2L3PA

Structure of the prolyl cis isomer of the crk protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
GPYAQPSINTPLPNLQNGPFYARVIQKRVPNAYDKTALALEVGELVKVTKINMSGQWEGECNGKRGHFPFTHVRLLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cis isomer of Crk protein
publication title Structural basis for regulation of the Crk signaling protein by a proline switch.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 9
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l3pA00
2EYWA 2J06A 2O31A 1E7OA 2EVRA 2O9SA 1WX6A 3CQTA 3H0HA 4LNPA 1VYVA 2W10A 1Y57A 2EKHA 4JJCA 2LQNA 3I9QA 2C0OA 2EYYA 2BTTA 2CDTA 1IO6A 1PRLC 2KXDA 2CH4A 1PHTA 1K4US 1ZUKA 1E6HA 2DLPA 4DEYA 3UATA 4HVWA 4J9DA 2GTJA 2LZ6B 1OV3A 1UGVA 2RQUA 1NG2A 2HSPA 3VRZA 2KEAA 1QWEA 3I35A 3NGPA 4AFQC 1I1JA 1WFWA 3EG3A 4AFZC 2KNBB 1RLPC 2SEMA 1PRMC 1PKSA 3VS4A 2A28A 2RNAA 4F17A 1PNJA 2DRKA 2J7IA 4F16A 4KRTA 4RUGA 5IHIA 4QT7A 5FWCA 2JMCA 1JEGA 2OJ2A 1NM7A 1SSHA 1HSQA 3M0RA 2AZSA 2VVKA 1NEBA 4JJDA 1CKAA 2DL3A 2SRCA 5EC7A 1ZUUA 1QLYA 1S1NA 1X2QA 2D8HA 2LP5A 2DMOA 2ESWA 2EBPA 2DL5A 4DEXA 4J9HA 2C0TA 1M3AA 5FWBA 4E6RA 4HVVA 1SRLA 1UFFA 1YP5A 2A37A 2LJ1A 2DILA 2YDLA 4FSSA 4RTZA 3VS3A 1X69A 3RBBB 2B86A 1WA7A 2AZVA 2FPEA 1K1ZA 2LMJA 1VA7A 1KFZA 1MUZA 4WCIA 4RTUA 1SHFA 1B3QA 1OPLA 2ENMA 1SPKA 1G83A 2LJ3A 2JW4A 2LNHB 3NPFA 4IIOA 1QCFA 4J9FA 4JJBA 3R6NA 5ECAA 3PVLA 1NLOC 3TVTA 1GRIA 2PTKA 1YN8A 1WXTA 4JPBW 2OAWA 1TUDA 3EG1A 2BZYA 1AWWA 3M0TA 4RTTA 1MV3A 1QKXA 2V1RA 1KIKA 1RUWA 4JZ4A 1M3CA 4X1VA 1W1FA 2L3QA 3EGUA 2JS2A 5I11A 4HVUA 2FRYA 2A08A 3U23A 2DX1A 2D0NA 2VKNA 1SEMA 3TSWA 2C0IA 2F2XA 1WIEA 1HJDA 1AOJA 1HD3A 3GBQA 4RTXA 2D1XA 3UA6A 2KRNA 2FEIA 2M51A 1K9AA 2O9VA 4CC2A 4Z8AA 1N5ZA 2EGAA 2X3WD 2V1QA 2K6DA 1AZGB 1X2KA 1BBZA 1K0XA 1FYNA 2JM9A 1WDXA 2GNCA 1VYTA 5HCKA 1LCKA 4LN2A 1UDLA 3FJ5A 1X6GA 2RQVA 2KYMA 4J9EA 1ZX6A 1ABQA 2EGEA 1AZEA 2K9GA 1PKTA 2ROLA 2RQWA 1AWJA 2YUOA 4ZNXA 2RN8A 1T3SA 1G2BA 1GBRA 1TG0A 2KE9A 1UHFA 2KRSA 1AD5A 2QDLA 4LE9A 1UHCA 1GL5A 2KBTA 4D8DA 2K2MA 1QWFA 1X27A 4OMMA 2HBWA 1K0SA 1X43A 1AWOA 2KGTA 1AVZC 3RNJA 1NLPC 1AWXA 4RTYA 4F14A 4OMLA 3VS7A 3LH5A 2KXCA 2EW3A 2IIMA 4OMQA 1ZUYA 1KSWA 3QWXX 1UUEA 2AKLA 1W70A 2J6KA 2AKKA 2PZ1A 5GJWB 2F2WA 1EFNA 2I0NA 1T3LA 3I5SA 4RTVA 1K76A 1PWTA 4J9CA 1U5SA 1AEYA 2NUZA 2FPFA 1M3BA 3M0PA 2DL8A 2FG0A 4CC7A 4LUEA 2ECZA 2ED1A 2VWFA 1VYUA 2FRWA 2DL7A 1WYXA 1I07A 2J05A 3UF4A 2XMFA 1GCQA 1I0CA 1A0NB 3ZL7C 3EHRA 2KR3A 2EPDA 3NMZC 3H0IA 3PE0A 4GBQA 2LCSA 3TSZA 1UTIA 1ARKA 1BB9A 1H92A 4AFUC 2CSQA 3KFVA 4J9GA 2ED0A 2YSQA 1ZBJA 2L3PA 4K11A 1H8KA 1RLQC 2YT6A 2O2OA 3VS2A 2L3SA 2KT1A 3VS5A 4AG1C 1M27C 1SRMA 2HEQA 2K7AA 1TUCA 5IXFA 2G6FX 2E5KA 1GCQC 1WLPB 5GJVB 4CC3A 3EHQA 3VS0A 5FW9A 1UG1A 2CREA 3EG0A 2DA9A 1UJYA 2PNIA 1YWOA 2P4RA 4RTWA 2EYZA 1W6XA 3SHWA 4Y92A 5IHKA 2JT4A 2DBKA 2EQIA 4D8KA 3H41A 2AK5A 3M0SA 3QWYA 3ULRB 2O88A 4IIMA 2RQTA 1Y0MA 5L23A 1GCPA 1ZLMA 2EYXA 1YWPA 1WXBA 1GBQA 1JXMA 3PVQA 1T0HA 1H3HA 2YUQA 3VS1A 2YUNA 2KRMA 1V1CA 1Z9ZA 2CSIA 4AG2C 2LX7A 4M4ZA 3THKA 2CUBA 2JTEA 2BZXA 1NYFA 2A36A 3M0QA 3O5ZA 2D8JA 2CUDA 2K3BA 2BZ8A 5IH2A 1CKBA 1WXUA 4ESRA 3VRYA 1UJ0A 2DL4A 2YUPA 2ROTA 4ORZA 4OMPA 1GFDA 2MIOA 1JU5C 4GLMA 2J6FA 4OMNA 1ZSGA 3EG2A 4AFSC 1WI7A 2KT8A 2MCNA 1GFCA 1BK2A 2L0AA 1Z9QA 3JV3A 1JXOA 1YNZA 2X3XD 2FPDA 3I5RA 1U3OA 2CH4W 4J9IA 4LUDA 1OOTA 2DVJA 2JS0A 2RMOA 2GGRA 4CC4B 4JZ3A 1E6GA 3IQLA 5IHNA 1UECA 2LQWA 1T0JA 2DYBA 2L2PA 2DF6A 2RF0A 1SHGA 1QKWA 1FMKA 1MV0B 2JMAA 2J6OA 3A98A 1OEBA 1RI9A 2HCKA 3REBB 2DJQA 1NYGA 3C0CA 3M0UA 1UE9A 3REAB 4J9BA 2OI3A 1U06A 3UA7A 1KJWA 1YCSB 2FO0A 3SEMA 4Z89A 2GTOA 2MOXA 1JQQA 1X6BA 2W0ZA 2F2VA 1JO8A 2LJ0A 1M8MA 3NHNA 4R0KA 2K79A 4EIKA 2DNUA 2CT4A 2HDAA 2DE0X 2NWMA 2ABLA 2M0YA 3VS6A 4OMOA 2DRMA 1B07A 1BU1A 1CSKA 1ABOA 3H0FA 2GBQA 1J3TA 2CT3A 4HCKA 2RQRA 5IXBA 2EGCA 2RPNA 2DBMA 2KROA 4HXJA 2JXBA 4A63B 2DM1A 1M30A 2JM8A 4Z88A 1OPKA 2KYBA 5I22A 2GQIA 2H8HA 1NEGA 1XOVA
chains in the Genus database with same CATH superfamily
2Y4XA 3QYHB 3OMGA 3PTAA 2O9SA 2ATCB 3A8GB 2K3YA 3H0HA 3PT9A 4R56A 1Y57A 2EKHA 4XTWA 3X25B 5GAN6 1Q86U 3O8VA 3OYNA 2CDTA 1I5OB 3SFMA 2HKNA 2KXDA 1QMCA 1K9MU 1WPYA 1K4US 1ZUKA 4DEYA 3UATA 1WGSA 4J9DA 2LZ6B 1XNIA 1MNEA 2FHDA 1KHCA 3RUXA 1W2BP 1TS9A 2HSPA 3VRZA 5LJ5h 1MNDA 1QWEA 1YJ9T 3PMIA 1I1JA 3EG3A 2A0FB 1PRMC 4M77G 2M0OA 5A0DA 3VS4A 2A28A 3C95A 1ZSZB 4XQ3A 3JCMP 1ZHIA 4F16A 2YRDA 4WF2A 1KK7A 4E47A 2KVQG 1YITQ 3JCMh 1NPPA 4IUQA 3JCMc 3EAEA 2DETA 1NM7A 1SSHA 3OYMA 4PJOB 2AZSA 4KBMB 2RHIA 1R8OB 5EC7A 4EMKC 1QLYA 3QXEB 3L2RA 2V26A 1BIAA 4XTZA 2DEQA 2DMOA 2RK1A 5D7UA 4J9HA 4LDYA 2EQMA 4CI0C 4J7IA 4BI8B 3MP1A 2QQBA 5A0GA 3I56T 4QW2A 3HFNA 2A37A 1YP5A 4RTZA 4OF1A 3PNWC 2OTJQ 2OTLT 2JOYA 1QW1A 3HHTB 5GAOp 2FPEA 5HK0A 1VQ4A 2LMJA 1VA7A 3G6EQ 1JBMA 2E65A 1W2BA 5J3BA 1VQ5T 3KXTA 4QKUA 1KC8U 1OPLA 2QGGA 2P0QA 1G83A 4IIOA 4J9FA 3R6NA 5GAMe 4JJNK 3M57A 1GRIA 3CBPA 4LXCA 1NJIU 4JS5A 1YN8A 3JB9D 2MPXC 2K5FA 2OAWA 2QTVA 1KQSS 1VQPT 1RUWA 3CC7Q 1M3CA 4X1VA 2FZGB 2RK2A 1H641 3CD6Q 1D09B 2DYIA 2L3QA 4FL6A 2JS2A 2RD1A 2DX1A 2DD4A 1SEMA 2VUBA 2MYSA 4KGXB 2E6ZA 4BY6C 3GBQA 3CC2A 3ZEHA 4M78B 4Z8AA 4ATOA 1C1AA 1Y7XA 3SD4A 4J6YA 4C0ZA 1VQ9A 1Q81R 1X2KA 3ZFJA 4ZTFA 4NS5A 2E1HA 1Q7YU 1LCKA 3CCQQ 5CK9A 1UDLA 4L5GA 3WVEB 4EMKA 2KYMA 1ZX6A 2C06A 2E6NA 2K9GA 3M4GA 2ROLA 4F7UF 4ZNXA 4C92B 2DTOA 1G2BA 2EJFA 3CC4A 1TG0A 3E9FA 5KYYB 3QKJA 3X20B 1QVGS 2DD5A 1AD5A 3OYLA 2K5IA 1UHCA 4QVDA 2RI3A 4DBQA 5I21A 1QWFA 4QQ6A 2PU9B 4ZTJA 5HKCA 4J5YA 2EKOA 2Y90A 1X43A 2YRCA 1W2BS 3OYJA 2RB6A 1NLPC 1AWXA 1VQOT 3VS7A 2KI7A 3LH5A 2D0QB 2BUDA 2EW3A 1N8RR 2EJGA 1UUEA 1Q86C 1W70A 2R5AA 3VYHB 4J83A 2F2WA 2I0NA 1K9MC 2PVOB 1PWTA 5KE3A 4LD6A 2NUZA 4ZN1A 2DL8A 3CCLT 2V8JA 3V7SA 4LUEA 3PMTA 2BIVA 2ED1A 3CCSA 2CP7A 5GAN8 3LGLA 3RR6A 2QXFA 1I07A 2J05A 1A0NB 3DLLA 1PD1A 3LWIA 1Q82U 1OU9A 1FWZA 3BE3A 3H0IA 1BB9A 3KFVA 2ED0A 1TSFA 4XU0A 2M02A 2MK5A 8ATCB 2YT6A 2L3SA 4F7UG 2AHJB 1M27C 1SRMA 3LX7A 3JCMb 2K7AA 3CMEA 2MWPA 4RG8A 5KH6A 3J7AF 3JAME 5GJVB 4CC3A 4RKUE 2EFIA 3EHQA 2FYKA 2L89A 3OBWA 3OYYA 1IGQA 1EX4A 2P4RA 4OVAA 1D3BB 1SF9A 3EFOB 1W6XA 3H6ZA 3HRSA 4N4IA 1VQ7T 1PSFA 1OX8A 5C6SA 5KYWB 3T9NA 3PGGA 1VQ4Q 1NJIC 3OS2A 1I81A 1BI3A 1UGQB 1Y0MA 3ZBDA 5GMKi 1BIBA 1M1KU 2F1LA 2EYXA 1FX7A 1YWPA 2DK3A 4M7AB 1JXMA 3MEWA 3OSSC 2QASA 1RL2A 1VOMA 4Z02A 1V1CA 1Z9ZA 2FVUA 3JCMQ 3CCET 2LX7A 1NYFA 1RADB 5GMKl 3UDCA 2CUDA 2QI2A 1S72A 4FT2A 1IRXA 2ROTA 1WZOA 1GFDA 1VQ6T 1M8VA 2DAQA 2XDBA 2GF7A 3TEEA 2NUPB 2CZ1B 1I8FA 2MCNA 1GFCA 1DJ7B 4A4KA 1BI1A 1Z9QA 1YHQA 3RESA 1M5Q1 3N5BB 4HKEA 3OBYA 3G4SA 1R77A 1U3OA 4PFPA 2DVJA 2RJFA 2RMOA 4M77B 2GGRA 1VQ9Q 1E6GA 5CO7A 1UECA 2L2PA 3OS0A 3JB9F 3OQ5A 1FMKA 2KDSA 1LJOA 2J6OA 1OZ3A 3A98A 2NUTA 1RI9A 3LH0A 4QQDA 3A1PA 4PJLA 2EQUA 3FLGA 2OI3A 1U06A 4BDYA 3CBOA 3CC4Q 5I2SA 3SEMA 4II1A 2E12A 2GTOA 1G3TA 2MOXA 2LNVA 3SWNA 2F2VA 1JO8A 2O01E 1PCXA 2GFUA 2LJ0A 1M8MA 4EIKA 2DNUA 2HDAA 1C0MA 1IB8A 2RHZA 4KGVB 3TU4K 1B07A 1CSKA 1J3TA 1YIJT 7AT1B 2YRVA 3SB2A 3RIRA 3P8HA 2KROA 4HXJA 3A8LB 4QVZA 2JM8A 2RM4A 1OPKA 1RABB 2XU8A 2PVDB 5LJ5e 3PIPA 3JB9H 3DLMA 3A8MB 2O31A 2QEXA 1WX6A 1RAIB 3CCSQ 1VYVA 2CZ6B 1LNXA 3DB3A 2W10A 3S3MA 3CCUT 3CCJA 2KQWA 3AHUA 5GANe 4LDXA 3BDLA 2C0OA 2EYYA 2H3JA 1IO6A 3QO3A 1BCMA 5CKHA 1K8AU 2JUFA 4AMCA 2CP6A 4HVWA 2HL3A 3HP9A 5CKBA 4C5IA 1G3WA 1OV3A 2DVEA 4FW2A 1UEBA 1QP2A 4J6XA 4A4HA 5GAN2 2LT1A 5CKEA 1WFWA 2KNBB 1RLPC 2SEMA 3OYEA 1PKSA 1YI2A 3CMEQ 4RG2A 2ZGWA 4MZPA 2J7IA 4HT9A 5FWCA 2JMCA 2OJ2A 5IAYA 1NEBA 2IPOB 4L6V5 2DZ9A 3NFCA 2DL3A 2SRCA 2VC8A 1M1KC 2O4XA 3OYIA 3JSCA 3M54A 2A7YA 4ELYC 3EH2A 2LP5A 2RHUA 4BE1A 4DEXA 1M3AA 2COWA 2DZCA 4R55A 1SRLA 2LJ1A 2M1HA 3VJPA 1KD1R 3VS3A 1X69A 5AT1B 3JCMJ 2AZVA 2X9HA 3M59A 1KFZA 1MUZA 4WCIA 3CMAT 2MWOA 1S72Q 1VQKT 4IKFA 1SPKA 2LJ3A 3NPFA 2LNHB 1H92A 4JJBA 4DOVA 1RI0A 3V8LA 3GIBA 3TVTA 1N8RC 3OMCA 1M2VA 2E3IA 2OTJT 2PTKA 1NZ9A 1WXTA 4JPBW 4PJOD 1QKXA 2V1RA 4JZ4A 2RJCA 5IT9E 4KH1B 5KYXA 1YHQQ 2LTOA 5GAOm 3G4SQ 3FIFA 2D0NA 2RJEA 4N4HA 3TSWA 1B34A 2C0IA 3UT1A 3CC7T 1M1GA 3UA6A 2KRNA 4HA8A 1SKUB 1YJNT 2O9VA 4CC2A 3I56A 3EFSA 4F7UB 2EGAA 2PUKB 2Y4YA 4MMKA 3KUFA 2XDPA 3CCRQ 4JDSA 1I4K1 3M58A 2DXTA 3JB9J 5LJ3j 3CPWP 5KYUB 4J9EA 4A4EA 2RQWA 1AWJA 4B6MA 1T3SA 1VQLA 2JTMA 2KE9A 3NTHA 2RI5A 2NYSA 2QDLA 4LE9A 2LQ8A 1VQPA 4M75D 4PJOA 5GANh 1RAGB 4HCBA 3INZA 1PD0A 2KGTA 1OU8A 2HQHA 2RO0A 4EPCA 4PFOA 5GMKj 5DLOA 1RAEB 4F14A 2X4JA 2XHCA 4O6JA 2KXCA 1ZUYA 1KSWA 4UC4A 2RHXA 2AKLA 2J6KA 2QEXQ 2PZ1A 2LRQA 1TOVA 5LJ3g 1K8AC 1T3LA 3BDUA 2VGMA 1KQ1A 2VXFA 3CCJQ 4J9CA 3S3OA 3QDFA 4M75E 3CPWA 1M3BA 3M0PA 2FG0A 4CC7A 3G71T 4JRIA 2HQXA 2ECZA 2VWFA 4BUGA 3OSVA 3C4SA 1WYXA 3UF4A 1GCQA 1WNLA 3L2WA 4PNOA 2QA4Q 3G7ZA 2PVGB 3ZL7C 3EHRA 5EG2A 4FSXA 1YI2Q 3PE0A 3FJPA 3CCVA 2CSQA 4ZGDB 3AT1B 3META 4DBFA 4PKCC 1IZ6A 1VQNT 2KT1A 3C12A 4NL2A 4M75A 3JCMV 4E7IA 5A2QE 5IXFA 3MO8A 2E64A 3CCMQ 3M4YA 3P8BB 4RCCA 1WLPB 4PJNA 5CR2A 2K5LA 2ZPBB 3BFMA 1TH7A 2PNIA 4FU6A 2BE7D 4M78A 5D6WA 3GNGA 3SHWA 1X6OA 4PFZA 2DPPB 5IHKA 4N0AC 3JCMX 4ZGEB 3M0SA 3QWYA 2I2LA 4C8QC 1IGUA 1QVFP 1GCPA 2VYTA 1WXBA 1N6AA 3PVQA 2XI9A 3VS1A 3WXMB 2CSIA 4FIBA 4AG2C 4BI4A 4C92A 3BW1A 4A54A 3VV0A 3OS5A 1H3ZA 2JTEA 2A36A 3M0QA 3O5ZA 1NPRA 3X26B 3S3NA 5GAN7 4ESRA 4Y91A 2DL4A 4C8QD 5A0LA 4EMKB 1WHGA 4XK8E 5DLQE 1JU5C 1M4ZA 2ZPFB 3RKWA 3OYFA 4C5HA 1WJSA 2J6FA 2CZ7B 4DQ2A 1YJWA 1WI7A 1QQJA 5GAMg 2CP5A 2MF2A 3HPWA 3I55T 2L0AA 5FROA 2BKDN 3VYGA 5GMKh 2DO3A 4X9DA 2ZZDA 2P0KA 1YNZA 3I56Q 4LUDA 4OB3B 1OOTA 1WJQA 1QVFA 2JS0A 4CC4B 4C8QE 4JZ3A 3IQLA 2OTLQ 5IHNA 1VQ7A 3FDRA 2LQWA 4IUVA 4B9WA 2RF0A 1SHGA 3CC2T 4A53A 1M90R 5I2MA 1LOJA 4PJOF 1SG5A 5KE2A 2HCKA 2DJZA 3GPLA 3M0UA 3REAB 4FYXB 1VQLQ 1EIFA 2L8DA 3UA7A 2DXCA 3DB4A 1KJWA 3PFSA 4MZMA 2F5TX 4Z89A 2FO0A 3L42A 2KSSA 1VQPQ 1JQQA 3FB9A 2W0ZA 1BYMA 3HTRA 4N0AA 2CT4A 2K4YA 1ZA2B 2MI6A 4C8QA 4BY6B 2M0YA 4FW1A 1BU1A 1VQMT 3ASKA 2P0PA 2GBQA 1KD1C 4XTVA 1PG5B 4M7DC 1WHJA 1VQ8T 2JXBA 1D3BA 3SWNC 3EFOA 1M30A 2CYZB 2WACA 1B7TA 5I22A 3QG1A 3SDZA 3V8JA 1Q81U 3X24B 3H9NA 5FU7C 2PUOB 5KYWA 1N27A 1UGPB 1Y71A 2J06A 1E7OA 2RA2A 3JCMW 3RKYA 4M7AA 3LWHA 2F5KA 3QBYA 5CKFA 4C0GA 3MEVA 3A8OB 4M75F 4JJCA 2LQNA 4M7DD 4MDWA 3I9QA 3TQ7P 4HCCA 1TTHB 1U8RA 1O9SA 2L5QA 2LX9A 1NE8A 5DM7R 2CH4A 4XU1A 1PHTA 3CCVQ 2DLPA 2XK0A 4TVRA 1QVFS 4PLLA 2DXBA 1UGVA 3CXCP 4FT4A 2RQUA 1G5VA 2KEAA 5FLXE 2P4TA 3I35A 3LGFA 1ACMB 3NGPA 3V7RA 4EDUA 1N9RA 2JTFA 2QQRA 2DFUA 2RNAA 1N8RU 4PL6A 3JRZA 4M7DE 5LL6S 5CVIA 2XICA 4JJDA 1CKAA 1ZUUA 1WHLA 1S1NA 2HNIA 4C92F 5LJ3d 4PLIA 3UWNA 4M77A 3CMET 3E19A 1GXIE 2D8HA 6AT1B 2DERA 2L3RA 4JS4A 2EBPA 2DL5A 3X28B 2C0TA 1PM3A 4FCYA 5D6XA 2LT4A 4E6RA 2E70A 4HVVA 1UFFA 3L1AA 2DILA 2YDLA 4ZN3A 4FSSA 5GAOq 2VASA 2QGFB 3CCUA 3CCRA 2D6FA 5GMKm 3RBBB 2B86A 1WA7A 4CRIA 1KG1A 4M7DA 3CXCA 2YHTA 1HXDA 4RTUA 1B3QA 3L2QA 2ENMA 2JW4A 2M16A 3M53A 2ZCFB 3PVLA 1HK9A 2HBPA 1NLOC 1K73R 2NUTB 3R6OA 4V2SA 2ZPEB 4M75G 5FU6C 3EG1A 3M0TA 1YJWQ 1TWBA 2E4HA 2XG8D 4FYWB 1KIKA 1S72T 3QDRB 2V8KA 3EGUA 3U23A 1WQ7A 2R5MA 2VKNA 3CEYA 2H3EB 2IVWA 3QYGB 1VQ7Q 2F2XA 1HJDA 1XJWB 1AOJA 4RTXA 5IN1A 5HY6A 1O75A 4A4FA 1OQKA 2M51A 3HFOA 1K9AA 3G4ST 2E5QA 3J81E 1AT1B 4C8QF 2X3WD 2R57A 5CIUA 3HKSA 4GLKA 1K0XA 1FYNA 2HKQB 5FRMA 2JM9A 2ZAEA 1WDXA 4C0DC 2VXEA 4KT0E 3JB9G 2NLUA 3KBGA 3CMAA 4E7JA 3RMSA 1VQKA 3MEAA 1ABQA 1VUBA 2LVMA 4WTOB 4KUIA 2QA4A 1Q86R 1D0XA 2RI2A 4L59A 3EFRA 1K9MR 5GAMd 1GL5A 3S6WA 2KBTA 4D8DA 2K2MA 2AT1B 2LC4A 1Q81C 1X27A 2AIRB 3CPFA 1R0BG 4OMMA 3A8HB 1K0SA 4FM4B 3EGXB 4JLGA 3MP6A 3RNJA 2KMTA 3EGDB 4RTYA 3CCMA 4OMLA 3J80E 1JRIA 4RMOA 1TU0B 4OMQA 1YITT 3QWXX 2AKKA 1ZSZC 3GP8A 5GJWB 3RDVA 1UB4A 1EFNA 4HCZA 3I5SA 4RTVA 2O4XB 4PJOC 1AEYA 4N4GA 3HRTA 4D6WA 2FPFA 4KH0B 5LJ3f 4O5VA 2QQ9A 3EG9A 4NL3A 2G3RA 4JLIA 5FU6B 5LJ5g 1VYUA 2FRWA 4VUBA 2XMFA 1YJ9A 4C8QG 2HQEA 2XKOC 4OMFB 1KQSP 4M77F 4AT1B 2KR3A 3G6ET 2EPDA 3NMZC 4GBQA 3TSZA 2LCSA 4E2FB 4DA4A 1IHWA 1ARKA 3JCMg 2YWWA 4AFUC 4QQGA 4J9GA 1YIJQ 2YLCA 1KC8R 1ZBJA 4K11A 4OB1B 3P8DA 5GAN5 1RLQC 2O2OA 2R58A 1NJIR 5HK3A 2Z0WA 1M2OA 4PJJA 1TUCA 2CP0A 2D9TA 2E10A 5LJ3e 2E5KA 1GCQC 2QTXA 4M7DF 2E3HA 3EH1A 3VS0A 1Y96B 2JNGA 2WSEE 5FW9A 5KYXB 3CD6T 1D0YA 2K2VA 1UG1A 2X4XA 3EG0A 4IURA 4E7HA 1SSFA 1OYXA 4P5NA 1G3SA 4RTWA 2RHYA 3OYCA 4PJOE 2EYZA 2VV5A 3CCUQ 1RAAB 4Y92A 2OTLA 3DKMA 4D8KA 3H41A 3RKXA 4M75C 3ER0A 3OYAA 2O88A 1YBYA 1FMWA 4IIMA 2RQTA 1BI2A 1Y07A 1VQ5A 1UGSB 3G71A 9ATCB 5KYUA 1KQSA 4HT8A 1GBQA 3VUBA 1H3HA 1T0HA 5GMKe 5GAN4 2YUNA 2KRMA 2COZA 5AYFA 5GAN3 1VIFA 4M78C 4M4ZA 5CKDA 3THKA 1QVGP 2CUBA 4B9XA 1ZSZA 3CCQT 1Q7YR 4YTLA 2ZPIB 2DIGA 5IH2A 1CKBA 2JN0A 1NBEB 3QUIA 4OMPA 1ZQ1A 1VQNA 4E7SA 2GFAA 3QSUA 1QP3A 3QZ9B 3ME9A 3MCAB 4OMNA 2M9UA 3EG2A 2XD0A 4LDVA 2KT8A 4X34A 4LD9K 4C92C 2X4WA 4JRQA 3VKIA 4JRPA 4M78D 1BK2A 2FB7A 2JZ2A 5L8RE 3JV3A 1LPLA 2X3XD 2HMAA 5GAMf 5KCOA 2FPDA 3I5RA 1KD1U 1PSEA 1RACB 1T0JA 2DYBA 1G8XA 2DF6A 4M7DG 4C92D 3CMAQ 2VGNA 1VQKQ 2OAUA 3GOXA 3M9QA 1IHVA 4C5GA 4ELZC 3REBB 3OYHA 1QVGA 2DXUA 3E9GA 4M78E 1NYGA 5GAOn 3A5ZB 4LDWA 4OB2B 2KAFA 1IXDA 1YCSB 1JB0E 2DTIA 4IUTA 4XTXA 2ZPGB 3NHNA 4R0KA 2DTHA 3NTIA 3WVDB 1VQLT 2DE0X 1YFNA 2ABLA 1Q82R 2E41A 1VQOA 4C92E 2QAZA 4OMOA 2DRMA 1MGQA 3H0FA 3I55A 2CT3A 3L2ZA 4HCKA 4ME7A 1OULA 2V8IA 1R0CB 5IXBA 2EJ9A 2EGCA 1YJNQ 2DBMA 1D0ZA 4M75B 5GAMj 4Z88A 2KYBA 4DBRA 2GQIA 2H8HA 1NEGA 1XOVA 4DOWA 1WQWA 1U1TA 1K73C 2EYWA 5CAIA 3CCLA 2EVRA 3CQTA 4OGEA 4LNPA 2GCXA 5C0MA 2X51A 5LJ3h 1M1FA 2VB6A 1YJ9Q 2CP2A 2BTTA 1FXXA 3OYDA 1QCOA 1VQ4T 5KYYA 2HAXA 3FEOA 1PRLC 3OA6A 2CS7A 1ZA1B 2XIDA 1E6HA 1M1KR 2LCCA 2GTJA 4RCBA 3CPWS 3G1JA 1NG2A 1RAFB 4BI3A 4MZTA 4M7AC 2K57A 3HL8A 4AFQC 4AFZC 4F17A 4JRKA 1PNJA 3CCVT 1VQMA 2DRKA 5KCHA 1OZ2A 4KRTA 4RUGA 3URGA 5IHIA 4QT7A 3RMQA 3MP8A 1JEGA 1HSQA 3M0RA 2VVKA 2K3XA 1P92A 3E2UA 2LQKA 1VQ8A 1X2QA 3OYBA 2QQAA 4E7KA 4M7AD 2ESWA 4OGCA 2HZYA 4NOYA 4F04B 5FWBA 1VQ5Q 3G71Q 1AHJB 1W4SA 1Q95G 2QK0A 2EYQA 5LJ5d 1VQ9T 4J8OA 5CQXA 3CCEA 1K1ZA 1KHIA 2DKGA 4M77C 3VUZA 1SHFA 3JCMd 3C94A 1QCFA 5ECAA 5GANd 1VQNQ 4M7AE 5CCAA 1VQ6A 1EZZB 3CC4T 1TUDA 2BZYA 1AWWA 1BCOA 3PIOA 4RTTA 1MV3A 2CKKA 3V8KA 1U1SA 2HD0A 2MMPA 1W1FA 3L2VA 4X9CA 5GAOr 4M77D 4DBHA 5I11A 4HVUA 2FRYA 1D1AA 2A08A 3QHSA 4C8QB 1WHHA 2HSEB 2FL7A 1F1BB 3MPUB 1YJWT 1V76A 2RJDA 1WIEA 2EWNA 5GAMh 1HD3A 1JJ2P 2D1XA 3TREA 4Q5WA 2DIQA 2FEIA 3MHXA 2FZCB 1X01A 1N5ZA 1HYOA 1V29B 3UPUA 4C5EA 1OI1A 1KC8C 2V1QA 2K6DA 4BE0A 1AZGB 1BBZA 2LCLA 2GNCA 4M77E 3OW2P 4KULA 4PJMA 1VYTA 5HCKA 4LN2A 3FRNA 4BDZA 3FJ5A 4BB7A 3RERA 3CCST 2EAYA 1X6GA 2RQVA 2LDMA 2KY9A 4PJOG 2EGEA 1AZEA 3M55A 4M78F 1PKTA 2YUOA 2RN8A 4KUDK 1RAHB 2EIFA 4Y28E 2NUPA 1BI0A 2CP3A 3QPHA 1GBRA 1VQOQ 1UHFA 2KRSA 1K8AR 5DY9A 3I55Q 1YIJA 2GQVA 2YXYA 1VIEA 2RH2A 2HBWA 3GLXA 1AWOA 1AVZC 5J39A 2EQKA 1JJ2A 3MKDA 4IUUA 2IIMA 3CCLQ 2ZPHB 4XTYA 3CC2Q 1M90U 2A3LA 2JJ9A 1Q7YC 2CZ0B 3OYGA 1QCNA 3JB9I 3OW2A 1K76A 4JUVA 1U5SA 1MMGA 1MMAA 3M56A 4OB0B 1D1CA 3E1SA 4XTUA 4XU3A 2HL5C 2QQSA 1YCYA 2QDYB 3TCJA 4A4GA 1UGRB 2DL7A 3NTKA 4OP0A 1I0CA 2OX7A 1M9SA 2XDDA 4MMLA 2WSCE 3OYKA 5LJ5f 3QJYA 1UTIA 4M7DB 1VQMQ 2DEUA 2YSQA 3SWNB 2L3PA 1WJRA 1H8KA 1ZBXA 3VS2A 4M78G 3VS5A 5D6YA 5FU7B 4AG1C 4C0FA 1VQ8Q 3JCMf 4BE2A 4GY5A 2HEQA 1QVPA 4QVCA 4J7FA 5GANf 2G6FX 1TUGB 3MEUA 3MJXA 1YITA 1YHQT 1XQHA 4E7ZA 2CREA 3GNFB 2DA9A 1UJYA 2YLBA 1YWOA 3L2UA 3H8ZA 4XU2A 3LLRA 2P84A 4C92G 2JT4A 2DBKA 2EQIA 3QJ6A 2AK5A 2F69A 3CCEQ 2B8AA 3ULRB 1MMNA 5L23A 3GF5A 1ZLMA 1Q82C 1I5LA 2BE9B 1JJ2S 2JVVA 8AT1B 5FRNA 4FYYB 3JCMe 5J26A 2YUQA 2X4YA 2KK4A 3CCRT 1TXQA 2OTJA 1VQ6Q 2BZXA 3G6EA 2D8JA 3OW2S 2K3BA 2BZ8A 5LJ5j 1WXUA 3VRYA 4PK4A 1UJ0A 2YUPA 4M7AF 3CBMA 4ORZA 2MIOA 4IUPA 4BACA 4MDXA 3EGXA 1OX9A 2CGHA 1D1BA 1C6VX 1N9SA 1WHKA 3CXCS 4BD3A 4GLMA 3EGDA 1KQ2A 3QZ5B 4E7LA 1ZSGA 1PC0A 4AFSC 3VU3C 5GANj 3HSBA 3CC7A 4EMGA 4ANJA 5CQYA 3BY7A 3LYIA 3CD6A 3OS1A 1YJNA 1JXOA 1MMDA 2IG0A 2CH4W 4J9IA 2EQJA 1IREB 5GAOl 2X35A 3M5AA 2PQWA 3Q1JA 2FZKB 4LDUA 3OY9A 5M9OA 1QKWA 2QEXT 1MV0B 2WSFE 1FMVA 2JMAA 1OEBA 1K73U 3CCJT 2DJQA 3HRUA 4FYVB 2QG9B 3C0CA 4F7UE 1X75C 1UE9A 4J9BA 3FC3A 4KGZB 3CCQA 4EMHA 3EG9B 5GANg 1X6BA 2MAMA 2K79A 1BKBA 1MHNA 1M2VB 2QYZA 4J6WA 2QA4T 3V7CA 2NWMA 1M90C 3QIIA 3F70A 1YI2T 3OB9A 3VS6A 1ABOA 1G3YA 1Y96A 3D7SB 2COYA 3LW5E 4ZGJB 2RQRA 4M7AG 2RPNA 5KYNA 4XAXB 4F7UA 1WHMA 4A63B 2DM1A 4C0DB 3CCMT 1XTDA 1B34B 1LVKA
chains in the Genus database with same CATH topology
2EYWA 2J06A 2O31A 1E7OA 2EVRA 2O9SA 1WX6A 3CQTA 3H0HA 4LNPA 1VYVA 2W10A 1Y57A 2EKHA 4JJCA 2LQNA 3I9QA 2C0OA 2EYYA 2BTTA 2CDTA 1IO6A 1PRLC 2KXDA 2CH4A 1PHTA 1K4US 1ZUKA 1E6HA 2DLPA 4DEYA 3UATA 4HVWA 4J9DA 2GTJA 2LZ6B 1OV3A 1UGVA 2RQUA 1NG2A 2HSPA 3VRZA 2KEAA 1QWEA 3I35A 3NGPA 4AFQC 1I1JA 1WFWA 3EG3A 4AFZC 2KNBB 1RLPC 2SEMA 1PRMC 1PKSA 3VS4A 2A28A 2RNAA 4F17A 1PNJA 2DRKA 2J7IA 4F16A 4KRTA 4RUGA 5IHIA 4QT7A 5FWCA 2JMCA 1JEGA 2OJ2A 1NM7A 1SSHA 1HSQA 3M0RA 2AZSA 2VVKA 1NEBA 4JJDA 1CKAA 2DL3A 2SRCA 5EC7A 1ZUUA 1QLYA 1S1NA 1X2QA 2D8HA 2LP5A 2DMOA 2ESWA 2EBPA 2DL5A 4DEXA 4J9HA 2C0TA 1M3AA 5FWBA 4E6RA 4HVVA 1SRLA 1UFFA 1YP5A 2A37A 2LJ1A 2DILA 2YDLA 4FSSA 4RTZA 3VS3A 1X69A 3RBBB 2B86A 1WA7A 2AZVA 2FPEA 1K1ZA 2LMJA 1VA7A 1KFZA 1MUZA 4WCIA 4RTUA 1SHFA 1B3QA 1OPLA 2ENMA 1SPKA 1G83A 2LJ3A 2JW4A 2LNHB 3NPFA 4IIOA 1QCFA 4J9FA 4JJBA 3R6NA 5ECAA 3PVLA 1NLOC 3TVTA 1GRIA 2PTKA 1YN8A 1WXTA 4JPBW 2OAWA 1TUDA 3EG1A 2BZYA 1AWWA 3M0TA 4RTTA 1MV3A 1QKXA 2V1RA 1KIKA 1RUWA 4JZ4A 1M3CA 4X1VA 1W1FA 2L3QA 3EGUA 2JS2A 5I11A 4HVUA 2FRYA 2A08A 3U23A 2DX1A 2D0NA 2VKNA 1SEMA 3TSWA 2C0IA 2F2XA 1WIEA 1HJDA 1AOJA 1HD3A 3GBQA 4RTXA 2D1XA 3UA6A 2KRNA 2FEIA 2M51A 1K9AA 2O9VA 4CC2A 4Z8AA 1N5ZA 2EGAA 2X3WD 2V1QA 2K6DA 1AZGB 1X2KA 1BBZA 1K0XA 1FYNA 2JM9A 1WDXA 2GNCA 1VYTA 5HCKA 1LCKA 4LN2A 1UDLA 3FJ5A 1X6GA 2RQVA 2KYMA 4J9EA 1ZX6A 1ABQA 2EGEA 1AZEA 2K9GA 1PKTA 2ROLA 2RQWA 1AWJA 2YUOA 4ZNXA 2RN8A 1T3SA 1G2BA 1GBRA 1TG0A 2KE9A 1UHFA 2KRSA 1AD5A 2QDLA 4LE9A 1UHCA 1GL5A 2KBTA 4D8DA 2K2MA 1QWFA 1X27A 4OMMA 2HBWA 1K0SA 1X43A 1AWOA 2KGTA 1AVZC 3RNJA 1NLPC 1AWXA 4RTYA 4F14A 4OMLA 3VS7A 3LH5A 2KXCA 2EW3A 2IIMA 4OMQA 1ZUYA 1KSWA 3QWXX 1UUEA 2AKLA 1W70A 2J6KA 2AKKA 2PZ1A 5GJWB 2F2WA 1EFNA 2I0NA 1T3LA 3I5SA 4RTVA 1K76A 1PWTA 4J9CA 1U5SA 1AEYA 2NUZA 2FPFA 1M3BA 3M0PA 2DL8A 2FG0A 4CC7A 4LUEA 2ECZA 2ED1A 2VWFA 1VYUA 2FRWA 2DL7A 1WYXA 1I07A 2J05A 3UF4A 2XMFA 1GCQA 1I0CA 1A0NB 3ZL7C 3EHRA 2KR3A 2EPDA 3NMZC 3H0IA 3PE0A 4GBQA 2LCSA 3TSZA 1UTIA 1ARKA 1BB9A 1H92A 4AFUC 2CSQA 3KFVA 4J9GA 2ED0A 2YSQA 1ZBJA 2L3PA 4K11A 1H8KA 1RLQC 2YT6A 2O2OA 3VS2A 2L3SA 2KT1A 3VS5A 4AG1C 1M27C 1SRMA 2HEQA 2K7AA 1TUCA 5IXFA 2G6FX 2E5KA 1GCQC 1WLPB 5GJVB 4CC3A 3EHQA 3VS0A 5FW9A 1UG1A 2CREA 3EG0A 2DA9A 1UJYA 2PNIA 1YWOA 2P4RA 4RTWA 2EYZA 1W6XA 3SHWA 4Y92A 5IHKA 2JT4A 2DBKA 2EQIA 4D8KA 3H41A 2AK5A 3M0SA 3QWYA 3ULRB 2O88A 4IIMA 2RQTA 1Y0MA 5L23A 1GCPA 1ZLMA 2EYXA 1YWPA 1WXBA 1GBQA 1JXMA 3PVQA 1T0HA 1H3HA 2YUQA 3VS1A 2YUNA 2KRMA 1V1CA 1Z9ZA 2CSIA 4AG2C 2LX7A 4M4ZA 3THKA 2CUBA 2JTEA 2BZXA 1NYFA 2A36A 3M0QA 3O5ZA 2D8JA 2CUDA 2K3BA 2BZ8A 5IH2A 1CKBA 1WXUA 4ESRA 3VRYA 1UJ0A 2DL4A 2YUPA 2ROTA 4ORZA 4OMPA 1GFDA 2MIOA 1JU5C 4GLMA 2J6FA 4OMNA 1ZSGA 3EG2A 4AFSC 1WI7A 2KT8A 2MCNA 1GFCA 1BK2A 2L0AA 1Z9QA 3JV3A 1JXOA 1YNZA 2X3XD 2FPDA 3I5RA 1U3OA 2CH4W 4J9IA 4LUDA 1OOTA 2DVJA 2JS0A 2RMOA 2GGRA 4CC4B 4JZ3A 1E6GA 3IQLA 5IHNA 1UECA 2LQWA 1T0JA 2DYBA 2L2PA 2DF6A 2RF0A 1SHGA 1QKWA 1FMKA 1MV0B 2JMAA 2J6OA 3A98A 1OEBA 1RI9A 2HCKA 3REBB 2DJQA 1NYGA 3C0CA 3M0UA 1UE9A 3REAB 4J9BA 2OI3A 1U06A 3UA7A 1KJWA 1YCSB 2FO0A 3SEMA 4Z89A 2GTOA 2MOXA 1JQQA 1X6BA 2W0ZA 2F2VA 1JO8A 2LJ0A 1M8MA 3NHNA 4R0KA 2K79A 4EIKA 2DNUA 2CT4A 2HDAA 2DE0X 2NWMA 2ABLA 2M0YA 3VS6A 4OMOA 2DRMA 1B07A 1BU1A 1CSKA 1ABOA 3H0FA 2GBQA 1J3TA 2CT3A 4HCKA 2RQRA 5IXBA 2EGCA 2RPNA 2DBMA 2KROA 4HXJA 2JXBA 4A63B 2DM1A 1M30A 2JM8A 4Z88A 1OPKA 2KYBA 5I22A 2GQIA 2H8HA 1NEGA 1XOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYW A;  2J06 A;  2O31 A;  1E7O A;  2EVR A;  2O9S A;  1WX6 A;  3CQT A;  3H0H A;  4LNP A;  1VYV A;  2W10 A;  1Y57 A;  2EKH A;  4JJC A;  2LQN A;  3I9Q A;  2C0O A;  2EYY A;  2BTT A;  2CDT A;  1IO6 A;  1PRL C;  2KXD A;  2CH4 A;  1PHT A;  1K4U S;  1ZUK A;  1E6H A;  2DLP A;  4DEY A;  3UAT A;  4HVW A;  4J9D A;  2GTJ A;  2LZ6 B;  1OV3 A;  1UGV A;  2RQU A;  1NG2 A;  2HSP A;  3VRZ A;  2KEA A;  1QWE A;  3I35 A;  3NGP A;  4AFQ C;  1I1J A;  1WFW A;  3EG3 A;  4AFZ C;  2KNB B;  1RLP C;  2SEM A;  1PRM C;  1PKS A;  3VS4 A;  2A28 A;  2RNA A;  4F17 A;  1PNJ A;  2DRK A;  2J7I A;  4F16 A;  4KRT A;  4RUG A;  5IHI A;  4QT7 A;  5FWC A;  2JMC A;  1JEG A;  2OJ2 A;  1NM7 A;  1SSH A;  1HSQ A;  3M0R A;  2AZS A;  2VVK A;  1NEB A;  4JJD A;  1CKA A;  2DL3 A;  2SRC A;  5EC7 A;  1ZUU A;  1QLY A;  1S1N A;  1X2Q A;  2D8H A;  2LP5 A;  2DMO A;  2ESW A;  2EBP A;  2DL5 A;  4DEX A;  4J9H A;  2C0T A;  1M3A A;  5FWB A;  4E6R A;  4HVV A;  1SRL A;  1UFF A;  1YP5 A;  2A37 A;  2LJ1 A;  2DIL A;  2YDL A;  4FSS A;  4RTZ A;  3VS3 A;  1X69 A;  3RBB B;  2B86 A;  1WA7 A;  2AZV A;  2FPE A;  1K1Z A;  2LMJ A;  1VA7 A;  1KFZ A;  1MUZ A;  4WCI A;  4RTU A;  1SHF A;  1B3Q A;  1OPL A;  2ENM A;  1SPK A;  1G83 A;  2LJ3 A;  2JW4 A;  2LNH B;  3NPF A;  4IIO A;  1QCF A;  4J9F A;  4JJB A;  3R6N A;  5ECA A;  3PVL A;  1NLO C;  3TVT A;  1GRI A;  2PTK A;  1YN8 A;  1WXT A;  4JPB W;  2OAW A;  1TUD A;  3EG1 A;  2BZY A;  1AWW A;  3M0T A;  4RTT A;  1MV3 A;  1QKX A;  2V1R A;  1KIK A;  1RUW A;  4JZ4 A;  1M3C A;  4X1V A;  1W1F A;  2L3Q A;  3EGU A;  2JS2 A;  5I11 A;  4HVU A;  2FRY A;  2A08 A;  3U23 A;  2DX1 A;  2D0N A;  2VKN A;  1SEM A;  3TSW A;  2C0I A;  2F2X A;  1WIE A;  1HJD A;  1AOJ A;  1HD3 A;  3GBQ A;  4RTX A;  2D1X A;  3UA6 A;  2KRN A;  2FEI A;  2M51 A;  1K9A A;  2O9V A;  4CC2 A;  4Z8A A;  1N5Z A;  2EGA A;  2X3W D;  2V1Q A;  2K6D A;  1AZG B;  1X2K A;  1BBZ A;  1K0X A;  1FYN A;  2JM9 A;  1WDX A;  2GNC A;  1VYT A;  5HCK A;  1LCK A;  4LN2 A;  1UDL A;  3FJ5 A;  1X6G A;  2RQV A;  2KYM A;  4J9E A;  1ZX6 A;  1ABQ A;  2EGE A;  1AZE A;  2K9G A;  1PKT A;  2ROL A;  2RQW A;  1AWJ A;  2YUO A;  4ZNX A;  2RN8 A;  1T3S A;  1G2B A;  1GBR A;  1TG0 A;  2KE9 A;  1UHF A;  2KRS A;  1AD5 A;  2QDL A;  4LE9 A;  1UHC A;  1GL5 A;  2KBT A;  4D8D A;  2K2M A;  1QWF A;  1X27 A;  4OMM A;  2HBW A;  1K0S A;  1X43 A;  1AWO A;  2KGT A;  1AVZ C;  3RNJ A;  1NLP C;  1AWX A;  4RTY A;  4F14 A;  4OML A;  3VS7 A;  3LH5 A;  2KXC A;  2EW3 A;  2IIM A;  4OMQ A;  1ZUY A;  1KSW A;  3QWX X;  1UUE A;  2AKL A;  1W70 A;  2J6K A;  2AKK A;  2PZ1 A;  5GJW B;  2F2W A;  1EFN A;  2I0N A;  1T3L A;  3I5S A;  4RTV A;  1K76 A;  1PWT A;  4J9C A;  1U5S A;  1AEY A;  2NUZ A;  2FPF A;  1M3B A;  3M0P A;  2DL8 A;  2FG0 A;  4CC7 A;  4LUE A;  2ECZ A;  2ED1 A;  2VWF A;  1VYU A;  2FRW A;  2DL7 A;  1WYX A;  1I07 A;  2J05 A;  3UF4 A;  2XMF A;  1GCQ A;  1I0C A;  1A0N B;  3ZL7 C;  3EHR A;  2KR3 A;  2EPD A;  3NMZ C;  3H0I A;  3PE0 A;  4GBQ A;  2LCS A;  3TSZ A;  1UTI A;  1ARK A;  1BB9 A;  1H92 A;  4AFU C;  2CSQ A;  3KFV A;  4J9G A;  2ED0 A;  2YSQ A;  1ZBJ A;  2L3P A;  4K11 A;  1H8K A;  1RLQ C;  2YT6 A;  2O2O A;  3VS2 A;  2L3S A;  2KT1 A;  3VS5 A;  4AG1 C;  1M27 C;  1SRM A;  2HEQ A;  2K7A A;  1TUC A;  5IXF A;  2G6F X;  2E5K A;  1GCQ C;  1WLP B;  5GJV B;  4CC3 A;  3EHQ A;  3VS0 A;  5FW9 A;  1UG1 A;  2CRE A;  3EG0 A;  2DA9 A;  1UJY A;  2PNI A;  1YWO A;  2P4R A;  4RTW A;  2EYZ A;  1W6X A;  3SHW A;  4Y92 A;  5IHK A;  2JT4 A;  2DBK A;  2EQI A;  4D8K A;  3H41 A;  2AK5 A;  3M0S A;  3QWY A;  3ULR B;  2O88 A;  4IIM A;  2RQT A;  1Y0M A;  5L23 A;  1GCP A;  1ZLM A;  2EYX A;  1YWP A;  1WXB A;  1GBQ A;  1JXM A;  3PVQ A;  1T0H A;  1H3H A;  2YUQ A;  3VS1 A;  2YUN A;  2KRM A;  1V1C A;  1Z9Z A;  2CSI A;  4AG2 C;  2LX7 A;  4M4Z A;  3THK A;  2CUB A;  2JTE A;  2BZX A;  1NYF A;  2A36 A;  3M0Q A;  3O5Z A;  2D8J A;  2CUD A;  2K3B A;  2BZ8 A;  5IH2 A;  1CKB A;  1WXU A;  4ESR A;  3VRY A;  1UJ0 A;  2DL4 A;  2YUP A;  2ROT A;  4ORZ A;  4OMP A;  1GFD A;  2MIO A;  1JU5 C;  4GLM A;  2J6F A;  4OMN A;  1ZSG A;  3EG2 A;  4AFS C;  1WI7 A;  2KT8 A;  2MCN A;  1GFC A;  1BK2 A;  2L0A A;  1Z9Q A;  3JV3 A;  1JXO A;  1YNZ A;  2X3X D;  2FPD A;  3I5R A;  1U3O A;  2CH4 W;  4J9I A;  4LUD A;  1OOT A;  2DVJ A;  2JS0 A;  2RMO A;  2GGR A;  4CC4 B;  4JZ3 A;  1E6G A;  3IQL A;  5IHN A;  1UEC A;  2LQW A;  1T0J A;  2DYB A;  2L2P A;  2DF6 A;  2RF0 A;  1SHG A;  1QKW A;  1FMK A;  1MV0 B;  2JMA A;  2J6O A;  3A98 A;  1OEB A;  1RI9 A;  2HCK A;  3REB B;  2DJQ A;  1NYG A;  3C0C A;  3M0U A;  1UE9 A;  3REA B;  4J9B A;  2OI3 A;  1U06 A;  3UA7 A;  1KJW A;  1YCS B;  2FO0 A;  3SEM A;  4Z89 A;  2GTO A;  2MOX A;  1JQQ A;  1X6B A;  2W0Z A;  2F2V A;  1JO8 A;  2LJ0 A;  1M8M A;  3NHN A;  4R0K A;  2K79 A;  4EIK A;  2DNU A;  2CT4 A;  2HDA A;  2DE0 X;  2NWM A;  2ABL A;  2M0Y A;  3VS6 A;  4OMO A;  2DRM A;  1B07 A;  1BU1 A;  1CSK A;  1ABO A;  3H0F A;  2GBQ A;  1J3T A;  2CT3 A;  4HCK A;  2RQR A;  5IXB A;  2EGC A;  2RPN A;  2DBM A;  2KRO A;  4HXJ A;  2JXB A;  4A63 B;  2DM1 A;  1M30 A;  2JM8 A;  4Z88 A;  1OPK A;  2KYB A;  5I22 A;  2GQI A;  2H8H A;  1NEG A;  1XOV A; 
#chains in the Genus database with same CATH topology
 2Y4X A;  3QYH B;  3OMG A;  3PTA A;  2O9S A;  2ATC B;  3A8G B;  2K3Y A;  3H0H A;  3PT9 A;  4R56 A;  1Y57 A;  2EKH A;  4XTW A;  3X25 B;  5GAN 6;  1Q86 U;  3O8V A;  3OYN A;  2CDT A;  1I5O B;  3SFM A;  2HKN A;  2KXD A;  1QMC A;  1K9M U;  1WPY A;  1K4U S;  1ZUK A;  4DEY A;  3UAT A;  1WGS A;  4J9D A;  2LZ6 B;  1XNI A;  1MNE A;  2FHD A;  1KHC A;  3RUX A;  1W2B P;  1TS9 A;  2HSP A;  3VRZ A;  5LJ5 h;  1MND A;  1QWE A;  1YJ9 T;  3PMI A;  1I1J A;  3EG3 A;  2A0F B;  1PRM C;  4M77 G;  2M0O A;  5A0D A;  3VS4 A;  2A28 A;  3C95 A;  1ZSZ B;  4XQ3 A;  3JCM P;  1ZHI A;  4F16 A;  2YRD A;  4WF2 A;  1KK7 A;  4E47 A;  2KVQ G;  1YIT Q;  3JCM h;  1NPP A;  4IUQ A;  3JCM c;  3EAE A;  2DET A;  1NM7 A;  1SSH A;  3OYM A;  4PJO B;  2AZS A;  4KBM B;  2RHI A;  1R8O B;  5EC7 A;  4EMK C;  1QLY A;  3QXE B;  3L2R A;  2V26 A;  1BIA A;  4XTZ A;  2DEQ A;  2DMO A;  2RK1 A;  5D7U A;  4J9H A;  4LDY A;  2EQM A;  4CI0 C;  4J7I A;  4BI8 B;  3MP1 A;  2QQB A;  5A0G A;  3I56 T;  4QW2 A;  3HFN A;  2A37 A;  1YP5 A;  4RTZ A;  4OF1 A;  3PNW C;  2OTJ Q;  2OTL T;  2JOY A;  1QW1 A;  3HHT B;  5GAO p;  2FPE A;  5HK0 A;  1VQ4 A;  2LMJ A;  1VA7 A;  3G6E Q;  1JBM A;  2E65 A;  1W2B A;  5J3B A;  1VQ5 T;  3KXT A;  4QKU A;  1KC8 U;  1OPL A;  2QGG A;  2P0Q A;  1G83 A;  4IIO A;  4J9F A;  3R6N A;  5GAM e;  4JJN K;  3M57 A;  1GRI A;  3CBP A;  4LXC A;  1NJI U;  4JS5 A;  1YN8 A;  3JB9 D;  2MPX C;  2K5F A;  2OAW A;  2QTV A;  1KQS S;  1VQP T;  1RUW A;  3CC7 Q;  1M3C A;  4X1V A;  2FZG B;  2RK2 A;  1H64 1;  3CD6 Q;  1D09 B;  2DYI A;  2L3Q A;  4FL6 A;  2JS2 A;  2RD1 A;  2DX1 A;  2DD4 A;  1SEM A;  2VUB A;  2MYS A;  4KGX B;  2E6Z A;  4BY6 C;  3GBQ A;  3CC2 A;  3ZEH A;  4M78 B;  4Z8A A;  4ATO A;  1C1A A;  1Y7X A;  3SD4 A;  4J6Y A;  4C0Z A;  1VQ9 A;  1Q81 R;  1X2K A;  3ZFJ A;  4ZTF A;  4NS5 A;  2E1H A;  1Q7Y U;  1LCK A;  3CCQ Q;  5CK9 A;  1UDL A;  4L5G A;  3WVE B;  4EMK A;  2KYM A;  1ZX6 A;  2C06 A;  2E6N A;  2K9G A;  3M4G A;  2ROL A;  4F7U F;  4ZNX A;  4C92 B;  2DTO A;  1G2B A;  2EJF A;  3CC4 A;  1TG0 A;  3E9F A;  5KYY B;  3QKJ A;  3X20 B;  1QVG S;  2DD5 A;  1AD5 A;  3OYL A;  2K5I A;  1UHC A;  4QVD A;  2RI3 A;  4DBQ A;  5I21 A;  1QWF A;  4QQ6 A;  2PU9 B;  4ZTJ A;  5HKC A;  4J5Y A;  2EKO A;  2Y90 A;  1X43 A;  2YRC A;  1W2B S;  3OYJ A;  2RB6 A;  1NLP C;  1AWX A;  1VQO T;  3VS7 A;  2KI7 A;  3LH5 A;  2D0Q B;  2BUD A;  2EW3 A;  1N8R R;  2EJG A;  1UUE A;  1Q86 C;  1W70 A;  2R5A A;  3VYH B;  4J83 A;  2F2W A;  2I0N A;  1K9M C;  2PVO B;  1PWT A;  5KE3 A;  4LD6 A;  2NUZ A;  4ZN1 A;  2DL8 A;  3CCL T;  2V8J A;  3V7S A;  4LUE A;  3PMT A;  2BIV A;  2ED1 A;  3CCS A;  2CP7 A;  5GAN 8;  3LGL A;  3RR6 A;  2QXF A;  1I07 A;  2J05 A;  1A0N B;  3DLL A;  1PD1 A;  3LWI A;  1Q82 U;  1OU9 A;  1FWZ A;  3BE3 A;  3H0I A;  1BB9 A;  3KFV A;  2ED0 A;  1TSF A;  4XU0 A;  2M02 A;  2MK5 A;  8ATC B;  2YT6 A;  2L3S A;  4F7U G;  2AHJ B;  1M27 C;  1SRM A;  3LX7 A;  3JCM b;  2K7A A;  3CME A;  2MWP A;  4RG8 A;  5KH6 A;  3J7A F;  3JAM E;  5GJV B;  4CC3 A;  4RKU E;  2EFI A;  3EHQ A;  2FYK A;  2L89 A;  3OBW A;  3OYY A;  1IGQ A;  1EX4 A;  2P4R A;  4OVA A;  1D3B B;  1SF9 A;  3EFO B;  1W6X A;  3H6Z A;  3HRS A;  4N4I A;  1VQ7 T;  1PSF A;  1OX8 A;  5C6S A;  5KYW B;  3T9N A;  3PGG A;  1VQ4 Q;  1NJI C;  3OS2 A;  1I81 A;  1BI3 A;  1UGQ B;  1Y0M A;  3ZBD A;  5GMK i;  1BIB A;  1M1K U;  2F1L A;  2EYX A;  1FX7 A;  1YWP A;  2DK3 A;  4M7A B;  1JXM A;  3MEW A;  3OSS C;  2QAS A;  1RL2 A;  1VOM A;  4Z02 A;  1V1C A;  1Z9Z A;  2FVU A;  3JCM Q;  3CCE T;  2LX7 A;  1NYF A;  1RAD B;  5GMK l;  3UDC A;  2CUD A;  2QI2 A;  1S72 A;  4FT2 A;  1IRX A;  2ROT A;  1WZO A;  1GFD A;  1VQ6 T;  1M8V A;  2DAQ A;  2XDB A;  2GF7 A;  3TEE A;  2NUP B;  2CZ1 B;  1I8F A;  2MCN A;  1GFC A;  1DJ7 B;  4A4K A;  1BI1 A;  1Z9Q A;  1YHQ A;  3RES A;  1M5Q 1;  3N5B B;  4HKE A;  3OBY A;  3G4S A;  1R77 A;  1U3O A;  4PFP A;  2DVJ A;  2RJF A;  2RMO A;  4M77 B;  2GGR A;  1VQ9 Q;  1E6G A;  5CO7 A;  1UEC A;  2L2P A;  3OS0 A;  3JB9 F;  3OQ5 A;  1FMK A;  2KDS A;  1LJO A;  2J6O A;  1OZ3 A;  3A98 A;  2NUT A;  1RI9 A;  3LH0 A;  4QQD A;  3A1P A;  4PJL A;  2EQU A;  3FLG A;  2OI3 A;  1U06 A;  4BDY A;  3CBO A;  3CC4 Q;  5I2S A;  3SEM A;  4II1 A;  2E12 A;  2GTO A;  1G3T A;  2MOX A;  2LNV A;  3SWN A;  2F2V A;  1JO8 A;  2O01 E;  1PCX A;  2GFU A;  2LJ0 A;  1M8M A;  4EIK A;  2DNU A;  2HDA A;  1C0M A;  1IB8 A;  2RHZ A;  4KGV B;  3TU4 K;  1B07 A;  1CSK A;  1J3T A;  1YIJ T;  7AT1 B;  2YRV A;  3SB2 A;  3RIR A;  3P8H A;  2KRO A;  4HXJ A;  3A8L B;  4QVZ A;  2JM8 A;  2RM4 A;  1OPK A;  1RAB B;  2XU8 A;  2PVD B;  5LJ5 e;  3PIP A;  3JB9 H;  3DLM A;  3A8M B;  2O31 A;  2QEX A;  1WX6 A;  1RAI B;  3CCS Q;  1VYV A;  2CZ6 B;  1LNX A;  3DB3 A;  2W10 A;  3S3M A;  3CCU T;  3CCJ A;  2KQW A;  3AHU A;  5GAN e;  4LDX A;  3BDL A;  2C0O A;  2EYY A;  2H3J A;  1IO6 A;  3QO3 A;  1BCM A;  5CKH A;  1K8A U;  2JUF A;  4AMC A;  2CP6 A;  4HVW A;  2HL3 A;  3HP9 A;  5CKB A;  4C5I A;  1G3W A;  1OV3 A;  2DVE A;  4FW2 A;  1UEB A;  1QP2 A;  4J6X A;  4A4H A;  5GAN 2;  2LT1 A;  5CKE A;  1WFW A;  2KNB B;  1RLP C;  2SEM A;  3OYE A;  1PKS A;  1YI2 A;  3CME Q;  4RG2 A;  2ZGW A;  4MZP A;  2J7I A;  4HT9 A;  5FWC A;  2JMC A;  2OJ2 A;  5IAY A;  1NEB A;  2IPO B;  4L6V 5;  2DZ9 A;  3NFC A;  2DL3 A;  2SRC A;  2VC8 A;  1M1K C;  2O4X A;  3OYI A;  3JSC A;  3M54 A;  2A7Y A;  4ELY C;  3EH2 A;  2LP5 A;  2RHU A;  4BE1 A;  4DEX A;  1M3A A;  2COW A;  2DZC A;  4R55 A;  1SRL A;  2LJ1 A;  2M1H A;  3VJP A;  1KD1 R;  3VS3 A;  1X69 A;  5AT1 B;  3JCM J;  2AZV A;  2X9H A;  3M59 A;  1KFZ A;  1MUZ A;  4WCI A;  3CMA T;  2MWO A;  1S72 Q;  1VQK T;  4IKF A;  1SPK A;  2LJ3 A;  3NPF A;  2LNH B;  1H92 A;  4JJB A;  4DOV A;  1RI0 A;  3V8L A;  3GIB A;  3TVT A;  1N8R C;  3OMC A;  1M2V A;  2E3I A;  2OTJ T;  2PTK A;  1NZ9 A;  1WXT A;  4JPB W;  4PJO D;  1QKX A;  2V1R A;  4JZ4 A;  2RJC A;  5IT9 E;  4KH1 B;  5KYX A;  1YHQ Q;  2LTO A;  5GAO m;  3G4S Q;  3FIF A;  2D0N A;  2RJE A;  4N4H A;  3TSW A;  1B34 A;  2C0I A;  3UT1 A;  3CC7 T;  1M1G A;  3UA6 A;  2KRN A;  4HA8 A;  1SKU B;  1YJN T;  2O9V A;  4CC2 A;  3I56 A;  3EFS A;  4F7U B;  2EGA A;  2PUK B;  2Y4Y A;  4MMK A;  3KUF A;  2XDP A;  3CCR Q;  4JDS A;  1I4K 1;  3M58 A;  2DXT A;  3JB9 J;  5LJ3 j;  3CPW P;  5KYU B;  4J9E A;  4A4E A;  2RQW A;  1AWJ A;  4B6M A;  1T3S A;  1VQL A;  2JTM A;  2KE9 A;  3NTH A;  2RI5 A;  2NYS A;  2QDL A;  4LE9 A;  2LQ8 A;  1VQP A;  4M75 D;  4PJO A;  5GAN h;  1RAG B;  4HCB A;  3INZ A;  1PD0 A;  2KGT A;  1OU8 A;  2HQH A;  2RO0 A;  4EPC A;  4PFO A;  5GMK j;  5DLO A;  1RAE B;  4F14 A;  2X4J A;  2XHC A;  4O6J A;  2KXC A;  1ZUY A;  1KSW A;  4UC4 A;  2RHX A;  2AKL A;  2J6K A;  2QEX Q;  2PZ1 A;  2LRQ A;  1TOV A;  5LJ3 g;  1K8A C;  1T3L A;  3BDU A;  2VGM A;  1KQ1 A;  2VXF A;  3CCJ Q;  4J9C A;  3S3O A;  3QDF A;  4M75 E;  3CPW A;  1M3B A;  3M0P A;  2FG0 A;  4CC7 A;  3G71 T;  4JRI A;  2HQX A;  2ECZ A;  2VWF A;  4BUG A;  3OSV A;  3C4S A;  1WYX A;  3UF4 A;  1GCQ A;  1WNL A;  3L2W A;  4PNO A;  2QA4 Q;  3G7Z A;  2PVG B;  3ZL7 C;  3EHR A;  5EG2 A;  4FSX A;  1YI2 Q;  3PE0 A;  3FJP A;  3CCV A;  2CSQ A;  4ZGD B;  3AT1 B;  3MET A;  4DBF A;  4PKC C;  1IZ6 A;  1VQN T;  2KT1 A;  3C12 A;  4NL2 A;  4M75 A;  3JCM V;  4E7I A;  5A2Q E;  5IXF A;  3MO8 A;  2E64 A;  3CCM Q;  3M4Y A;  3P8B B;  4RCC A;  1WLP B;  4PJN A;  5CR2 A;  2K5L A;  2ZPB B;  3BFM A;  1TH7 A;  2PNI A;  4FU6 A;  2BE7 D;  4M78 A;  5D6W A;  3GNG A;  3SHW A;  1X6O A;  4PFZ A;  2DPP B;  5IHK A;  4N0A C;  3JCM X;  4ZGE B;  3M0S A;  3QWY A;  2I2L A;  4C8Q C;  1IGU A;  1QVF P;  1GCP A;  2VYT A;  1WXB A;  1N6A A;  3PVQ A;  2XI9 A;  3VS1 A;  3WXM B;  2CSI A;  4FIB A;  4AG2 C;  4BI4 A;  4C92 A;  3BW1 A;  4A54 A;  3VV0 A;  3OS5 A;  1H3Z A;  2JTE A;  2A36 A;  3M0Q A;  3O5Z A;  1NPR A;  3X26 B;  3S3N A;  5GAN 7;  4ESR A;  4Y91 A;  2DL4 A;  4C8Q D;  5A0L A;  4EMK B;  1WHG A;  4XK8 E;  5DLQ E;  1JU5 C;  1M4Z A;  2ZPF B;  3RKW A;  3OYF A;  4C5H A;  1WJS A;  2J6F A;  2CZ7 B;  4DQ2 A;  1YJW A;  1WI7 A;  1QQJ A;  5GAM g;  2CP5 A;  2MF2 A;  3HPW A;  3I55 T;  2L0A A;  5FRO A;  2BKD N;  3VYG A;  5GMK h;  2DO3 A;  4X9D A;  2ZZD A;  2P0K A;  1YNZ A;  3I56 Q;  4LUD A;  4OB3 B;  1OOT A;  1WJQ A;  1QVF A;  2JS0 A;  4CC4 B;  4C8Q E;  4JZ3 A;  3IQL A;  2OTL Q;  5IHN A;  1VQ7 A;  3FDR A;  2LQW A;  4IUV A;  4B9W A;  2RF0 A;  1SHG A;  3CC2 T;  4A53 A;  1M90 R;  5I2M A;  1LOJ A;  4PJO F;  1SG5 A;  5KE2 A;  2HCK A;  2DJZ A;  3GPL A;  3M0U A;  3REA B;  4FYX B;  1VQL Q;  1EIF A;  2L8D A;  3UA7 A;  2DXC A;  3DB4 A;  1KJW A;  3PFS A;  4MZM A;  2F5T X;  4Z89 A;  2FO0 A;  3L42 A;  2KSS A;  1VQP Q;  1JQQ A;  3FB9 A;  2W0Z A;  1BYM A;  3HTR A;  4N0A A;  2CT4 A;  2K4Y A;  1ZA2 B;  2MI6 A;  4C8Q A;  4BY6 B;  2M0Y A;  4FW1 A;  1BU1 A;  1VQM T;  3ASK A;  2P0P A;  2GBQ A;  1KD1 C;  4XTV A;  1PG5 B;  4M7D C;  1WHJ A;  1VQ8 T;  2JXB A;  1D3B A;  3SWN C;  3EFO A;  1M30 A;  2CYZ B;  2WAC A;  1B7T A;  5I22 A;  3QG1 A;  3SDZ A;  3V8J A;  1Q81 U;  3X24 B;  3H9N A;  5FU7 C;  2PUO B;  5KYW A;  1N27 A;  1UGP B;  1Y71 A;  2J06 A;  1E7O A;  2RA2 A;  3JCM W;  3RKY A;  4M7A A;  3LWH A;  2F5K A;  3QBY A;  5CKF A;  4C0G A;  3MEV A;  3A8O B;  4M75 F;  4JJC A;  2LQN A;  4M7D D;  4MDW A;  3I9Q A;  3TQ7 P;  4HCC A;  1TTH B;  1U8R A;  1O9S A;  2L5Q A;  2LX9 A;  1NE8 A;  5DM7 R;  2CH4 A;  4XU1 A;  1PHT A;  3CCV Q;  2DLP A;  2XK0 A;  4TVR A;  1QVF S;  4PLL A;  2DXB A;  1UGV A;  3CXC P;  4FT4 A;  2RQU A;  1G5V A;  2KEA A;  5FLX E;  2P4T A;  3I35 A;  3LGF A;  1ACM B;  3NGP A;  3V7R A;  4EDU A;  1N9R A;  2JTF A;  2QQR A;  2DFU A;  2RNA A;  1N8R U;  4PL6 A;  3JRZ A;  4M7D E;  5LL6 S;  5CVI A;  2XIC A;  4JJD A;  1CKA A;  1ZUU A;  1WHL A;  1S1N A;  2HNI A;  4C92 F;  5LJ3 d;  4PLI A;  3UWN A;  4M77 A;  3CME T;  3E19 A;  1GXI E;  2D8H A;  6AT1 B;  2DER A;  2L3R A;  4JS4 A;  2EBP A;  2DL5 A;  3X28 B;  2C0T A;  1PM3 A;  4FCY A;  5D6X A;  2LT4 A;  4E6R A;  2E70 A;  4HVV A;  1UFF A;  3L1A A;  2DIL A;  2YDL A;  4ZN3 A;  4FSS A;  5GAO q;  2VAS A;  2QGF B;  3CCU A;  3CCR A;  2D6F A;  5GMK m;  3RBB B;  2B86 A;  1WA7 A;  4CRI A;  1KG1 A;  4M7D A;  3CXC A;  2YHT A;  1HXD A;  4RTU A;  1B3Q A;  3L2Q A;  2ENM A;  2JW4 A;  2M16 A;  3M53 A;  2ZCF B;  3PVL A;  1HK9 A;  2HBP A;  1NLO C;  1K73 R;  2NUT B;  3R6O A;  4V2S A;  2ZPE B;  4M75 G;  5FU6 C;  3EG1 A;  3M0T A;  1YJW Q;  1TWB A;  2E4H A;  2XG8 D;  4FYW B;  1KIK A;  1S72 T;  3QDR B;  2V8K A;  3EGU A;  3U23 A;  1WQ7 A;  2R5M A;  2VKN A;  3CEY A;  2H3E B;  2IVW A;  3QYG B;  1VQ7 Q;  2F2X A;  1HJD A;  1XJW B;  1AOJ A;  4RTX A;  5IN1 A;  5HY6 A;  1O75 A;  4A4F A;  1OQK A;  2M51 A;  3HFO A;  1K9A A;  3G4S T;  2E5Q A;  3J81 E;  1AT1 B;  4C8Q F;  2X3W D;  2R57 A;  5CIU A;  3HKS A;  4GLK A;  1K0X A;  1FYN A;  2HKQ B;  5FRM A;  2JM9 A;  2ZAE A;  1WDX A;  4C0D C;  2VXE A;  4KT0 E;  3JB9 G;  2NLU A;  3KBG A;  3CMA A;  4E7J A;  3RMS A;  1VQK A;  3MEA A;  1ABQ A;  1VUB A;  2LVM A;  4WTO B;  4KUI A;  2QA4 A;  1Q86 R;  1D0X A;  2RI2 A;  4L59 A;  3EFR A;  1K9M R;  5GAM d;  1GL5 A;  3S6W A;  2KBT A;  4D8D A;  2K2M A;  2AT1 B;  2LC4 A;  1Q81 C;  1X27 A;  2AIR B;  3CPF A;  1R0B G;  4OMM A;  3A8H B;  1K0S A;  4FM4 B;  3EGX B;  4JLG A;  3MP6 A;  3RNJ A;  2KMT A;  3EGD B;  4RTY A;  3CCM A;  4OML A;  3J80 E;  1JRI A;  4RMO A;  1TU0 B;  4OMQ A;  1YIT T;  3QWX X;  2AKK A;  1ZSZ C;  3GP8 A;  5GJW B;  3RDV A;  1UB4 A;  1EFN A;  4HCZ A;  3I5S A;  4RTV A;  2O4X B;  4PJO C;  1AEY A;  4N4G A;  3HRT A;  4D6W A;  2FPF A;  4KH0 B;  5LJ3 f;  4O5V A;  2QQ9 A;  3EG9 A;  4NL3 A;  2G3R A;  4JLI A;  5FU6 B;  5LJ5 g;  1VYU A;  2FRW A;  4VUB A;  2XMF A;  1YJ9 A;  4C8Q G;  2HQE A;  2XKO C;  4OMF B;  1KQS P;  4M77 F;  4AT1 B;  2KR3 A;  3G6E T;  2EPD A;  3NMZ C;  4GBQ A;  3TSZ A;  2LCS A;  4E2F B;  4DA4 A;  1IHW A;  1ARK A;  3JCM g;  2YWW A;  4AFU C;  4QQG A;  4J9G A;  1YIJ Q;  2YLC A;  1KC8 R;  1ZBJ A;  4K11 A;  4OB1 B;  3P8D A;  5GAN 5;  1RLQ C;  2O2O A;  2R58 A;  1NJI R;  5HK3 A;  2Z0W A;  1M2O A;  4PJJ A;  1TUC A;  2CP0 A;  2D9T A;  2E10 A;  5LJ3 e;  2E5K A;  1GCQ C;  2QTX A;  4M7D F;  2E3H A;  3EH1 A;  3VS0 A;  1Y96 B;  2JNG A;  2WSE E;  5FW9 A;  5KYX B;  3CD6 T;  1D0Y A;  2K2V A;  1UG1 A;  2X4X A;  3EG0 A;  4IUR A;  4E7H A;  1SSF A;  1OYX A;  4P5N A;  1G3S A;  4RTW A;  2RHY A;  3OYC A;  4PJO E;  2EYZ A;  2VV5 A;  3CCU Q;  1RAA B;  4Y92 A;  2OTL A;  3DKM A;  4D8K A;  3H41 A;  3RKX A;  4M75 C;  3ER0 A;  3OYA A;  2O88 A;  1YBY A;  1FMW A;  4IIM A;  2RQT A;  1BI2 A;  1Y07 A;  1VQ5 A;  1UGS B;  3G71 A;  9ATC B;  5KYU A;  1KQS A;  4HT8 A;  1GBQ A;  3VUB A;  1H3H A;  1T0H A;  5GMK e;  5GAN 4;  2YUN A;  2KRM A;  2COZ A;  5AYF A;  5GAN 3;  1VIF A;  4M78 C;  4M4Z A;  5CKD A;  3THK A;  1QVG P;  2CUB A;  4B9X A;  1ZSZ A;  3CCQ T;  1Q7Y R;  4YTL A;  2ZPI B;  2DIG A;  5IH2 A;  1CKB A;  2JN0 A;  1NBE B;  3QUI A;  4OMP A;  1ZQ1 A;  1VQN A;  4E7S A;  2GFA A;  3QSU A;  1QP3 A;  3QZ9 B;  3ME9 A;  3MCA B;  4OMN A;  2M9U A;  3EG2 A;  2XD0 A;  4LDV A;  2KT8 A;  4X34 A;  4LD9 K;  4C92 C;  2X4W A;  4JRQ A;  3VKI A;  4JRP A;  4M78 D;  1BK2 A;  2FB7 A;  2JZ2 A;  5L8R E;  3JV3 A;  1LPL A;  2X3X D;  2HMA A;  5GAM f;  5KCO A;  2FPD A;  3I5R A;  1KD1 U;  1PSE A;  1RAC B;  1T0J A;  2DYB A;  1G8X A;  2DF6 A;  4M7D G;  4C92 D;  3CMA Q;  2VGN A;  1VQK Q;  2OAU A;  3GOX A;  3M9Q A;  1IHV A;  4C5G A;  4ELZ C;  3REB B;  3OYH A;  1QVG A;  2DXU A;  3E9G A;  4M78 E;  1NYG A;  5GAO n;  3A5Z B;  4LDW A;  4OB2 B;  2KAF A;  1IXD A;  1YCS B;  1JB0 E;  2DTI A;  4IUT A;  4XTX A;  2ZPG B;  3NHN A;  4R0K A;  2DTH A;  3NTI A;  3WVD B;  1VQL T;  2DE0 X;  1YFN A;  2ABL A;  1Q82 R;  2E41 A;  1VQO A;  4C92 E;  2QAZ A;  4OMO A;  2DRM A;  1MGQ A;  3H0F A;  3I55 A;  2CT3 A;  3L2Z A;  4HCK A;  4ME7 A;  1OUL A;  2V8I A;  1R0C B;  5IXB A;  2EJ9 A;  2EGC A;  1YJN Q;  2DBM A;  1D0Z A;  4M75 B;  5GAM j;  4Z88 A;  2KYB A;  4DBR A;  2GQI A;  2H8H A;  1NEG A;  1XOV A;  4DOW A;  1WQW A;  1U1T A;  1K73 C;  2EYW A;  5CAI A;  3CCL A;  2EVR A;  3CQT A;  4OGE A;  4LNP A;  2GCX A;  5C0M A;  2X51 A;  5LJ3 h;  1M1F A;  2VB6 A;  1YJ9 Q;  2CP2 A;  2BTT A;  1FXX A;  3OYD A;  1QCO A;  1VQ4 T;  5KYY A;  2HAX A;  3FEO A;  1PRL C;  3OA6 A;  2CS7 A;  1ZA1 B;  2XID A;  1E6H A;  1M1K R;  2LCC A;  2GTJ A;  4RCB A;  3CPW S;  3G1J A;  1NG2 A;  1RAF B;  4BI3 A;  4MZT A;  4M7A C;  2K57 A;  3HL8 A;  4AFQ C;  4AFZ C;  4F17 A;  4JRK A;  1PNJ A;  3CCV T;  1VQM A;  2DRK A;  5KCH A;  1OZ2 A;  4KRT A;  4RUG A;  3URG A;  5IHI A;  4QT7 A;  3RMQ A;  3MP8 A;  1JEG A;  1HSQ A;  3M0R A;  2VVK A;  2K3X A;  1P92 A;  3E2U A;  2LQK A;  1VQ8 A;  1X2Q A;  3OYB A;  2QQA A;  4E7K A;  4M7A D;  2ESW A;  4OGC A;  2HZY A;  4NOY A;  4F04 B;  5FWB A;  1VQ5 Q;  3G71 Q;  1AHJ B;  1W4S A;  1Q95 G;  2QK0 A;  2EYQ A;  5LJ5 d;  1VQ9 T;  4J8O A;  5CQX A;  3CCE A;  1K1Z A;  1KHI A;  2DKG A;  4M77 C;  3VUZ A;  1SHF A;  3JCM d;  3C94 A;  1QCF A;  5ECA A;  5GAN d;  1VQN Q;  4M7A E;  5CCA A;  1VQ6 A;  1EZZ B;  3CC4 T;  1TUD A;  2BZY A;  1AWW A;  1BCO A;  3PIO A;  4RTT A;  1MV3 A;  2CKK A;  3V8K A;  1U1S A;  2HD0 A;  2MMP A;  1W1F A;  3L2V A;  4X9C A;  5GAO r;  4M77 D;  4DBH A;  5I11 A;  4HVU A;  2FRY A;  1D1A A;  2A08 A;  3QHS A;  4C8Q B;  1WHH A;  2HSE B;  2FL7 A;  1F1B B;  3MPU B;  1YJW T;  1V76 A;  2RJD A;  1WIE A;  2EWN A;  5GAM h;  1HD3 A;  1JJ2 P;  2D1X A;  3TRE A;  4Q5W A;  2DIQ A;  2FEI A;  3MHX A;  2FZC B;  1X01 A;  1N5Z A;  1HYO A;  1V29 B;  3UPU A;  4C5E A;  1OI1 A;  1KC8 C;  2V1Q A;  2K6D A;  4BE0 A;  1AZG B;  1BBZ A;  2LCL A;  2GNC A;  4M77 E;  3OW2 P;  4KUL A;  4PJM A;  1VYT A;  5HCK A;  4LN2 A;  3FRN A;  4BDZ A;  3FJ5 A;  4BB7 A;  3RER A;  3CCS T;  2EAY A;  1X6G A;  2RQV A;  2LDM A;  2KY9 A;  4PJO G;  2EGE A;  1AZE A;  3M55 A;  4M78 F;  1PKT A;  2YUO A;  2RN8 A;  4KUD K;  1RAH B;  2EIF A;  4Y28 E;  2NUP A;  1BI0 A;  2CP3 A;  3QPH A;  1GBR A;  1VQO Q;  1UHF A;  2KRS A;  1K8A R;  5DY9 A;  3I55 Q;  1YIJ A;  2GQV A;  2YXY A;  1VIE A;  2RH2 A;  2HBW A;  3GLX A;  1AWO A;  1AVZ C;  5J39 A;  2EQK A;  1JJ2 A;  3MKD A;  4IUU A;  2IIM A;  3CCL Q;  2ZPH B;  4XTY A;  3CC2 Q;  1M90 U;  2A3L A;  2JJ9 A;  1Q7Y C;  2CZ0 B;  3OYG A;  1QCN A;  3JB9 I;  3OW2 A;  1K76 A;  4JUV A;  1U5S A;  1MMG A;  1MMA A;  3M56 A;  4OB0 B;  1D1C A;  3E1S A;  4XTU A;  4XU3 A;  2HL5 C;  2QQS A;  1YCY A;  2QDY B;  3TCJ A;  4A4G A;  1UGR B;  2DL7 A;  3NTK A;  4OP0 A;  1I0C A;  2OX7 A;  1M9S A;  2XDD A;  4MML A;  2WSC E;  3OYK A;  5LJ5 f;  3QJY A;  1UTI A;  4M7D B;  1VQM Q;  2DEU A;  2YSQ A;  3SWN B;  2L3P A;  1WJR A;  1H8K A;  1ZBX A;  3VS2 A;  4M78 G;  3VS5 A;  5D6Y A;  5FU7 B;  4AG1 C;  4C0F A;  1VQ8 Q;  3JCM f;  4BE2 A;  4GY5 A;  2HEQ A;  1QVP A;  4QVC A;  4J7F A;  5GAN f;  2G6F X;  1TUG B;  3MEU A;  3MJX A;  1YIT A;  1YHQ T;  1XQH A;  4E7Z A;  2CRE A;  3GNF B;  2DA9 A;  1UJY A;  2YLB A;  1YWO A;  3L2U A;  3H8Z A;  4XU2 A;  3LLR A;  2P84 A;  4C92 G;  2JT4 A;  2DBK A;  2EQI A;  3QJ6 A;  2AK5 A;  2F69 A;  3CCE Q;  2B8A A;  3ULR B;  1MMN A;  5L23 A;  3GF5 A;  1ZLM A;  1Q82 C;  1I5L A;  2BE9 B;  1JJ2 S;  2JVV A;  8AT1 B;  5FRN A;  4FYY B;  3JCM e;  5J26 A;  2YUQ A;  2X4Y A;  2KK4 A;  3CCR T;  1TXQ A;  2OTJ A;  1VQ6 Q;  2BZX A;  3G6E A;  2D8J A;  3OW2 S;  2K3B A;  2BZ8 A;  5LJ5 j;  1WXU A;  3VRY A;  4PK4 A;  1UJ0 A;  2YUP A;  4M7A F;  3CBM A;  4ORZ A;  2MIO A;  4IUP A;  4BAC A;  4MDX A;  3EGX A;  1OX9 A;  2CGH A;  1D1B A;  1C6V X;  1N9S A;  1WHK A;  3CXC S;  4BD3 A;  4GLM A;  3EGD A;  1KQ2 A;  3QZ5 B;  4E7L A;  1ZSG A;  1PC0 A;  4AFS C;  3VU3 C;  5GAN j;  3HSB A;  3CC7 A;  4EMG A;  4ANJ A;  5CQY A;  3BY7 A;  3LYI A;  3CD6 A;  3OS1 A;  1YJN A;  1JXO A;  1MMD A;  2IG0 A;  2CH4 W;  4J9I A;  2EQJ A;  1IRE B;  5GAO l;  2X35 A;  3M5A A;  2PQW A;  3Q1J A;  2FZK B;  4LDU A;  3OY9 A;  5M9O A;  1QKW A;  2QEX T;  1MV0 B;  2WSF E;  1FMV A;  2JMA A;  1OEB A;  1K73 U;  3CCJ T;  2DJQ A;  3HRU A;  4FYV B;  2QG9 B;  3C0C A;  4F7U E;  1X75 C;  1UE9 A;  4J9B A;  3FC3 A;  4KGZ B;  3CCQ A;  4EMH A;  3EG9 B;  5GAN g;  1X6B A;  2MAM A;  2K79 A;  1BKB A;  1MHN A;  1M2V B;  2QYZ A;  4J6W A;  2QA4 T;  3V7C A;  2NWM A;  1M90 C;  3QII A;  3F70 A;  1YI2 T;  3OB9 A;  3VS6 A;  1ABO A;  1G3Y A;  1Y96 A;  3D7S B;  2COY A;  3LW5 E;  4ZGJ B;  2RQR A;  4M7A G;  2RPN A;  5KYN A;  4XAX B;  4F7U A;  1WHM A;  4A63 B;  2DM1 A;  4C0D B;  3CCM T;  1XTD A;  1B34 B;  1LVK A; 
#chains in the Genus database with same CATH homology
 2EYW A;  2J06 A;  2O31 A;  1E7O A;  2EVR A;  2O9S A;  1WX6 A;  3CQT A;  3H0H A;  4LNP A;  1VYV A;  2W10 A;  1Y57 A;  2EKH A;  4JJC A;  2LQN A;  3I9Q A;  2C0O A;  2EYY A;  2BTT A;  2CDT A;  1IO6 A;  1PRL C;  2KXD A;  2CH4 A;  1PHT A;  1K4U S;  1ZUK A;  1E6H A;  2DLP A;  4DEY A;  3UAT A;  4HVW A;  4J9D A;  2GTJ A;  2LZ6 B;  1OV3 A;  1UGV A;  2RQU A;  1NG2 A;  2HSP A;  3VRZ A;  2KEA A;  1QWE A;  3I35 A;  3NGP A;  4AFQ C;  1I1J A;  1WFW A;  3EG3 A;  4AFZ C;  2KNB B;  1RLP C;  2SEM A;  1PRM C;  1PKS A;  3VS4 A;  2A28 A;  2RNA A;  4F17 A;  1PNJ A;  2DRK A;  2J7I A;  4F16 A;  4KRT A;  4RUG A;  5IHI A;  4QT7 A;  5FWC A;  2JMC A;  1JEG A;  2OJ2 A;  1NM7 A;  1SSH A;  1HSQ A;  3M0R A;  2AZS A;  2VVK A;  1NEB A;  4JJD A;  1CKA A;  2DL3 A;  2SRC A;  5EC7 A;  1ZUU A;  1QLY A;  1S1N A;  1X2Q A;  2D8H A;  2LP5 A;  2DMO A;  2ESW A;  2EBP A;  2DL5 A;  4DEX A;  4J9H A;  2C0T A;  1M3A A;  5FWB A;  4E6R A;  4HVV A;  1SRL A;  1UFF A;  1YP5 A;  2A37 A;  2LJ1 A;  2DIL A;  2YDL A;  4FSS A;  4RTZ A;  3VS3 A;  1X69 A;  3RBB B;  2B86 A;  1WA7 A;  2AZV A;  2FPE A;  1K1Z A;  2LMJ A;  1VA7 A;  1KFZ A;  1MUZ A;  4WCI A;  4RTU A;  1SHF A;  1B3Q A;  1OPL A;  2ENM A;  1SPK A;  1G83 A;  2LJ3 A;  2JW4 A;  2LNH B;  3NPF A;  4IIO A;  1QCF A;  4J9F A;  4JJB A;  3R6N A;  5ECA A;  3PVL A;  1NLO C;  3TVT A;  1GRI A;  2PTK A;  1YN8 A;  1WXT A;  4JPB W;  2OAW A;  1TUD A;  3EG1 A;  2BZY A;  1AWW A;  3M0T A;  4RTT A;  1MV3 A;  1QKX A;  2V1R A;  1KIK A;  1RUW A;  4JZ4 A;  1M3C A;  4X1V A;  1W1F A;  2L3Q A;  3EGU A;  2JS2 A;  5I11 A;  4HVU A;  2FRY A;  2A08 A;  3U23 A;  2DX1 A;  2D0N A;  2VKN A;  1SEM A;  3TSW A;  2C0I A;  2F2X A;  1WIE A;  1HJD A;  1AOJ A;  1HD3 A;  3GBQ A;  4RTX A;  2D1X A;  3UA6 A;  2KRN A;  2FEI A;  2M51 A;  1K9A A;  2O9V A;  4CC2 A;  4Z8A A;  1N5Z A;  2EGA A;  2X3W D;  2V1Q A;  2K6D A;  1AZG B;  1X2K A;  1BBZ A;  1K0X A;  1FYN A;  2JM9 A;  1WDX A;  2GNC A;  1VYT A;  5HCK A;  1LCK A;  4LN2 A;  1UDL A;  3FJ5 A;  1X6G A;  2RQV A;  2KYM A;  4J9E A;  1ZX6 A;  1ABQ A;  2EGE A;  1AZE A;  2K9G A;  1PKT A;  2ROL A;  2RQW A;  1AWJ A;  2YUO A;  4ZNX A;  2RN8 A;  1T3S A;  1G2B A;  1GBR A;  1TG0 A;  2KE9 A;  1UHF A;  2KRS A;  1AD5 A;  2QDL A;  4LE9 A;  1UHC A;  1GL5 A;  2KBT A;  4D8D A;  2K2M A;  1QWF A;  1X27 A;  4OMM A;  2HBW A;  1K0S A;  1X43 A;  1AWO A;  2KGT A;  1AVZ C;  3RNJ A;  1NLP C;  1AWX A;  4RTY A;  4F14 A;  4OML A;  3VS7 A;  3LH5 A;  2KXC A;  2EW3 A;  2IIM A;  4OMQ A;  1ZUY A;  1KSW A;  3QWX X;  1UUE A;  2AKL A;  1W70 A;  2J6K A;  2AKK A;  2PZ1 A;  5GJW B;  2F2W A;  1EFN A;  2I0N A;  1T3L A;  3I5S A;  4RTV A;  1K76 A;  1PWT A;  4J9C A;  1U5S A;  1AEY A;  2NUZ A;  2FPF A;  1M3B A;  3M0P A;  2DL8 A;  2FG0 A;  4CC7 A;  4LUE A;  2ECZ A;  2ED1 A;  2VWF A;  1VYU A;  2FRW A;  2DL7 A;  1WYX A;  1I07 A;  2J05 A;  3UF4 A;  2XMF A;  1GCQ A;  1I0C A;  1A0N B;  3ZL7 C;  3EHR A;  2KR3 A;  2EPD A;  3NMZ C;  3H0I A;  3PE0 A;  4GBQ A;  2LCS A;  3TSZ A;  1UTI A;  1ARK A;  1BB9 A;  1H92 A;  4AFU C;  2CSQ A;  3KFV A;  4J9G A;  2ED0 A;  2YSQ A;  1ZBJ A;  2L3P A;  4K11 A;  1H8K A;  1RLQ C;  2YT6 A;  2O2O A;  3VS2 A;  2L3S A;  2KT1 A;  3VS5 A;  4AG1 C;  1M27 C;  1SRM A;  2HEQ A;  2K7A A;  1TUC A;  5IXF A;  2G6F X;  2E5K A;  1GCQ C;  1WLP B;  5GJV B;  4CC3 A;  3EHQ A;  3VS0 A;  5FW9 A;  1UG1 A;  2CRE A;  3EG0 A;  2DA9 A;  1UJY A;  2PNI A;  1YWO A;  2P4R A;  4RTW A;  2EYZ A;  1W6X A;  3SHW A;  4Y92 A;  5IHK A;  2JT4 A;  2DBK A;  2EQI A;  4D8K A;  3H41 A;  2AK5 A;  3M0S A;  3QWY A;  3ULR B;  2O88 A;  4IIM A;  2RQT A;  1Y0M A;  5L23 A;  1GCP A;  1ZLM A;  2EYX A;  1YWP A;  1WXB A;  1GBQ A;  1JXM A;  3PVQ A;  1T0H A;  1H3H A;  2YUQ A;  3VS1 A;  2YUN A;  2KRM A;  1V1C A;  1Z9Z A;  2CSI A;  4AG2 C;  2LX7 A;  4M4Z A;  3THK A;  2CUB A;  2JTE A;  2BZX A;  1NYF A;  2A36 A;  3M0Q A;  3O5Z A;  2D8J A;  2CUD A;  2K3B A;  2BZ8 A;  5IH2 A;  1CKB A;  1WXU A;  4ESR A;  3VRY A;  1UJ0 A;  2DL4 A;  2YUP A;  2ROT A;  4ORZ A;  4OMP A;  1GFD A;  2MIO A;  1JU5 C;  4GLM A;  2J6F A;  4OMN A;  1ZSG A;  3EG2 A;  4AFS C;  1WI7 A;  2KT8 A;  2MCN A;  1GFC A;  1BK2 A;  2L0A A;  1Z9Q A;  3JV3 A;  1JXO A;  1YNZ A;  2X3X D;  2FPD A;  3I5R A;  1U3O A;  2CH4 W;  4J9I A;  4LUD A;  1OOT A;  2DVJ A;  2JS0 A;  2RMO A;  2GGR A;  4CC4 B;  4JZ3 A;  1E6G A;  3IQL A;  5IHN A;  1UEC A;  2LQW A;  1T0J A;  2DYB A;  2L2P A;  2DF6 A;  2RF0 A;  1SHG A;  1QKW A;  1FMK A;  1MV0 B;  2JMA A;  2J6O A;  3A98 A;  1OEB A;  1RI9 A;  2HCK A;  3REB B;  2DJQ A;  1NYG A;  3C0C A;  3M0U A;  1UE9 A;  3REA B;  4J9B A;  2OI3 A;  1U06 A;  3UA7 A;  1KJW A;  1YCS B;  2FO0 A;  3SEM A;  4Z89 A;  2GTO A;  2MOX A;  1JQQ A;  1X6B A;  2W0Z A;  2F2V A;  1JO8 A;  2LJ0 A;  1M8M A;  3NHN A;  4R0K A;  2K79 A;  4EIK A;  2DNU A;  2CT4 A;  2HDA A;  2DE0 X;  2NWM A;  2ABL A;  2M0Y A;  3VS6 A;  4OMO A;  2DRM A;  1B07 A;  1BU1 A;  1CSK A;  1ABO A;  3H0F A;  2GBQ A;  1J3T A;  2CT3 A;  4HCK A;  2RQR A;  5IXB A;  2EGC A;  2RPN A;  2DBM A;  2KRO A;  4HXJ A;  2JXB A;  4A63 B;  2DM1 A;  1M30 A;  2JM8 A;  4Z88 A;  1OPK A;  2KYB A;  5I22 A;  2GQI A;  2H8H A;  1NEG A;  1XOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...