 4MVZA 3SYAA 3CCSV 3SYOA 4U3JB 1ZX3A 1XNRO 2CE4A 2F95B 2XHBA 1Y66A 3HKCA 5EYPB 4A5UB 1SQBH 4P9PA 1M56C 2XAJA 4JYCA 2YI9A 1KKDA 3LSSA 1XHZA 1L0LH 4WFHA 4DUYO 1QLEC 2M6YA 3O9OA 1VP7A 3JAWA 1LUWA 1BMFG 3ETEA 2QJ1A 2JDIG 4GCZA 2P67A 3M99B 3ZMTA 4CH6A 2QWPB 3D3IA 1KECA 1P7BA 1WN7A 1VQ8V 4XDJA 5LGUA 3ABKC 4I55A 4YIOA 1N36O 4I0XB 2FL4A 3Q4HB 4Q6GA 3CCLV 2H94A 2OIGA 3IJ4A 4PA7A 3BCCH 4LFAO 2P4KA 2PYLA 3OR6C 3JAMN 4FLUA 2Q5ZA 4E4EA 1FFXA 3APOA 1MMMA 2DW4A 3BRCA 5J2TB 4DV4O 3ZS8C 2P90A 2LQTA 5KAFZ 2PI5A 2QWRB 3JAKB 3G4SV 4YHHO 1N32O 2UUCO 5BMVB 1PNLA 2WLMA 2WWWA 2BTQA 3BPZA 3VQXA 2JVDA 2Z3YA 3ZMVA 1FD9A 4PI2A 3W7XA 2JIZG 1WP8A 1RFYA 4I55B 5L3GA 5EYPA 3G71V 3DTUB 1VQPV 4NXMB 3G6BA 4UXNA 5LXTB 4F6RB 1ZTEA 5DECA 1FXKB 5LP6A 2ZDIC 3SPCA 2YIAA 4TV8B 4GX1A 2Y69B 2UXXA 1K97A 4MTOA 1YJ9V 5H2FZ 4GKKB 1B6QA 3RFRA 4FM2A 1S5HC 2FMLA 1RPRA 4EKWA 2XUMA 2UU9B 3C3TA 4YXWG 5LA6A 1NTMH 1IBMB 1JFFA 1WA8B 5IY5C 3AG7A 5DEDA 3ZEDA 4D7TA 1I08A 1FJGO 1XREA 5KA6A 1UPGA 1XDCA 2EULA 1DGSA 2ADPA 1YZBA 1ZL8A 4DR4O 2ZQMA 1IBKB 2Q73A 1YTFD 3QNEA 1AP5A 3F5TA 1NVPD 2GV9A 2JS3A 4GX2A 1US6A 1MG1A 4WFFA 3DC5A 1QNMA 5KHKA 2ZNIA 1E1RG 1SA0A 4JAVA 3A0RA 1XMQO 1SRYA 4LF6O 1G1XB 4F6RA 3FB7C 4PA4A 3CCQV 4X1IB 3E8FA 1VF6A 3OEHG 4PA6A 1MOFA 4B3MO 1KBHA 2DYRB 4FLYA 4JI6O 3N27A 1Y76B 1Q86W 1I5YA 3ABLB 2UXDB 4I4TB 1J5EO 2WLJA 3VQWA 1HNZB 2PUSA 1M1KW 2DYSB 1ZSPA 4PA3A 1SC5B 2EINB 2MW2B 1AROP 2KSDA 1IDSA 2ZE6A 2PYJA 3Q4HA 1K3EA 2Y69C 4I0XA 3OTOB 3B77A 2B1IA 4LFBB 2Q9LA 3L74H 1J5EB 2N04A 3ZHUA 5J2TA 3P3PA 3K04A 4X1YA 1OCCB 1FFXB 3OUFA 1XNQO 4CZZA 4O4IA 5IT9N 1JMKC 3P32A 3H9VA 4P9OA 1Q5OA 3R65A 3CXHF 2LFRA 2R9IA 2YICA 3HKDA 2HJFC 3ASNB 4Z2WA 4QIWF 1Q6IA 1QR8A 3ABLC 3SYCA 1XUQA 2WSSG 1EZVH 2BE3A 3N2KA 4U3JA 4B3TB 4PDLA 1M90W 4PDVA 1PP9H 1FXHA 3JAWB 3EHBB 1BL8A 4GX5A 1MNGA 3ZMUA 5J2UA 3E86A 2VQEB 2A0LA 2YXHA 2KB1A 2HG5C 4DR1O 3E8BA 3ZRVA 1MSWD 4WFAV 4AQYB 1M56B 5FPRA 3MD0A 5B1OA 2UXDO 4TQDA 2UU9O 2ZKOA 3ZRXA 1NVPB 5L3CA 4QPKA 3TETA 3K0DA 1VF6C 4MW3A 3BAAA 2UXBB 2H8PC 4FFKA 3JD0A 4DK1A 1YJWV 3APQA 2F4VO 5CB4A 3EXAA 4LWSA 3JALA 3H1JH 4PJ0Z 2ZIOA 4U3FH 1IX9A 1H2MA 1J95A 2YSUB 3AG1C 5LHIA 3WG7C 1CP9A 5JVDA 1ORQC 3AG4B 2RCVA 2ZE5A 4JYBA 5B1NA 3E22B 5BR8B 1BQ0A 4EFEA 4MW8A 4CC5A 1K4DC 2CUGA 4YY3O 1IVSA 2D2CB 2YS8A 4K35A 4FIPC 4I9WA 4MVQA 1XEQA 1H8EG 2FTKA 3SYQA 2RN9A 4EB6B 2Q8VA 4LF6B 4Z1VA 1OCRB 4DV4B 2Q7EA 2EILC 3K79A 4MT8A 3OGIB 3CS5A 1F4NA 1K4CC 2EIMC 2JEXA 4UCUA 4G27B 4DRXB 1RP3B 2OWOA 3L72H 2JK5C 4TWKA 2AHYA 4KXRA 2NLJC 4J42A 4FLTA 1TUBA 3HKDB 3EVKA 1IBMO 2E5LB 1WLEA 3ZHVA 3CE2A 4CS4A 1QVGU 3K06A 4DR6B 2BTOA 4E2LA 3N2GB 1K34A 4KP4A 2F4VB 2CH7A 2OCCC 1O9GA 2EIMB 5B3SC 1IURA 4NXNB 4LFAB 1MABG 2EBOA 3D3QA 4XDLA 2YIBD 4YJ3A 4FM1A 3SGIA 1BZKA 3CX5F 4H33A 3M8AA 4IT5A 4AILC 1D5AA 3T1CA 2DOSA 3CCVV 2P22C 1N0NA 4HNAA 1B06A 3RYFA 3CB2A 1SS3A 1AR4A 3HKEA 2MK3A 4OX9B 3CSXA 3JARA 2LW7A 4X89A 3AG3B 1BSMA 1QBZA 5EC1C 2XASA 2LGQA 3FX7A 5JCOC 4DR2B 3K58A 4X1IA 4MVOA 4ZKIA 4NR1A 3M7MX 3W7UA 4ZI7B 4GUNA 1GN6A 3GB7C 2HFEC 4DO2A 3ASOB 1IXMA 4BWAA 3S3XA 4DW0A 2F93B 4FLXA 3ZHQA 4JI5O 4WFGA 2CK3G 4J10A 1VQMV 2PGGA 4DR1B 4R7CA 3BY6A 2IJHA 2WLKA 3PJSK 3CRCA 2RQ6A 1LNQA 3CRMA 2XAFA 1F4MA 3E22A 3IC7A 3LSUA 4BW9A 1PD3A 3R66A 4K3AA 3PN1A 3LUTB 4BAYA 5B1BB 2ZR3A 3SPJA 4UCTA 4DUZO 2ZCEA 3D8CA 5KUKA 5LMUB 4UCVA 5D5QA 3ZN1A 1FS0G 3J80N 4JI0O 5GONB 5CB4B 3AEIA 4ZHQB 2X7RB 3T1HB 3K08A 4L87A 1VARA 4J9ZB 1NBMG 3ABTA 4DV7O 1SERA 3SR2C 5B3SB 1R1BA 5GTIZ 2JS5A 1Q6UA 4NTYA 5H5NA 4DR3O 4GKJB 2QM4A 5FPOA 1IXBA 3RN4A 3J7AU 4XBFA 1NR1A 4OX9O 4NB5A 2IU0A 1FPOA 4JF3A 4X66O 2ZR2A 1GRJA 4Z1MG 4X65B 2Z5UA 3CC4V 1AI5A 5B1BC 4NKGB 2ATKC 3B2EE 4G28B 3U10A 4UV8A 4DYLA 4GZRB 1KQSU 3SJQC 2YIDA 2A9HA 4JGSA 1NTZH 1CPYA 2IJIA 1N8RW 4DK0A 4AHCA 1S72V 2ODMA 3U11A 3T1YO 4QE9A 1H2LA 1UFIA 1BHBA 4UFZA 3CD6V 1Q81W 1I5XA 3C3SA 4TV9B 2BTQB 4Q20A 5C93A 4GYCB 4H37A 4X1YB 1I94O 4X62O 5IYDO 5JQGB 3G6EV 5JJNB 1NQTA 3GWKC 1WJZA 4DR4B 3ZRWA 5FNVB 2OCCB 3CCRV 1XOUA 5KAIZ 3LNNA 1QCEA 2ITCC 3K59A 4K8XA 3P3NA 5IYBO 3AK3A 2AW9A 3HKBB 2LJ2A 4DR2O 2OT5A 2ILMA 2WLIB 4LR3A 4GKJO 2C2AA 3RW0A 3JATB 4OXSA 3JD1A 1AILA 1R3JC 3RBZA 1KYOF 4PV1B 4RQEA 1PKXA 1WPBA 5CA3A 5KX5B 4B7EA 1F23A 1SQFA 4X20B 2JGUA 2HVJC 3JASB 4FK5C 1Q7YW 1TVKA 1AJPA 1YTFB 3E83A 2CAZC 1YF2A 3BFRA 3ZJZA 1R6TA 2KKWA 2EIJC 4UVAA 3X2QC 2EIKB 3L75H 1D5NA 5KHJA 1XHXA 1ENVA 4JYAO 4DR6O 2ETNA 2F66C 2IJKA 5CBFA 1ZL8B 1W2BU 4O4HB 2P06A 2UUCB 1SQGA 3QVNA 2GUZB 5BY1A 1I94B 2CDYA 5EZYA 3K9SA 1KP3A 3RYIB 1AB3A 1ZWIC 3JYCA 4IL6Z 2UXCB 2PZSA 3AK1A 1JVMA 5KUMA 4B3RO 2DQ3A 5KHGA 5LMNO 1EN4A 4KFMA 1S5JA 1SZXA 2BOBC 3QO7A 1Q90D 4DV5B 3JD4A 3T2MA 1MA1A 4LCUC 5L3DA 3WB2A 3T4ZA 4LF5B 1H38A 1K5QA 2X6CA 4ZBMA 1W0KG 5LOVA 5H6QA 2CTPA 2IJJA 3B8NA 2GTAA 4TV8A 1IBLO 3L71H 1K33A 2DYSC 1XQ8A 3F5WC 5KA5A 2VQEO 3JSNA 4DR7B 1N33O 4ASUG 2AXTZ 1U97A 5DM6V 1PM9A 5KHHA 1YVWA 3TGUH 1FYJA 1Y6XA 4QE7A 1DK1A 3LDEA 2E74B 4UV9A 2NN4A 4NTXA 3ABUA 2A7WA 4LF4O 2IW5A 4FFBB 4IGGA 2W0FC 4DXWA 3ABKB 1QLNA 3L73H 3VQVA 1IBKO 4JI3O 3L9DA 2ZM6O 4KUMA 1JJOA 4YHHB 1N32B 1L1FA 2WA3A 1GAXA 4O4JB 3C90A 3SPHA 2DE0X 4UB8Z 1QLEB 4UUJC 4LNUA 4B3RB 1G8MA 2Y0PA 3CMAV 1IZ3A 4KL1A 4MTXA 3CRQA 3FB6C 1AJQA 1BE3H 1OHHG 3WB1A 2WLNA 1WB7A 3FD9A 1Q43A 2R70A 5FNVA 4FM0A 2GHYA 3JCZA 4HYOA 1R3IC 1HR0O 5C8YB 1EN5A 4DV0B 4O4LB 2XAHA 4D6TH 1GM7A 4FFBA 4C7UA 4JI1O 2RNBA 3HKCB 2V4DA 1HR0B 4R50A 3OTFA 2Z0AA 3ABMC 5IJ0B 1Y74B 4I50A 3ETGA 3AG2C 1PNKA 2ZT9B 2WLHA 4GKKO 4JI7B 3SDLA 1R6NA 1QHTA 2OYQA 2Y4TA 4JI1B 3ZCCA 4JYAB 1X59A 3BA8A 2ZE8A 2DJVA 1KP2A 4JV5O 4TQFA 2K9PA 3ZN0A 3VQYA 5E1AC
chains in the Genus database with same CATH topology
1WP8A 4NTWA 4FZ1A 4FZ0A 4NYKA 3IJ4A 3S3XA 4NTXA 2L35A 3N27A 1WP7A 3S3WA 2FB5A 4NTYA 2QTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP8 A;  4NTW A;  4FZ1 A;  4FZ0 A;  4NYK A;  3IJ4 A;  3S3X A;  4NTX A;  2L35 A;  3N27 A;  1WP7 A;  3S3W A;  2FB5 A;  4NTY A;  2QTS A; 
#chains in the Genus database with same CATH topology
 2PI4 A;  1NTK H;  3WU2 Z;  1Y4M A;  3RWR D;  4WBN A;  5IY5 B;  2PF4 E;  2Q7G A;  1EBO A;  5LYJ A;  5LGN A;  1XL6 A;  3K5M A;  3G80 A;  3CJH B;  3KCX A;  4TUY A;  4QNH B;  4O2B B;  4JV5 B;  2P4V A;  4YIP A;  1VQN V;  3MAQ A;  2W6I G;  1N36 B;  1MSD A;  2LW1 A;  2OIE A;  1M57 C;  5LP6 C;  2UUA O;  3T1Y B;  2F1M A;  5JH7 A;  4WFB V;  1JOY A;  5GON A;  3LDD A;  2Q7H A;  2WA4 A;  5LHG A;  2UXN A;  2QKS A;  1ZUQ A;  2EZO A;  4X62 B;  1SQP H;  4L8J A;  3ZX6 A;  2QM7 A;  1OCZ B;  1TUE B;  1JPX A;  1PL4 A;  1K5S A;  2QWQ B;  2XTA A;  1BGY H;  3LDC A;  2CTR A;  4TT3 G;  2F23 A;  3OMN B;  2HEP A;  1WNS A;  3CCE V;  3GVM A;  2KQX A;  3D36 A;  3A0H Z;  4PA9 A;  1XI1 A;  5CA1 A;  3B09 A;  3G67 A;  4WCE V;  1YIJ V;  4QGP A;  1SZT A;  1NS1 A;  3TXS A;  4ZOL A;  4JI7 O;  1VQ6 V;  3ZRS A;  2VRZ A;  3DXR B;  2FYU H;  3JAT A;  3NR7 A;  4DV2 B;  3K03 A;  3KCY A;  3CCU V;  1R3K C;  4BR6 A;  2CGN A;  4HNA B;  3A8T A;  1KU9 A;  4UVC A;  1SKV A;  3QO8 A;  1CEZ A;  1HNX O;  1XMQ B;  4DV2 O;  2ZNJ A;  3H01 A;  3SJA C;  3ZHS A;  4YJ3 B;  5EK0 A;  4O2A B;  1H2K A;  1YSC A;  5JQG A;  1OCZ C;  2DN9 A;  3DXR A;  4X65 O;  4B3T O;  2CH7 B;  4MS2 A;  1V9P A;  2B9Z A;  2KG7 A;  3IAY A;  3FAV B;  2ZD9 A;  5FL7 G;  4CS3 A;  3H1I H;  4IIJ B;  4CH3 A;  2OCH A;  1YIT V;  2EZP A;  2CGO A;  4X8A A;  4IYH A;  2Q68 A;  1AI7 A;  2H3O A;  2A3Q A;  1JJ2 U;  3ETQ A;  4KHP O;  4LF4 B;  1P4R A;  2N05 A;  1LUV A;  2ZIN A;  4H13 B;  1S5L Z;  2YUA A;  2UXB O;  4J7J A;  3ZIA G;  1OCO B;  4HAM A;  5ITZ A;  2RMK B;  1F7Y A;  4ZOL B;  4FLW A;  1Q82 W;  3A0B Z;  3CEI A;  1B04 A;  5TIS Z;  3OUS A;  2UUB B;  4EB6 A;  3JCU Z;  3UO3 A;  4OPA A;  5JWP A;  1H2S B;  4PHZ A;  4RUF A;  4FVM A;  1GKF A;  2E3C A;  4G2K A;  4D7S A;  1F51 A;  2Q6A A;  2ARH A;  2IH1 C;  3GWO A;  1VEW A;  1RSO B;  3UQ8 A;  1H2N A;  1SF9 A;  2Y4U A;  1JR9 A;  2OTJ V;  2EIJ B;  5HFL A;  2D3O W;  2FKX A;  2PTM A;  5JCO A;  2ZDI A;  4LH7 A;  2ZXW C;  4MSW C;  4JI2 B;  1KB9 F;  2EJ7 A;  2Q0A A;  1HNX B;  2HHH O;  5IJ9 B;  4J7Z A;  1I0H A;  5H9C A;  2JEU A;  5IDJ A;  2ZXW B;  3DC6 A;  1ZLZ A;  1W59 A;  4O2B A;  1MZE A;  3FB8 C;  4TUY B;  3RYC A;  4H0L B;  2ADQ B;  1BHA A;  2LGW A;  2P5O A;  3OE7 G;  3CCJ V;  1Y74 A;  4I50 B;  3OFN G;  3CWB H;  3K5O A;  4DR7 O;  5JJJ B;  1NH2 B;  5LMU O;  5LHH A;  4NVP A;  4DR5 B;  4MTG A;  2HP8 A;  1KKC A;  4LBE C;  5B66 Z;  1E1Q G;  2K1E A;  1Z5V A;  5H6R A;  2BOC C;  3BA9 A;  4DV7 B;  3VOU A;  1O9H A;  1CXZ B;  1V54 B;  1GN4 A;  4NXN O;  1KUQ A;  2ITD C;  3E35 A;  3D36 C;  1R73 A;  1AJN A;  2XND G;  3AG1 B;  4IIJ A;  4AI8 A;  2IU3 A;  1VF7 A;  2VS0 A;  1OZ0 A;  4LF5 O;  2KG7 B;  3ZMS A;  4CH5 A;  4J11 A;  4EFB A;  5A9G A;  4YJ2 A;  2OTL V;  1SET A;  1COW G;  4O4L A;  4QPJ A;  1HW7 A;  3BHP A;  2EJR A;  1Q3E A;  5J9P C;  4FZ0 A;  1PV0 A;  2HJD A;  3B40 A;  4BW5 A;  4W4K A;  4LF9 B;  4BIU A;  1AR5 A;  5EBW C;  3CYO A;  5LBQ A;  2YI8 A;  4K0K O;  3ETD A;  4I9Q A;  1TUB B;  1PL0 A;  3H1K H;  4ICG A;  1I7F A;  1S0V A;  4LNU B;  1GH6 A;  3O65 A;  1THZ A;  1NT2 B;  1V54 C;  2RDC A;  5LGT A;  2HVK C;  1Y76 A;  4JTD B;  4J9Y B;  1S3J A;  2JJ2 G;  3THO A;  3SJC C;  3CPW U;  4XDK A;  3FKS G;  3SYP A;  1VQ9 V;  1V55 C;  3H1L H;  3KZI Z;  4JI4 O;  3QO5 A;  1WAZ A;  1VMG A;  1FKA O;  1SA0 B;  1DF4 A;  4CS2 A;  2B5U A;  1VQ5 V;  2HR3 A;  5CMU A;  1IBL B;  2XAQ A;  5IYZ A;  4LF7 O;  4BIZ A;  1VQ4 V;  1NR7 A;  1G4Y B;  4R6Z A;  3SJB C;  4WBN B;  4DV6 O;  3K0G A;  4B3S B;  3UKM A;  2Y48 A;  5FLX N;  4DV0 O;  1FXV A;  2F43 G;  4DR3 B;  1QU7 A;  3ZMZ A;  2JJ1 G;  3RYI A;  3LSQ A;  3P30 A;  1YXB A;  2HLD G;  3TXQ A;  1VF5 B;  1GN2 A;  4RWU A;  2QSA A;  1S77 D;  3CRR A;  3WB0 A;  5IYC O;  1DF5 A;  1SQV H;  2IH3 C;  5IYZ B;  1K7D A;  1URF A;  3OT7 A;  1QQC A;  1KC8 W;  3CP1 A;  1FFT B;  4TSF G;  5HFM A;  2L6L A;  3UT5 A;  3JAS A;  4X20 A;  1DTO A;  1M93 A;  4JZG A;  3OM3 B;  5LP6 B;  5C8Y A;  1EM1 A;  2AZ0 A;  1VQ7 V;  2QE7 G;  3JSL A;  3CHX A;  5LXT A;  3AG2 B;  4MTF A;  4MVS A;  5CBG A;  3K3W A;  1P84 F;  3MDS A;  1N34 B;  2QTS A;  3OMI B;  5E79 Z;  2HKO A;  2Q67 A;  3E89 A;  5EBM C;  3IC9 A;  4GT1 A;  4P30 A;  2Q69 A;  2Q0O C;  4JTA B;  2GSM B;  1K8A W;  1TGO A;  5KLV H;  2GDS A;  1BQZ A;  1L0N H;  4QJF B;  3IFX A;  1GK9 A;  4CC6 A;  4JYY A;  1QR9 A;  5KX5 A;  1SQQ H;  4B3M B;  2R9A A;  1N33 B;  5BMV A;  4UB6 Z;  2UUA B;  2BCC H;  5A2Q N;  2QWO B;  3A2F A;  2FB5 A;  3JAK A;  1NJI W;  3AK2 A;  1AP6 A;  1HDJ A;  3BEH A;  1XL4 A;  4PD4 F;  2WLI A;  4JTC B;  4GX0 A;  3FB5 C;  4TV9 A;  1X4T A;  3TK1 A;  3HKB A;  4DUY B;  1OCR C;  1T5E A;  3BAB A;  1XMO B;  2XAG A;  4J7K A;  1NKD A;  3J81 N;  1A32 A;  2QKC A;  4O4J A;  1OCC C;  2XOK G;  2X6A A;  4I4T A;  2N74 A;  1UJW B;  1JX9 A;  4W4L A;  4LH6 A;  1AI6 A;  2WPD G;  2A06 H;  3QF7 A;  1HNW B;  1PPJ H;  2EIL B;  1D2D A;  4MVU A;  3BVO A;  4DV3 B;  1M9N A;  5L3F A;  3K57 A;  3UT5 B;  5B5E Z;  2EIN C;  1Z5W A;  3KG2 A;  2DQ0 A;  1G6U A;  1XNR B;  1ROP A;  5LOV B;  4WF9 V;  3DGE A;  1HNW O;  2O57 A;  5IE9 A;  4PDR A;  4WFE A;  2E75 B;  5LMN B;  4N21 A;  4J41 A;  3RYC B;  4YY3 B;  1KMI Z;  1VQL V;  3OD4 A;  3B8M A;  4PI0 A;  5K1P A;  2LFS A;  3ZHT A;  3W7S A;  4NTW A;  2R72 A;  1P49 A;  2L35 A;  3HPL C;  4I5S A;  1K92 A;  4ZHQ A;  5GTH Z;  1JQ0 A;  1JFF B;  3SPI A;  2QGN A;  4NXM O;  1LR1 A;  1NU1 H;  5EBL C;  4RAI A;  2IBZ H;  4RQF A;  2QWN B;  3RGB A;  5KHI A;  3E8G A;  3W7T A;  1VQK V;  3LNM B;  1RSO A;  1K9M W;  2VWK A;  3E8H A;  1P7G A;  3QTC A;  1QVF U;  3T4D A;  3F7V C;  1EZJ A;  1WP7 A;  2QDO A;  3FFQ A;  3EFF K;  3FYI B;  2QKA A;  5JJE B;  1BCC H;  1BS3 A;  2XT9 A;  4RUE A;  3ASO C;  2GTS A;  5EZY B;  4FJC C;  2BSK B;  4X9Q A;  2NNU A;  3STL C;  2GUZ A;  3F7Y C;  3SPG A;  1GM9 A;  2VWJ A;  4O4H A;  4FLZ A;  3MHS C;  1RM1 C;  2ZE7 A;  4DV3 O;  1GTO A;  4JI3 B;  2ZM6 B;  5LL6 Y;  1MZF A;  1HP8 A;  3AG3 C;  1XNQ B;  1OJH A;  2P7T C;  1EFR G;  1JA8 A;  3CME V;  3RVY A;  1TVK B;  3B4S A;  1YHQ V;  2Q4P A;  3ASN C;  4N23 A;  2DMX A;  3FAV A;  5EC2 C;  4PEL A;  1SQX H;  2QEX V;  4JI2 O;  1YEW A;  4F4L A;  3ABM B;  3L70 H;  4CBC A;  4KHP B;  4O2A A;  4YJ2 B;  5CN0 A;  1N0J A;  2EIK C;  3N2G A;  3HKE B;  5EIB D;  4FZ1 A;  3RYF B;  3ZHR A;  4X88 A;  1NI8 A;  2YEV A;  4HBN A;  3H1H H;  4AQY O;  4JI4 B;  4X66 B;  4JZ2 A;  2E76 B;  2R9R B;  4JAU A;  3ZRW B;  4LF9 O;  1EN6 A;  1AI4 A;  2YXL A;  1NZ6 A;  2JGD B;  3HB3 B;  3IGA C;  1AR1 B;  2AZ2 A;  3K9A A;  2QR4 A;  2NR5 A;  1W0J G;  5EIB C;  1R6K A;  1JCH A;  3JD3 A;  3RYH A;  1M5I A;  2YIB A;  2W0X A;  4FMT A;  4GLX A;  3OEE G;  3E2E A;  1XBL A;  3STZ C;  4HZ3 A;  5L3B A;  1WB8 A;  4PDM A;  2GBO A;  4FPP A;  5BR8 O;  4OGQ B;  1K73 W;  4EEQ A;  4X1K B;  2B1G A;  3DSQ A;  5IJ9 A;  3ML0 A;  5B1A B;  5JH7 B;  3K5N A;  4LP8 A;  4DR5 O;  1XMO O;  2DWD C;  1YDX A;  4LC1 A;  4JI6 B;  3I55 V;  1DLB A;  4U7O A;  3S3W A;  3MHH C;  1OV9 A;  3CJH A;  4DUZ B;  1YI2 V;  4F6E A;  1ZAU A;  3ICX A;  1VIB A;  2VQF B;  4JI0 B;  3FYE B;  2X6B A;  4ZIB A;  4OPH A;  1E79 G;  2YXY A;  3T1H O;  2WAM A;  3JAL B;  1S76 D;  4LWS B;  4LFC B;  3TJT A;  2E5L O;  3NXS A;  4ZI7 A;  4MVR A;  5ITZ B;  5IWA B;  3I56 V;  2WLL A;  1FXK C;  2LP7 A;  4CH4 A;  3CRA A;  1XIL A;  5AG2 A;  4IHJ B;  4UCO A;  1TA8 A;  3JAR B;  5KMG A;  5IJ0 A;  1RM1 B;  5CA0 B;  4LFC O;  5DN6 G;  4H44 B;  4LF7 B;  1GM8 A;  1Z2G A;  3OMA B;  1V55 B;  2PY5 A;  4LF8 O;  5IWA O;  5B1A C;  3WG7 B;  4B3S O;  4RO2 A;  2JRI A;  3QG5 A;  5L3E A;  2V7Q G;  4K8Z A;  4K0K B;  3RYH B;  1H2G A;  1BT8 A;  5D5P A;  4ABM A;  2QA4 V;  1L8D A;  4O4I B;  5K1X A;  4I7Z B;  4IYI A;  1Q8I A;  1KD1 W;  3TCU A;  4JI8 B;  1AVM A;  3N2K B;  2JGD A;  3OTO O;  2W6J G;  2DWE C;  4JAS A;  1H8H G;  4LFB O;  4MVM A;  1HWY A;  1RPO A;  4FLV A;  3OR7 C;  4JI5 B;  2YEV B;  4X64 O;  2VQF O;  3CXC U;  1WPX A;  4B7K A;  1R3L C;  4DRX A;  1YCI A;  4DV1 B;  1U96 A;  2AHZ A;  2P6J A;  3ZBH A;  1YJN V;  4JI8 O;  2M7W A;  5BXZ A;  3WFV A;  4B08 A;  2RJZ A;  2AGA A;  2UXC O;  1FJG B;  5CA1 B;  2ZIM A;  2YC0 A;  3UO2 A;  1GO3 F;  2QM8 A;  2UUB O;  3CC7 V;  4DV1 O;  4DV6 B;  2G38 A;  1B3Q A;  5CBH A;  3I5D A;  2YDE A;  3U0Z A;  2V1D A;  3JD2 A;  1GMG A;  1N34 O;  1M57 B;  5CA0 A;  4DV5 O;  5KMG B;  1OCO C;  3K5L A;  3CC2 V;  4UCS A;  2EX3 A;  4IHJ A;  3W7W A;  5F2V O;  3RVZ A;  1M4U A;  4JPR A;  2WLL B;  5JVD B;  3OW2 U;  2CTQ A;  4LF8 B;  3UM7 A;  3OGC C;  2QTO A;  3KKY A;  4J80 A;  5GW7 A;  3UCS C;  3RT3 C;  2BSK A;  3VBB A;  2CTW A;  4R8C A;  1PNM A;  1Q6H A;  1NH2 D;  3OAA G;  2HHH B;  1FAF A;  4JAA A;  1Y67 A;  5LYJ B;  1TAE A;  4U7N A;  2X0L A;  1HNZ O;  5BZB A;  1VQO V;  1SES A;  4TOI A;  2DYR C;  3AG4 C;  3HR0 A;  4UVB A;  4X64 B;  2Y0I A;  3X2Q B;  4BIO A;  2LO1 A;  4DW1 A;  4NYK A;  4P2Z A;  5J2U B;  1WA8 A;  4X1K A;  4UCR A;  5LA6 B;  1GN3 A;  3CCM V;  2IM9 A;  1FXK A;  2A79 B;  1N4C A;  4MVZ A;  3SYA A;  3CCS V;  3SYO A;  4U3J B;  1ZX3 A;  1XNR O;  2CE4 A;  2F95 B;  2XHB A;  1Y66 A;  3HKC A;  5EYP B;  4A5U B;  1SQB H;  4P9P A;  1M56 C;  2XAJ A;  4JYC A;  2YI9 A;  1KKD A;  3LSS A;  1XHZ A;  1L0L H;  4WFH A;  4DUY O;  1QLE C;  2M6Y A;  3O9O A;  1VP7 A;  3JAW A;  1LUW A;  1BMF G;  3ETE A;  2QJ1 A;  2JDI G;  4GCZ A;  2P67 A;  3M99 B;  3ZMT A;  4CH6 A;  2QWP B;  3D3I A;  1KEC A;  1P7B A;  1WN7 A;  1VQ8 V;  4XDJ A;  5LGU A;  3ABK C;  4I55 A;  4YIO A;  1N36 O;  4I0X B;  2FL4 A;  3Q4H B;  4Q6G A;  3CCL V;  2H94 A;  2OIG A;  3IJ4 A;  4PA7 A;  3BCC H;  4LFA O;  2P4K A;  2PYL A;  3OR6 C;  3JAM N;  4FLU A;  2Q5Z A;  4E4E A;  1FFX A;  3APO A;  1MMM A;  2DW4 A;  3BRC A;  5J2T B;  4DV4 O;  3ZS8 C;  2P90 A;  2LQT A;  5KAF Z;  2PI5 A;  2QWR B;  3JAK B;  3G4S V;  4YHH O;  1N32 O;  2UUC O;  5BMV B;  1PNL A;  2WLM A;  2WWW A;  2BTQ A;  3BPZ A;  3VQX A;  2JVD A;  2Z3Y A;  3ZMV A;  1FD9 A;  4PI2 A;  3W7X A;  2JIZ G;  1WP8 A;  1RFY A;  4I55 B;  5L3G A;  5EYP A;  3G71 V;  3DTU B;  1VQP V;  4NXM B;  3G6B A;  4UXN A;  5LXT B;  4F6R B;  1ZTE A;  5DEC A;  1FXK B;  5LP6 A;  2ZDI C;  3SPC A;  2YIA A;  4TV8 B;  4GX1 A;  2Y69 B;  2UXX A;  1K97 A;  4MTO A;  1YJ9 V;  5H2F Z;  4GKK B;  1B6Q A;  3RFR A;  4FM2 A;  1S5H C;  2FML A;  1RPR A;  4EKW A;  2XUM A;  2UU9 B;  3C3T A;  4YXW G;  5LA6 A;  1NTM H;  1IBM B;  1JFF A;  1WA8 B;  5IY5 C;  3AG7 A;  5DED A;  3ZED A;  4D7T A;  1I08 A;  1FJG O;  1XRE A;  5KA6 A;  1UPG A;  1XDC A;  2EUL A;  1DGS A;  2ADP A;  1YZB A;  1ZL8 A;  4DR4 O;  2ZQM A;  1IBK B;  2Q73 A;  1YTF D;  3QNE A;  1AP5 A;  3F5T A;  1NVP D;  2GV9 A;  2JS3 A;  4GX2 A;  1US6 A;  1MG1 A;  4WFF A;  3DC5 A;  1QNM A;  5KHK A;  2ZNI A;  1E1R G;  1SA0 A;  4JAV A;  3A0R A;  1XMQ O;  1SRY A;  4LF6 O;  1G1X B;  4F6R A;  3FB7 C;  4PA4 A;  3CCQ V;  4X1I B;  3E8F A;  1VF6 A;  3OEH G;  4PA6 A;  1MOF A;  4B3M O;  1KBH A;  2DYR B;  4FLY A;  4JI6 O;  3N27 A;  1Y76 B;  1Q86 W;  1I5Y A;  3ABL B;  2UXD B;  4I4T B;  1J5E O;  2WLJ A;  3VQW A;  1HNZ B;  2PUS A;  1M1K W;  2DYS B;  1ZSP A;  4PA3 A;  1SC5 B;  2EIN B;  2MW2 B;  1ARO P;  2KSD A;  1IDS A;  2ZE6 A;  2PYJ A;  3Q4H A;  1K3E A;  2Y69 C;  4I0X A;  3OTO B;  3B77 A;  2B1I A;  4LFB B;  2Q9L A;  3L74 H;  1J5E B;  2N04 A;  3ZHU A;  5J2T A;  3P3P A;  3K04 A;  4X1Y A;  1OCC B;  1FFX B;  3OUF A;  1XNQ O;  4CZZ A;  4O4I A;  5IT9 N;  1JMK C;  3P32 A;  3H9V A;  4P9O A;  1Q5O A;  3R65 A;  3CXH F;  2LFR A;  2R9I A;  2YIC A;  3HKD A;  2HJF C;  3ASN B;  4Z2W A;  4QIW F;  1Q6I A;  1QR8 A;  3ABL C;  3SYC A;  1XUQ A;  2WSS G;  1EZV H;  2BE3 A;  3N2K A;  4U3J A;  4B3T B;  4PDL A;  1M90 W;  4PDV A;  1PP9 H;  1FXH A;  3JAW B;  3EHB B;  1BL8 A;  4GX5 A;  1MNG A;  3ZMU A;  5J2U A;  3E86 A;  2VQE B;  2A0L A;  2YXH A;  2KB1 A;  2HG5 C;  4DR1 O;  3E8B A;  3ZRV A;  1MSW D;  4WFA V;  4AQY B;  1M56 B;  5FPR A;  3MD0 A;  5B1O A;  2UXD O;  4TQD A;  2UU9 O;  2ZKO A;  3ZRX A;  1NVP B;  5L3C A;  4QPK A;  3TET A;  3K0D A;  1VF6 C;  4MW3 A;  3BAA A;  2UXB B;  2H8P C;  4FFK A;  3JD0 A;  4DK1 A;  1YJW V;  3APQ A;  2F4V O;  5CB4 A;  3EXA A;  4LWS A;  3JAL A;  3H1J H;  4PJ0 Z;  2ZIO A;  4U3F H;  1IX9 A;  1H2M A;  1J95 A;  2YSU B;  3AG1 C;  5LHI A;  3WG7 C;  1CP9 A;  5JVD A;  1ORQ C;  3AG4 B;  2RCV A;  2ZE5 A;  4JYB A;  5B1N A;  3E22 B;  5BR8 B;  1BQ0 A;  4EFE A;  4MW8 A;  4CC5 A;  1K4D C;  2CUG A;  4YY3 O;  1IVS A;  2D2C B;  2YS8 A;  4K35 A;  4FIP C;  4I9W A;  4MVQ A;  1XEQ A;  1H8E G;  2FTK A;  3SYQ A;  2RN9 A;  4EB6 B;  2Q8V A;  4LF6 B;  4Z1V A;  1OCR B;  4DV4 B;  2Q7E A;  2EIL C;  3K79 A;  4MT8 A;  3OGI B;  3CS5 A;  1F4N A;  1K4C C;  2EIM C;  2JEX A;  4UCU A;  4G27 B;  4DRX B;  1RP3 B;  2OWO A;  3L72 H;  2JK5 C;  4TWK A;  2AHY A;  4KXR A;  2NLJ C;  4J42 A;  4FLT A;  1TUB A;  3HKD B;  3EVK A;  1IBM O;  2E5L B;  1WLE A;  3ZHV A;  3CE2 A;  4CS4 A;  1QVG U;  3K06 A;  4DR6 B;  2BTO A;  4E2L A;  3N2G B;  1K34 A;  4KP4 A;  2F4V B;  2CH7 A;  2OCC C;  1O9G A;  2EIM B;  5B3S C;  1IUR A;  4NXN B;  4LFA B;  1MAB G;  2EBO A;  3D3Q A;  4XDL A;  2YIB D;  4YJ3 A;  4FM1 A;  3SGI A;  1BZK A;  3CX5 F;  4H33 A;  3M8A A;  4IT5 A;  4AIL C;  1D5A A;  3T1C A;  2DOS A;  3CCV V;  2P22 C;  1N0N A;  4HNA A;  1B06 A;  3RYF A;  3CB2 A;  1SS3 A;  1AR4 A;  3HKE A;  2MK3 A;  4OX9 B;  3CSX A;  3JAR A;  2LW7 A;  4X89 A;  3AG3 B;  1BSM A;  1QBZ A;  5EC1 C;  2XAS A;  2LGQ A;  3FX7 A;  5JCO C;  4DR2 B;  3K58 A;  4X1I A;  4MVO A;  4ZKI A;  4NR1 A;  3M7M X;  3W7U A;  4ZI7 B;  4GUN A;  1GN6 A;  3GB7 C;  2HFE C;  4DO2 A;  3ASO B;  1IXM A;  4BWA A;  3S3X A;  4DW0 A;  2F93 B;  4FLX A;  3ZHQ A;  4JI5 O;  4WFG A;  2CK3 G;  4J10 A;  1VQM V;  2PGG A;  4DR1 B;  4R7C A;  3BY6 A;  2IJH A;  2WLK A;  3PJS K;  3CRC A;  2RQ6 A;  1LNQ A;  3CRM A;  2XAF A;  1F4M A;  3E22 A;  3IC7 A;  3LSU A;  4BW9 A;  1PD3 A;  3R66 A;  4K3A A;  3PN1 A;  3LUT B;  4BAY A;  5B1B B;  2ZR3 A;  3SPJ A;  4UCT A;  4DUZ O;  2ZCE A;  3D8C A;  5KUK A;  5LMU B;  4UCV A;  5D5Q A;  3ZN1 A;  1FS0 G;  3J80 N;  4JI0 O;  5GON B;  5CB4 B;  3AEI A;  4ZHQ B;  2X7R B;  3T1H B;  3K08 A;  4L87 A;  1VAR A;  4J9Z B;  1NBM G;  3ABT A;  4DV7 O;  1SER A;  3SR2 C;  5B3S B;  1R1B A;  5GTI Z;  2JS5 A;  1Q6U A;  4NTY A;  5H5N A;  4DR3 O;  4GKJ B;  2QM4 A;  5FPO A;  1IXB A;  3RN4 A;  3J7A U;  4XBF A;  1NR1 A;  4OX9 O;  4NB5 A;  2IU0 A;  1FPO A;  4JF3 A;  4X66 O;  2ZR2 A;  1GRJ A;  4Z1M G;  4X65 B;  2Z5U A;  3CC4 V;  1AI5 A;  5B1B C;  4NKG B;  2ATK C;  3B2E E;  4G28 B;  3U10 A;  4UV8 A;  4DYL A;  4GZR B;  1KQS U;  3SJQ C;  2YID A;  2A9H A;  4JGS A;  1NTZ H;  1CPY A;  2IJI A;  1N8R W;  4DK0 A;  4AHC A;  1S72 V;  2ODM A;  3U11 A;  3T1Y O;  4QE9 A;  1H2L A;  1UFI A;  1BHB A;  4UFZ A;  3CD6 V;  1Q81 W;  1I5X A;  3C3S A;  4TV9 B;  2BTQ B;  4Q20 A;  5C93 A;  4GYC B;  4H37 A;  4X1Y B;  1I94 O;  4X62 O;  5IYD O;  5JQG B;  3G6E V;  5JJN B;  1NQT A;  3GWK C;  1WJZ A;  4DR4 B;  3ZRW A;  5FNV B;  2OCC B;  3CCR V;  1XOU A;  5KAI Z;  3LNN A;  1QCE A;  2ITC C;  3K59 A;  4K8X A;  3P3N A;  5IYB O;  3AK3 A;  2AW9 A;  3HKB B;  2LJ2 A;  4DR2 O;  2OT5 A;  2ILM A;  2WLI B;  4LR3 A;  4GKJ O;  2C2A A;  3RW0 A;  3JAT B;  4OXS A;  3JD1 A;  1AIL A;  1R3J C;  3RBZ A;  1KYO F;  4PV1 B;  4RQE A;  1PKX A;  1WPB A;  5CA3 A;  5KX5 B;  4B7E A;  1F23 A;  1SQF A;  4X20 B;  2JGU A;  2HVJ C;  3JAS B;  4FK5 C;  1Q7Y W;  1TVK A;  1AJP A;  1YTF B;  3E83 A;  2CAZ C;  1YF2 A;  3BFR A;  3ZJZ A;  1R6T A;  2KKW A;  2EIJ C;  4UVA A;  3X2Q C;  2EIK B;  3L75 H;  1D5N A;  5KHJ A;  1XHX A;  1ENV A;  4JYA O;  4DR6 O;  2ETN A;  2F66 C;  2IJK A;  5CBF A;  1ZL8 B;  1W2B U;  4O4H B;  2P06 A;  2UUC B;  1SQG A;  3QVN A;  2GUZ B;  5BY1 A;  1I94 B;  2CDY A;  5EZY A;  3K9S A;  1KP3 A;  3RYI B;  1AB3 A;  1ZWI C;  3JYC A;  4IL6 Z;  2UXC B;  2PZS A;  3AK1 A;  1JVM A;  5KUM A;  4B3R O;  2DQ3 A;  5KHG A;  5LMN O;  1EN4 A;  4KFM A;  1S5J A;  1SZX A;  2BOB C;  3QO7 A;  1Q90 D;  4DV5 B;  3JD4 A;  3T2M A;  1MA1 A;  4LCU C;  5L3D A;  3WB2 A;  3T4Z A;  4LF5 B;  1H38 A;  1K5Q A;  2X6C A;  4ZBM A;  1W0K G;  5LOV A;  5H6Q A;  2CTP A;  2IJJ A;  3B8N A;  2GTA A;  4TV8 A;  1IBL O;  3L71 H;  1K33 A;  2DYS C;  1XQ8 A;  3F5W C;  5KA5 A;  2VQE O;  3JSN A;  4DR7 B;  1N33 O;  4ASU G;  2AXT Z;  1U97 A;  5DM6 V;  1PM9 A;  5KHH A;  1YVW A;  3TGU H;  1FYJ A;  1Y6X A;  4QE7 A;  1DK1 A;  3LDE A;  2E74 B;  4UV9 A;  2NN4 A;  4NTX A;  3ABU A;  2A7W A;  4LF4 O;  2IW5 A;  4FFB B;  4IGG A;  2W0F C;  4DXW A;  3ABK B;  1QLN A;  3L73 H;  3VQV A;  1IBK O;  4JI3 O;  3L9D A;  2ZM6 O;  4KUM A;  1JJO A;  4YHH B;  1N32 B;  1L1F A;  2WA3 A;  1GAX A;  4O4J B;  3C90 A;  3SPH A;  2DE0 X;  4UB8 Z;  1QLE B;  4UUJ C;  4LNU A;  4B3R B;  1G8M A;  2Y0P A;  3CMA V;  1IZ3 A;  4KL1 A;  4MTX A;  3CRQ A;  3FB6 C;  1AJQ A;  1BE3 H;  1OHH G;  3WB1 A;  2WLN A;  1WB7 A;  3FD9 A;  1Q43 A;  2R70 A;  5FNV A;  4FM0 A;  2GHY A;  3JCZ A;  4HYO A;  1R3I C;  1HR0 O;  5C8Y B;  1EN5 A;  4DV0 B;  4O4L B;  2XAH A;  4D6T H;  1GM7 A;  4FFB A;  4C7U A;  4JI1 O;  2RNB A;  3HKC B;  2V4D A;  1HR0 B;  4R50 A;  3OTF A;  2Z0A A;  3ABM C;  5IJ0 B;  1Y74 B;  4I50 A;  3ETG A;  3AG2 C;  1PNK A;  2ZT9 B;  2WLH A;  4GKK O;  4JI7 B;  3SDL A;  1R6N A;  1QHT A;  2OYQ A;  2Y4T A;  4JI1 B;  3ZCC A;  4JYA B;  1X59 A;  3BA8 A;  2ZE8 A;  2DJV A;  1KP2 A;  4JV5 O;  4TQF A;  2K9P A;  3ZN0 A;  3VQY A;  5E1A C; 
#chains in the Genus database with same CATH homology
 1WP8 A;  4NTW A;  4FZ1 A;  4FZ0 A;  4NYK A;  3IJ4 A;  3S3X A;  4NTX A;  2L35 A;  3N27 A;  1WP7 A;  3S3W A;  2FB5 A;  4NTY A;  2QTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...