2L3PA

Structure of the prolyl cis isomer of the crk protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
b'GPYAQPSINTPLPNLQNGPFYARVIQKRVPNAYDKTALALEVGELVKVTKINMSGQWEGECNGKRGHFPFTHVRLLDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cis isomer of Crk protein
publication title Structural basis for regulation of the Crk signaling protein by a proline switch.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 9
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l3pA00
1KFZA 3I35A 2VWFA 1MV3A 2J06A 4F17A 1TG0A 2RQRA 3ULRB 2FPFA 4AFUC 2BZ8A 2KT1A 4RTWA 2P4RA 2YDLA 2SEMA 4J9BA 4LUEA 1ZUYA 3VS5A 1ABQA 2D8JA 1OEBA 2X3WD 3EG1A 3I9QA 4JZ3A 3TSZA 1GFDA 1UGVA 2AZVA 2GTOA 2ENMA 3QWYA 3PVLA 2OI3A 4AG1C 1W70A 2AKLA 3EG3A 2O9SA 1X6GA 1WA7A 1H3HA 4E6RA 1HSQA 1E6GA 2LQWA 2BTTA 1UDLA 2QDLA 1IO6A 1GRIA 4HVVA 2K6DA 2HCKA 2KRSA 1E7OA 1MUZA 1UJ0A 2YUNA 1RI9A 2RQUA 3TVTA 1X2KA 1B07A 4M4ZA 1YP5A 5IH2A 1Z9ZA 1BK2A 5IHIA 3VS4A 2C0TA 2JTEA 4HCKA 2CUBA 2JM8A 3NPFA 2JS0A 4CC4B 3M0TA 2RQVA 4HVWA 2CSQA 2KGTA 4IIMA 1T3LA 1PHTA 1M3AA 4J9EA 2FO0A 2GNCA 3UF4A 2LJ0A 1KSWA 2H8HA 2GTJA 1A0NB 2EVRA 2DL3A 2FEIA 2PTKA 3VRYA 2YUPA 5EC7A 1NG2A 2M51A 1YCSB 2EYWA 1YNZA 2KXCA 2PZ1A 1U3OA 2DLPA 1PRLC 2JT4A 1UJYA 4Z89A 1VYUA 3M0SA 3M0UA 3H41A 1NM7A 3UA7A 1ZUKA 1NYGA 1QWEA 2DF6A 4LNPA 2HEQA 4AFQC 3UA6A 2YUOA 2FPDA 2JXBA 1W1FA 1LCKA 1M3BA 3NHNA 2BZYA 3EHRA 1AOJA 2CT4A 1NEGA 1PNJA 2E5KA 1I07A 2DBKA 1RLPC 4J9GA 2DA9A 1UECA 2YUQA 1X69A 2RNAA 1B3QA 1WX6A 4CC7A 2DNUA 2GGRA 1Y0MA 2HDAA 4Z88A 2LMJA 4JZ4A 4JJDA 1HJDA 4J9FA 2CH4W 1AWXA 5IHNA 3EG2A 3VS1A 2ROTA 4F16A 2KROA 2L3SA 4OMPA 1ZSGA 1AD5A 4OMQA 2J6KA 2RQWA 1SPKA 1AWOA 2D8HA 2JW4A 2OAWA 2LZ6B 3EG0A 1AZGB 3GBQA 1AWJA 2RF0A 1U06A 1WI7A 2DRMA 4ZNXA 2F2XA 4OMOA 2KT8A 4J9IA 1ZX6A 3H0FA 4OMMA 1CKBA 2L3PA 2B86A 1VYTA 4ESRA 1QKXA 3U23A 1GL5A 3CQTA 1M8MA 1KJWA 4QT7A 3RBBB 2VKNA 1S1NA 1CKAA 5FWBA 1SEMA 1VYVA 2CUDA 2PNIA 5GJVB 2DRKA 2YT6A 1PKSA 1YWPA 5I11A 4J9CA 1SRMA 2LJ3A 1GCPA 4ORZA 1M27C 2DYBA 2EKHA 3VS2A 2A37A 3M0RA 2EW3A 5IXBA 3SEMA 2KYMA 2LP5A 5ECAA 1ZUUA 4DEXA 2LQNA 1MV0B 2DMOA 1WYXA 1XOVA 2J7IA 2JMAA 2A08A 5FWCA 3VS0A 1PWTA 1WFWA 2KR3A 3I5SA 4A63B 1H8KA 1V1CA 2I0NA 2LX7A 2EYXA 4CC2A 2DVJA 1G83A 1H92A 1GBQA 3M0QA 4GLMA 1JXMA 2W0ZA 2DBMA 3M0PA 2OJ2A 1X27A 2JM9A 2LNHB 1K0SA 1TUCA 2FRYA 2MIOA 1UHFA 1HD3A 4EIKA 1GCQA 1Z9QA 1M30A 2O2OA 2DE0X 3I5RA 4LN2A 1OPKA 2ESWA 1WDXA 5FW9A 2RPNA 2L3QA 4K11A 2VVKA 2W10A 4WCIA 1SHFA 2KXDA 3REBB 1WXUA 2KRMA 3VS7A 2HSPA 4RTXA 3VS6A 4HVUA 2ABLA 1WXBA 4RTUA 4J9HA 3VS3A 2NWMA 2ECZA 1ARKA 1UTIA 4DEYA 1G2BA 2DILA 5GJWB 3O5ZA 2BZXA 5I22A 2D0NA 1NEBA 2F2VA 5HCKA 1YWOA 1PRMC 1RUWA 2EYZA 3KFVA 2EGCA 2RQTA 2KBTA 1OV3A 3TSWA 2RN8A 4IIOA 2AKKA 4RTVA 4D8DA 2AK5A 4RTYA 1Y57A 4RTTA 2DX1A 1TUDA 3RNJA 1NYFA 3UATA 3NGPA 2CT3A 2CREA 2MCNA 4FSSA 2CDTA 4LE9A 3H0HA 1K76A 1W6XA 4Z8AA 2GQIA 2J6OA 5IXFA 1ZBJA 1WXTA 1YN8A 2EGAA 4X1VA 2HBWA 4LUDA 3PVQA 1UE9A 1WIEA 3PE0A 2KRNA 2IIMA 1X6BA 2RMOA 4R0KA 1SHGA 3REAB 2KYBA 2ED1A 1VA7A 4F14A 2LJ1A 1M3CA 1JXOA 2V1QA 1NLPC 1PKTA 3H0IA 3R6NA 3QWXX 2JMCA 2SRCA 1JQQA 2EPDA 3A98A 2F2WA 2EYYA 4J9DA 1GFCA 1K4US 3THKA 4HXJA 2CSIA 2JS2A 1J3TA 2K9GA 4OMLA 1T3SA 2V1RA 1AZEA 2KE9A 1NLOC 2M0YA 3EGUA 3EHQA 3LH5A 4CC3A 2O31A 2FRWA 1ABOA 2ED0A 2EBPA 1UUEA 5IHKA 1CSKA 4JJCA 4KRTA 1T0JA 1QWFA 3SHWA 2CH4A 1OPLA 2J05A 2G6FX 1JO8A 4OMNA 1QLYA 1GCQC 1SSHA 4RTZA 2X3XD 2NUZA 2DL7A 2DL5A 2C0IA 1SRLA 4JPBW 1AWWA 3FJ5A 1T0HA 4AG2C 4AFSC 2AZSA 2L2PA 2DM1A 1X2QA 1OOTA 1QKWA 1QCFA 1AVZC 2LCSA 2J6FA 3ZL7C 1FYNA 2O88A 2C0OA 1E6HA 1U5SA 1RLQC 2D1XA 2EGEA 4RUGA 1BB9A 5L23A 2A28A 1I0CA 1BU1A 2MOXA 4Y92A 1UFFA 3JV3A 2K79A 1UHCA 2K3BA 4JJBA 2YSQA 1K0XA 1KIKA 4AFZC 1AEYA 1JU5C 1GBRA 4D8KA 1FMKA 4GBQA 2DL8A 1K1ZA 2ROLA 2K2MA 2KEAA 2EQIA 1WLPB 1EFNA 1ZLMA 1BBZA 2KNBB 2XMFA 2DJQA 2FPEA 2L0AA 2O9VA 3C0CA 2GBQA 1JEGA 3IQLA 1N5ZA 1I1JA 2A36A 2K7AA 1X43A 1K9AA 2FG0A 3NMZC 1UG1A 3VRZA 2DL4A
chains in the Genus database with same CATH superfamily
2VWFA 1MV3A 2J06A 3I55Q 3EFOA 1IHWA 1MMNA 2XDDA 2F69A 4AFUC 1BI0A 4LDUA 1EZZB 4C0GA 5LJ3j 3VS5A 1RAAB 2F5TX 3EG1A 5KYUA 1BIBA 8AT1B 3C94A 5IN1A 3BDLA 1UGVA 2HQHA 2ENMA 3DB4A 1YBYA 3OYIA 2K4YA 4C8QE 3EFOB 1Q7YR 2AKLA 1OZ2A 2WSFE 3G4SA 3A8MB 4C5HA 3GNGA 1WA7A 1H3HA 1HSQA 1E6GA 1UDLA 3TU4K 5CVIA 1WGSA 2K6DA 3CC7T 5KYUB 5LJ5g 1BIAA 1OI1A 4M7DC 2KRSA 2P84A 5GAN2 1D1AA 1YJNQ 2RQUA 4AT1B 1B07A 3VUBA 1VQNQ 3PNWC 3G1JA 4ZN1A 3MPUB 2JM8A 5GAMh 1R77A 3BY7A 2RQVA 2NYSA 3M59A 4OMFB 3CCMQ 2FB7A 1M3AA 3HTRA 4BE0A 2GNCA 4M75E 4OB1B 5GANj 2LJ0A 2C06A 2H8HA 4GY5A 3TQ7P 1KC8R 2E6ZA 3OYJA 3V8LA 2EVRA 7AT1B 3HFNA 4PJLA 1S72Q 2P0PA 2EQMA 2M51A 1YCSB 1YNZA 1IB8A 1PRLC 1UJYA 2QEXQ 3M0SA 1SSFA 3H41A 3CXCA 3UA7A 1WHMA 4C92C 1M1FA 1QWEA 2DF6A 2GFAA 2DYIA 2X51A 2YUOA 2M1HA 1SG5A 8ATCB 3I56T 3G4ST 4QQDA 3OYGA 2BZYA 1NEGA 1PNJA 2DBKA 1I8FA 3FJPA 5A2QE 4JDSA 1UECA 2YUQA 2O4XA 1WX6A 4JRKA 2CP6A 5HKCA 4CC7A 1UEBA 1KQSS 3G71Q 1YHQQ 2LX9A 1QP2A 1Y96A 1HJDA 2CH4W 1AWXA 4E7HA 2NUPA 4OB3B 3E19A 3CD6A 3VS1A 2KROA 1ZSGA 4F7UG 2J6KA 1AWOA 2D8HA 1VQ9A 1VQ5A 3M58A 5I2MA 3QUIA 3EG0A 3GBQA 5GAOp 2XDBA 2R5AA 2RF0A 1ACMB 2DRMA 2F2XA 2O4XB 4OMOA 1ZX6A 2XIDA 2L3PA 1Y96B 1WQ7A 2QQAA 3V7SA 4PLLA 1GL5A 2NUPB 3CQTA 1VQ8A 1KJWA 2ZPFB 1Y07A 4C5IA 1S1NA 1YITQ 1MMDA 2DTHA 1VYVA 3RIRA 1I81A 3EAEA 1M2VA 1SRMA 5CQXA 4DBHA 9ATCB 1M27C 5CCAA 1M1GA 4JRPA 2A37A 3M0RA 2EW3A 3OYEA 2KYMA 4KT0E 1TH7A 1P92A 3CMEA 4PJJA 2RH2A 2J7IA 4KGXB 4M7AD 2A08A 5LJ5h 4M7AF 3DLMA 1ZHIA 1KC8C 1BYMA 3OYCA 3I5SA 1K8AC 1H8KA 4XK8E 1V1CA 5KYXA 2EYXA 1X6OA 1M2VB 1GBQA 2QGGA 4E2FB 3F70A 2W0ZA 2DBMA 3CEYA 1VQPA 2DZCA 3CD6T 2RHXA 3M0PA 3EGDA 2JM9A 5CIUA 4FM4B 3X20B 2E1HA 4C8QC 2EQKA 2FRYA 4KH0B 1VQ9T 1VQ5T 2MIOA 3MEVA 3OS1A 3NTHA 3VKIA 3QKJA 2OTLQ 3EH1A 4XU0A 3BDUA 1OPKA 2VXFA 2DJZA 1WDXA 3GNFB 2VGMA 5KYXB 2P0QA 1RI0A 1SHFA 3REBB 1TUGB 3VS7A 4WTOB 1VQ6T 3EGDB 2ABLA 3RESA 4PFOA 3VS3A 2CKKA 1B34A 2CZ1B 1ARKA 4FT4A 2FZCB 4PFPA 3JCMd 2CP3A 1N27A 2X9HA 2XU8A 3JCMW 2F2VA 1PD0A 5HCKA 4M75C 2KSSA 2HMAA 1RUWA 2LVMA 4LDVA 2RQTA 4M77A 4LDWA 2RB6A 4RTVA 1ZBXA 3A8GB 3CCST 4PFZA 2K3YA 4XU3A 5CKEA 4XU1A 1YCYA 5D7UA 2DK3A 1B34B 3PIPA 3KUFA 4O5VA 2FL7A 3J80E 1WHKA 1UGQB 1VQPT 2RHYA 4C92B 2COWA 3MO8A 3CCQA 2QYZA 3JCMc 3CCLT 1K76A 1WXTA 2DD4A 1YN8A 2EGAA 4X1VA 2HBWA 4M77B 2OAUA 3PVQA 1TTHB 4PLIA 3C12A 4Y91A 4M78A 2IIMA 1FMWA 2X4YA 1SHGA 3REAB 5LJ3g 4ELYC 2ED1A 5GAMe 1Q82R 2COZA 1M90U 5GMKh 5GAOm 5GAOl 3JB9J 2DEUA 3I55A 3LW5E 4C0DC 1JQQA 3E2UA 4FYVB 1GFCA 4A4KA 3S3OA 5HY6A 5DM7R 1J3TA 2NUTA 3V7RA 4M78B 2BE9B 2QGFB 4IUUA 2KE9A 1NLOC 4RG8A 1AZEA 4CC3A 3OYKA 2FRWA 3M5AA 4ZGJB 3H9NA 4O6JA 4FW2A 4JJCA 4MZMA 2E65A 4Y28E 1VQMT 2J05A 5D6YA 4OMNA 1QVFP 1QLYA 1IZ6A 1PCXA 5C0MA 2NUZA 1SRLA 4JPBW 2BIVA 2NUTB 1DJ7B 2A0FB 4MZPA 2AZSA 3S6WA 1VIEA 3LWHA 2DM1A 1TU0B 1QCFA 3OSSC 5GMKi 1E6HA 4DBQA 5GANg 1G5VA 4C8QA 5HK0A 2EGEA 1YJNA 3OYMA 2A28A 1I0CA 3X25B 2Z0WA 1H641 1UHCA 3L1AA 2K3BA 4BI3A 2QQ9A 2MAMA 3CCMA 2YRVA 3QG1A 1RAHB 5I21A 3EGXA 1AEYA 1GBRA 4D8KA 3I55T 4EMKA 5AYFA 4J8OA 5FU7C 4FU6A 2K2MA 3DKMA 1WLPB 2JUFA 2E12A 2QQSA 2XMFA 4C8QB 2O9VA 1S72A 2GBQA 3ER0A 4OP0A 2A36A 1NPPA 3M4GA 4KUDK 1NJIR 2QEXA 1FXXA 3VRZA 4NL3A 2PVDB 6AT1B 3M9QA 3LWIA 1G3YA 1KFZA 3I35A 2DD5A 5D6WA 4F17A 3EGXB 4EMKB 2FPFA 5GMKj 1N9SA 4RTWA 1VQKQ 4NOYA 2YDLA 1BI1A 4J9BA 1M8VA 4FCYA 5FROA 2RA2A 3T9NA 2DXUA 3RMSA 2LTOA 2CP2A 5LJ5e 3I9QA 1WHGA 4LDYA 3CC4Q 2AZVA 4C92G 4R56A 2GTOA 3G71A 3OYYA 1VQ7Q 3PVLA 1YJNT 1PM3A 2OI3A 1YHQA 4AG1C 1W70A 5EG2A 1VQNT 2EJFA 3HRUA 1IGQA 5LJ3h 4BI4A 2O9SA 4M77G 4B9XA 1X6GA 3LH0A 2GQVA 1YFNA 3CCMT 2BTTA 1H3ZA 1Q7YU 2QDLA 4XU2A 2CYZB 4BD3A 2ZCFB 2HCKA 2A3LA 4E7KA 2YUNA 2DVEA 4ZGEB 1S72T 3TVTA 1X2KA 2PUKB 1RAFB 1BK2A 3VS4A 3QXEB 2C0TA 1QVFA 4HCKA 1IGUA 2CUBA 2HD0A 2JS0A 4CC4B 1M1KC 3M0TA 2CSQA 3SD4A 1YITA 1T3LA 2F5KA 4M78G 4QKUA 2QTVA 3L42A 2FO0A 2KK4A 3VYHB 3VV0A 2GTJA 2DFUA 5IT9E 3OYDA 2PTKA 1Y71A 3VRYA 4F7UA 2YUPA 4CI0C 2LDMA 4XTZA 2DLPA 1KC8U 4XTUA 4ME7A 1TSFA 3CC2Q 3G71T 4N4HA 1YHQT 2ZPBB 3V8JA 1IREB 2K5IA 1LCKA 2X35A 4BDZA 3NHNA 1HXDA 1SF9A 4OB0B 1I07A 1RLPC 1W2BS 2DA9A 4CRIA 4D6WA 1Q86R 2OTLA 3JB9G 5GAOq 2DNUA 2VXEA 1Y0MA 2HDAA 2BUDA 1OX9A 4M77F 4C5EA 3EG2A 1MNEA 2VUBA 2R57A 2KQWA 1YITT 4OMQA 3GIBA 2RQWA 1SPKA 2ZGWA 4C8QG 1Q81C 2HZYA 2GCXA 1UGSB 1U06A 1WI7A 4ZNXA 4E7JA 2KT8A 3HSBA 1LPLA 1CKBA 3MHXA 2B86A 2DTIA 1M8MA 4PJOA 1G3WA 1SEMA 4M78F 5GJVB 2DRKA 3JCMX 4ORZA 1B7TA 1KHCA 3QZ9B 3V8KA 5GAN3 4XQ3A 3VS2A 3JAME 4M75G 5ECAA 1MV0B 4J6XA 1K9MC 1K73C 2MMPA 2OTLT 2HL5C 2JMAA 5GAN6 1WFWA 2RJDA 4PJOB 4A63B 4FW1A 3WVEB 2I0NA 1D0YA 3H6ZA 1H92A 1PSFA 1JXMA 4TVRA 1QP3A 2DXBA 3QZ5B 3TEEA 1K8AR 2LNHB 5HK3A 4II1A 1HK9A 4QW2A 1K0SA 2RJEA 3MEUA 3JB9D 2KI7A 3JB9F 4LN2A 2DE0X 3BE3A 3A8HB 3D7SB 3RMQA 4K11A 2IG0A 3OMCA 4J5YA 4XTVA 1WXUA 1Q86C 4RTXA 3VS6A 3VYGA 4HVUA 4A4FA 2DETA 3SB2A 4C8QF 4LD6A 4RTUA 2EIFA 1M9SA 4BY6B 2ECZA 1KD1C 1UTIA 4DEYA 1PG5B 1JJ2P 2BZXA 4NS5A 1YWOA 4ANJA 1PRMC 2A7YA 5LL6S 4C0FA 2YXYA 1OV3A 1I4K1 4M7AE 5GAOn 3GLXA 4FYWB 4RTYA 1QVGP 4A4GA 5LJ3e 3VUZA 3RNJA 2QASA 1NYFA 2G3RA 2OTJQ 3NGPA 2CREA 3EG9A 4P5NA 4LE9A 1KK7A 1ZSZC 1KG1A 2JNGA 3OB9A 3EFSA 3LLRA 3JCMf 4FSXA 2DZ9A 2RMOA 3SWNC 1X6BA 3CCVQ 5KYNA 2KYBA 1U1SA 4IUQA 4JUVA 1M3CA 2RJCA 3EG9B 1N8RC 2V1QA 5GAN5 1PKTA 1TXQA 4A4HA 4EDUA 3QWXX 2JMCA 2SRCA 1Q82U 2MPXC 4PNOA 2E10A 1XNIA 2F2WA 3QDRB 4IUTA 4J9DA 1VQKA 1K4US 3THKA 3L2ZA 2PU9B 2K9GA 3LGFA 1PSEA 3LH5A 3MP8A 2PQWA 1HYOA 3CC4A 1ABOA 2VC8A 2CS7A 4M7DA 1UUEA 5IHKA 5GANe 4KRTA 1VQ7A 4XTWA 2EJGA 3HP9A 3SHWA 4ZTFA 2YWWA 1GCQC 2VGNA 2DL7A 5GMKm 1WJSA 2DL5A 4PJOG 3HRSA 3RKXA 2EWNA 5GMKl 3FJ5A 2EYQA 4AFSC 2E4HA 1IRXA 2D9TA 3CPWP 1OOTA 1QKWA 5DY9A 4HA8A 1VQ8T 4M7DB 2C0OA 2K5LA 3QJ6A 2D1XA 4F7UF 3MEWA 2EQJA 4OB2B 3JB9I 4ZN3A 1BU1A 2MOXA 4PJMA 4Y92A 1UFFA 3SDZA 1G3SA 1LOJA 1JJ2A 4R55A 4JJBA 4JS4A 2HQEA 4FL6A 4C92A 2DAQA 2HNIA 1KIKA 4X34A 1VQ4Q 1UGPB 1K1ZA 3CMET 1VQKT 1BBZA 2M0OA 2JOYA 2KNBB 2DJQA 3JCMh 1QVGA 3C0CA 4E7IA 2M02A 3PTAA 1M4ZA 1ZQ1A 3P8BB 1X43A 4ELZC 2QG9B 4C5GA 3CC2A 1VQ7T 1TG0A 1YI2Q 3G6EQ 2RM4A 2QDYB 3I56Q 3HHTB 2XKOC 2BZ8A 4HKEA 2KT1A 4N4GA 3ZFJA 2RK2A 1NJIU 2P4RA 3MP1A 4WF2A 2SEMA 2RI2A 1ABQA 1OEBA 2MWOA 1KHIA 2D6FA 4Q5WA 4B9WA 5CO7A 3A8LB 3OYBA 1R0CB 3QWYA 2QTXA 1R0BG 1ZA2B 3L2VA 3X24B 3EG3A 3E9FA 2E6NA 4HCCA 5CKFA 4M7AC 2MK5A 2LRQA 4PJOD 3M53A 3N5BB 4PJOF 2KVQG 2I2LA 1FMVA 4DOVA 1OX8A 1IO6A 2WSCE 2L5QA 3RKYA 2YHTA 1MUZA 1UJ0A 1ZSZB 1RI9A 2L3RA 1WHLA 2PVGB 4RMOA 4HCBA 2KY9A 4M4ZA 5IHIA 4FYYB 1AHJB 4A4EA 3E1SA 3NPFA 3TREA 2ZAEA 1PC0A 4HVWA 2KGTA 4Z02A 2LQ8A 3CC2T 2V8JA 2EKOA 3CCQT 3UF4A 3CPWA 4UC4A 2PVOB 1RABB 3OSVA 1M1KR 1A0NB 2FEIA 3OA6A 3OYHA 3QDFA 3L2QA 2PZ1A 2XDPA 4ZGDB 1U3OA 2ZPHB 2Y4YA 2JT4A 3QYHB 4DOWA 4Z89A 4RCBA 3M0UA 3JB9H 4FT2A 1BI2A 3OW2S 3UWNA 1NYGA 4LNPA 2HEQA 3NTKA 4OVAA 3CMAQ 2FPDA 4B6MA 2JXBA 4BE1A 1F1BB 1M3BA 2RHZA 4M7DG 1AOJA 2E5KA 2EAYA 3CCJQ 4J9GA 4PK4A 1B3QA 1WQWA 1QQJA 3X26B 2JVVA 4Z88A 2LCLA 3OBYA 4M75A 2L89A 4JJDA 1VQLQ 1RAEB 3M55A 1Q86U 1VQ6Q 3A8OB 1EX4A 4F16A 3MEAA 2RD1A 1AD5A 2JW4A 2OAWA 2HSEB 4EPCA 3FDRA 1AZGB 3JRZA 5CR2A 5FRNA 4J6WA 1AWJA 2JTMA 1D3BA 4J9IA 3JCMQ 3ME9A 1Q81R 3H0FA 4OMMA 3RKWA 4M75B 1W4SA 1MMGA 4ESRA 1LNXA 3VU3C 2QI2A 4XTXA 3CCSQ 4QT7A 2VKNA 4BDYA 3OS0A 1CKAA 1GXIE 5FWBA 3M54A 1JBMA 1QVPA 4YTLA 1VIFA 1PKSA 4J9CA 4BE2A 2AIRB 2LJ3A 3CCRQ 1D3BB 2JJ9A 2OTJA 3CCLQ 3ZBDA 4XAXB 1MNDA 2EKHA 2LP5A 5L8RE 1C1AA 4DEXA 2DMOA 1WYXA 2E70A 1XOVA 1WJQA 4VUBA 4JJNK 3VS0A 1PWTA 4AMCA 4QVCA 2KR3A 1MMAA 3X28B 2QEXT 1KQ2A 4JLGA 3Q1JA 3WXMB 1BI3A 2DVJA 3CCVA 2DO3A 4GLMA 1JRIA 1XJWB 4X9DA 1VQOQ 3CCUQ 1K9MR 1K73R 4M77E 4M7DF 1RADB 2E3HA 2AHJB 1X27A 4QQ6A 1TUCA 2DXCA 2ZPIB 2ZPGB 1UHFA 4C0DB 1HD3A 4N0AC 4M7AB 4EIKA 2HBPA 1X01A 2X4WA 2O2OA 3I5RA 3L2WA 2RI3A 2Y4XA 2LT4A 1FWZA 2ESWA 1K8AU 4L6V5 5FW9A 1KQSP 2L3QA 1LVKA 2VVKA 1YIJQ 2W10A 2KXDA 5I2SA 2HSPA 3JCMb 5GANd 3ASKA 1WXBA 2COYA 4M78E 3DB3A 5CQYA 2NWMA 2X4XA 4E7ZA 5GAMf 3J7AF 3QIIA 4KULA 3SFMA 2DILA 4DBFA 3QJYA 4PKCC 4C92D 4C92F 5I22A 3J81E 1N6AA 2R58A 1KD1R 2KBTA 1UB4A 4M77D 4D8DA 3RR6A 5GMKe 2AK5A 4MDXA 5CKDA 1Y57A 5AT1B 4L59A 4J83A 2Y90A 1Q95G 2KDSA 3CCEQ 4OF1A 3OYNA 1IHVA 2MYSA 4DA4A 4LDXA 4GLKA 1V29B 5KCHA 2DTOA 1VQ4A 1W6XA 2GQIA 4BUGA 2J6OA 3HL8A 5FU7B 1NBEB 2OX7A 1YJ9Q 1UE9A 1R8OB 2HL3A 3PE0A 2KRNA 4M78D 4ZTJA 2K5FA 3MJXA 4MDWA 1VA7A 4F14A 2LJ1A 3UPUA 1NLPC 2VYTA 2XK0A 3H0IA 3PMTA 1YI2A 3G6EA 2EPDA 3I56A 3A98A 2RO0A 2P4TA 2FVUA 2WACA 4HXJA 2CSIA 1N8RR 2FYKA 1D1CA 3LGLA 4OMLA 1T3SA 3GF5A 2QQBA 4RG2A 2M0YA 3EHQA 1OU8A 4DQ2A 5GAMd 2O31A 1UGRB 2KMTA 2PUOB 2ED0A 2EBPA 3RUXA 3RERA 1CSKA 3MCAB 2YLCA 3JCMP 4IURA 1T0JA 1QWFA 1NE8A 3META 2CH4A 1OPLA 2RHUA 3A1PA 3MP6A 1XTDA 4RTZA 2X3XD 3L2RA 5DLOA 1YJWQ 2C0IA 3MKDA 1AWWA 1KQSA 1O75A 1T0HA 4AG2C 2L8DA 2L2PA 1VQ4T 1X2QA 3ZL7C 2MI6A 2FZKB 4C0ZA 3DLLA 5KE3A 2DXTA 4C8QD 4RUGA 2CP7A 2X4JA 3OY9A 2YRCA 5L23A 4IUVA 4N0AA 5LJ5f 1QCOA 4M7AG 3JV3A 2K79A 2QA4Q 5KCOA 3PGGA 5CKHA 4E47A 3JCMg 3L2UA 2B8AA 1K0XA 1JU5C 1FMKA 4GBQA 1YI2T 2ROLA 3G6ET 4JRIA 4XTYA 2KEAA 4M77C 2EQIA 1ZLMA 3LX7A 4BB7A 3CBPA 4JRQA 5KE2A 3OS5A 2FPEA 1JEGA 2CZ7B 4KBMB 4MMLA 2HKNA 1K9AA 2XI9A 3NMZC 1UG1A 3CXCS 2CGHA 3LYIA 4LXCA 4MZTA 2DL4A 4M75D 1D1BA 4M75F 2RQRA 3PIOA 3ULRB 1N9RA 1I5LA 3CMAA 5FRMA 2H3JA 3TCJA 4LUEA 1ZUYA 3NFCA 4M78C 2BE7D 2D8JA 3O8VA 2X3WD 1OQKA 1TWBA 1XQHA 1Q7YC 3CCJA 2E41A 1WHHA 3OYFA 4JZ3A 3TSZA 3JCMJ 1U8RA 1GFDA 2HKQB 4BACA 2V8KA 4F7UE 2LCCA 1VUBA 5DLQE 4X9CA 1VQLA 1QW1A 1VQ6A 3QO3A 4EMGA 2LNVA 5CKBA 3AHUA 3NTIA 4E6RA 2QK0A 2LQWA 5GAMj 3GPLA 3AT1B 1GRIA 4HVVA 2LT1A 5LJ5d 1WJRA 5KH6A 1E7OA 2DEQA 1G8XA 3OS2A 1YP5A 1JB0E 5IH2A 1Z9ZA 2JTEA 3CCSA 4IUPA 1EIFA 2EJ9A 2K3XA 3G7ZA 4IIMA 1PHTA 2YLBA 3OW2P 4J9EA 2RJFA 3CC7Q 3QYGB 4J7IA 1QCNA 3CMAT 1KSWA 2GF7A 2MWPA 3CCRA 1WZOA 4EMHA 4E7LA 2E5QA 3CCLA 3M57A 2DL3A 1WHJA 5FU6C 5KYYA 4QVDA 5EC7A 4KGZB 1NG2A 3OBWA 2JZ2A 2KXCA 2EYWA 3CCJT 5D6XA 1C6VX 1TOVA 1M1KU 1VYUA 4F04B 1NM7A 2DERA 1ZUKA 3JSCA 3M56A 4AFQC 3C4SA 3UA6A 4EMKC 4DBRA 1VQLT 2DIQA 1W1FA 1VQOA 3CCUA 4J7FA 3EHRA 5J39A 2YRDA 1V76A 2CT4A 4PJOE 5KYYB 1X69A 2RNAA 2M9UA 3S3MA 3CC4T 1PD1A 1BCOA 2GGRA 3QSUA 2LMJA 4JZ4A 1D09B 4HT8A 1RL2A 4J9FA 4KUIA 1YIJA 5IHNA 4QVZA 3G4SQ 2ROTA 4OMPA 2L3SA 1VQMA 2XG8D 2LZ6B 2XICA 5C6SA 2IVWA 2CZ6B 1JJ2S 2GFUA 3CCRT 2HAXA 1ZSZA 2BKDN 1WNLA 1VYTA 1I5OB 3V7CA 1QKXA 1X75C 3U23A 5M9OA 3BW1A 3RBBB 1QVGS 2FZGB 1AT1B 1OZ3A 1Q81U 2CUDA 4JLIA 3SWNA 3URGA 5LJ5j 2PNIA 2YT6A 1YWPA 1MHNA 5I11A 2IPOB 3FEOA 1GCPA 1VQOT 3CCUT 1TS9A 4V2SA 2DYBA 2O01E 3CCEA 2CP5A 5IXBA 3SEMA 3JCMV 1ZUUA 2LQNA 2ZZDA 1RAIB 4NL2A 5FWCA 3QPHA 2CP0A 3P8DA 5IAYA 1YJ9A 3ZEHA 3OW2A 1NPRA 3SWNB 3E9GA 2LX7A 4CC2A 1G83A 5GAN4 3M0QA 1YIJT 4IKFA 3OMGA 2F1LA 3C95A 2OJ2A 2EFIA 4J6YA 1QMCA 2ATCB 5LJ3f 1RAGB 1K9MU 1K73U 1GCQA 1Z9QA 2R5MA 1W2BP 1M30A 1FX7A 4A53A 2RPNA 4N4IA 2V26A 4WCIA 3PFSA 3CD6Q 2KRMA 1IXDA 1ZA1B 3INZA 1SKUB 3PT9A 1VQ9Q 1VQ5Q 1VQNA 4J9HA 1OULA 3UT1A 5CAIA 4LD9K 1G2BA 5GJWB 3O5ZA 2RHIA 3CCET 1YJWA 4HT9A 3CPWS 2D0NA 1NEBA 2H3EB 4QQGA 2EYZA 3OYAA 3KFVA 1LJOA 2EGCA 3EH2A 1VQ8Q 2ZPEB 2E3IA 3TSWA 1O9SA 2RN8A 4IIOA 4A54A 2AKKA 3FC3A 4JS5A 1M5Q1 1YJ9T 5FU6B 4RTTA 1KD1U 4BI8B 2DX1A 3BFMA 1TUDA 2LQKA 3UATA 4KGVB 2QA4A 2MF2A 2CT3A 4RKUE 5GANf 4M7DE 2MCNA 4FSSA 2M16A 2CDTA 2AT1B 3H0HA 5A0LA 3FB9A 5GAOr 4Z8AA 3CMEQ 5IXFA 1Q82C 1ZBJA 5A0GA 3H8ZA 1M2OA 4LUDA 1M90R 1WIEA 5KYWA 4PJOC 1KQ1A 1WPYA 1D0ZA 4R0KA 4OGEA 5LJ3d 2LC4A 3S3NA 5A0DA 1VQPQ 4PL6A 2KAFA 2V8IA 2WSEE 2XHCA 1JXOA 1NZ9A 4HCZA 3FLGA 3RDVA 3R6NA 4OGCA 2EQUA 1RACB 3PMIA 2RI5A 5GAN8 2EYYA 1G3TA 4M7AA 1OYXA 5FLXE 3EFRA 4FYXB 1U1TA 5KYWB 1YJWT 2JS2A 1VOMA 3UDCA 2XD0A 2QXFA 5J26A 4C92E 2V1RA 2QAZA 2VV5A 3EGUA 2JN0A 3FRNA 5GAMg 2VASA 4L5GA 3KXTA 1N8RU 4M7DD 2JTFA 3QBYA 4BY6C 3GOXA 3HKSA 2NLUA 2G6FX 1JO8A 1W2BA 3FIFA 1SSHA 2QA4T 3OYLA 3JCMe 3VJPA 2HQXA 2E64A 2K57A 2QQRA 2CZ0B 4MMKA 1AVZC 2LCSA 2J6FA 3CBOA 3WVDB 1FYNA 2O88A 3A5ZB 3OQ5A 1U5SA 3P8HA 1RLQC 2P0KA 4RCCA 1BCMA 1BB9A 1VQMQ 1Y7XA 1BKBA 3HRTA 4KH1B 1QVFS 3R6OA 3HPWA 2K2VA 3HFOA 3CXCP 1D0XA 2YSQA 3QHSA 3CCQQ 2OTJT 4ATOA 5GANh 1C0MA 3KBGA 4PJNA 5J3BA 4AFZC 3CBMA 3CC7A 2DL8A 3M4YA 5CK9A 1NJIC 1EFNA 1OU9A 3CPFA 4F7UB 2DKGA 2L0AA 2DPPB 2VB6A 3IQLA 1N5ZA 1I1JA 2K7AA 4FIBA 2D0QB 3GP8A 3CCVT 1MGQA 2FG0A 2FHDA 4E7SA 5GAN7 1M90C 2RK1A 2DIGA
chains in the Genus database with same CATH topology
1KFZA 3I35A 2VWFA 1MV3A 2J06A 4F17A 1TG0A 2RQRA 3ULRB 2FPFA 4AFUC 2BZ8A 2KT1A 4RTWA 2P4RA 2YDLA 2SEMA 4J9BA 4LUEA 1ZUYA 3VS5A 1ABQA 2D8JA 1OEBA 2X3WD 3EG1A 3I9QA 4JZ3A 3TSZA 1GFDA 1UGVA 2AZVA 2GTOA 2ENMA 3QWYA 3PVLA 2OI3A 4AG1C 1W70A 2AKLA 3EG3A 2O9SA 1X6GA 1WA7A 1H3HA 4E6RA 1HSQA 1E6GA 2LQWA 2BTTA 1UDLA 2QDLA 1IO6A 1GRIA 4HVVA 2K6DA 2HCKA 2KRSA 1E7OA 1MUZA 1UJ0A 2YUNA 1RI9A 2RQUA 3TVTA 1X2KA 1B07A 4M4ZA 1YP5A 5IH2A 1Z9ZA 1BK2A 5IHIA 3VS4A 2C0TA 2JTEA 4HCKA 2CUBA 2JM8A 3NPFA 2JS0A 4CC4B 3M0TA 2RQVA 4HVWA 2CSQA 2KGTA 4IIMA 1T3LA 1PHTA 1M3AA 4J9EA 2FO0A 2GNCA 3UF4A 2LJ0A 1KSWA 2H8HA 2GTJA 1A0NB 2EVRA 2DL3A 2FEIA 2PTKA 3VRYA 2YUPA 5EC7A 1NG2A 2M51A 1YCSB 2EYWA 1YNZA 2KXCA 2PZ1A 1U3OA 2DLPA 1PRLC 2JT4A 1UJYA 4Z89A 1VYUA 3M0SA 3M0UA 3H41A 1NM7A 3UA7A 1ZUKA 1NYGA 1QWEA 2DF6A 4LNPA 2HEQA 4AFQC 3UA6A 2YUOA 2FPDA 2JXBA 1W1FA 1LCKA 1M3BA 3NHNA 2BZYA 3EHRA 1AOJA 2CT4A 1NEGA 1PNJA 2E5KA 1I07A 2DBKA 1RLPC 4J9GA 2DA9A 1UECA 2YUQA 1X69A 2RNAA 1B3QA 1WX6A 4CC7A 2DNUA 2GGRA 1Y0MA 2HDAA 4Z88A 2LMJA 4JZ4A 4JJDA 1HJDA 4J9FA 2CH4W 1AWXA 5IHNA 3EG2A 3VS1A 2ROTA 4F16A 2KROA 2L3SA 4OMPA 1ZSGA 1AD5A 4OMQA 2J6KA 2RQWA 1SPKA 1AWOA 2D8HA 2JW4A 2OAWA 2LZ6B 3EG0A 1AZGB 3GBQA 1AWJA 2RF0A 1U06A 1WI7A 2DRMA 4ZNXA 2F2XA 4OMOA 2KT8A 4J9IA 1ZX6A 3H0FA 4OMMA 1CKBA 2L3PA 2B86A 1VYTA 4ESRA 1QKXA 3U23A 1GL5A 3CQTA 1M8MA 1KJWA 4QT7A 3RBBB 2VKNA 1S1NA 1CKAA 5FWBA 1SEMA 1VYVA 2CUDA 2PNIA 5GJVB 2DRKA 2YT6A 1PKSA 1YWPA 5I11A 4J9CA 1SRMA 2LJ3A 1GCPA 4ORZA 1M27C 2DYBA 2EKHA 3VS2A 2A37A 3M0RA 2EW3A 5IXBA 3SEMA 2KYMA 2LP5A 5ECAA 1ZUUA 4DEXA 2LQNA 1MV0B 2DMOA 1WYXA 1XOVA 2J7IA 2JMAA 2A08A 5FWCA 3VS0A 1PWTA 1WFWA 2KR3A 3I5SA 4A63B 1H8KA 1V1CA 2I0NA 2LX7A 2EYXA 4CC2A 2DVJA 1G83A 1H92A 1GBQA 3M0QA 4GLMA 1JXMA 2W0ZA 2DBMA 3M0PA 2OJ2A 1X27A 2JM9A 2LNHB 1K0SA 1TUCA 2FRYA 2MIOA 1UHFA 1HD3A 4EIKA 1GCQA 1Z9QA 1M30A 2O2OA 2DE0X 3I5RA 4LN2A 1OPKA 2ESWA 1WDXA 5FW9A 2RPNA 2L3QA 4K11A 2VVKA 2W10A 4WCIA 1SHFA 2KXDA 3REBB 1WXUA 2KRMA 3VS7A 2HSPA 4RTXA 3VS6A 4HVUA 2ABLA 1WXBA 4RTUA 4J9HA 3VS3A 2NWMA 2ECZA 1ARKA 1UTIA 4DEYA 1G2BA 2DILA 5GJWB 3O5ZA 2BZXA 5I22A 2D0NA 1NEBA 2F2VA 5HCKA 1YWOA 1PRMC 1RUWA 2EYZA 3KFVA 2EGCA 2RQTA 2KBTA 1OV3A 3TSWA 2RN8A 4IIOA 2AKKA 4RTVA 4D8DA 2AK5A 4RTYA 1Y57A 4RTTA 2DX1A 1TUDA 3RNJA 1NYFA 3UATA 3NGPA 2CT3A 2CREA 2MCNA 4FSSA 2CDTA 4LE9A 3H0HA 1K76A 1W6XA 4Z8AA 2GQIA 2J6OA 5IXFA 1ZBJA 1WXTA 1YN8A 2EGAA 4X1VA 2HBWA 4LUDA 3PVQA 1UE9A 1WIEA 3PE0A 2KRNA 2IIMA 1X6BA 2RMOA 4R0KA 1SHGA 3REAB 2KYBA 2ED1A 1VA7A 4F14A 2LJ1A 1M3CA 1JXOA 2V1QA 1NLPC 1PKTA 3H0IA 3R6NA 3QWXX 2JMCA 2SRCA 1JQQA 2EPDA 3A98A 2F2WA 2EYYA 4J9DA 1GFCA 1K4US 3THKA 4HXJA 2CSIA 2JS2A 1J3TA 2K9GA 4OMLA 1T3SA 2V1RA 1AZEA 2KE9A 1NLOC 2M0YA 3EGUA 3EHQA 3LH5A 4CC3A 2O31A 2FRWA 1ABOA 2ED0A 2EBPA 1UUEA 5IHKA 1CSKA 4JJCA 4KRTA 1T0JA 1QWFA 3SHWA 2CH4A 1OPLA 2J05A 2G6FX 1JO8A 4OMNA 1QLYA 1GCQC 1SSHA 4RTZA 2X3XD 2NUZA 2DL7A 2DL5A 2C0IA 1SRLA 4JPBW 1AWWA 3FJ5A 1T0HA 4AG2C 4AFSC 2AZSA 2L2PA 2DM1A 1X2QA 1OOTA 1QKWA 1QCFA 1AVZC 2LCSA 2J6FA 3ZL7C 1FYNA 2O88A 2C0OA 1E6HA 1U5SA 1RLQC 2D1XA 2EGEA 4RUGA 1BB9A 5L23A 2A28A 1I0CA 1BU1A 2MOXA 4Y92A 1UFFA 3JV3A 2K79A 1UHCA 2K3BA 4JJBA 2YSQA 1K0XA 1KIKA 4AFZC 1AEYA 1JU5C 1GBRA 4D8KA 1FMKA 4GBQA 2DL8A 1K1ZA 2ROLA 2K2MA 2KEAA 2EQIA 1WLPB 1EFNA 1ZLMA 1BBZA 2KNBB 2XMFA 2DJQA 2FPEA 2L0AA 2O9VA 3C0CA 2GBQA 1JEGA 3IQLA 1N5ZA 1I1JA 2A36A 2K7AA 1X43A 1K9AA 2FG0A 3NMZC 1UG1A 3VRZA 2DL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFZ A;  3I35 A;  2VWF A;  1MV3 A;  2J06 A;  4F17 A;  1TG0 A;  2RQR A;  3ULR B;  2FPF A;  4AFU C;  2BZ8 A;  2KT1 A;  4RTW A;  2P4R A;  2YDL A;  2SEM A;  4J9B A;  4LUE A;  1ZUY A;  3VS5 A;  1ABQ A;  2D8J A;  1OEB A;  2X3W D;  3EG1 A;  3I9Q A;  4JZ3 A;  3TSZ A;  1GFD A;  1UGV A;  2AZV A;  2GTO A;  2ENM A;  3QWY A;  3PVL A;  2OI3 A;  4AG1 C;  1W70 A;  2AKL A;  3EG3 A;  2O9S A;  1X6G A;  1WA7 A;  1H3H A;  4E6R A;  1HSQ A;  1E6G A;  2LQW A;  2BTT A;  1UDL A;  2QDL A;  1IO6 A;  1GRI A;  4HVV A;  2K6D A;  2HCK A;  2KRS A;  1E7O A;  1MUZ A;  1UJ0 A;  2YUN A;  1RI9 A;  2RQU A;  3TVT A;  1X2K A;  1B07 A;  4M4Z A;  1YP5 A;  5IH2 A;  1Z9Z A;  1BK2 A;  5IHI A;  3VS4 A;  2C0T A;  2JTE A;  4HCK A;  2CUB A;  2JM8 A;  3NPF A;  2JS0 A;  4CC4 B;  3M0T A;  2RQV A;  4HVW A;  2CSQ A;  2KGT A;  4IIM A;  1T3L A;  1PHT A;  1M3A A;  4J9E A;  2FO0 A;  2GNC A;  3UF4 A;  2LJ0 A;  1KSW A;  2H8H A;  2GTJ A;  1A0N B;  2EVR A;  2DL3 A;  2FEI A;  2PTK A;  3VRY A;  2YUP A;  5EC7 A;  1NG2 A;  2M51 A;  1YCS B;  2EYW A;  1YNZ A;  2KXC A;  2PZ1 A;  1U3O A;  2DLP A;  1PRL C;  2JT4 A;  1UJY A;  4Z89 A;  1VYU A;  3M0S A;  3M0U A;  3H41 A;  1NM7 A;  3UA7 A;  1ZUK A;  1NYG A;  1QWE A;  2DF6 A;  4LNP A;  2HEQ A;  4AFQ C;  3UA6 A;  2YUO A;  2FPD A;  2JXB A;  1W1F A;  1LCK A;  1M3B A;  3NHN A;  2BZY A;  3EHR A;  1AOJ A;  2CT4 A;  1NEG A;  1PNJ A;  2E5K A;  1I07 A;  2DBK A;  1RLP C;  4J9G A;  2DA9 A;  1UEC A;  2YUQ A;  1X69 A;  2RNA A;  1B3Q A;  1WX6 A;  4CC7 A;  2DNU A;  2GGR A;  1Y0M A;  2HDA A;  4Z88 A;  2LMJ A;  4JZ4 A;  4JJD A;  1HJD A;  4J9F A;  2CH4 W;  1AWX A;  5IHN A;  3EG2 A;  3VS1 A;  2ROT A;  4F16 A;  2KRO A;  2L3S A;  4OMP A;  1ZSG A;  1AD5 A;  4OMQ A;  2J6K A;  2RQW A;  1SPK A;  1AWO A;  2D8H A;  2JW4 A;  2OAW A;  2LZ6 B;  3EG0 A;  1AZG B;  3GBQ A;  1AWJ A;  2RF0 A;  1U06 A;  1WI7 A;  2DRM A;  4ZNX A;  2F2X A;  4OMO A;  2KT8 A;  4J9I A;  1ZX6 A;  3H0F A;  4OMM A;  1CKB A;  2L3P A;  2B86 A;  1VYT A;  4ESR A;  1QKX A;  3U23 A;  1GL5 A;  3CQT A;  1M8M A;  1KJW A;  4QT7 A;  3RBB B;  2VKN A;  1S1N A;  1CKA A;  5FWB A;  1SEM A;  1VYV A;  2CUD A;  2PNI A;  5GJV B;  2DRK A;  2YT6 A;  1PKS A;  1YWP A;  5I11 A;  4J9C A;  1SRM A;  2LJ3 A;  1GCP A;  4ORZ A;  1M27 C;  2DYB A;  2EKH A;  3VS2 A;  2A37 A;  3M0R A;  2EW3 A;  5IXB A;  3SEM A;  2KYM A;  2LP5 A;  5ECA A;  1ZUU A;  4DEX A;  2LQN A;  1MV0 B;  2DMO A;  1WYX A;  1XOV A;  2J7I A;  2JMA A;  2A08 A;  5FWC A;  3VS0 A;  1PWT A;  1WFW A;  2KR3 A;  3I5S A;  4A63 B;  1H8K A;  1V1C A;  2I0N A;  2LX7 A;  2EYX A;  4CC2 A;  2DVJ A;  1G83 A;  1H92 A;  1GBQ A;  3M0Q A;  4GLM A;  1JXM A;  2W0Z A;  2DBM A;  3M0P A;  2OJ2 A;  1X27 A;  2JM9 A;  2LNH B;  1K0S A;  1TUC A;  2FRY A;  2MIO A;  1UHF A;  1HD3 A;  4EIK A;  1GCQ A;  1Z9Q A;  1M30 A;  2O2O A;  2DE0 X;  3I5R A;  4LN2 A;  1OPK A;  2ESW A;  1WDX A;  5FW9 A;  2RPN A;  2L3Q A;  4K11 A;  2VVK A;  2W10 A;  4WCI A;  1SHF A;  2KXD A;  3REB B;  1WXU A;  2KRM A;  3VS7 A;  2HSP A;  4RTX A;  3VS6 A;  4HVU A;  2ABL A;  1WXB A;  4RTU A;  4J9H A;  3VS3 A;  2NWM A;  2ECZ A;  1ARK A;  1UTI A;  4DEY A;  1G2B A;  2DIL A;  5GJW B;  3O5Z A;  2BZX A;  5I22 A;  2D0N A;  1NEB A;  2F2V A;  5HCK A;  1YWO A;  1PRM C;  1RUW A;  2EYZ A;  3KFV A;  2EGC A;  2RQT A;  2KBT A;  1OV3 A;  3TSW A;  2RN8 A;  4IIO A;  2AKK A;  4RTV A;  4D8D A;  2AK5 A;  4RTY A;  1Y57 A;  4RTT A;  2DX1 A;  1TUD A;  3RNJ A;  1NYF A;  3UAT A;  3NGP A;  2CT3 A;  2CRE A;  2MCN A;  4FSS A;  2CDT A;  4LE9 A;  3H0H A;  1K76 A;  1W6X A;  4Z8A A;  2GQI A;  2J6O A;  5IXF A;  1ZBJ A;  1WXT A;  1YN8 A;  2EGA A;  4X1V A;  2HBW A;  4LUD A;  3PVQ A;  1UE9 A;  1WIE A;  3PE0 A;  2KRN A;  2IIM A;  1X6B A;  2RMO A;  4R0K A;  1SHG A;  3REA B;  2KYB A;  2ED1 A;  1VA7 A;  4F14 A;  2LJ1 A;  1M3C A;  1JXO A;  2V1Q A;  1NLP C;  1PKT A;  3H0I A;  3R6N A;  3QWX X;  2JMC A;  2SRC A;  1JQQ A;  2EPD A;  3A98 A;  2F2W A;  2EYY A;  4J9D A;  1GFC A;  1K4U S;  3THK A;  4HXJ A;  2CSI A;  2JS2 A;  1J3T A;  2K9G A;  4OML A;  1T3S A;  2V1R A;  1AZE A;  2KE9 A;  1NLO C;  2M0Y A;  3EGU A;  3EHQ A;  3LH5 A;  4CC3 A;  2O31 A;  2FRW A;  1ABO A;  2ED0 A;  2EBP A;  1UUE A;  5IHK A;  1CSK A;  4JJC A;  4KRT A;  1T0J A;  1QWF A;  3SHW A;  2CH4 A;  1OPL A;  2J05 A;  2G6F X;  1JO8 A;  4OMN A;  1QLY A;  1GCQ C;  1SSH A;  4RTZ A;  2X3X D;  2NUZ A;  2DL7 A;  2DL5 A;  2C0I A;  1SRL A;  4JPB W;  1AWW A;  3FJ5 A;  1T0H A;  4AG2 C;  4AFS C;  2AZS A;  2L2P A;  2DM1 A;  1X2Q A;  1OOT A;  1QKW A;  1QCF A;  1AVZ C;  2LCS A;  2J6F A;  3ZL7 C;  1FYN A;  2O88 A;  2C0O A;  1E6H A;  1U5S A;  1RLQ C;  2D1X A;  2EGE A;  4RUG A;  1BB9 A;  5L23 A;  2A28 A;  1I0C A;  1BU1 A;  2MOX A;  4Y92 A;  1UFF A;  3JV3 A;  2K79 A;  1UHC A;  2K3B A;  4JJB A;  2YSQ A;  1K0X A;  1KIK A;  4AFZ C;  1AEY A;  1JU5 C;  1GBR A;  4D8K A;  1FMK A;  4GBQ A;  2DL8 A;  1K1Z A;  2ROL A;  2K2M A;  2KEA A;  2EQI A;  1WLP B;  1EFN A;  1ZLM A;  1BBZ A;  2KNB B;  2XMF A;  2DJQ A;  2FPE A;  2L0A A;  2O9V A;  3C0C A;  2GBQ A;  1JEG A;  3IQL A;  1N5Z A;  1I1J A;  2A36 A;  2K7A A;  1X43 A;  1K9A A;  2FG0 A;  3NMZ C;  1UG1 A;  3VRZ A;  2DL4 A; 
#chains in the Genus database with same CATH topology
 2VWF A;  1MV3 A;  2J06 A;  3I55 Q;  3EFO A;  1IHW A;  1MMN A;  2XDD A;  2F69 A;  4AFU C;  1BI0 A;  4LDU A;  1EZZ B;  4C0G A;  5LJ3 j;  3VS5 A;  1RAA B;  2F5T X;  3EG1 A;  5KYU A;  1BIB A;  8AT1 B;  3C94 A;  5IN1 A;  3BDL A;  1UGV A;  2HQH A;  2ENM A;  3DB4 A;  1YBY A;  3OYI A;  2K4Y A;  4C8Q E;  3EFO B;  1Q7Y R;  2AKL A;  1OZ2 A;  2WSF E;  3G4S A;  3A8M B;  4C5H A;  3GNG A;  1WA7 A;  1H3H A;  1HSQ A;  1E6G A;  1UDL A;  3TU4 K;  5CVI A;  1WGS A;  2K6D A;  3CC7 T;  5KYU B;  5LJ5 g;  1BIA A;  1OI1 A;  4M7D C;  2KRS A;  2P84 A;  5GAN 2;  1D1A A;  1YJN Q;  2RQU A;  4AT1 B;  1B07 A;  3VUB A;  1VQN Q;  3PNW C;  3G1J A;  4ZN1 A;  3MPU B;  2JM8 A;  5GAM h;  1R77 A;  3BY7 A;  2RQV A;  2NYS A;  3M59 A;  4OMF B;  3CCM Q;  2FB7 A;  1M3A A;  3HTR A;  4BE0 A;  2GNC A;  4M75 E;  4OB1 B;  5GAN j;  2LJ0 A;  2C06 A;  2H8H A;  4GY5 A;  3TQ7 P;  1KC8 R;  2E6Z A;  3OYJ A;  3V8L A;  2EVR A;  7AT1 B;  3HFN A;  4PJL A;  1S72 Q;  2P0P A;  2EQM A;  2M51 A;  1YCS B;  1YNZ A;  1IB8 A;  1PRL C;  1UJY A;  2QEX Q;  3M0S A;  1SSF A;  3H41 A;  3CXC A;  3UA7 A;  1WHM A;  4C92 C;  1M1F A;  1QWE A;  2DF6 A;  2GFA A;  2DYI A;  2X51 A;  2YUO A;  2M1H A;  1SG5 A;  8ATC B;  3I56 T;  3G4S T;  4QQD A;  3OYG A;  2BZY A;  1NEG A;  1PNJ A;  2DBK A;  1I8F A;  3FJP A;  5A2Q E;  4JDS A;  1UEC A;  2YUQ A;  2O4X A;  1WX6 A;  4JRK A;  2CP6 A;  5HKC A;  4CC7 A;  1UEB A;  1KQS S;  3G71 Q;  1YHQ Q;  2LX9 A;  1QP2 A;  1Y96 A;  1HJD A;  2CH4 W;  1AWX A;  4E7H A;  2NUP A;  4OB3 B;  3E19 A;  3CD6 A;  3VS1 A;  2KRO A;  1ZSG A;  4F7U G;  2J6K A;  1AWO A;  2D8H A;  1VQ9 A;  1VQ5 A;  3M58 A;  5I2M A;  3QUI A;  3EG0 A;  3GBQ A;  5GAO p;  2XDB A;  2R5A A;  2RF0 A;  1ACM B;  2DRM A;  2F2X A;  2O4X B;  4OMO A;  1ZX6 A;  2XID A;  2L3P A;  1Y96 B;  1WQ7 A;  2QQA A;  3V7S A;  4PLL A;  1GL5 A;  2NUP B;  3CQT A;  1VQ8 A;  1KJW A;  2ZPF B;  1Y07 A;  4C5I A;  1S1N A;  1YIT Q;  1MMD A;  2DTH A;  1VYV A;  3RIR A;  1I81 A;  3EAE A;  1M2V A;  1SRM A;  5CQX A;  4DBH A;  9ATC B;  1M27 C;  5CCA A;  1M1G A;  4JRP A;  2A37 A;  3M0R A;  2EW3 A;  3OYE A;  2KYM A;  4KT0 E;  1TH7 A;  1P92 A;  3CME A;  4PJJ A;  2RH2 A;  2J7I A;  4KGX B;  4M7A D;  2A08 A;  5LJ5 h;  4M7A F;  3DLM A;  1ZHI A;  1KC8 C;  1BYM A;  3OYC A;  3I5S A;  1K8A C;  1H8K A;  4XK8 E;  1V1C A;  5KYX A;  2EYX A;  1X6O A;  1M2V B;  1GBQ A;  2QGG A;  4E2F B;  3F70 A;  2W0Z A;  2DBM A;  3CEY A;  1VQP A;  2DZC A;  3CD6 T;  2RHX A;  3M0P A;  3EGD A;  2JM9 A;  5CIU A;  4FM4 B;  3X20 B;  2E1H A;  4C8Q C;  2EQK A;  2FRY A;  4KH0 B;  1VQ9 T;  1VQ5 T;  2MIO A;  3MEV A;  3OS1 A;  3NTH A;  3VKI A;  3QKJ A;  2OTL Q;  3EH1 A;  4XU0 A;  3BDU A;  1OPK A;  2VXF A;  2DJZ A;  1WDX A;  3GNF B;  2VGM A;  5KYX B;  2P0Q A;  1RI0 A;  1SHF A;  3REB B;  1TUG B;  3VS7 A;  4WTO B;  1VQ6 T;  3EGD B;  2ABL A;  3RES A;  4PFO A;  3VS3 A;  2CKK A;  1B34 A;  2CZ1 B;  1ARK A;  4FT4 A;  2FZC B;  4PFP A;  3JCM d;  2CP3 A;  1N27 A;  2X9H A;  2XU8 A;  3JCM W;  2F2V A;  1PD0 A;  5HCK A;  4M75 C;  2KSS A;  2HMA A;  1RUW A;  2LVM A;  4LDV A;  2RQT A;  4M77 A;  4LDW A;  2RB6 A;  4RTV A;  1ZBX A;  3A8G B;  3CCS T;  4PFZ A;  2K3Y A;  4XU3 A;  5CKE A;  4XU1 A;  1YCY A;  5D7U A;  2DK3 A;  1B34 B;  3PIP A;  3KUF A;  4O5V A;  2FL7 A;  3J80 E;  1WHK A;  1UGQ B;  1VQP T;  2RHY A;  4C92 B;  2COW A;  3MO8 A;  3CCQ A;  2QYZ A;  3JCM c;  3CCL T;  1K76 A;  1WXT A;  2DD4 A;  1YN8 A;  2EGA A;  4X1V A;  2HBW A;  4M77 B;  2OAU A;  3PVQ A;  1TTH B;  4PLI A;  3C12 A;  4Y91 A;  4M78 A;  2IIM A;  1FMW A;  2X4Y A;  1SHG A;  3REA B;  5LJ3 g;  4ELY C;  2ED1 A;  5GAM e;  1Q82 R;  2COZ A;  1M90 U;  5GMK h;  5GAO m;  5GAO l;  3JB9 J;  2DEU A;  3I55 A;  3LW5 E;  4C0D C;  1JQQ A;  3E2U A;  4FYV B;  1GFC A;  4A4K A;  3S3O A;  5HY6 A;  5DM7 R;  1J3T A;  2NUT A;  3V7R A;  4M78 B;  2BE9 B;  2QGF B;  4IUU A;  2KE9 A;  1NLO C;  4RG8 A;  1AZE A;  4CC3 A;  3OYK A;  2FRW A;  3M5A A;  4ZGJ B;  3H9N A;  4O6J A;  4FW2 A;  4JJC A;  4MZM A;  2E65 A;  4Y28 E;  1VQM T;  2J05 A;  5D6Y A;  4OMN A;  1QVF P;  1QLY A;  1IZ6 A;  1PCX A;  5C0M A;  2NUZ A;  1SRL A;  4JPB W;  2BIV A;  2NUT B;  1DJ7 B;  2A0F B;  4MZP A;  2AZS A;  3S6W A;  1VIE A;  3LWH A;  2DM1 A;  1TU0 B;  1QCF A;  3OSS C;  5GMK i;  1E6H A;  4DBQ A;  5GAN g;  1G5V A;  4C8Q A;  5HK0 A;  2EGE A;  1YJN A;  3OYM A;  2A28 A;  1I0C A;  3X25 B;  2Z0W A;  1H64 1;  1UHC A;  3L1A A;  2K3B A;  4BI3 A;  2QQ9 A;  2MAM A;  3CCM A;  2YRV A;  3QG1 A;  1RAH B;  5I21 A;  3EGX A;  1AEY A;  1GBR A;  4D8K A;  3I55 T;  4EMK A;  5AYF A;  4J8O A;  5FU7 C;  4FU6 A;  2K2M A;  3DKM A;  1WLP B;  2JUF A;  2E12 A;  2QQS A;  2XMF A;  4C8Q B;  2O9V A;  1S72 A;  2GBQ A;  3ER0 A;  4OP0 A;  2A36 A;  1NPP A;  3M4G A;  4KUD K;  1NJI R;  2QEX A;  1FXX A;  3VRZ A;  4NL3 A;  2PVD B;  6AT1 B;  3M9Q A;  3LWI A;  1G3Y A;  1KFZ A;  3I35 A;  2DD5 A;  5D6W A;  4F17 A;  3EGX B;  4EMK B;  2FPF A;  5GMK j;  1N9S A;  4RTW A;  1VQK Q;  4NOY A;  2YDL A;  1BI1 A;  4J9B A;  1M8V A;  4FCY A;  5FRO A;  2RA2 A;  3T9N A;  2DXU A;  3RMS A;  2LTO A;  2CP2 A;  5LJ5 e;  3I9Q A;  1WHG A;  4LDY A;  3CC4 Q;  2AZV A;  4C92 G;  4R56 A;  2GTO A;  3G71 A;  3OYY A;  1VQ7 Q;  3PVL A;  1YJN T;  1PM3 A;  2OI3 A;  1YHQ A;  4AG1 C;  1W70 A;  5EG2 A;  1VQN T;  2EJF A;  3HRU A;  1IGQ A;  5LJ3 h;  4BI4 A;  2O9S A;  4M77 G;  4B9X A;  1X6G A;  3LH0 A;  2GQV A;  1YFN A;  3CCM T;  2BTT A;  1H3Z A;  1Q7Y U;  2QDL A;  4XU2 A;  2CYZ B;  4BD3 A;  2ZCF B;  2HCK A;  2A3L A;  4E7K A;  2YUN A;  2DVE A;  4ZGE B;  1S72 T;  3TVT A;  1X2K A;  2PUK B;  1RAF B;  1BK2 A;  3VS4 A;  3QXE B;  2C0T A;  1QVF A;  4HCK A;  1IGU A;  2CUB A;  2HD0 A;  2JS0 A;  4CC4 B;  1M1K C;  3M0T A;  2CSQ A;  3SD4 A;  1YIT A;  1T3L A;  2F5K A;  4M78 G;  4QKU A;  2QTV A;  3L42 A;  2FO0 A;  2KK4 A;  3VYH B;  3VV0 A;  2GTJ A;  2DFU A;  5IT9 E;  3OYD A;  2PTK A;  1Y71 A;  3VRY A;  4F7U A;  2YUP A;  4CI0 C;  2LDM A;  4XTZ A;  2DLP A;  1KC8 U;  4XTU A;  4ME7 A;  1TSF A;  3CC2 Q;  3G71 T;  4N4H A;  1YHQ T;  2ZPB B;  3V8J A;  1IRE B;  2K5I A;  1LCK A;  2X35 A;  4BDZ A;  3NHN A;  1HXD A;  1SF9 A;  4OB0 B;  1I07 A;  1RLP C;  1W2B S;  2DA9 A;  4CRI A;  4D6W A;  1Q86 R;  2OTL A;  3JB9 G;  5GAO q;  2DNU A;  2VXE A;  1Y0M A;  2HDA A;  2BUD A;  1OX9 A;  4M77 F;  4C5E A;  3EG2 A;  1MNE A;  2VUB A;  2R57 A;  2KQW A;  1YIT T;  4OMQ A;  3GIB A;  2RQW A;  1SPK A;  2ZGW A;  4C8Q G;  1Q81 C;  2HZY A;  2GCX A;  1UGS B;  1U06 A;  1WI7 A;  4ZNX A;  4E7J A;  2KT8 A;  3HSB A;  1LPL A;  1CKB A;  3MHX A;  2B86 A;  2DTI A;  1M8M A;  4PJO A;  1G3W A;  1SEM A;  4M78 F;  5GJV B;  2DRK A;  3JCM X;  4ORZ A;  1B7T A;  1KHC A;  3QZ9 B;  3V8K A;  5GAN 3;  4XQ3 A;  3VS2 A;  3JAM E;  4M75 G;  5ECA A;  1MV0 B;  4J6X A;  1K9M C;  1K73 C;  2MMP A;  2OTL T;  2HL5 C;  2JMA A;  5GAN 6;  1WFW A;  2RJD A;  4PJO B;  4A63 B;  4FW1 A;  3WVE B;  2I0N A;  1D0Y A;  3H6Z A;  1H92 A;  1PSF A;  1JXM A;  4TVR A;  1QP3 A;  2DXB A;  3QZ5 B;  3TEE A;  1K8A R;  2LNH B;  5HK3 A;  4II1 A;  1HK9 A;  4QW2 A;  1K0S A;  2RJE A;  3MEU A;  3JB9 D;  2KI7 A;  3JB9 F;  4LN2 A;  2DE0 X;  3BE3 A;  3A8H B;  3D7S B;  3RMQ A;  4K11 A;  2IG0 A;  3OMC A;  4J5Y A;  4XTV A;  1WXU A;  1Q86 C;  4RTX A;  3VS6 A;  3VYG A;  4HVU A;  4A4F A;  2DET A;  3SB2 A;  4C8Q F;  4LD6 A;  4RTU A;  2EIF A;  1M9S A;  4BY6 B;  2ECZ A;  1KD1 C;  1UTI A;  4DEY A;  1PG5 B;  1JJ2 P;  2BZX A;  4NS5 A;  1YWO A;  4ANJ A;  1PRM C;  2A7Y A;  5LL6 S;  4C0F A;  2YXY A;  1OV3 A;  1I4K 1;  4M7A E;  5GAO n;  3GLX A;  4FYW B;  4RTY A;  1QVG P;  4A4G A;  5LJ3 e;  3VUZ A;  3RNJ A;  2QAS A;  1NYF A;  2G3R A;  2OTJ Q;  3NGP A;  2CRE A;  3EG9 A;  4P5N A;  4LE9 A;  1KK7 A;  1ZSZ C;  1KG1 A;  2JNG A;  3OB9 A;  3EFS A;  3LLR A;  3JCM f;  4FSX A;  2DZ9 A;  2RMO A;  3SWN C;  1X6B A;  3CCV Q;  5KYN A;  2KYB A;  1U1S A;  4IUQ A;  4JUV A;  1M3C A;  2RJC A;  3EG9 B;  1N8R C;  2V1Q A;  5GAN 5;  1PKT A;  1TXQ A;  4A4H A;  4EDU A;  3QWX X;  2JMC A;  2SRC A;  1Q82 U;  2MPX C;  4PNO A;  2E10 A;  1XNI A;  2F2W A;  3QDR B;  4IUT A;  4J9D A;  1VQK A;  1K4U S;  3THK A;  3L2Z A;  2PU9 B;  2K9G A;  3LGF A;  1PSE A;  3LH5 A;  3MP8 A;  2PQW A;  1HYO A;  3CC4 A;  1ABO A;  2VC8 A;  2CS7 A;  4M7D A;  1UUE A;  5IHK A;  5GAN e;  4KRT A;  1VQ7 A;  4XTW A;  2EJG A;  3HP9 A;  3SHW A;  4ZTF A;  2YWW A;  1GCQ C;  2VGN A;  2DL7 A;  5GMK m;  1WJS A;  2DL5 A;  4PJO G;  3HRS A;  3RKX A;  2EWN A;  5GMK l;  3FJ5 A;  2EYQ A;  4AFS C;  2E4H A;  1IRX A;  2D9T A;  3CPW P;  1OOT A;  1QKW A;  5DY9 A;  4HA8 A;  1VQ8 T;  4M7D B;  2C0O A;  2K5L A;  3QJ6 A;  2D1X A;  4F7U F;  3MEW A;  2EQJ A;  4OB2 B;  3JB9 I;  4ZN3 A;  1BU1 A;  2MOX A;  4PJM A;  4Y92 A;  1UFF A;  3SDZ A;  1G3S A;  1LOJ A;  1JJ2 A;  4R55 A;  4JJB A;  4JS4 A;  2HQE A;  4FL6 A;  4C92 A;  2DAQ A;  2HNI A;  1KIK A;  4X34 A;  1VQ4 Q;  1UGP B;  1K1Z A;  3CME T;  1VQK T;  1BBZ A;  2M0O A;  2JOY A;  2KNB B;  2DJQ A;  3JCM h;  1QVG A;  3C0C A;  4E7I A;  2M02 A;  3PTA A;  1M4Z A;  1ZQ1 A;  3P8B B;  1X43 A;  4ELZ C;  2QG9 B;  4C5G A;  3CC2 A;  1VQ7 T;  1TG0 A;  1YI2 Q;  3G6E Q;  2RM4 A;  2QDY B;  3I56 Q;  3HHT B;  2XKO C;  2BZ8 A;  4HKE A;  2KT1 A;  4N4G A;  3ZFJ A;  2RK2 A;  1NJI U;  2P4R A;  3MP1 A;  4WF2 A;  2SEM A;  2RI2 A;  1ABQ A;  1OEB A;  2MWO A;  1KHI A;  2D6F A;  4Q5W A;  4B9W A;  5CO7 A;  3A8L B;  3OYB A;  1R0C B;  3QWY A;  2QTX A;  1R0B G;  1ZA2 B;  3L2V A;  3X24 B;  3EG3 A;  3E9F A;  2E6N A;  4HCC A;  5CKF A;  4M7A C;  2MK5 A;  2LRQ A;  4PJO D;  3M53 A;  3N5B B;  4PJO F;  2KVQ G;  2I2L A;  1FMV A;  4DOV A;  1OX8 A;  1IO6 A;  2WSC E;  2L5Q A;  3RKY A;  2YHT A;  1MUZ A;  1UJ0 A;  1ZSZ B;  1RI9 A;  2L3R A;  1WHL A;  2PVG B;  4RMO A;  4HCB A;  2KY9 A;  4M4Z A;  5IHI A;  4FYY B;  1AHJ B;  4A4E A;  3E1S A;  3NPF A;  3TRE A;  2ZAE A;  1PC0 A;  4HVW A;  2KGT A;  4Z02 A;  2LQ8 A;  3CC2 T;  2V8J A;  2EKO A;  3CCQ T;  3UF4 A;  3CPW A;  4UC4 A;  2PVO B;  1RAB B;  3OSV A;  1M1K R;  1A0N B;  2FEI A;  3OA6 A;  3OYH A;  3QDF A;  3L2Q A;  2PZ1 A;  2XDP A;  4ZGD B;  1U3O A;  2ZPH B;  2Y4Y A;  2JT4 A;  3QYH B;  4DOW A;  4Z89 A;  4RCB A;  3M0U A;  3JB9 H;  4FT2 A;  1BI2 A;  3OW2 S;  3UWN A;  1NYG A;  4LNP A;  2HEQ A;  3NTK A;  4OVA A;  3CMA Q;  2FPD A;  4B6M A;  2JXB A;  4BE1 A;  1F1B B;  1M3B A;  2RHZ A;  4M7D G;  1AOJ A;  2E5K A;  2EAY A;  3CCJ Q;  4J9G A;  4PK4 A;  1B3Q A;  1WQW A;  1QQJ A;  3X26 B;  2JVV A;  4Z88 A;  2LCL A;  3OBY A;  4M75 A;  2L89 A;  4JJD A;  1VQL Q;  1RAE B;  3M55 A;  1Q86 U;  1VQ6 Q;  3A8O B;  1EX4 A;  4F16 A;  3MEA A;  2RD1 A;  1AD5 A;  2JW4 A;  2OAW A;  2HSE B;  4EPC A;  3FDR A;  1AZG B;  3JRZ A;  5CR2 A;  5FRN A;  4J6W A;  1AWJ A;  2JTM A;  1D3B A;  4J9I A;  3JCM Q;  3ME9 A;  1Q81 R;  3H0F A;  4OMM A;  3RKW A;  4M75 B;  1W4S A;  1MMG A;  4ESR A;  1LNX A;  3VU3 C;  2QI2 A;  4XTX A;  3CCS Q;  4QT7 A;  2VKN A;  4BDY A;  3OS0 A;  1CKA A;  1GXI E;  5FWB A;  3M54 A;  1JBM A;  1QVP A;  4YTL A;  1VIF A;  1PKS A;  4J9C A;  4BE2 A;  2AIR B;  2LJ3 A;  3CCR Q;  1D3B B;  2JJ9 A;  2OTJ A;  3CCL Q;  3ZBD A;  4XAX B;  1MND A;  2EKH A;  2LP5 A;  5L8R E;  1C1A A;  4DEX A;  2DMO A;  1WYX A;  2E70 A;  1XOV A;  1WJQ A;  4VUB A;  4JJN K;  3VS0 A;  1PWT A;  4AMC A;  4QVC A;  2KR3 A;  1MMA A;  3X28 B;  2QEX T;  1KQ2 A;  4JLG A;  3Q1J A;  3WXM B;  1BI3 A;  2DVJ A;  3CCV A;  2DO3 A;  4GLM A;  1JRI A;  1XJW B;  4X9D A;  1VQO Q;  3CCU Q;  1K9M R;  1K73 R;  4M77 E;  4M7D F;  1RAD B;  2E3H A;  2AHJ B;  1X27 A;  4QQ6 A;  1TUC A;  2DXC A;  2ZPI B;  2ZPG B;  1UHF A;  4C0D B;  1HD3 A;  4N0A C;  4M7A B;  4EIK A;  2HBP A;  1X01 A;  2X4W A;  2O2O A;  3I5R A;  3L2W A;  2RI3 A;  2Y4X A;  2LT4 A;  1FWZ A;  2ESW A;  1K8A U;  4L6V 5;  5FW9 A;  1KQS P;  2L3Q A;  1LVK A;  2VVK A;  1YIJ Q;  2W10 A;  2KXD A;  5I2S A;  2HSP A;  3JCM b;  5GAN d;  3ASK A;  1WXB A;  2COY A;  4M78 E;  3DB3 A;  5CQY A;  2NWM A;  2X4X A;  4E7Z A;  5GAM f;  3J7A F;  3QII A;  4KUL A;  3SFM A;  2DIL A;  4DBF A;  3QJY A;  4PKC C;  4C92 D;  4C92 F;  5I22 A;  3J81 E;  1N6A A;  2R58 A;  1KD1 R;  2KBT A;  1UB4 A;  4M77 D;  4D8D A;  3RR6 A;  5GMK e;  2AK5 A;  4MDX A;  5CKD A;  1Y57 A;  5AT1 B;  4L59 A;  4J83 A;  2Y90 A;  1Q95 G;  2KDS A;  3CCE Q;  4OF1 A;  3OYN A;  1IHV A;  2MYS A;  4DA4 A;  4LDX A;  4GLK A;  1V29 B;  5KCH A;  2DTO A;  1VQ4 A;  1W6X A;  2GQI A;  4BUG A;  2J6O A;  3HL8 A;  5FU7 B;  1NBE B;  2OX7 A;  1YJ9 Q;  1UE9 A;  1R8O B;  2HL3 A;  3PE0 A;  2KRN A;  4M78 D;  4ZTJ A;  2K5F A;  3MJX A;  4MDW A;  1VA7 A;  4F14 A;  2LJ1 A;  3UPU A;  1NLP C;  2VYT A;  2XK0 A;  3H0I A;  3PMT A;  1YI2 A;  3G6E A;  2EPD A;  3I56 A;  3A98 A;  2RO0 A;  2P4T A;  2FVU A;  2WAC A;  4HXJ A;  2CSI A;  1N8R R;  2FYK A;  1D1C A;  3LGL A;  4OML A;  1T3S A;  3GF5 A;  2QQB A;  4RG2 A;  2M0Y A;  3EHQ A;  1OU8 A;  4DQ2 A;  5GAM d;  2O31 A;  1UGR B;  2KMT A;  2PUO B;  2ED0 A;  2EBP A;  3RUX A;  3RER A;  1CSK A;  3MCA B;  2YLC A;  3JCM P;  4IUR A;  1T0J A;  1QWF A;  1NE8 A;  3MET A;  2CH4 A;  1OPL A;  2RHU A;  3A1P A;  3MP6 A;  1XTD A;  4RTZ A;  2X3X D;  3L2R A;  5DLO A;  1YJW Q;  2C0I A;  3MKD A;  1AWW A;  1KQS A;  1O75 A;  1T0H A;  4AG2 C;  2L8D A;  2L2P A;  1VQ4 T;  1X2Q A;  3ZL7 C;  2MI6 A;  2FZK B;  4C0Z A;  3DLL A;  5KE3 A;  2DXT A;  4C8Q D;  4RUG A;  2CP7 A;  2X4J A;  3OY9 A;  2YRC A;  5L23 A;  4IUV A;  4N0A A;  5LJ5 f;  1QCO A;  4M7A G;  3JV3 A;  2K79 A;  2QA4 Q;  5KCO A;  3PGG A;  5CKH A;  4E47 A;  3JCM g;  3L2U A;  2B8A A;  1K0X A;  1JU5 C;  1FMK A;  4GBQ A;  1YI2 T;  2ROL A;  3G6E T;  4JRI A;  4XTY A;  2KEA A;  4M77 C;  2EQI A;  1ZLM A;  3LX7 A;  4BB7 A;  3CBP A;  4JRQ A;  5KE2 A;  3OS5 A;  2FPE A;  1JEG A;  2CZ7 B;  4KBM B;  4MML A;  2HKN A;  1K9A A;  2XI9 A;  3NMZ C;  1UG1 A;  3CXC S;  2CGH A;  3LYI A;  4LXC A;  4MZT A;  2DL4 A;  4M75 D;  1D1B A;  4M75 F;  2RQR A;  3PIO A;  3ULR B;  1N9R A;  1I5L A;  3CMA A;  5FRM A;  2H3J A;  3TCJ A;  4LUE A;  1ZUY A;  3NFC A;  4M78 C;  2BE7 D;  2D8J A;  3O8V A;  2X3W D;  1OQK A;  1TWB A;  1XQH A;  1Q7Y C;  3CCJ A;  2E41 A;  1WHH A;  3OYF A;  4JZ3 A;  3TSZ A;  3JCM J;  1U8R A;  1GFD A;  2HKQ B;  4BAC A;  2V8K A;  4F7U E;  2LCC A;  1VUB A;  5DLQ E;  4X9C A;  1VQL A;  1QW1 A;  1VQ6 A;  3QO3 A;  4EMG A;  2LNV A;  5CKB A;  3AHU A;  3NTI A;  4E6R A;  2QK0 A;  2LQW A;  5GAM j;  3GPL A;  3AT1 B;  1GRI A;  4HVV A;  2LT1 A;  5LJ5 d;  1WJR A;  5KH6 A;  1E7O A;  2DEQ A;  1G8X A;  3OS2 A;  1YP5 A;  1JB0 E;  5IH2 A;  1Z9Z A;  2JTE A;  3CCS A;  4IUP A;  1EIF A;  2EJ9 A;  2K3X A;  3G7Z A;  4IIM A;  1PHT A;  2YLB A;  3OW2 P;  4J9E A;  2RJF A;  3CC7 Q;  3QYG B;  4J7I A;  1QCN A;  3CMA T;  1KSW A;  2GF7 A;  2MWP A;  3CCR A;  1WZO A;  4EMH A;  4E7L A;  2E5Q A;  3CCL A;  3M57 A;  2DL3 A;  1WHJ A;  5FU6 C;  5KYY A;  4QVD A;  5EC7 A;  4KGZ B;  1NG2 A;  3OBW A;  2JZ2 A;  2KXC A;  2EYW A;  3CCJ T;  5D6X A;  1C6V X;  1TOV A;  1M1K U;  1VYU A;  4F04 B;  1NM7 A;  2DER A;  1ZUK A;  3JSC A;  3M56 A;  4AFQ C;  3C4S A;  3UA6 A;  4EMK C;  4DBR A;  1VQL T;  2DIQ A;  1W1F A;  1VQO A;  3CCU A;  4J7F A;  3EHR A;  5J39 A;  2YRD A;  1V76 A;  2CT4 A;  4PJO E;  5KYY B;  1X69 A;  2RNA A;  2M9U A;  3S3M A;  3CC4 T;  1PD1 A;  1BCO A;  2GGR A;  3QSU A;  2LMJ A;  4JZ4 A;  1D09 B;  4HT8 A;  1RL2 A;  4J9F A;  4KUI A;  1YIJ A;  5IHN A;  4QVZ A;  3G4S Q;  2ROT A;  4OMP A;  2L3S A;  1VQM A;  2XG8 D;  2LZ6 B;  2XIC A;  5C6S A;  2IVW A;  2CZ6 B;  1JJ2 S;  2GFU A;  3CCR T;  2HAX A;  1ZSZ A;  2BKD N;  1WNL A;  1VYT A;  1I5O B;  3V7C A;  1QKX A;  1X75 C;  3U23 A;  5M9O A;  3BW1 A;  3RBB B;  1QVG S;  2FZG B;  1AT1 B;  1OZ3 A;  1Q81 U;  2CUD A;  4JLI A;  3SWN A;  3URG A;  5LJ5 j;  2PNI A;  2YT6 A;  1YWP A;  1MHN A;  5I11 A;  2IPO B;  3FEO A;  1GCP A;  1VQO T;  3CCU T;  1TS9 A;  4V2S A;  2DYB A;  2O01 E;  3CCE A;  2CP5 A;  5IXB A;  3SEM A;  3JCM V;  1ZUU A;  2LQN A;  2ZZD A;  1RAI B;  4NL2 A;  5FWC A;  3QPH A;  2CP0 A;  3P8D A;  5IAY A;  1YJ9 A;  3ZEH A;  3OW2 A;  1NPR A;  3SWN B;  3E9G A;  2LX7 A;  4CC2 A;  1G83 A;  5GAN 4;  3M0Q A;  1YIJ T;  4IKF A;  3OMG A;  2F1L A;  3C95 A;  2OJ2 A;  2EFI A;  4J6Y A;  1QMC A;  2ATC B;  5LJ3 f;  1RAG B;  1K9M U;  1K73 U;  1GCQ A;  1Z9Q A;  2R5M A;  1W2B P;  1M30 A;  1FX7 A;  4A53 A;  2RPN A;  4N4I A;  2V26 A;  4WCI A;  3PFS A;  3CD6 Q;  2KRM A;  1IXD A;  1ZA1 B;  3INZ A;  1SKU B;  3PT9 A;  1VQ9 Q;  1VQ5 Q;  1VQN A;  4J9H A;  1OUL A;  3UT1 A;  5CAI A;  4LD9 K;  1G2B A;  5GJW B;  3O5Z A;  2RHI A;  3CCE T;  1YJW A;  4HT9 A;  3CPW S;  2D0N A;  1NEB A;  2H3E B;  4QQG A;  2EYZ A;  3OYA A;  3KFV A;  1LJO A;  2EGC A;  3EH2 A;  1VQ8 Q;  2ZPE B;  2E3I A;  3TSW A;  1O9S A;  2RN8 A;  4IIO A;  4A54 A;  2AKK A;  3FC3 A;  4JS5 A;  1M5Q 1;  1YJ9 T;  5FU6 B;  4RTT A;  1KD1 U;  4BI8 B;  2DX1 A;  3BFM A;  1TUD A;  2LQK A;  3UAT A;  4KGV B;  2QA4 A;  2MF2 A;  2CT3 A;  4RKU E;  5GAN f;  4M7D E;  2MCN A;  4FSS A;  2M16 A;  2CDT A;  2AT1 B;  3H0H A;  5A0L A;  3FB9 A;  5GAO r;  4Z8A A;  3CME Q;  5IXF A;  1Q82 C;  1ZBJ A;  5A0G A;  3H8Z A;  1M2O A;  4LUD A;  1M90 R;  1WIE A;  5KYW A;  4PJO C;  1KQ1 A;  1WPY A;  1D0Z A;  4R0K A;  4OGE A;  5LJ3 d;  2LC4 A;  3S3N A;  5A0D A;  1VQP Q;  4PL6 A;  2KAF A;  2V8I A;  2WSE E;  2XHC A;  1JXO A;  1NZ9 A;  4HCZ A;  3FLG A;  3RDV A;  3R6N A;  4OGC A;  2EQU A;  1RAC B;  3PMI A;  2RI5 A;  5GAN 8;  2EYY A;  1G3T A;  4M7A A;  1OYX A;  5FLX E;  3EFR A;  4FYX B;  1U1T A;  5KYW B;  1YJW T;  2JS2 A;  1VOM A;  3UDC A;  2XD0 A;  2QXF A;  5J26 A;  4C92 E;  2V1R A;  2QAZ A;  2VV5 A;  3EGU A;  2JN0 A;  3FRN A;  5GAM g;  2VAS A;  4L5G A;  3KXT A;  1N8R U;  4M7D D;  2JTF A;  3QBY A;  4BY6 C;  3GOX A;  3HKS A;  2NLU A;  2G6F X;  1JO8 A;  1W2B A;  3FIF A;  1SSH A;  2QA4 T;  3OYL A;  3JCM e;  3VJP A;  2HQX A;  2E64 A;  2K57 A;  2QQR A;  2CZ0 B;  4MMK A;  1AVZ C;  2LCS A;  2J6F A;  3CBO A;  3WVD B;  1FYN A;  2O88 A;  3A5Z B;  3OQ5 A;  1U5S A;  3P8H A;  1RLQ C;  2P0K A;  4RCC A;  1BCM A;  1BB9 A;  1VQM Q;  1Y7X A;  1BKB A;  3HRT A;  4KH1 B;  1QVF S;  3R6O A;  3HPW A;  2K2V A;  3HFO A;  3CXC P;  1D0X A;  2YSQ A;  3QHS A;  3CCQ Q;  2OTJ T;  4ATO A;  5GAN h;  1C0M A;  3KBG A;  4PJN A;  5J3B A;  4AFZ C;  3CBM A;  3CC7 A;  2DL8 A;  3M4Y A;  5CK9 A;  1NJI C;  1EFN A;  1OU9 A;  3CPF A;  4F7U B;  2DKG A;  2L0A A;  2DPP B;  2VB6 A;  3IQL A;  1N5Z A;  1I1J A;  2K7A A;  4FIB A;  2D0Q B;  3GP8 A;  3CCV T;  1MGQ A;  2FG0 A;  2FHD A;  4E7S A;  5GAN 7;  1M90 C;  2RK1 A;  2DIG A; 
#chains in the Genus database with same CATH homology
 1KFZ A;  3I35 A;  2VWF A;  1MV3 A;  2J06 A;  4F17 A;  1TG0 A;  2RQR A;  3ULR B;  2FPF A;  4AFU C;  2BZ8 A;  2KT1 A;  4RTW A;  2P4R A;  2YDL A;  2SEM A;  4J9B A;  4LUE A;  1ZUY A;  3VS5 A;  1ABQ A;  2D8J A;  1OEB A;  2X3W D;  3EG1 A;  3I9Q A;  4JZ3 A;  3TSZ A;  1GFD A;  1UGV A;  2AZV A;  2GTO A;  2ENM A;  3QWY A;  3PVL A;  2OI3 A;  4AG1 C;  1W70 A;  2AKL A;  3EG3 A;  2O9S A;  1X6G A;  1WA7 A;  1H3H A;  4E6R A;  1HSQ A;  1E6G A;  2LQW A;  2BTT A;  1UDL A;  2QDL A;  1IO6 A;  1GRI A;  4HVV A;  2K6D A;  2HCK A;  2KRS A;  1E7O A;  1MUZ A;  1UJ0 A;  2YUN A;  1RI9 A;  2RQU A;  3TVT A;  1X2K A;  1B07 A;  4M4Z A;  1YP5 A;  5IH2 A;  1Z9Z A;  1BK2 A;  5IHI A;  3VS4 A;  2C0T A;  2JTE A;  4HCK A;  2CUB A;  2JM8 A;  3NPF A;  2JS0 A;  4CC4 B;  3M0T A;  2RQV A;  4HVW A;  2CSQ A;  2KGT A;  4IIM A;  1T3L A;  1PHT A;  1M3A A;  4J9E A;  2FO0 A;  2GNC A;  3UF4 A;  2LJ0 A;  1KSW A;  2H8H A;  2GTJ A;  1A0N B;  2EVR A;  2DL3 A;  2FEI A;  2PTK A;  3VRY A;  2YUP A;  5EC7 A;  1NG2 A;  2M51 A;  1YCS B;  2EYW A;  1YNZ A;  2KXC A;  2PZ1 A;  1U3O A;  2DLP A;  1PRL C;  2JT4 A;  1UJY A;  4Z89 A;  1VYU A;  3M0S A;  3M0U A;  3H41 A;  1NM7 A;  3UA7 A;  1ZUK A;  1NYG A;  1QWE A;  2DF6 A;  4LNP A;  2HEQ A;  4AFQ C;  3UA6 A;  2YUO A;  2FPD A;  2JXB A;  1W1F A;  1LCK A;  1M3B A;  3NHN A;  2BZY A;  3EHR A;  1AOJ A;  2CT4 A;  1NEG A;  1PNJ A;  2E5K A;  1I07 A;  2DBK A;  1RLP C;  4J9G A;  2DA9 A;  1UEC A;  2YUQ A;  1X69 A;  2RNA A;  1B3Q A;  1WX6 A;  4CC7 A;  2DNU A;  2GGR A;  1Y0M A;  2HDA A;  4Z88 A;  2LMJ A;  4JZ4 A;  4JJD A;  1HJD A;  4J9F A;  2CH4 W;  1AWX A;  5IHN A;  3EG2 A;  3VS1 A;  2ROT A;  4F16 A;  2KRO A;  2L3S A;  4OMP A;  1ZSG A;  1AD5 A;  4OMQ A;  2J6K A;  2RQW A;  1SPK A;  1AWO A;  2D8H A;  2JW4 A;  2OAW A;  2LZ6 B;  3EG0 A;  1AZG B;  3GBQ A;  1AWJ A;  2RF0 A;  1U06 A;  1WI7 A;  2DRM A;  4ZNX A;  2F2X A;  4OMO A;  2KT8 A;  4J9I A;  1ZX6 A;  3H0F A;  4OMM A;  1CKB A;  2L3P A;  2B86 A;  1VYT A;  4ESR A;  1QKX A;  3U23 A;  1GL5 A;  3CQT A;  1M8M A;  1KJW A;  4QT7 A;  3RBB B;  2VKN A;  1S1N A;  1CKA A;  5FWB A;  1SEM A;  1VYV A;  2CUD A;  2PNI A;  5GJV B;  2DRK A;  2YT6 A;  1PKS A;  1YWP A;  5I11 A;  4J9C A;  1SRM A;  2LJ3 A;  1GCP A;  4ORZ A;  1M27 C;  2DYB A;  2EKH A;  3VS2 A;  2A37 A;  3M0R A;  2EW3 A;  5IXB A;  3SEM A;  2KYM A;  2LP5 A;  5ECA A;  1ZUU A;  4DEX A;  2LQN A;  1MV0 B;  2DMO A;  1WYX A;  1XOV A;  2J7I A;  2JMA A;  2A08 A;  5FWC A;  3VS0 A;  1PWT A;  1WFW A;  2KR3 A;  3I5S A;  4A63 B;  1H8K A;  1V1C A;  2I0N A;  2LX7 A;  2EYX A;  4CC2 A;  2DVJ A;  1G83 A;  1H92 A;  1GBQ A;  3M0Q A;  4GLM A;  1JXM A;  2W0Z A;  2DBM A;  3M0P A;  2OJ2 A;  1X27 A;  2JM9 A;  2LNH B;  1K0S A;  1TUC A;  2FRY A;  2MIO A;  1UHF A;  1HD3 A;  4EIK A;  1GCQ A;  1Z9Q A;  1M30 A;  2O2O A;  2DE0 X;  3I5R A;  4LN2 A;  1OPK A;  2ESW A;  1WDX A;  5FW9 A;  2RPN A;  2L3Q A;  4K11 A;  2VVK A;  2W10 A;  4WCI A;  1SHF A;  2KXD A;  3REB B;  1WXU A;  2KRM A;  3VS7 A;  2HSP A;  4RTX A;  3VS6 A;  4HVU A;  2ABL A;  1WXB A;  4RTU A;  4J9H A;  3VS3 A;  2NWM A;  2ECZ A;  1ARK A;  1UTI A;  4DEY A;  1G2B A;  2DIL A;  5GJW B;  3O5Z A;  2BZX A;  5I22 A;  2D0N A;  1NEB A;  2F2V A;  5HCK A;  1YWO A;  1PRM C;  1RUW A;  2EYZ A;  3KFV A;  2EGC A;  2RQT A;  2KBT A;  1OV3 A;  3TSW A;  2RN8 A;  4IIO A;  2AKK A;  4RTV A;  4D8D A;  2AK5 A;  4RTY A;  1Y57 A;  4RTT A;  2DX1 A;  1TUD A;  3RNJ A;  1NYF A;  3UAT A;  3NGP A;  2CT3 A;  2CRE A;  2MCN A;  4FSS A;  2CDT A;  4LE9 A;  3H0H A;  1K76 A;  1W6X A;  4Z8A A;  2GQI A;  2J6O A;  5IXF A;  1ZBJ A;  1WXT A;  1YN8 A;  2EGA A;  4X1V A;  2HBW A;  4LUD A;  3PVQ A;  1UE9 A;  1WIE A;  3PE0 A;  2KRN A;  2IIM A;  1X6B A;  2RMO A;  4R0K A;  1SHG A;  3REA B;  2KYB A;  2ED1 A;  1VA7 A;  4F14 A;  2LJ1 A;  1M3C A;  1JXO A;  2V1Q A;  1NLP C;  1PKT A;  3H0I A;  3R6N A;  3QWX X;  2JMC A;  2SRC A;  1JQQ A;  2EPD A;  3A98 A;  2F2W A;  2EYY A;  4J9D A;  1GFC A;  1K4U S;  3THK A;  4HXJ A;  2CSI A;  2JS2 A;  1J3T A;  2K9G A;  4OML A;  1T3S A;  2V1R A;  1AZE A;  2KE9 A;  1NLO C;  2M0Y A;  3EGU A;  3EHQ A;  3LH5 A;  4CC3 A;  2O31 A;  2FRW A;  1ABO A;  2ED0 A;  2EBP A;  1UUE A;  5IHK A;  1CSK A;  4JJC A;  4KRT A;  1T0J A;  1QWF A;  3SHW A;  2CH4 A;  1OPL A;  2J05 A;  2G6F X;  1JO8 A;  4OMN A;  1QLY A;  1GCQ C;  1SSH A;  4RTZ A;  2X3X D;  2NUZ A;  2DL7 A;  2DL5 A;  2C0I A;  1SRL A;  4JPB W;  1AWW A;  3FJ5 A;  1T0H A;  4AG2 C;  4AFS C;  2AZS A;  2L2P A;  2DM1 A;  1X2Q A;  1OOT A;  1QKW A;  1QCF A;  1AVZ C;  2LCS A;  2J6F A;  3ZL7 C;  1FYN A;  2O88 A;  2C0O A;  1E6H A;  1U5S A;  1RLQ C;  2D1X A;  2EGE A;  4RUG A;  1BB9 A;  5L23 A;  2A28 A;  1I0C A;  1BU1 A;  2MOX A;  4Y92 A;  1UFF A;  3JV3 A;  2K79 A;  1UHC A;  2K3B A;  4JJB A;  2YSQ A;  1K0X A;  1KIK A;  4AFZ C;  1AEY A;  1JU5 C;  1GBR A;  4D8K A;  1FMK A;  4GBQ A;  2DL8 A;  1K1Z A;  2ROL A;  2K2M A;  2KEA A;  2EQI A;  1WLP B;  1EFN A;  1ZLM A;  1BBZ A;  2KNB B;  2XMF A;  2DJQ A;  2FPE A;  2L0A A;  2O9V A;  3C0C A;  2GBQ A;  1JEG A;  3IQL A;  1N5Z A;  1I1J A;  2A36 A;  2K7A A;  1X43 A;  1K9A A;  2FG0 A;  3NMZ C;  1UG1 A;  3VRZ A;  2DL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...