2L35A

Structure of the dap12-nkg2c transmembrane heterotrimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for intramembrane assembly of an activating immunoreceptor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords DAP12-NKG2C_TM
total genus 19
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 2l35A00
4NTWA 4NYKA 4NTXA 4FZ1A 4FZ0A 2FB5A 1WP7A 2L35A 1WP8A 3N27A 4NTYA 2QTSA 3S3WA 3IJ4A 3S3XA
chains in the Genus database with same CATH superfamily
1YIJV 1F7YA 4JTDB 4PA4A 3A0RA 2QE7G 4PHZA 4R7CA 4MS2A 1Q82W 1S3JA 1H2SB 1AR5A 2QTOA 4DR2O 5H6QA 3RYFA 1FS0G 5CB4B 4CH6A 3F7YC 5IY5C 1PV0A 3ABTA 5IWAO 4WFEA 4CS3A 5BR8B 4UCOA 3RBZA 1WB7A 2B9ZA 4LFCO 3E2EA 3OUFA 1BCCH 1NR1A 3IAYA 5JVDA 4DR7O 3KCXA 5KUKA 2EJRA 4GLXA 4JI6O 1NH2D 1NTMH 2MW2B 4WFGA 4J7JA 2QM8A 3GWKC 4TV8B 1D2DA 4CH3A 2JRIA 3S3WA 4X66B 2P67A 3ZRXA 4AQYO 3A0HZ 4DO2A 2GTSA 2HHHO 4JI0O 4LH6A 1Y66A 3GWOA 3EFFK 1XBLA 2HVKC 5B1BB 3CMEV 1Y4MA 2WLIA 1NZ6A 3EVKA 4LF4B 2R9AA 5TISZ 1Q43A 1JPXA 4PA3A 3DC6A 4TV8A 1S5LZ 4B3MB 2AGAA 3T4ZA 4K8ZA 2NN4A 4U7OA 3G80A 2YIBD 3FFQA 1I08A 3J7AU 3CC7V 3SPIA 4J10A 4JI1O 2BTQA 2DN9A 1QLNA 3RYHA 1M9NA 2RJZA 1TVKA 4E2LA 1J95A 4CZZA 1MMMA 3APOA 1IURA 1GN2A 3SGIA 3CSXA 4UVBA 1CXZB 2JS5A 3OT7A 1GH6A 1ZUQA 4YJ3B 3K03A 3TK1A 2WLIB 1VQ8V 1R3KC 1M4UA 3H1JH 4MTFA 4FLTA 4EB6B 3RVZA 5JCOC 4F6EA 2JJ1G 4DRXA 4F6RB 4L87A 4KUMA 5B66Z 3P3PA 3SPJA 3WFVA 3ZX6A 2XT9A 4PDLA 2IU0A 2LQTA 2QWNB 2UXNA 1JOYA 2HR3A 4DK0A 4MVUA 1QQCA 2Y69B 1Y74A 3ZRWB 2FTKA 2UXXA 3E83A 5B1BC 5AG2A 1EN5A 2EIKC 1N33B 1QLEC 2PI4A 1QR8A 5JCOA 4N21A 2IJJA 5EBMC 3H01A 5EC1C 1SQXH 1VF6C 2Q69A 3CRAA 2ILMA 5LMNB 1YEWA 1GTOA 1KQSU 3N27A 1S77D 4X64O 1B06A 1V55B 1XNQB 1FAFA 2ZQMA 4DR2B 3WG7C 4GX0A 3NXSA 4Z2WA 4LR3A 2XAQA 4FVMA 4NVPA 5EYPB 1L0NH 1TAEA 2PTMA 4OPHA 3W7SA 2Q4PA 2UUAB 5K1PA 1NBMG 5JQGB 1MNGA 4PI2A 5KMGA 3BPZA 3AG2C 3OR6C 1XDCA 4UB6Z 2LW1A 1G1XB 3LNMB 1N4CA 5KX5A 2YICA 4GCZA 4H44B 1FJGB 1AVMA 2EIJB 2F1MA 2YXLA 2HG5C 2B5UA 3SJBC 2ZKOA 5CA1B 4DUZB 4JYCA 5EK0A 3R65A 3CS5A 5D5PA 1S72V 3K08A 1PNMA 3Q4HA 3CE2A 3VQXA 3K0DA 2PZSA 1ZL8A 2EINB 4UUJC 2QTSA 2DYSB 1M57C 5GTHZ 4G2KA 1M56C 4IYIA 1S5HC 4CH5A 5CBHA 1WA8B 2QEXV 2P90A 2EZOA 4R8CA 2E3CA 1VQPV 2YXYA 2GDSA 3ABKC 2GUZB 2KG7A 1VQKV 2F4VB 4LF5B 1Z5WA 2WLKA 2QR4A 2AW9A 5LGUA 1W0JG 3HKCB 1K5QA 3ZN0A 1YF2A 4DR3O 4O4HB 4KHPO 4O4LB 4X1KA 3CXCU 1KD1W 2WLNA 2Z5UA 4UXNA 4UCSA 4X1KB 1OCZB 3T1HO 3DSQA 4I4TA 5LOVA 1FFXB 1BQ0A 1E79G 2PYLA 1GK9A 4FZ1A 2NR5A 1SETA 4ZOLA 4PI0A 2E75B 4O2BA 4O2AB 1KYOF 4LFCB 4HYOA 1EBOA 3PN1A 1RM1C 2ADQB 1GN6A 4LF7O 3E22A 1FYJA 3ZMSA 1H2LA 3SYQA 2R9IA 2UUCB 2X0LA 3E22B 1XEQA 2X6BA 4LP8A 4I9WA 4O4HA 2IH3C 3ZCCA 1P49A 5JJJB 1JMKC 2EIMC 5FL7G 2OT5A 5KA5A 3JSNA 3ML0A 1RM1B 1F51A 1MSDA 4BW9A 4LH7A 4FM1A 2CTPA 4JYAB 3APQA 2C2AA 5LBQA 4CC5A 2JEXA 4YY3B 3K79A 2Y4UA 1ENVA 4XDJA 1NJIW 3CYOA 1EM1A 5IYCO 1FXVA 5CBFA 1BL8A 4I50A 5L3GA 5LXTB 1HNWO 5JJEB 3K06A 1YITV 5CA0A 4B3MO 5LA6B 3G67A 1FXKC 4I50B 1Y67A 4DV2B 1HP8A 4UCUA 1H8HG 3ZHVA 1DGSA 2FMLA 4PJ0Z 4YXWG 2AHZA 3OEEG 1MG1A 5CA3A 3E89A 4JAUA 1L8DA 2QWOB 1CEZA 3OEHG 4FFBA 4GT1A 1GN3A 2Q6AA 2RN9A 4FMTA 4P9OA 4LWSA 1HNXO 2ATKC 5LGTA 4GYCB 2IU3A 4IYHA 5CB4A 1N36O 3JYCA 5LXTA 2DWDC 3VQYA 4A5UB 3BY6A 3DTUB 5LMUB 1AR4A 4NXMB 5IYBO 3FKSG 1HNZB 3AK2A 1YSCA 3KKYA 1SS3A 5IE9A 5IYZB 1HWYA 3SPGA 2UUBO 2CH7B 4FJCC 4PA7A 3AG2B 4MTXA 5GTIZ 2X6CA 3D3QA 1JQ0A 4JYAO 1O9HA 3WG7B 3K59A 1AJPA 4P2ZA 2JIZG 4U3JB 4RAIA 4DV3O 2Y48A 2BTQB 1SQQH 1NVPB 1N34B 2R72A 4LF9O 2QSAA 1VARA 3SPCA 1OJHA 1QNMA 1YCIA 1URFA 2VQEO 4TQFA 3TETA 3MAQA 2NLJC 2QA4V 1K92A 1XQ8A 1JCHA 1V54C 3JCUZ 3RYIA 2Y0IA 2ZDIA 3ZMTA 1HR0O 2EIKB 5BZBA 5EIBD 2ZR2A 4FIPC 3ZHUA 5LP6C 4P30A 4QNHB 4IHJB 3QO8A 4LF6B 3B8MA 3JD0A 4OPAA 4O4JB 4X20A 4BIUA 4D6TH 2ZT9B 1W0KG 5LL6Y 1K7DA 1Q6UA 3B4SA 4J41A 3P32A 4Q6GA 4JI8O 1QVGU 1GM8A 1Q5OA 5JH7A 3J81N 2LGWA 3G6BA 2ZM6B 2CK3G 2ZE6A 5LOVB 3SR2C 1ZSPA 4JF3A 5HFMA 1WA8A 2YIAA 3TJTA 1WLEA 3JALA 4CBCA 3OR7C 2UXBO 3ABKB 2YXHA 4JAAA 2EULA 1JA8A 2WLJA 1R6NA 5L3DA 4GUNA 1MOFA 2DYSC 1IXMA 5JJNB 4DUYO 2OWOA 1AP6A 3ETEA 3UT5B 2YSUB 4Z1MG 4PDRA 2F4VO 1XL4A 1UPGA 2H3OA 4UCTA 5LHHA 1I94B 1G6UA 1I5YA 2CH7A 4D7SA 2D2CB 2CUGA 3E86A 2Q7GA 3OGIB 5JH7B 4I4TB 3CJHA 3W7WA 1RSOA 2BOBC 4DV3B 2ZIMA 2EILB 3JCZA 1BE3H 4FLWA 2ITDC 2WLLB 5EBWC 3AG3C 2BOCC 3RYIB 1VQMV 2A0LA 3OAAG 1EZJA 1W2BU 4G28B 4X1YB 5CA1A 2Z0AA 4NXNB 4UVCA 3G71V 3W7TA 4EEQA 4FLZA 5IDJA 2MK3A 5H9CA 2ZNIA 2NNUA 1SQGA 3M7MX 3WU2Z 4B7EA 1GMGA 3SPHA 2HFEC 4X65B 4GKJO 3CCVV 1Q81W 4IL6Z 3CJHB 4BWAA 4EB6A 1I94O 3JARB 2YEVA 2VWJA 5KAFZ 1MA1A 2W0XA 1YZBA 5EZYB 3JARA 2A7WA 2CDYA 1F4MA 2P22C 3SYOA 1BHAA 1XREA 3P3NA 3H1KH 3B40A 2QKSA 1Y76A 2QWPB 3ZS8C 5IYZA 5KHIA 2P4VA 1IZ3A 2R9RB 4X8AA 3B77A 3L70H 2QDOA 3RWRD 3BRCA 3AK1A 1VQ6V 1HDJA 2DQ0A 5KX5B 4HBNA 3FX7A 4ZHQB 1BQZA 4DYLA 4FM0A 2OIGA 1KMIZ 4YJ2A 1KKCA 4DV4O 4DV6O 4DV7O 1IDSA 2WLHA 5DM6V 1AR1B 2UUBB 1OHHG 4DR3B 1N0NA 4J80A 3ZHRA 1SKVA 3IJ4A 3OFNG 4K8XA 2PGGA 4JI6B 3CCSV 1QVFU 4MTOA 3HPLC 1E1QG 4UV9A 4NTWA 3VQVA 3E8GA 3SYAA 3C3SA 1K9MW 3CRMA 1N34O 2AZ0A 4ZI7B 4CH4A 1V9PA 1WB8A 2LO1A 4TV9A 4IIJA 1IBMO 2DW4A 5BXZA 2BSKB 4GKJB 3IC9A 4ZBMA 3F5WC 4B7KA 4XDLA 1SA0A 4JYBA 2ZIOA 4LNUA 2VQFO 2QGNA 3FD9A 3VQWA 4DV7B 5DN6G 2EIMB 3FB7C 5L3BA 5C8YB 1D5AA 1JFFB 4LFBO 1ORQC 4NKGB 3ZHSA 1N32B 2H94A 3ZMZA 4JI0B 1GRJA 4MW8A 3CCLV 3AG4B 4UVAA 1K73W 2LJ2A 3M99B 3A0BZ 4DV5B 4FK5C 2WLMA 1QHTA 1AI6A 3MHSC 1TGOA 4FM2A 2LFRA 3JAKB 3O9OA 1K8AW 2PI5A 1Q6HA 2R70A 5BR8O 4MVRA 4J9ZB 1Y6XA 2DWEC 3CCUV 4KL1A 4FLYA 3H1LH 3K04A 2BTOA 4YIOA 1B6QA 2OIEA 1DF5A 4J7ZA 3AK3A 3CRCA 4QJFB 1WNSA 5LHIA 3CHXA 2BCCH 2FYUH 4KXRA 4ZOLB 2JJ2G 5B1AB 3JAWA 2GBOA 4B3RB 2JGUA 2ZM6O 1JJ2U 2CTWA 3F7VC 2YIBA 3KG2A 2QKCA 2ODMA 4X62B 3F5TA 3E8HA 3OM3B 2ZE5A 4J42A 1NTZH 4UCVA 3RYHB 5CBGA 1BMFG 1M56B 5JVDB 3AG1B 1TUBA 1FD9A 3D36A 5J2TB 1K97A 2PY5A 4X65O 1BT8A 1K34A 3A2FA 4Z1VA 1NS1A 1NT2B 3D3IA 4AILC 2JS3A 3K5NA 1GM9A 1HR0B 4CS2A 2VRZA 1PL4A 4RWUA 4K3AA 4MVOA 3QO5A 1OCRC 4Q20A 4LCUC 2PYJA 3LNNA 5DECA 4JI5O 2LGQA 3RT3C 4IT5A 2GHYA 1XNRB 3OD4A 1OV9A 1SRYA 1YXBA 1B04A 3T1HB 3FB8C 1PNKA 1SA0B 1N33O 4X1IB 1PD3A 3AG7A 2WPDG 2O57A 1HW7A 2QKAA 5IJ0B 4X1IA 3W7XA 1V55C 2Q7HA 4X1YA 1Z2GA 1RP3B 4TUYB 4O4JA 5FNVA 4AHCA 4ZI7A 2A06H 1MABG 5FNVB 4NB5A 3THOA 3K58A 4DV4B 2IM9A 4DV6B 2CE4A 1BS3A 1V54B 1R73A 5LA6A 3OE7G 1YDXA 2IW5A 5GONA 2Y69C 2JGDB 3FAVB 1SQFA 2V7QG 4GX2A 1XI1A 4FLXA 1OCCC 4B3TB 3HKBA 2YI9A 4NTYA 1H2KA 5KA6A 2ZINA 4JI2B 4QIWF 3SYCA 1LUVA 3CC2V 2QWRB 5KHKA 3L72H 4JI3O 2KB1A 4G27B 4GZRB 5B3SC 4FLUA 4JV5B 5H2FZ 4DR4B 2AXTZ 2YDEA 2PF4E 3FYEB 2JGDA 3FAVA 5C8YA 3JATB 4JAVA 4JI4O 3HKDA 5B5EZ 2Q9LA 2ZDIC 3UCSC 3RYCB 1J5EB 3K57A 1COWG 3FYIB 4ZHQA 5GW7A 5DEDA 4H33A 4JTCB 2GUZA 2KG7B 1I7FA 1YHQV 2UXCB 1IBKO 2W6IG 5CMUA 3ZHTA 2OYQA 1EN4A 4ASUG 2CGOA 4X62O 1KKDA 2EX3A 2OCCC 1AI5A 5ITZA 3SYPA 2N04A 1SC5B 2PUSA 1S0VA 4AI8A 1SESA 3K0GA 4HNAA 1R6TA 1DTOA 1RPRA 3JD2A 3LDEA 3D8CA 3K5MA 3UM7A 4DR1B 3X2QC 3CCRV 1SERA 4HAMA 2YEVB 2DYRC 2WLLA 4ABMA 4DW1A 1XMQB 3JD3A 1K4DC 1W59A 1XMOB 1ZL8B 3SDLA 1XUQA 1ZX3A 1NQTA 1U97A 1ROPA 2CTQA 1B3QA 3ABLB 2EJ7A 3RYFB 3HR0A 4OX9B 1HNXB 3HKEB 3AG4C 2QWQB 4K35A 3DXRB 2VS0A 3JD1A 3OW2U 2DJVA 1ZLZA 3OGCC 2P06A 3JATA 1DF4A 1WP8A 5FPRA 1KBHA 2DYRB 5L3CA 3RFRA 1KC8W 1GN4A 1JR9A 4DR7B 3ZHQA 2VWKA 5HFLA 5LYJB 1XHXA 4TWKA 3L74H 3I56V 5KLVH 1G4YB 3BCCH 2K1EA 1YVWA 2P4KA 3BAAA 1KECA 3DXRA 2XHBA 2OTLV 1UJWB 2RDCA 3T1YB 2EILC 2ZCEA 3ICXA 1WJZA 4MSWC 3ZMUA 3D36C 1X4TA 1T5EA 4JI1B 4IIJB 4JI7B 1S76D 1N32O 1TA8A 3E8FA 2H8PC 3ASNB 5E1AC 4EFBA 1RSOB 3E8BA 1YI2V 3CPWU 4TSFG 2A79B 3CC4V 2GV9A 2Y0PA 3UO3A 4DR1O 4RUEA 1PPJH 2F43G 1BGYH 1THZA 4JGSA 2IBZH 2QJ1A 4QPJA 1UFIA 4I9QA 4MVZA 1KUQA 4QGPA 3BFRA 1TUBB 2F93B 1F23A 1DK1A 2UU9O 1NVPD 1PNLA 3T2MA 4LF6O 4KHPB 1VMGA 3ZRSA 3ETQA 1P7BA 2K9PA 4FZ0A 1SQPH 4QPKA 3JALB 2IJIA 1QU7A 2Y4TA 2V4DA 1OCCB 4DV5O 3J80N 3H1IH 1AP5A 3SJQC 4XDKA 2IH1C 3BA9A 1AI7A 5FLXN 4I55A 2ZXWC 4TUYA 1G8MA 5KAIZ 4LF8O 2DMXA 4ICGA 4O2AA 2RNBA 4JI3B 5J9PC 3OTFA 3ASOC 2HJFC 1Q8IA 1WAZA 5H5NA 3L73H 3T1CA 1YJWV 1VP7A 2OCHA 4DV2O 1VQ9V 1XL6A 2Q73A 4DR6O 3UT5A 3VOUA 3BVOA 3X2QB 2B1IA 3I55V 2FB5A 3ZN1A 4NR1A 4EKWA 3CMAV 1LR1A 5BMVA 1IXBA 5ITZB 2Q8VA 1VQOV 4DR5B 2UXCO 5EYPA 3SJAC 4CC6A 5IYDO 1DLBA 3OMNB 2IJHA 4NXNO 1HNWB 2HVJC 1L1FA 5LGNA 3ABMC 4GX1A 3CCMV 4RO2A 4WFBV 1X59A 1NR7A 3CP1A 2M6YA 5KHHA 3ABUA 1WPBA 1KP2A 2UUAO 1QR9A 1R1BA 4DXWA 2GSMB 3JASA 3LSUA 1J5EO 2ARHA 4PDMA 1O9GA 4LNUB 1BHBA 3CB2A 4B3SO 4RQEA 1EFRG 1Y74B 3ZRWA 1N36B 2UXBB 4PELA 3NR7A 1H8EG 3R66A 3CRQA 4I5SA 3KCYA 4RQFA 1RFYA 3K3WA 1YJNV 4IHJA 4FFBB 2WSSG 3LSSA 2AZ2A 1AB3A 4DUYB 2ZR3A 2VQEB 3Q4HB 5B1AC 2E5LB 1PP9H 4UCRA 3QG5A 4MT8A 5GONB 5LHGA 3TCUA 4JASA 3EHBB 4J11A 1XNQO 5EIBC 3LUTB 2JVDA 5CA0B 2XAFA 4DR4O 1S5JA 3LDDA 4DR6B 5IJ9B 2XAJA 3ZEDA 4I55B 1JJOA 3ASOB 1ZWIC 3N2GA 1IVSA 2ZE7A 1VQ7V 3N2GB 4WFAV 2RQ6A 2ZXWB 4H37A 1Q86W 4LF9B 1K33A 4WF9V 2XTAA 2Q0OC 5KHGA 1NTKH 3GVMA 4DK1A 1H2GA 1F4NA 5E79Z 3ZJZA 2KSDA 2UXDO 1CP9A 1CPYA 1GKFA 2HHHB 1FFXA 3JASB 2XASA 4I0XA 3HB3B 2ZNJA 2LP7A 4U7NA 3RN4A 3M8AA 1VQ5V 1R6KA 3ZBHA 2N74A 3L9DA 1SZTA 1IBMB 1M5IA 3U10A 1FFTB 4LF8B 1E1RG 1QCEA 4FLVA 3OMAB 3QO7A 4H0LB 4U3FH 1XOUA 1IBLO 1Z5VA 4BAYA 4X66O 2QM4A 3WB0A 2Q68A 4I0XB 4DW0A 3ZMVA 3QTCA 3EXAA 5H6RA 2YC0A 3H9VA 2P5OA 1M1KW 3QVNA 4IGGA 1LUWA 3ASNC 1NI8A 4MVQA 4MTGA 5IJ0A 3BHPA 4R6ZA 4OGQB 3CCJV 3ABMB 5FPOA 1PL0A 3UKMA 1EZVH 4TV9B 2LW7A 2F66C 4W4LA 4NYKA 1SQBH 2QM7A 4ZKIA 3N2KA 1I5XA 1JX9A 3TXSA 3K9SA 2W0FC 5IJ9A 3BEHA 3B09A 1IX9A 2XUMA 3K5OA 1K5SA 4LC1A 5J2UA 4PDVA 2CTRA 4HNAB 3W7UA 4DR5O 1H2MA 3JAMN 1R3LC 5BY1A 4JZ2A 3HKDB 4GX5A 3U0ZA 4YHHB 3OTOO 2Q67A 3RVYA 4F6RA 1GM7A 3CRRA 2HLDG 4E4EA 3ABLC 4LF7B 3CCQV 4TQDA 1MSWD 3B8NA 2UUCO 3MDSA 2IJKA 3CEIA 1WP7A 1NU1H 1FXHA 4PV1B 1AI4A 2RMKB 1VF5B 1I0HA 4B3RO 5KHJA 1FXKA 2M7WA 4KFMA 2N05A 1R3JC 5KMGB 2HP8A 2Q0AA 4JI5B 5A9GA 3CXHF 4JI7O 3HKCA 4GKKB 3CD6V 3AEIA 4DRXB 5IT9N 1MZEA 1Q3EA 1FPOA 4JYYA 1P84F 1OCZC 1VF6A 5LMNO 2F95B 2Q5ZA 1K4CC 3BABA 4FFKA 3VBBA 5EZYA 4X9QA 1AILA 1VQNV 4YHHO 3B2EE 3ETGA 5IWAB 3OTOB 1LNQA 3FB6C 5LMUO 1GO3F 5D5QA 3DC5A 3C90A 3H1HH 2ADPA 3KZIZ 2W6JG 4TOIA 5EC2C 2G38A 3P30A 2P6JA 4TT3G 2EZPA 4BR6A 4JI4B 1OZ0A 1XILA 4B3SB 5KUMA 5LP6A 1KU9A 3ZRVA 3UQ8A 4LF5O 2X6AA 4LFAB 4NTXA 2JEUA 4JPRA 4DUZO 2HJDA 3TXQA 5B3SB 3JD4A 2WA4A 1N0JA 4UFZA 4X20B 1KP3A 3MHHC 2A9HA 4K0KB 4O4IA 5A2QN 2E5LO 5B1OA 1WPXA 2EIJC 2GTAA 4LF4O 3G6EV 4YJ3A 4JI2O 3PJSK 3JAWB 3I5DA 2WWWA 1HNZO 2DE0X 1TUEB 3TGUH 2Q7EA 1AJNA 1ZAUA 1PM9A 3STZC 4LWSB 4MW3A 4JV5O 2BSKA 2VQFB 1K3EA 2HKOA 2CGNA 2JK5C 2KKWA 3IFXA 2P7TC 2AHYA 4QE7A 4YJ2B 4L8JA 4LFBB 1M90W 4PA9A 3SJCC 3K5LA 3T4DA 1WN7A 2DOSA 3WB1A 1IBLB 1PKXA 4R50A 1YTFD 1AJQA 4O2BB 1BSMA 1US6A 3C3TA 4MVMA 4BIOA 4NXMO 4B08A 5B1NA 4N23A 4AQYB 3ETDA 1Q6IA 5J2TA 4K0KO 4KP4A 1QLEB 4YY3O 1AROP 4PD4F 4JZGA 1U96A 2D3OW 5C93A 1SQVH 2L35A 3AG3B 2HEPA 2DQ3A 2OCCB 3CWBH 3IGAC 1VQLV 4OXSA 1MZFA 4RUFA 3WB2A 2BE3A 3MD0A 4MVSA 3QF7A 2FL4A 4DV0O 3HKEA 4H13B 4EFEA 1KB9F 1SZXA 5EBLC 5JQGA 4WCEV 1VQ4V 1H38A 3S3XA 4B3TO 4I7ZB 4HZ3A 3U11A 4XBFA 3CX5F 2ZD9A 4GKKO 3JSLA 3AG1C 1Q90D 2YUAA 1IBKB 4WBNA 2WA3A 1OCOC 1Q7YW 4YIPA 4W4KA 2X7RB 1EN6A 3RW0A 5BMVB 1TVKB 1GAXA 4J9YB 1VF7A 3ZIAG 5LYJA 1Y76B 2JDIG 2F23A 5F2VO 4O4IB 2L6LA 3IC7A 4ZIBA 3E35A 1FXKB 4WFHA 2E76B 4X88A 4DV1O 2OTJV 1R3IC 1XMQO 2YS8A 4JI8B 2E74B 1JFFA 1XNRO 1FJGO 2KQXA 2RCVA 2XAHA 1VEWA 2V1DA 5LP6B 3BA8A 4OX9O 4LBEC 1JVMA 1NH2B 3T1YO 1H2NA 4WBNB 2UXDB 3A8TA 2YIDA 5JWPA 1QBZA 2WAMA 4BIZA 2LFSA 4O4LA 3DGEA 1YJ9V 5J2UB 4FPPA 1NKDA 2XOKG 4F4LA 1FKAO 4UB8Z 1SF9A 2XNDG 4PA6A 2ITCC 3L75H 3OMIB 3LSQA 4JTAB 4DV0B 3STLC 4CS4A 3RYCA 4DV1B 1XMOO 4LFAO 5CN0A 5L3FA 5IY5B 1P4RA 4J7KA 2UU9B 2Z3YA 3UO2A 4U3JA 3G4SV 2ETNA 2B1GA 1OCRB 1P7GA 3RGBA 3QNEA 1RPOA 1N8RW 1XHZA 3K9AA 3HKBB 3LDCA 4QE9A 3O65A 4UV8A 2EBOA 3N2KB 1VIBA 3L71H 3OUSA 3GB7C 5L3EA 2A3QA 4D7TA 3FB5C 4X64B 5K1XA 1L0LH 1A32A 2ZE8A 2FKXA 1ZTEA 3CCEV 1M93A 1OCOB 3JAKA 2XAGA 1M57B 1D5NA 4BW5A 4C7UA 1YTFB 2EINC 4X89A 2CAZC 4WFFA 4P9PA 1BZKA 2YI8A
chains in the Genus database with same CATH topology
4NTWA 4NYKA 4NTXA 4FZ1A 4FZ0A 2FB5A 1WP7A 2L35A 1WP8A 3N27A 4NTYA 2QTSA 3S3WA 3IJ4A 3S3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTW A;  4NYK A;  4NTX A;  4FZ1 A;  4FZ0 A;  2FB5 A;  1WP7 A;  2L35 A;  1WP8 A;  3N27 A;  4NTY A;  2QTS A;  3S3W A;  3IJ4 A;  3S3X A; 
#chains in the Genus database with same CATH topology
 1YIJ V;  1F7Y A;  4JTD B;  4PA4 A;  3A0R A;  2QE7 G;  4PHZ A;  4R7C A;  4MS2 A;  1Q82 W;  1S3J A;  1H2S B;  1AR5 A;  2QTO A;  4DR2 O;  5H6Q A;  3RYF A;  1FS0 G;  5CB4 B;  4CH6 A;  3F7Y C;  5IY5 C;  1PV0 A;  3ABT A;  5IWA O;  4WFE A;  4CS3 A;  5BR8 B;  4UCO A;  3RBZ A;  1WB7 A;  2B9Z A;  4LFC O;  3E2E A;  3OUF A;  1BCC H;  1NR1 A;  3IAY A;  5JVD A;  4DR7 O;  3KCX A;  5KUK A;  2EJR A;  4GLX A;  4JI6 O;  1NH2 D;  1NTM H;  2MW2 B;  4WFG A;  4J7J A;  2QM8 A;  3GWK C;  4TV8 B;  1D2D A;  4CH3 A;  2JRI A;  3S3W A;  4X66 B;  2P67 A;  3ZRX A;  4AQY O;  3A0H Z;  4DO2 A;  2GTS A;  2HHH O;  4JI0 O;  4LH6 A;  1Y66 A;  3GWO A;  3EFF K;  1XBL A;  2HVK C;  5B1B B;  3CME V;  1Y4M A;  2WLI A;  1NZ6 A;  3EVK A;  4LF4 B;  2R9A A;  5TIS Z;  1Q43 A;  1JPX A;  4PA3 A;  3DC6 A;  4TV8 A;  1S5L Z;  4B3M B;  2AGA A;  3T4Z A;  4K8Z A;  2NN4 A;  4U7O A;  3G80 A;  2YIB D;  3FFQ A;  1I08 A;  3J7A U;  3CC7 V;  3SPI A;  4J10 A;  4JI1 O;  2BTQ A;  2DN9 A;  1QLN A;  3RYH A;  1M9N A;  2RJZ A;  1TVK A;  4E2L A;  1J95 A;  4CZZ A;  1MMM A;  3APO A;  1IUR A;  1GN2 A;  3SGI A;  3CSX A;  4UVB A;  1CXZ B;  2JS5 A;  3OT7 A;  1GH6 A;  1ZUQ A;  4YJ3 B;  3K03 A;  3TK1 A;  2WLI B;  1VQ8 V;  1R3K C;  1M4U A;  3H1J H;  4MTF A;  4FLT A;  4EB6 B;  3RVZ A;  5JCO C;  4F6E A;  2JJ1 G;  4DRX A;  4F6R B;  4L87 A;  4KUM A;  5B66 Z;  3P3P A;  3SPJ A;  3WFV A;  3ZX6 A;  2XT9 A;  4PDL A;  2IU0 A;  2LQT A;  2QWN B;  2UXN A;  1JOY A;  2HR3 A;  4DK0 A;  4MVU A;  1QQC A;  2Y69 B;  1Y74 A;  3ZRW B;  2FTK A;  2UXX A;  3E83 A;  5B1B C;  5AG2 A;  1EN5 A;  2EIK C;  1N33 B;  1QLE C;  2PI4 A;  1QR8 A;  5JCO A;  4N21 A;  2IJJ A;  5EBM C;  3H01 A;  5EC1 C;  1SQX H;  1VF6 C;  2Q69 A;  3CRA A;  2ILM A;  5LMN B;  1YEW A;  1GTO A;  1KQS U;  3N27 A;  1S77 D;  4X64 O;  1B06 A;  1V55 B;  1XNQ B;  1FAF A;  2ZQM A;  4DR2 B;  3WG7 C;  4GX0 A;  3NXS A;  4Z2W A;  4LR3 A;  2XAQ A;  4FVM A;  4NVP A;  5EYP B;  1L0N H;  1TAE A;  2PTM A;  4OPH A;  3W7S A;  2Q4P A;  2UUA B;  5K1P A;  1NBM G;  5JQG B;  1MNG A;  4PI2 A;  5KMG A;  3BPZ A;  3AG2 C;  3OR6 C;  1XDC A;  4UB6 Z;  2LW1 A;  1G1X B;  3LNM B;  1N4C A;  5KX5 A;  2YIC A;  4GCZ A;  4H44 B;  1FJG B;  1AVM A;  2EIJ B;  2F1M A;  2YXL A;  2HG5 C;  2B5U A;  3SJB C;  2ZKO A;  5CA1 B;  4DUZ B;  4JYC A;  5EK0 A;  3R65 A;  3CS5 A;  5D5P A;  1S72 V;  3K08 A;  1PNM A;  3Q4H A;  3CE2 A;  3VQX A;  3K0D A;  2PZS A;  1ZL8 A;  2EIN B;  4UUJ C;  2QTS A;  2DYS B;  1M57 C;  5GTH Z;  4G2K A;  1M56 C;  4IYI A;  1S5H C;  4CH5 A;  5CBH A;  1WA8 B;  2QEX V;  2P90 A;  2EZO A;  4R8C A;  2E3C A;  1VQP V;  2YXY A;  2GDS A;  3ABK C;  2GUZ B;  2KG7 A;  1VQK V;  2F4V B;  4LF5 B;  1Z5W A;  2WLK A;  2QR4 A;  2AW9 A;  5LGU A;  1W0J G;  3HKC B;  1K5Q A;  3ZN0 A;  1YF2 A;  4DR3 O;  4O4H B;  4KHP O;  4O4L B;  4X1K A;  3CXC U;  1KD1 W;  2WLN A;  2Z5U A;  4UXN A;  4UCS A;  4X1K B;  1OCZ B;  3T1H O;  3DSQ A;  4I4T A;  5LOV A;  1FFX B;  1BQ0 A;  1E79 G;  2PYL A;  1GK9 A;  4FZ1 A;  2NR5 A;  1SET A;  4ZOL A;  4PI0 A;  2E75 B;  4O2B A;  4O2A B;  1KYO F;  4LFC B;  4HYO A;  1EBO A;  3PN1 A;  1RM1 C;  2ADQ B;  1GN6 A;  4LF7 O;  3E22 A;  1FYJ A;  3ZMS A;  1H2L A;  3SYQ A;  2R9I A;  2UUC B;  2X0L A;  3E22 B;  1XEQ A;  2X6B A;  4LP8 A;  4I9W A;  4O4H A;  2IH3 C;  3ZCC A;  1P49 A;  5JJJ B;  1JMK C;  2EIM C;  5FL7 G;  2OT5 A;  5KA5 A;  3JSN A;  3ML0 A;  1RM1 B;  1F51 A;  1MSD A;  4BW9 A;  4LH7 A;  4FM1 A;  2CTP A;  4JYA B;  3APQ A;  2C2A A;  5LBQ A;  4CC5 A;  2JEX A;  4YY3 B;  3K79 A;  2Y4U A;  1ENV A;  4XDJ A;  1NJI W;  3CYO A;  1EM1 A;  5IYC O;  1FXV A;  5CBF A;  1BL8 A;  4I50 A;  5L3G A;  5LXT B;  1HNW O;  5JJE B;  3K06 A;  1YIT V;  5CA0 A;  4B3M O;  5LA6 B;  3G67 A;  1FXK C;  4I50 B;  1Y67 A;  4DV2 B;  1HP8 A;  4UCU A;  1H8H G;  3ZHV A;  1DGS A;  2FML A;  4PJ0 Z;  4YXW G;  2AHZ A;  3OEE G;  1MG1 A;  5CA3 A;  3E89 A;  4JAU A;  1L8D A;  2QWO B;  1CEZ A;  3OEH G;  4FFB A;  4GT1 A;  1GN3 A;  2Q6A A;  2RN9 A;  4FMT A;  4P9O A;  4LWS A;  1HNX O;  2ATK C;  5LGT A;  4GYC B;  2IU3 A;  4IYH A;  5CB4 A;  1N36 O;  3JYC A;  5LXT A;  2DWD C;  3VQY A;  4A5U B;  3BY6 A;  3DTU B;  5LMU B;  1AR4 A;  4NXM B;  5IYB O;  3FKS G;  1HNZ B;  3AK2 A;  1YSC A;  3KKY A;  1SS3 A;  5IE9 A;  5IYZ B;  1HWY A;  3SPG A;  2UUB O;  2CH7 B;  4FJC C;  4PA7 A;  3AG2 B;  4MTX A;  5GTI Z;  2X6C A;  3D3Q A;  1JQ0 A;  4JYA O;  1O9H A;  3WG7 B;  3K59 A;  1AJP A;  4P2Z A;  2JIZ G;  4U3J B;  4RAI A;  4DV3 O;  2Y48 A;  2BTQ B;  1SQQ H;  1NVP B;  1N34 B;  2R72 A;  4LF9 O;  2QSA A;  1VAR A;  3SPC A;  1OJH A;  1QNM A;  1YCI A;  1URF A;  2VQE O;  4TQF A;  3TET A;  3MAQ A;  2NLJ C;  2QA4 V;  1K92 A;  1XQ8 A;  1JCH A;  1V54 C;  3JCU Z;  3RYI A;  2Y0I A;  2ZDI A;  3ZMT A;  1HR0 O;  2EIK B;  5BZB A;  5EIB D;  2ZR2 A;  4FIP C;  3ZHU A;  5LP6 C;  4P30 A;  4QNH B;  4IHJ B;  3QO8 A;  4LF6 B;  3B8M A;  3JD0 A;  4OPA A;  4O4J B;  4X20 A;  4BIU A;  4D6T H;  2ZT9 B;  1W0K G;  5LL6 Y;  1K7D A;  1Q6U A;  3B4S A;  4J41 A;  3P32 A;  4Q6G A;  4JI8 O;  1QVG U;  1GM8 A;  1Q5O A;  5JH7 A;  3J81 N;  2LGW A;  3G6B A;  2ZM6 B;  2CK3 G;  2ZE6 A;  5LOV B;  3SR2 C;  1ZSP A;  4JF3 A;  5HFM A;  1WA8 A;  2YIA A;  3TJT A;  1WLE A;  3JAL A;  4CBC A;  3OR7 C;  2UXB O;  3ABK B;  2YXH A;  4JAA A;  2EUL A;  1JA8 A;  2WLJ A;  1R6N A;  5L3D A;  4GUN A;  1MOF A;  2DYS C;  1IXM A;  5JJN B;  4DUY O;  2OWO A;  1AP6 A;  3ETE A;  3UT5 B;  2YSU B;  4Z1M G;  4PDR A;  2F4V O;  1XL4 A;  1UPG A;  2H3O A;  4UCT A;  5LHH A;  1I94 B;  1G6U A;  1I5Y A;  2CH7 A;  4D7S A;  2D2C B;  2CUG A;  3E86 A;  2Q7G A;  3OGI B;  5JH7 B;  4I4T B;  3CJH A;  3W7W A;  1RSO A;  2BOB C;  4DV3 B;  2ZIM A;  2EIL B;  3JCZ A;  1BE3 H;  4FLW A;  2ITD C;  2WLL B;  5EBW C;  3AG3 C;  2BOC C;  3RYI B;  1VQM V;  2A0L A;  3OAA G;  1EZJ A;  1W2B U;  4G28 B;  4X1Y B;  5CA1 A;  2Z0A A;  4NXN B;  4UVC A;  3G71 V;  3W7T A;  4EEQ A;  4FLZ A;  5IDJ A;  2MK3 A;  5H9C A;  2ZNI A;  2NNU A;  1SQG A;  3M7M X;  3WU2 Z;  4B7E A;  1GMG A;  3SPH A;  2HFE C;  4X65 B;  4GKJ O;  3CCV V;  1Q81 W;  4IL6 Z;  3CJH B;  4BWA A;  4EB6 A;  1I94 O;  3JAR B;  2YEV A;  2VWJ A;  5KAF Z;  1MA1 A;  2W0X A;  1YZB A;  5EZY B;  3JAR A;  2A7W A;  2CDY A;  1F4M A;  2P22 C;  3SYO A;  1BHA A;  1XRE A;  3P3N A;  3H1K H;  3B40 A;  2QKS A;  1Y76 A;  2QWP B;  3ZS8 C;  5IYZ A;  5KHI A;  2P4V A;  1IZ3 A;  2R9R B;  4X8A A;  3B77 A;  3L70 H;  2QDO A;  3RWR D;  3BRC A;  3AK1 A;  1VQ6 V;  1HDJ A;  2DQ0 A;  5KX5 B;  4HBN A;  3FX7 A;  4ZHQ B;  1BQZ A;  4DYL A;  4FM0 A;  2OIG A;  1KMI Z;  4YJ2 A;  1KKC A;  4DV4 O;  4DV6 O;  4DV7 O;  1IDS A;  2WLH A;  5DM6 V;  1AR1 B;  2UUB B;  1OHH G;  4DR3 B;  1N0N A;  4J80 A;  3ZHR A;  1SKV A;  3IJ4 A;  3OFN G;  4K8X A;  2PGG A;  4JI6 B;  3CCS V;  1QVF U;  4MTO A;  3HPL C;  1E1Q G;  4UV9 A;  4NTW A;  3VQV A;  3E8G A;  3SYA A;  3C3S A;  1K9M W;  3CRM A;  1N34 O;  2AZ0 A;  4ZI7 B;  4CH4 A;  1V9P A;  1WB8 A;  2LO1 A;  4TV9 A;  4IIJ A;  1IBM O;  2DW4 A;  5BXZ A;  2BSK B;  4GKJ B;  3IC9 A;  4ZBM A;  3F5W C;  4B7K A;  4XDL A;  1SA0 A;  4JYB A;  2ZIO A;  4LNU A;  2VQF O;  2QGN A;  3FD9 A;  3VQW A;  4DV7 B;  5DN6 G;  2EIM B;  3FB7 C;  5L3B A;  5C8Y B;  1D5A A;  1JFF B;  4LFB O;  1ORQ C;  4NKG B;  3ZHS A;  1N32 B;  2H94 A;  3ZMZ A;  4JI0 B;  1GRJ A;  4MW8 A;  3CCL V;  3AG4 B;  4UVA A;  1K73 W;  2LJ2 A;  3M99 B;  3A0B Z;  4DV5 B;  4FK5 C;  2WLM A;  1QHT A;  1AI6 A;  3MHS C;  1TGO A;  4FM2 A;  2LFR A;  3JAK B;  3O9O A;  1K8A W;  2PI5 A;  1Q6H A;  2R70 A;  5BR8 O;  4MVR A;  4J9Z B;  1Y6X A;  2DWE C;  3CCU V;  4KL1 A;  4FLY A;  3H1L H;  3K04 A;  2BTO A;  4YIO A;  1B6Q A;  2OIE A;  1DF5 A;  4J7Z A;  3AK3 A;  3CRC A;  4QJF B;  1WNS A;  5LHI A;  3CHX A;  2BCC H;  2FYU H;  4KXR A;  4ZOL B;  2JJ2 G;  5B1A B;  3JAW A;  2GBO A;  4B3R B;  2JGU A;  2ZM6 O;  1JJ2 U;  2CTW A;  3F7V C;  2YIB A;  3KG2 A;  2QKC A;  2ODM A;  4X62 B;  3F5T A;  3E8H A;  3OM3 B;  2ZE5 A;  4J42 A;  1NTZ H;  4UCV A;  3RYH B;  5CBG A;  1BMF G;  1M56 B;  5JVD B;  3AG1 B;  1TUB A;  1FD9 A;  3D36 A;  5J2T B;  1K97 A;  2PY5 A;  4X65 O;  1BT8 A;  1K34 A;  3A2F A;  4Z1V A;  1NS1 A;  1NT2 B;  3D3I A;  4AIL C;  2JS3 A;  3K5N A;  1GM9 A;  1HR0 B;  4CS2 A;  2VRZ A;  1PL4 A;  4RWU A;  4K3A A;  4MVO A;  3QO5 A;  1OCR C;  4Q20 A;  4LCU C;  2PYJ A;  3LNN A;  5DEC A;  4JI5 O;  2LGQ A;  3RT3 C;  4IT5 A;  2GHY A;  1XNR B;  3OD4 A;  1OV9 A;  1SRY A;  1YXB A;  1B04 A;  3T1H B;  3FB8 C;  1PNK A;  1SA0 B;  1N33 O;  4X1I B;  1PD3 A;  3AG7 A;  2WPD G;  2O57 A;  1HW7 A;  2QKA A;  5IJ0 B;  4X1I A;  3W7X A;  1V55 C;  2Q7H A;  4X1Y A;  1Z2G A;  1RP3 B;  4TUY B;  4O4J A;  5FNV A;  4AHC A;  4ZI7 A;  2A06 H;  1MAB G;  5FNV B;  4NB5 A;  3THO A;  3K58 A;  4DV4 B;  2IM9 A;  4DV6 B;  2CE4 A;  1BS3 A;  1V54 B;  1R73 A;  5LA6 A;  3OE7 G;  1YDX A;  2IW5 A;  5GON A;  2Y69 C;  2JGD B;  3FAV B;  1SQF A;  2V7Q G;  4GX2 A;  1XI1 A;  4FLX A;  1OCC C;  4B3T B;  3HKB A;  2YI9 A;  4NTY A;  1H2K A;  5KA6 A;  2ZIN A;  4JI2 B;  4QIW F;  3SYC A;  1LUV A;  3CC2 V;  2QWR B;  5KHK A;  3L72 H;  4JI3 O;  2KB1 A;  4G27 B;  4GZR B;  5B3S C;  4FLU A;  4JV5 B;  5H2F Z;  4DR4 B;  2AXT Z;  2YDE A;  2PF4 E;  3FYE B;  2JGD A;  3FAV A;  5C8Y A;  3JAT B;  4JAV A;  4JI4 O;  3HKD A;  5B5E Z;  2Q9L A;  2ZDI C;  3UCS C;  3RYC B;  1J5E B;  3K57 A;  1COW G;  3FYI B;  4ZHQ A;  5GW7 A;  5DED A;  4H33 A;  4JTC B;  2GUZ A;  2KG7 B;  1I7F A;  1YHQ V;  2UXC B;  1IBK O;  2W6I G;  5CMU A;  3ZHT A;  2OYQ A;  1EN4 A;  4ASU G;  2CGO A;  4X62 O;  1KKD A;  2EX3 A;  2OCC C;  1AI5 A;  5ITZ A;  3SYP A;  2N04 A;  1SC5 B;  2PUS A;  1S0V A;  4AI8 A;  1SES A;  3K0G A;  4HNA A;  1R6T A;  1DTO A;  1RPR A;  3JD2 A;  3LDE A;  3D8C A;  3K5M A;  3UM7 A;  4DR1 B;  3X2Q C;  3CCR V;  1SER A;  4HAM A;  2YEV B;  2DYR C;  2WLL A;  4ABM A;  4DW1 A;  1XMQ B;  3JD3 A;  1K4D C;  1W59 A;  1XMO B;  1ZL8 B;  3SDL A;  1XUQ A;  1ZX3 A;  1NQT A;  1U97 A;  1ROP A;  2CTQ A;  1B3Q A;  3ABL B;  2EJ7 A;  3RYF B;  3HR0 A;  4OX9 B;  1HNX B;  3HKE B;  3AG4 C;  2QWQ B;  4K35 A;  3DXR B;  2VS0 A;  3JD1 A;  3OW2 U;  2DJV A;  1ZLZ A;  3OGC C;  2P06 A;  3JAT A;  1DF4 A;  1WP8 A;  5FPR A;  1KBH A;  2DYR B;  5L3C A;  3RFR A;  1KC8 W;  1GN4 A;  1JR9 A;  4DR7 B;  3ZHQ A;  2VWK A;  5HFL A;  5LYJ B;  1XHX A;  4TWK A;  3L74 H;  3I56 V;  5KLV H;  1G4Y B;  3BCC H;  2K1E A;  1YVW A;  2P4K A;  3BAA A;  1KEC A;  3DXR A;  2XHB A;  2OTL V;  1UJW B;  2RDC A;  3T1Y B;  2EIL C;  2ZCE A;  3ICX A;  1WJZ A;  4MSW C;  3ZMU A;  3D36 C;  1X4T A;  1T5E A;  4JI1 B;  4IIJ B;  4JI7 B;  1S76 D;  1N32 O;  1TA8 A;  3E8F A;  2H8P C;  3ASN B;  5E1A C;  4EFB A;  1RSO B;  3E8B A;  1YI2 V;  3CPW U;  4TSF G;  2A79 B;  3CC4 V;  2GV9 A;  2Y0P A;  3UO3 A;  4DR1 O;  4RUE A;  1PPJ H;  2F43 G;  1BGY H;  1THZ A;  4JGS A;  2IBZ H;  2QJ1 A;  4QPJ A;  1UFI A;  4I9Q A;  4MVZ A;  1KUQ A;  4QGP A;  3BFR A;  1TUB B;  2F93 B;  1F23 A;  1DK1 A;  2UU9 O;  1NVP D;  1PNL A;  3T2M A;  4LF6 O;  4KHP B;  1VMG A;  3ZRS A;  3ETQ A;  1P7B A;  2K9P A;  4FZ0 A;  1SQP H;  4QPK A;  3JAL B;  2IJI A;  1QU7 A;  2Y4T A;  2V4D A;  1OCC B;  4DV5 O;  3J80 N;  3H1I H;  1AP5 A;  3SJQ C;  4XDK A;  2IH1 C;  3BA9 A;  1AI7 A;  5FLX N;  4I55 A;  2ZXW C;  4TUY A;  1G8M A;  5KAI Z;  4LF8 O;  2DMX A;  4ICG A;  4O2A A;  2RNB A;  4JI3 B;  5J9P C;  3OTF A;  3ASO C;  2HJF C;  1Q8I A;  1WAZ A;  5H5N A;  3L73 H;  3T1C A;  1YJW V;  1VP7 A;  2OCH A;  4DV2 O;  1VQ9 V;  1XL6 A;  2Q73 A;  4DR6 O;  3UT5 A;  3VOU A;  3BVO A;  3X2Q B;  2B1I A;  3I55 V;  2FB5 A;  3ZN1 A;  4NR1 A;  4EKW A;  3CMA V;  1LR1 A;  5BMV A;  1IXB A;  5ITZ B;  2Q8V A;  1VQO V;  4DR5 B;  2UXC O;  5EYP A;  3SJA C;  4CC6 A;  5IYD O;  1DLB A;  3OMN B;  2IJH A;  4NXN O;  1HNW B;  2HVJ C;  1L1F A;  5LGN A;  3ABM C;  4GX1 A;  3CCM V;  4RO2 A;  4WFB V;  1X59 A;  1NR7 A;  3CP1 A;  2M6Y A;  5KHH A;  3ABU A;  1WPB A;  1KP2 A;  2UUA O;  1QR9 A;  1R1B A;  4DXW A;  2GSM B;  3JAS A;  3LSU A;  1J5E O;  2ARH A;  4PDM A;  1O9G A;  4LNU B;  1BHB A;  3CB2 A;  4B3S O;  4RQE A;  1EFR G;  1Y74 B;  3ZRW A;  1N36 B;  2UXB B;  4PEL A;  3NR7 A;  1H8E G;  3R66 A;  3CRQ A;  4I5S A;  3KCY A;  4RQF A;  1RFY A;  3K3W A;  1YJN V;  4IHJ A;  4FFB B;  2WSS G;  3LSS A;  2AZ2 A;  1AB3 A;  4DUY B;  2ZR3 A;  2VQE B;  3Q4H B;  5B1A C;  2E5L B;  1PP9 H;  4UCR A;  3QG5 A;  4MT8 A;  5GON B;  5LHG A;  3TCU A;  4JAS A;  3EHB B;  4J11 A;  1XNQ O;  5EIB C;  3LUT B;  2JVD A;  5CA0 B;  2XAF A;  4DR4 O;  1S5J A;  3LDD A;  4DR6 B;  5IJ9 B;  2XAJ A;  3ZED A;  4I55 B;  1JJO A;  3ASO B;  1ZWI C;  3N2G A;  1IVS A;  2ZE7 A;  1VQ7 V;  3N2G B;  4WFA V;  2RQ6 A;  2ZXW B;  4H37 A;  1Q86 W;  4LF9 B;  1K33 A;  4WF9 V;  2XTA A;  2Q0O C;  5KHG A;  1NTK H;  3GVM A;  4DK1 A;  1H2G A;  1F4N A;  5E79 Z;  3ZJZ A;  2KSD A;  2UXD O;  1CP9 A;  1CPY A;  1GKF A;  2HHH B;  1FFX A;  3JAS B;  2XAS A;  4I0X A;  3HB3 B;  2ZNJ A;  2LP7 A;  4U7N A;  3RN4 A;  3M8A A;  1VQ5 V;  1R6K A;  3ZBH A;  2N74 A;  3L9D A;  1SZT A;  1IBM B;  1M5I A;  3U10 A;  1FFT B;  4LF8 B;  1E1R G;  1QCE A;  4FLV A;  3OMA B;  3QO7 A;  4H0L B;  4U3F H;  1XOU A;  1IBL O;  1Z5V A;  4BAY A;  4X66 O;  2QM4 A;  3WB0 A;  2Q68 A;  4I0X B;  4DW0 A;  3ZMV A;  3QTC A;  3EXA A;  5H6R A;  2YC0 A;  3H9V A;  2P5O A;  1M1K W;  3QVN A;  4IGG A;  1LUW A;  3ASN C;  1NI8 A;  4MVQ A;  4MTG A;  5IJ0 A;  3BHP A;  4R6Z A;  4OGQ B;  3CCJ V;  3ABM B;  5FPO A;  1PL0 A;  3UKM A;  1EZV H;  4TV9 B;  2LW7 A;  2F66 C;  4W4L A;  4NYK A;  1SQB H;  2QM7 A;  4ZKI A;  3N2K A;  1I5X A;  1JX9 A;  3TXS A;  3K9S A;  2W0F C;  5IJ9 A;  3BEH A;  3B09 A;  1IX9 A;  2XUM A;  3K5O A;  1K5S A;  4LC1 A;  5J2U A;  4PDV A;  2CTR A;  4HNA B;  3W7U A;  4DR5 O;  1H2M A;  3JAM N;  1R3L C;  5BY1 A;  4JZ2 A;  3HKD B;  4GX5 A;  3U0Z A;  4YHH B;  3OTO O;  2Q67 A;  3RVY A;  4F6R A;  1GM7 A;  3CRR A;  2HLD G;  4E4E A;  3ABL C;  4LF7 B;  3CCQ V;  4TQD A;  1MSW D;  3B8N A;  2UUC O;  3MDS A;  2IJK A;  3CEI A;  1WP7 A;  1NU1 H;  1FXH A;  4PV1 B;  1AI4 A;  2RMK B;  1VF5 B;  1I0H A;  4B3R O;  5KHJ A;  1FXK A;  2M7W A;  4KFM A;  2N05 A;  1R3J C;  5KMG B;  2HP8 A;  2Q0A A;  4JI5 B;  5A9G A;  3CXH F;  4JI7 O;  3HKC A;  4GKK B;  3CD6 V;  3AEI A;  4DRX B;  5IT9 N;  1MZE A;  1Q3E A;  1FPO A;  4JYY A;  1P84 F;  1OCZ C;  1VF6 A;  5LMN O;  2F95 B;  2Q5Z A;  1K4C C;  3BAB A;  4FFK A;  3VBB A;  5EZY A;  4X9Q A;  1AIL A;  1VQN V;  4YHH O;  3B2E E;  3ETG A;  5IWA B;  3OTO B;  1LNQ A;  3FB6 C;  5LMU O;  1GO3 F;  5D5Q A;  3DC5 A;  3C90 A;  3H1H H;  2ADP A;  3KZI Z;  2W6J G;  4TOI A;  5EC2 C;  2G38 A;  3P30 A;  2P6J A;  4TT3 G;  2EZP A;  4BR6 A;  4JI4 B;  1OZ0 A;  1XIL A;  4B3S B;  5KUM A;  5LP6 A;  1KU9 A;  3ZRV A;  3UQ8 A;  4LF5 O;  2X6A A;  4LFA B;  4NTX A;  2JEU A;  4JPR A;  4DUZ O;  2HJD A;  3TXQ A;  5B3S B;  3JD4 A;  2WA4 A;  1N0J A;  4UFZ A;  4X20 B;  1KP3 A;  3MHH C;  2A9H A;  4K0K B;  4O4I A;  5A2Q N;  2E5L O;  5B1O A;  1WPX A;  2EIJ C;  2GTA A;  4LF4 O;  3G6E V;  4YJ3 A;  4JI2 O;  3PJS K;  3JAW B;  3I5D A;  2WWW A;  1HNZ O;  2DE0 X;  1TUE B;  3TGU H;  2Q7E A;  1AJN A;  1ZAU A;  1PM9 A;  3STZ C;  4LWS B;  4MW3 A;  4JV5 O;  2BSK A;  2VQF B;  1K3E A;  2HKO A;  2CGN A;  2JK5 C;  2KKW A;  3IFX A;  2P7T C;  2AHY A;  4QE7 A;  4YJ2 B;  4L8J A;  4LFB B;  1M90 W;  4PA9 A;  3SJC C;  3K5L A;  3T4D A;  1WN7 A;  2DOS A;  3WB1 A;  1IBL B;  1PKX A;  4R50 A;  1YTF D;  1AJQ A;  4O2B B;  1BSM A;  1US6 A;  3C3T A;  4MVM A;  4BIO A;  4NXM O;  4B08 A;  5B1N A;  4N23 A;  4AQY B;  3ETD A;  1Q6I A;  5J2T A;  4K0K O;  4KP4 A;  1QLE B;  4YY3 O;  1ARO P;  4PD4 F;  4JZG A;  1U96 A;  2D3O W;  5C93 A;  1SQV H;  2L35 A;  3AG3 B;  2HEP A;  2DQ3 A;  2OCC B;  3CWB H;  3IGA C;  1VQL V;  4OXS A;  1MZF A;  4RUF A;  3WB2 A;  2BE3 A;  3MD0 A;  4MVS A;  3QF7 A;  2FL4 A;  4DV0 O;  3HKE A;  4H13 B;  4EFE A;  1KB9 F;  1SZX A;  5EBL C;  5JQG A;  4WCE V;  1VQ4 V;  1H38 A;  3S3X A;  4B3T O;  4I7Z B;  4HZ3 A;  3U11 A;  4XBF A;  3CX5 F;  2ZD9 A;  4GKK O;  3JSL A;  3AG1 C;  1Q90 D;  2YUA A;  1IBK B;  4WBN A;  2WA3 A;  1OCO C;  1Q7Y W;  4YIP A;  4W4K A;  2X7R B;  1EN6 A;  3RW0 A;  5BMV B;  1TVK B;  1GAX A;  4J9Y B;  1VF7 A;  3ZIA G;  5LYJ A;  1Y76 B;  2JDI G;  2F23 A;  5F2V O;  4O4I B;  2L6L A;  3IC7 A;  4ZIB A;  3E35 A;  1FXK B;  4WFH A;  2E76 B;  4X88 A;  4DV1 O;  2OTJ V;  1R3I C;  1XMQ O;  2YS8 A;  4JI8 B;  2E74 B;  1JFF A;  1XNR O;  1FJG O;  2KQX A;  2RCV A;  2XAH A;  1VEW A;  2V1D A;  5LP6 B;  3BA8 A;  4OX9 O;  4LBE C;  1JVM A;  1NH2 B;  3T1Y O;  1H2N A;  4WBN B;  2UXD B;  3A8T A;  2YID A;  5JWP A;  1QBZ A;  2WAM A;  4BIZ A;  2LFS A;  4O4L A;  3DGE A;  1YJ9 V;  5J2U B;  4FPP A;  1NKD A;  2XOK G;  4F4L A;  1FKA O;  4UB8 Z;  1SF9 A;  2XND G;  4PA6 A;  2ITC C;  3L75 H;  3OMI B;  3LSQ A;  4JTA B;  4DV0 B;  3STL C;  4CS4 A;  3RYC A;  4DV1 B;  1XMO O;  4LFA O;  5CN0 A;  5L3F A;  5IY5 B;  1P4R A;  4J7K A;  2UU9 B;  2Z3Y A;  3UO2 A;  4U3J A;  3G4S V;  2ETN A;  2B1G A;  1OCR B;  1P7G A;  3RGB A;  3QNE A;  1RPO A;  1N8R W;  1XHZ A;  3K9A A;  3HKB B;  3LDC A;  4QE9 A;  3O65 A;  4UV8 A;  2EBO A;  3N2K B;  1VIB A;  3L71 H;  3OUS A;  3GB7 C;  5L3E A;  2A3Q A;  4D7T A;  3FB5 C;  4X64 B;  5K1X A;  1L0L H;  1A32 A;  2ZE8 A;  2FKX A;  1ZTE A;  3CCE V;  1M93 A;  1OCO B;  3JAK A;  2XAG A;  1M57 B;  1D5N A;  4BW5 A;  4C7U A;  1YTF B;  2EIN C;  4X89 A;  2CAZ C;  4WFF A;  4P9P A;  1BZK A;  2YI8 A; 
#chains in the Genus database with same CATH homology
 4NTW A;  4NYK A;  4NTX A;  4FZ1 A;  4FZ0 A;  2FB5 A;  1WP7 A;  2L35 A;  1WP8 A;  3N27 A;  4NTY A;  2QTS A;  3S3W A;  3IJ4 A;  3S3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...