2L3QA

Structure of the prolyl trans isomer of the crk protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
78
structure length
78
Chain Sequence
GPYAQPSINTPLPNLQNGPFYARVIQKRVPNAYDKTALALEVGELVKVTKINMSGQWEGECNGKRGHFPFTHVRLLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for regulation of the Crk signaling protein by a proline switch.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Trans isomer of Crk protein
total genus 7
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l3qA00
2LX7A 4OMMA 3GBQA 3H0HA 3I35A 1TG0A 2FEIA 2AZSA 4JJBA 1KJWA 2B86A 2L3SA 2DNUA 2DBMA 2YSQA 4AFSC 1GCQA 2A08A 2O2OA 2KXDA 2XMFA 1CSKA 3REAB 5L23A 2EVRA 2FPDA 2IIMA 4RUGA 2YDLA 4OMOA 4F17A 2KE9A 2HEQA 2KEAA 1CKBA 1RLQC 2NWMA 4X1VA 2KRMA 4J9DA 4J9IA 3H0FA 1U06A 1QCFA 1UJYA 1AVZC 1W70A 2HCKA 1BU1A 1U5SA 3EHRA 2K7AA 3REBB 2DILA 3FJ5A 2JS0A 1T3SA 3EG0A 1PNJA 4DEYA 1X43A 1SHGA 2J7IA 2FG0A 2KRNA 1UJ0A 4AFZC 1NM7A 2EPDA 4HVUA 3M0UA 1E6HA 2JTEA 1MV3A 2RQRA 2KT1A 3SHWA 4RTTA 1OV3A 2J06A 1NYFA 3RBBB 2GTJA 2DL3A 1IO6A 3UF4A 1WX6A 1JXOA 4AFUC 2J6OA 2AK5A 4EIKA 2BZYA 3VS5A 2LJ0A 3M0QA 3VRZA 2YUPA 4J9GA 3NGPA 1PWTA 4OMLA 1QKXA 2DJQA 1B3QA 4JJDA 4GBQA 1HJDA 3PE0A 1WIEA 2CDTA 1TUDA 3H0IA 2AKLA 2F2VA 2K6DA 2PTKA 1SHFA 2ESWA 2L3QA 1WXTA 1KFZA 1NLOC 5FWCA 2ENMA 3NMZC 2MOXA 1M3BA 2RMOA 2VVKA 2AKKA 1WXUA 1AWJA 2V1RA 4R0KA 3UA7A 1FYNA 3RNJA 1GFDA 1GL5A 3VS6A 1YN8A 2D0NA 4LUDA 4CC2A 1XOVA 5ECAA 2O9SA 2M0YA 2DYBA 4LN2A 3VS3A 1UFFA 2KYBA 3UA6A 1AOJA 1TUCA 1WDXA 1VYUA 3VS2A 2DL4A 1QLYA 1AWXA 1ZLMA 1S1NA 3EG3A 1SRMA 4RTWA 4HVWA 1Y57A 1X27A 2I0NA 2EW3A 1B07A 1BK2A 4HVVA 1KIKA 2EYXA 1SEMA 1PRMC 1UHCA 2KBTA 1E7OA 3VS0A 1RUWA 1ZUUA 3VRYA 1Y0MA 4Y92A 1T0JA 2C0TA 1AEYA 2KR3A 2P4RA 4JJCA 3ZL7C 2CT3A 1GFCA 2EYWA 1AWOA 1H92A 1AD5A 2D1XA 1GBRA 2KGTA 1JXMA 1I0CA 2KYMA 2EYYA 1GCQC 4GLMA 1VYVA 2CUDA 1SRLA 2W0ZA 2K2MA 2V1QA 1T3LA 4KRTA 2RN8A 4AG1C 1X6GA 2DL5A 1OPLA 1HD3A 4D8DA 2RQTA 4F14A 5IXBA 2RPNA 3NPFA 2O31A 2SEMA 4LUEA 2LQNA 4JZ4A 4E6RA 1A0NB 1PHTA 1WA7A 5HCKA 2J6KA 2OJ2A 1BBZA 2PNIA 4IIMA 5IHNA 2O9VA 1QWFA 2CSIA 5IHIA 2EGCA 2KT8A 2LJ3A 3A98A 2AZVA 1SSHA 5FWBA 1JEGA 2DVJA 2DA9A 2CT4A 1X69A 4WCIA 1I07A 2RQWA 2GTOA 2H8HA 2C0IA 4OMQA 1KSWA 2A37A 2DF6A 1UUEA 2ECZA 1U3OA 2CSQA 2DBKA 2GGRA 2X3WD 1AZEA 1M3AA 1ZUYA 4HXJA 1HSQA 1JU5C 1UECA 2EKHA 4M4ZA 1ZSGA 1K4US 2VKNA 2RNAA 3U23A 1GCPA 1UTIA 2DMOA 4Z88A 3EGUA 2DM1A 4RTXA 1LCKA 1UE9A 1YP5A 1UGVA 4J9BA 2FPFA 1K0SA 2CH4A 5IH2A 2KXCA 2HBWA 1YCSB 2F2XA 5IXFA 1FMKA 1YWOA 2L2PA 3C0CA 2LP5A 1G83A 1JQQA 2KRSA 2OI3A 2EGAA 2GQIA 4RTYA 2ED0A 1PKSA 1VA7A 2JS2A 2DL8A 2GBQA 2JXBA 2JM8A 1PRLC 4AFQC 1RLPC 1OPKA 3I5SA 2JT4A 5GJVB 3VS1A 5I11A 4HCKA 2VWFA 5FW9A 4OMPA 1GRIA 2FRWA 2K3BA 3NHNA 2LQWA 4AG2C 5EC7A 3EG2A 3SEMA 3TSZA 2MIOA 1QKWA 1SPKA 3TVTA 3TSWA 2BZ8A 2HSPA 2E5KA 3R6NA 3VS7A 2DX1A 1JO8A 2X3XD 4LE9A 2RF0A 3M0SA 1N5ZA 2YUQA 2A36A 1Z9QA 4RTUA 2GNCA 4J9EA 1WI7A 1NG2A 2A28A 2ROTA 2KROA 1ZUKA 1VYTA 2QDLA 2LZ6B 1WXBA 2ED1A 2K9GA 1WYXA 3QWYA 1WFWA 1NLPC 3IQLA 2OAWA 1MV0B 2BTTA 4JPBW 1MUZA 2EYZA 2FO0A 4DEXA 1PKTA 2F2WA 3PVQA 2CUBA 1NYGA 2L0AA 1X6BA 2J6FA 1ARKA 4ESRA 5I22A 2G6FX 2JMAA 2YUNA 4F16A 1AWWA 3JV3A 2CREA 4CC3A 3QWXX 1K0XA 1X2QA 4J9HA 2EGEA 2FPEA 2FRYA 1ZBJA 2MCNA 1NEBA 1YWPA 1M3CA 2CH4W 4IIOA 2ABLA 2LCSA 1NEGA 4ZNXA 4RTZA 1E6GA 2DRMA 3PVLA 3EHQA 2D8JA 4Z8AA 1W1FA 3UATA 1UG1A 1GBQA 2BZXA 3I9QA 1BB9A 1WLPB 2JW4A 2SRCA 1RI9A 1V1CA 4D8KA 1I1JA 2DRKA 2EBPA 2K79A 3M0RA 2LMJA 4RTVA 1YNZA 3O5ZA 4CC4B 2J05A 2O88A 2RQVA 1K1ZA 2LNHB 3VS4A 1K9AA 4JZ3A 1K76A 2DL7A 2RQUA 3H41A 2JM9A 1T0HA 3EG1A 2D8HA 4J9FA 1H8KA 1G2BA 2PZ1A 3LH5A 1M30A 2C0OA 3KFVA 4J9CA 2KNBB 4ORZA 2YUOA 1W6XA 1ABQA 1CKAA 2W10A 2M51A 3M0PA 4LNPA 1M27C 4CC7A 3I5RA 1OEBA 4FSSA 1UHFA 4K11A 1J3TA 5IHKA 2DE0X 2ROLA 1EFNA 1UDLA 2HDAA 3CQTA 1QWEA 1OOTA 3THKA 2L3PA 1H3HA 1ABOA 4A63B 1M8MA 1X2KA 2YT6A 1AZGB 2JMCA 1Z9ZA 3M0TA 2DLPA 4OMNA 4Z89A 3ULRB 4QT7A 2NUZA 2EQIA 5GJWB 1ZX6A 2LJ1A
chains in the Genus database with same CATH superfamily
2LX7A 2RJEA 1QVFA 3CCRQ 3H0HA 1TG0A 1WHLA 2RHZA 5GANj 2DK3A 2KMTA 4JJBA 2B86A 4DBRA 2L3SA 3PGGA 2VXFA 1VQOQ 3OYYA 4LD9K 4PJOF 3SWNB 4DA4A 1K73C 1M90R 1M2OA 3CEYA 2JOYA 4ZGJB 4JLGA 1KQSP 2DEQA 4J9IA 2RHIA 3R6OA 4E7SA 5KCOA 1UGSB 1QCFA 3EHRA 1U5SA 2K7AA 1KQ1A 8AT1B 2RJCA 2CGHA 3OW2A 1X43A 5CKBA 1VQPT 3EFSA 4XAXB 4AFZC 1NM7A 2K4YA 4HVUA 3M0UA 2JTEA 1W2BP 4JS5A 3VKIA 1Y96A 3SHWA 4PFZA 1ZSZA 3RBBB 2GTJA 1VQ9T 3UF4A 4O5VA 4IUTA 5EG2A 2RD1A 1DJ7B 4C8QE 2MI6A 4J9GA 4DBHA 3EGXA 2JUFA 2RJFA 4OMLA 1M9SA 4A4FA 5CKFA 2VB6A 1YI2Q 4C5IA 4OF1A 3H0IA 1TUDA 1WHMA 2K6DA 4BY6B 3X25B 4II1A 1NLOC 3NMZC 2VVKA 2NUTB 3VS6A 5KCHA 2D0NA 2LT4A 2HKNA 1OZ3A 2O9SA 3VS3A 4LN2A 3UA6A 1TUCA 1JRIA 2L89A 1GXIE 1QLYA 3URGA 1YJ9Q 1Q82U 4PJOD 4HVWA 2EW3A 1B07A 4C0FA 4EPCA 1KK7A 1SEMA 2OTJA 2M02A 5GAMe 2Y4YA 3VJPA 1UHCA 3I56A 4PNOA 3M4YA 1ZUUA 2X4XA 3CPFA 3D7SB 1MMAA 4A53A 3J7AF 1W2BS 5LJ3g 1AEYA 2P4RA 3GNGA 1GFCA 1AWOA 3GIBA 4R55A 3JCMb 1RAEB 1IREB 1GCQC 2MWPA 1VQ8T 4FSXA 4YTLA 1EIFA 1KQ2A 3TCJA 2PUOB 2AT1B 3QZ5B 1S72T 4XTVA 2DL5A 4M7AB 3V7SA 4C0GA 4F14A 1QVGP 3M59A 2RPNA 3PIOA 2LQNA 4JZ4A 4E6RA 4E7IA 5C0MA 1D1CA 1Q81C 1OU8A 2J6KA 1U1TA 3CMAT 2O9VA 1QWFA 2MPXC 4E7KA 4NL2A 3A98A 1U1SA 2E6ZA 1JEGA 4QW2A 2PVOB 4AT1B 2V8IA 1M1KC 2CT4A 2K5FA 4BE2A 2RQWA 3G6EA 2C0IA 4EMGA 1G3SA 4OMQA 2A37A 2BIVA 1UUEA 3RKWA 1U3OA 2X3WD 4FW2A 1YITT 1ZQ1A 2EKHA 1K4US 2RNAA 1UTIA 3PMIA 1LCKA 2G3RA 2PUKB 2V8JA 2ZAEA 3E1SA 3CCSQ 3Q1JA 5GMKl 5IH2A 4L5GA 4Y91A 2HBWA 2PVGB 5CVIA 5LJ5f 2RHYA 1WQ7A 1QCNA 3C0CA 8ATCB 2FYKA 2M16A 1LPLA 2EGAA 1BI1A 5KYYB 1IB8A 2JS2A 1C6VX 2PQWA 2QQ9A 2GBQA 3QYHB 1PRLC 2A0FB 3CCET 1VQ4A 3HFOA 1VQ8Q 2MK5A 5I11A 4WTOB 5KYXA 2E6NA 1WQWA 2ZCFB 1GRIA 2FRWA 4PJOC 2F5TX 4QVZA 4FCYA 1VQPA 4F7UB 1VQ6A 3MCAB 2DAQA 2JTFA 3MEWA 2QA4A 3QUIA 2RA2A 5IT9E 4J6XA 2HQEA 2NYSA 2QTVA 4LE9A 4J8OA 1N5ZA 2FZGB 2WACA 2A36A 2XU8A 3CCJT 5GMKh 4BB7A 3MJXA 1WI7A 1PSFA 3ZFJA 4DQ2A 2VV5A 2E65A 3QG1A 1I4K1 2X4WA 2HSEB 3VV0A 3DLMA 2VASA 3OYCA 2CZ6B 1M1KR 1D3BB 5GAOn 1WFWA 2OAWA 1MV0B 1MUZA 2HD0A 2EYZA 3E2UA 4DEXA 3JCMe 1PKTA 3CC2T 4A4GA 5LJ3f 1M4ZA 5CCAA 4BY6C 1ZHIA 4ZN3A 5KE2A 5IAYA 2YUNA 3BFMA 3M55A 2CREA 3EH2A 2EGEA 3QHSA 1VQ9A 3L2VA 2MCNA 1YWPA 4F7UE 5GANf 4PJJA 1ZSZC 2CH4W 2COZA 4IIOA 4B9WA 2DIQA 2COYA 2DRMA 2O4XA 5HK0A 3PVLA 2L3RA 4RKUE 2BZXA 1FWZA 2E64A 2JW4A 4KGZB 5GAMf 1RI9A 3OYGA 1I1JA 2DRKA 4DBQA 2XDBA 3KUFA 5J3BA 2LVMA 1TH7A 3M0RA 3JCMh 1YNZA 3OB9A 1BKBA 4MZTA 2HL3A 4CC4B 5GANg 3CBMA 1TS9A 2LNHB 3VS4A 2GCXA 3LYIA 4HCZA 2XIDA 3EG1A 3JB9G 4M7DF 1TSFA 2QGGA 4M75D 2RI5A 2YLCA 4GLKA 4HCBA 3BW1A 3OW2P 1RADB 1W6XA 3RERA 1CKAA 2W10A 5D6XA 1JJ2P 3DKMA 1VIEA 3CXCS 4FSSA 4B9XA 3CC7A 2L8DA 5IHKA 4JUVA 2DE0X 3RR6A 2YHTA 2ROLA 3C12A 2HDAA 1QWEA 1ABOA 5GANe 1N8RU 1K8AC 1AZGB 2JMCA 1Z9ZA 4LD6A 4OMNA 2LNVA 3E9GA 4LDXA 5GAN6 2R58A 1VQ9Q 4XU0A 2NUZA 5GJWB 1ZX6A 1VQ7T 2LJ1A 3QJ6A 4OMMA 1QVGA 3GBQA 1U8RA 5GAOr 3CCMT 1ZA1B 3QDRB 4M77F 3LWHA 3A8MB 3MHXA 2DNUA 2YSQA 2CP7A 4AFSC 1GCQA 2A08A 2O2OA 3SD4A 2XMFA 3ZEHA 1CSKA 3V8JA 1PD1A 1RAIB 2MF2A 4IKFA 2IIMA 5I2MA 3WVEB 1N8RR 4M7AE 2GQVA 3V8KA 3HTRA 4FT4A 3QO3A 4BI8B 1CKBA 2DVEA 2FB7A 2NWMA 3MKDA 3EGDA 4X1VA 1YJNQ 2DJZA 5CK9A 3CC7T 3T9NA 1AVZC 2QQAA 1BU1A 1NPPA 1SF9A 2DILA 1M1FA 3OYHA 4PL6A 1SHGA 4BI4A 2FG0A 3I55T 3M53A 4MDWA 3L42A 2RQRA 4MMKA 2EQMA 2KT1A 3QBYA 4A4HA 5CKHA 1OV3A 2J06A 4HT9A 1H641 1JXOA 4EIKA 2BZYA 3RKXA 4PJMA 2ZPBB 4XK8E 1VQ4Q 2LTOA 1KD1R 2CP6A 3H6ZA 3CCQA 2JTMA 1K9MR 1B3QA 4OGCA 4RG2A 4JRPA 3FDRA 1X6OA 3CCLQ 2F2VA 2PTKA 5LJ3d 4C92B 3NTHA 2IG0A 1M3BA 4M75C 3A1PA 3JB9I 3HL8A 4J6WA 1FYNA 5KYWA 2V8KA 5A0DA 3GOXA 3C94A 3ASKA 2YRVA 3G71Q 5CKEA 2NLUA 3EG9B 2DL4A 3PMTA 1AWXA 2Z0WA 1IRXA 3EG3A 4RTWA 4VUBA 4ANJA 1X27A 2I0NA 1VQNT 2EWNA 3CPWA 4FYVB 4M7AA 2BE7D 2EYXA 5FROA 2QXFA 3JSCA 2KBTA 4PJOB 1E7OA 2E3HA 2OTJT 2E10A 3CMAQ 2CP2A 3VRYA 4Y92A 1T0JA 2C0TA 4F04B 2KR3A 3JB9H 1QW1A 4C5GA 1AD5A 2D1XA 5GMKi 1JXMA 1I0CA 2KYMA 2EYYA 3JB9J 4GLMA 1VYVA 2CUDA 1SRLA 1VIFA 5DM7R 2K2MA 4M7DD 2V1QA 4KRTA 4AG1C 3J81E 4AMCA 1NBEB 1X6GA 1HD3A 4D8DA 2RQTA 5IXBA 1QVFP 1S72A 3LGLA 3UDCA 5CKDA 3NPFA 2SEMA 3NTIA 9ATCB 5GAN3 4LUEA 4M78C 1Y96B 1C0MA 1D1AA 2PNIA 2BKDN 3DB3A 2CSIA 5IHIA 2KT8A 1YJNA 3CMAA 2AZVA 3A5ZB 5FRNA 1ZBXA 1R0CB 2DA9A 4ELYC 4JRQA 4J7FA 3C95A 2LQ8A 3E19A 2H8HA 3MPUB 3EH1A 4M77D 3I56T 2CSQA 2DYIA 1AZEA 2JZ2A 1M3AA 4M78E 4HXJA 5CIUA 2CKKA 3G71A 3OS2A 2VKNA 1GCPA 2OTLT 4Z88A 2EJFA 4CRIA 1UE9A 1YP5A 1UGVA 4CI0C 3VYGA 2KXCA 4F7UA 4M7AG 5IXFA 4Y28E 1VQLA 2QTXA 1G83A 1WHGA 2MMPA 4N4HA 5CQXA 3JCMf 1PKSA 1VA7A 1TXQA 3SFMA 4KUIA 1Q7YR 3CC7Q 2EIFA 2VGNA 3FLGA 3I5SA 2JNGA 4C92D 4BACA 3OYKA 1YCYA 1KHIA 4V2SA 2QK0A 4HCKA 3OYBA 3GF5A 5FW9A 4OMPA 2HKQB 4RCCA 4RMOA 2RI3A 3JCMc 4AG2C 3SEMA 2MIOA 3CD6Q 3JCMQ 1SPKA 5D6WA 3TVTA 3TSWA 3L2QA 2KK4A 3G71T 1K8AU 2RJDA 2E5KA 5LJ3e 3EFOA 4JRKA 1JO8A 3V8LA 2K57A 1WZOA 4E7JA 2K3XA 4Q5WA 3CXCP 1Z9QA 4RTUA 1BCOA 3MEUA 2GNCA 4J9EA 3SDZA 2A28A 2V26A 4C8QC 3OS5A 1Q86R 2R5AA 1N27A 4MZMA 1ZUKA 3HKSA 2QDLA 2Y90A 4C8QF 2ED1A 3OYLA 1WYXA 3QWYA 4NS5A 3PFSA 3HRTA 1JJ2S 2ATCB 1SG5A 3G1JA 2F2WA 1BYMA 2E5QA 1NPRA 1ZSZB 2L0AA 1X6BA 3MO8A 5GAOp 2LC4A 4EMKA 3OS0A 1UGPB 3KXTA 4F16A 2VXEA 5GAOl 2ZPGB 1WHJA 3QWXX 1K0XA 2X4YA 4QQ6A 4J9HA 2A7YA 3M57A 2L5QA 1WJQA 3JB9F 1ZBJA 4NL3A 1D1BA 3FEOA 1M90U 4HT8A 4PFPA 4IUPA 2HAXA 2DIGA 3VUBA 1VQNA 2LCSA 4IURA 3RKYA 1NEGA 2P0QA 2VGMA 4Z8AA 3CCQT 4ELZC 3UATA 4HKEA 1UG1A 1V29B 1GBQA 4DBFA 4E47A 1VUBA 3CMET 4D8KA 3QJYA 2FZCB 1LNXA 2EBPA 2AIRB 5GAOm 1BIAA 2EYQA 2RI2A 2EQKA 2JJ9A 1HK9A 2MAMA 3CCVT 1RACB 1K76A 2JM9A 3DLLA 3CD6A 4ME7A 2E1HA 1MHNA 3CCRT 1VQ4T 1VQPQ 5KH6A 1OQKA 2PZ1A 3LH5A 4WF2A 1M30A 2C0OA 4J9CA 2KNBB 4ORZA 3CC2A 2YUOA 4FW1A 1ABQA 4F7UG 1VQ8A 3M0PA 2GFUA 4LNPA 1M27C 3CCUA 4M75B 4CC7A 3H8ZA 3A8HB 3BDLA 5GAOq 1UHFA 5CO7A 1OI1A 2XDDA 3GPLA 1R77A 4M7AF 2BUDA 1OOTA 1SKUB 4L59A 1H3HA 3QSUA 4R56A 4PJOG 4KUDK 1N6AA 1X2KA 2YT6A 4OMFB 2EKOA 1VQLQ 2WSFE 5LJ5j 5GAN5 2DLPA 1M8VA 4C8QD 2EQIA 3CCSA 3I35A 2FEIA 1JB0E 2H3EB 2AZSA 4XTYA 1K9MC 3J80E 4C8QB 1KD1C 2KXDA 5FU7C 2YXYA 4PJOA 2EVRA 2M1HA 1IHVA 5KYWB 3CD6T 3G6ET 2BE9B 2XKOC 2YDLA 2QASA 3VU3C 4OMOA 2KE9A 3FIFA 1RLQC 3JRZA 4RCBA 1H3ZA 1YHQT 6AT1B 1YJ9T 3CCUT 1VQKQ 4JJNK 4DOWA 2OAUA 3H0FA 1VQLT 4IUQA 3OYEA 1M90C 1U06A 5LL6S 3HRSA 1UJYA 4C0DC 1W70A 2HCKA 3OA6A 2P84A 4E7ZA 1EX4A 3FJ5A 4PJOE 1T3SA 2B8AA 4DEYA 3P8DA 4M7DC 3OW2S 2DD4A 1LJOA 3CPWP 2QEXT 4FYYB 3PNWC 1S72Q 2VYTA 4ZN1A 5CR2A 2EPDA 1BI0A 2P0KA 2XICA 1MV3A 1VQ6Q 4RTTA 1Y07A 2CS7A 2ZGWA 1N8RC 2DL3A 1G5VA 1IO6A 2LRQA 1WX6A 1Q7YU 2J6OA 4QQGA 3OYAA 5LJ5g 4ZGDB 3FRNA 4KGXB 4X9DA 3NGPA 4M75F 2DZ9A 2AHJB 1QKXA 4BE1A 1OYXA 2DJQA 5LJ5d 4JJDA 1HJDA 3I56Q 1X75C 3MP8A 1WIEA 2CDTA 2AKLA 1SHFA 2ESWA 2L3QA 3OYMA 1WXTA 2ENMA 2MOXA 2FVUA 3QIIA 1YIJA 1QQJA 1AWJA 2V1RA 3UA7A 5A0GA 1GL5A 1GFDA 4M78G 4HCCA 2D0QB 1QVPA 1OX8A 2K5IA 1D0YA 2LX9A 4C92F 2DYBA 4JLIA 2I2LA 1R8OB 1VYUA 3ZBDA 3VS2A 1YITQ 3G7ZA 3M9QA 1SRMA 3INZA 3RDVA 2YWWA 1BK2A 1XQHA 2XK0A 4HVVA 3E9FA 1PRMC 3CCLA 3VS0A 4X34A 1RUWA 2O01E 4C5EA 1X01A 1Y0MA 4NOYA 4MZPA 4N4IA 5DY9A 3CCQQ 1B7TA 1W2BA 5FU7B 4Z02A 3M54A 3ZL7C 2CT3A 3HP9A 3UT1A 3WXMB 2EYWA 2DEUA 1H92A 1N9RA 2ZPIB 2KGTA 4M7DA 3CCEQ 4KH0B 1Q95G 2EJGA 2VUBA 3M4GA 5CQYA 3TQ7P 1C1AA 1I5OB 1UB4A 2W0ZA 4KULA 1T3LA 2CP0A 5AYFA 3GNFB 3L1AA 2QQRA 3M5AA 4XU2A 2O31A 1Y7XA 1YHQQ 1MMDA 1A0NB 5LJ3h 2KVQG 2A3LA 2OJ2A 1BBZA 5IHNA 2LDMA 1NJIR 5DLOA 3UWNA 3S3NA 2LCCA 3X24B 2EGCA 2LJ3A 2F5KA 1SSHA 5FWBA 2DVJA 2R57A 2OTJQ 3FJPA 5A0LA 1X69A 3S3OA 4J5YA 3JCMV 1KSWA 2DF6A 2DBKA 3HPWA 3A8GB 1OZ2A 1VQOA 4J7IA 4M4ZA 3V7CA 1ZSGA 3U23A 1ZA2B 1Q7YC 2RK1A 3EGUA 2DM1A 3CCRA 3GLXA 2D9TA 4J9BA 2CH4A 3HFNA 1YCSB 1G3YA 3P8HA 2GFAA 4M77G 3MP6A 4M77B 1JQQA 1F1BB 1PC0A 2KRSA 2OI3A 1YI2A 2P0PA 1YFNA 2ZPEB 2GQIA 4QQDA 2ED0A 4M75G 2DL8A 2JXBA 5IN1A 2JN0A 1TTHB 4AFQC 1IGUA 2WSCE 3LH0A 4FYXB 1WGSA 1WJSA 5FU6C 5GJVB 3VS1A 3RMQA 2VWFA 4XQ3A 4XTZA 4QKUA 1VQ5T 2HQXA 2YLBA 1WHHA 1RAAB 5EC7A 3EG2A 1B34B 5GAMh 3META 4M75A 4FT2A 1BIBA 3DB4A 3JCMg 1Q82C 1W4SA 3RMSA 3HSBA 2BZ8A 4PK4A 2NUTA 4C5HA 2HSPA 3R6NA 1VQ7A 5D7UA 5DLQE 4C8QG 4C92G 2EAYA 2X3XD 2RF0A 1FMVA 3CBPA 2YUQA 4DOVA 2E4HA 5KYNA 4OVAA 1VQMT 1NG2A 4XU1A 5A2QE 3S3MA 4M7AC 3LLRA 4M75E 5LJ3j 1VYTA 1WXBA 2LZ6B 1M2VB 3JCMW 1WJRA 2E70A 4FM4B 1NLPC 4KT0E 2BTTA 5FLXE 4X9CA 3LX7A 2CUBA 1NYGA 1D09B 1YBYA 1QVFS 5AT1B 1MGQA 2J6FA 4ESRA 5I22A 1OU9A 2IVWA 3G4SA 1AWWA 3CBOA 3JV3A 1M1GA 1PCXA 4L6V5 3JCMP 4CC3A 3S6WA 1X2QA 5GAMg 3CCMQ 2FPEA 1VQMQ 1NE8A 4HA8A 4ATOA 1M3CA 5KYUA 4M78F 2ABLA 2OTLA 3OSSC 4ZNXA 3KBGA 4M78A 1E6GA 1Q86U 2CP5A 4KH1B 1I5LA 2QQSA 1NZ9A 5GAN2 5GAN4 3I9QA 2F1LA 2RO0A 4D6WA 2LCLA 2SRCA 1HXDA 4GY5A 4JS4A 2C06A 1V1CA 4FL6A 2XHCA 2K79A 2CZ0B 2LMJA 2DERA 1OX9A 3O5ZA 2QGFB 2J05A 3EG9A 2RQVA 5HK3A 2DFUA 1YIJT 1K1ZA 3H9NA 3EFOB 5GAMj 2QA4Q 2DL7A 2RQUA 2DTIA 3H41A 1T0HA 4J9FA 2X51A 1G2BA 5M9OA 2E3IA 3MP1A 4ZGEB 1K9MU 1AHJB 4LDUA 2NUPA 2HMAA 4M7DG 2HL5C 4OB3B 2OTLQ 2COWA 2L3PA 4A63B 1VQ6T 1M8MA 3M0TA 4EMKB 3AHUA 3ULRB 2QA4T 4E7HA 4XTWA 1ACMB 2DXCA 4RG8A 3CC4Q 2CYZB 3LWIA 4OP0A 1KJWA 1KQSS 3G4SQ 5J26A 5GMKe 4E7LA 2VC8A 2DBMA 3QXEB 1LOJA 5J39A 3REAB 5GANd 3OMGA 5L23A 2HZYA 2KI7A 2MYSA 4M77C 4QVDA 2FPDA 2X35A 4RUGA 3G6EQ 3RUXA 4F17A 1G8XA 2HEQA 2KEAA 3OY9A 5GAN8 1QP2A 4LDWA 2KRMA 3L2UA 4J9DA 4LDYA 1MMNA 2FL7A 2R5MA 1MNDA 1G3WA 2LQKA 3REBB 1BI3A 2IPOB 3EGXB 4BE0A 2JS0A 1WPYA 3EG0A 4LXCA 1PNJA 1WHKA 4C8QA 5C6SA 3OMCA 2QEXQ 2J7IA 2QQBA 3NTKA 2KRNA 3A8LB 3SWNC 3V7RA 4XU3A 4C0DB 1UJ0A 2QYZA 3CMEQ 3CCJA 5L8RE 1K8AR 1E6HA 1D3BA 4C92C 5HY6A 3TEEA 1VQ5A 4KGVB 3X28B 2XG8D 1NYFA 4EDUA 2D6FA 3X20B 1FXXA 4AFUC 4EMKC 1YJWA 2AK5A 3VS5A 2LJ0A 3MEAA 3M0QA 3VRZA 1K73R 2YUPA 3TREA 1IGQA 3OBYA 1PWTA 1LVKA 3FC3A 1VQKT 4M7DE 2DO3A 3PIPA 1YI2T 2DPPB 1Y71A 4GBQA 1M1KU 3QKJA 3PE0A 1RI0A 1RAGB 1RAHB 4PJLA 3QDFA 4OB0B 1TWBA 1TUGB 1HYOA 2FZKB 1KFZA 2MWOA 4M7AD 5FWCA 4OB1B 2RMOA 2RK2A 2AKKA 3OYDA 3L2WA 1YJ9A 1WXUA 4R0KA 3RNJA 1YN8A 2ZZDA 1IXDA 4LUDA 1KQSA 1D0XA 4CC2A 1XOVA 5ECAA 3JCMJ 1QCOA 2HBPA 2M0YA 1UFFA 2KYBA 2KSSA 1AOJA 1WDXA 4JRIA 4M77A 1PG5B 1ZLMA 2CZ7B 1S1NA 3JCMX 1Y57A 4N0AC 3OSVA 4PLLA 1AT1B 1KC8R 4M77E 1KIKA 1YJWT 3CPWS 2KQWA 2HNIA 2PU9B 2DKGA 3PT9A 1UGRB 3VUZA 4IUUA 1PSEA 1V76A 7AT1B 3I55Q 2X9HA 4ZTFA 3JAME 4JJCA 4MDXA 2KY9A 2K3YA 1XNIA 2ZPHB 1K73U 1B34A 1GBRA 2FHDA 5KYYA 4UC4A 1YHQA 1YJWQ 1I81A 4FU6A 2RN8A 4BD3A 1RL2A 3HHTB 2QI2A 1KHCA 1OPLA 3CMEA 1PM3A 3CCJQ 2LT1A 2P4TA 5GAMd 1UGQB 3G4ST 2QG9B 2JVVA 2GF7A 2RH2A 2HQHA 4C92E 3CCEA 3HRUA 4EMHA 1VOMA 1BCMA 3BDUA 1PHTA 1WA7A 3OYIA 5HCKA 4IIMA 1R0BG 2YRDA 3I55A 4M7DB 3M56A 5GMKm 3EFRA 3OYNA 5GMKj 1G3TA 4BDYA 1Q82R 2QDYB 3RESA 5D6YA 5LJ5h 3EGDB 4WCIA 4F7UF 4A4KA 3F70A 1I07A 3JCMd 2GTOA 3SB2A 5FRMA 1QMCA 3C4SA 2RM4A 1YITA 2ECZA 2GGRA 2EFIA 1Q86C 4XTXA 3MEVA 1ZUYA 2M9UA 1Q81U 1HSQA 1JU5C 1EZZB 1UECA 4E2FB 3ER0A 4BI3A 2ZPFB 2DMOA 2DD5A 2Y4XA 3CC4A 1M5Q1 4RTXA 3QYGB 2FPFA 4J6YA 1K0SA 1YIJQ 3OQ5A 4N0AA 3CCVA 2EQJA 1XTDA 2F2XA 2K2VA 3OYJA 1XJWB 1FMKA 1YWOA 2L2PA 2LP5A 2RB6A 3LW5E 5CAIA 4RTYA 5KYUB 3O8VA 2JM8A 1IZ6A 1OPKA 5FU6B 4PLIA 3WVDB 3RIRA 1KD1U 2JT4A 1FX7A 3BE3A 3CCLT 3SWNA 2DETA 1TOVA 2X4JA 2K3BA 3NHNA 2LQWA 3TSZA 1VQ5Q 4C92A 4A54A 3UPUA 5HKCA 4B6MA 1I8FA 1QKWA 3NFCA 2H3JA 5LJ5e 3PTAA 4ZTJA 5KE3A 1IHWA 3VS7A 2NUPB 4BDZA 2DX1A 3CCST 1NJIC 2QEXA 3CC4T 1KC8U 1RABB 2E41A 3M0SA 4QVCA 1Q81R 1O75A 3M58A 2F69A 3ME9A 4M78D 2M0OA 1SSFA 2RHXA 4N4GA 1RAFB 4IUVA 1UEBA 1KG1A 1TU0B 2ROTA 1VQKA 2KROA 3OYFA 3X26B 2WSEE 2K9GA 4JDSA 1WNLA 3IQLA 1QP3A 4JPBW 2FO0A 4P5NA 1JJ2A 3PVQA 1FMWA 1QVGS 1ARKA 2CP3A 2DTHA 3TU4K 4J83A 4MMLA 1OULA 2G6FX 2JMAA 2KDSA 4PKCC 2PVDB 3EAEA 2XD0A 3BY7A 4LDVA 1P92A 5I21A 4PFOA 2KAFA 2FRYA 4O6JA 4PJNA 4BUGA 1NEBA 2YRCA 1VQOT 1D0ZA 4RTZA 4XTUA 3JB9D 3EHQA 2D8JA 1W1FA 5KYXB 3L2RA 1BB9A 1WLPB 1N9SA 2K5LA 1MNEA 4FYWB 4TVRA 3L2ZA 3CCUQ 4FIBA 5GAN7 3P8BB 2QAZA 3VYHB 4RTVA 3CC2Q 2OX7A 5GANh 1VQ7Q 2O88A 2E12A 5I2SA 1PD0A 4JZ3A 3QZ9B 1K9AA 1O9SA 4OB2B 2DZCA 2RHUA 2DXBA 4A4EA 1BI2A 2D8HA 1H8KA 1KC8C 4OGEA 3FB9A 1YJNT 2EJ9A 3OBWA 4M78B 3KFVA 2O4XB 2XI9A 3OS1A 2DTOA 2XDPA 2M51A 2DXTA 4C0ZA 3CXCA 3N5BB 2CZ1B 2EQUA 3I5RA 1OEBA 3QPHA 4K11A 1J3TA 1M2VA 1EFNA 1UDLA 3CQTA 3GP8A 1NJIU 3AT1B 3THKA 1VQNQ 4KBMB 3LGFA 1MMGA 3A8OB 4Z89A 3CCVQ 4QT7A 2DXUA 1VQMA 1JBMA 1RLPC 3CCMA
chains in the Genus database with same CATH topology
2LX7A 4OMMA 3GBQA 3H0HA 3I35A 1TG0A 2FEIA 2AZSA 4JJBA 1KJWA 2B86A 2L3SA 2DNUA 2DBMA 2YSQA 4AFSC 1GCQA 2A08A 2O2OA 2KXDA 2XMFA 1CSKA 3REAB 5L23A 2EVRA 2FPDA 2IIMA 4RUGA 2YDLA 4OMOA 4F17A 2KE9A 2HEQA 2KEAA 1CKBA 1RLQC 2NWMA 4X1VA 2KRMA 4J9DA 4J9IA 3H0FA 1U06A 1QCFA 1UJYA 1AVZC 1W70A 2HCKA 1BU1A 1U5SA 3EHRA 2K7AA 3REBB 2DILA 3FJ5A 2JS0A 1T3SA 3EG0A 1PNJA 4DEYA 1X43A 1SHGA 2J7IA 2FG0A 2KRNA 1UJ0A 4AFZC 1NM7A 2EPDA 4HVUA 3M0UA 1E6HA 2JTEA 1MV3A 2RQRA 2KT1A 3SHWA 4RTTA 1OV3A 2J06A 1NYFA 3RBBB 2GTJA 2DL3A 1IO6A 3UF4A 1WX6A 1JXOA 4AFUC 2J6OA 2AK5A 4EIKA 2BZYA 3VS5A 2LJ0A 3M0QA 3VRZA 2YUPA 4J9GA 3NGPA 1PWTA 4OMLA 1QKXA 2DJQA 1B3QA 4JJDA 4GBQA 1HJDA 3PE0A 1WIEA 2CDTA 1TUDA 3H0IA 2AKLA 2F2VA 2K6DA 2PTKA 1SHFA 2ESWA 2L3QA 1WXTA 1KFZA 1NLOC 5FWCA 2ENMA 3NMZC 2MOXA 1M3BA 2RMOA 2VVKA 2AKKA 1WXUA 1AWJA 2V1RA 4R0KA 3UA7A 1FYNA 3RNJA 1GFDA 1GL5A 3VS6A 1YN8A 2D0NA 4LUDA 4CC2A 1XOVA 5ECAA 2O9SA 2M0YA 2DYBA 4LN2A 3VS3A 1UFFA 2KYBA 3UA6A 1AOJA 1TUCA 1WDXA 1VYUA 3VS2A 2DL4A 1QLYA 1AWXA 1ZLMA 1S1NA 3EG3A 1SRMA 4RTWA 4HVWA 1Y57A 1X27A 2I0NA 2EW3A 1B07A 1BK2A 4HVVA 1KIKA 2EYXA 1SEMA 1PRMC 1UHCA 2KBTA 1E7OA 3VS0A 1RUWA 1ZUUA 3VRYA 1Y0MA 4Y92A 1T0JA 2C0TA 1AEYA 2KR3A 2P4RA 4JJCA 3ZL7C 2CT3A 1GFCA 2EYWA 1AWOA 1H92A 1AD5A 2D1XA 1GBRA 2KGTA 1JXMA 1I0CA 2KYMA 2EYYA 1GCQC 4GLMA 1VYVA 2CUDA 1SRLA 2W0ZA 2K2MA 2V1QA 1T3LA 4KRTA 2RN8A 4AG1C 1X6GA 2DL5A 1OPLA 1HD3A 4D8DA 2RQTA 4F14A 5IXBA 2RPNA 3NPFA 2O31A 2SEMA 4LUEA 2LQNA 4JZ4A 4E6RA 1A0NB 1PHTA 1WA7A 5HCKA 2J6KA 2OJ2A 1BBZA 2PNIA 4IIMA 5IHNA 2O9VA 1QWFA 2CSIA 5IHIA 2EGCA 2KT8A 2LJ3A 3A98A 2AZVA 1SSHA 5FWBA 1JEGA 2DVJA 2DA9A 2CT4A 1X69A 4WCIA 1I07A 2RQWA 2GTOA 2H8HA 2C0IA 4OMQA 1KSWA 2A37A 2DF6A 1UUEA 2ECZA 1U3OA 2CSQA 2DBKA 2GGRA 2X3WD 1AZEA 1M3AA 1ZUYA 4HXJA 1HSQA 1JU5C 1UECA 2EKHA 4M4ZA 1ZSGA 1K4US 2VKNA 2RNAA 3U23A 1GCPA 1UTIA 2DMOA 4Z88A 3EGUA 2DM1A 4RTXA 1LCKA 1UE9A 1YP5A 1UGVA 4J9BA 2FPFA 1K0SA 2CH4A 5IH2A 2KXCA 2HBWA 1YCSB 2F2XA 5IXFA 1FMKA 1YWOA 2L2PA 3C0CA 2LP5A 1G83A 1JQQA 2KRSA 2OI3A 2EGAA 2GQIA 4RTYA 2ED0A 1PKSA 1VA7A 2JS2A 2DL8A 2GBQA 2JXBA 2JM8A 1PRLC 4AFQC 1RLPC 1OPKA 3I5SA 2JT4A 5GJVB 3VS1A 5I11A 4HCKA 2VWFA 5FW9A 4OMPA 1GRIA 2FRWA 2K3BA 3NHNA 2LQWA 4AG2C 5EC7A 3EG2A 3SEMA 3TSZA 2MIOA 1QKWA 1SPKA 3TVTA 3TSWA 2BZ8A 2HSPA 2E5KA 3R6NA 3VS7A 2DX1A 1JO8A 2X3XD 4LE9A 2RF0A 3M0SA 1N5ZA 2YUQA 2A36A 1Z9QA 4RTUA 2GNCA 4J9EA 1WI7A 1NG2A 2A28A 2ROTA 2KROA 1ZUKA 1VYTA 2QDLA 2LZ6B 1WXBA 2ED1A 2K9GA 1WYXA 3QWYA 1WFWA 1NLPC 3IQLA 2OAWA 1MV0B 2BTTA 4JPBW 1MUZA 2EYZA 2FO0A 4DEXA 1PKTA 2F2WA 3PVQA 2CUBA 1NYGA 2L0AA 1X6BA 2J6FA 1ARKA 4ESRA 5I22A 2G6FX 2JMAA 2YUNA 4F16A 1AWWA 3JV3A 2CREA 4CC3A 3QWXX 1K0XA 1X2QA 4J9HA 2EGEA 2FPEA 2FRYA 1ZBJA 2MCNA 1NEBA 1YWPA 1M3CA 2CH4W 4IIOA 2ABLA 2LCSA 1NEGA 4ZNXA 4RTZA 1E6GA 2DRMA 3PVLA 3EHQA 2D8JA 4Z8AA 1W1FA 3UATA 1UG1A 1GBQA 2BZXA 3I9QA 1BB9A 1WLPB 2JW4A 2SRCA 1RI9A 1V1CA 4D8KA 1I1JA 2DRKA 2EBPA 2K79A 3M0RA 2LMJA 4RTVA 1YNZA 3O5ZA 4CC4B 2J05A 2O88A 2RQVA 1K1ZA 2LNHB 3VS4A 1K9AA 4JZ3A 1K76A 2DL7A 2RQUA 3H41A 2JM9A 1T0HA 3EG1A 2D8HA 4J9FA 1H8KA 1G2BA 2PZ1A 3LH5A 1M30A 2C0OA 3KFVA 4J9CA 2KNBB 4ORZA 2YUOA 1W6XA 1ABQA 1CKAA 2W10A 2M51A 3M0PA 4LNPA 1M27C 4CC7A 3I5RA 1OEBA 4FSSA 1UHFA 4K11A 1J3TA 5IHKA 2DE0X 2ROLA 1EFNA 1UDLA 2HDAA 3CQTA 1QWEA 1OOTA 3THKA 2L3PA 1H3HA 1ABOA 4A63B 1M8MA 1X2KA 2YT6A 1AZGB 2JMCA 1Z9ZA 3M0TA 2DLPA 4OMNA 4Z89A 3ULRB 4QT7A 2NUZA 2EQIA 5GJWB 1ZX6A 2LJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LX7 A;  4OMM A;  3GBQ A;  3H0H A;  3I35 A;  1TG0 A;  2FEI A;  2AZS A;  4JJB A;  1KJW A;  2B86 A;  2L3S A;  2DNU A;  2DBM A;  2YSQ A;  4AFS C;  1GCQ A;  2A08 A;  2O2O A;  2KXD A;  2XMF A;  1CSK A;  3REA B;  5L23 A;  2EVR A;  2FPD A;  2IIM A;  4RUG A;  2YDL A;  4OMO A;  4F17 A;  2KE9 A;  2HEQ A;  2KEA A;  1CKB A;  1RLQ C;  2NWM A;  4X1V A;  2KRM A;  4J9D A;  4J9I A;  3H0F A;  1U06 A;  1QCF A;  1UJY A;  1AVZ C;  1W70 A;  2HCK A;  1BU1 A;  1U5S A;  3EHR A;  2K7A A;  3REB B;  2DIL A;  3FJ5 A;  2JS0 A;  1T3S A;  3EG0 A;  1PNJ A;  4DEY A;  1X43 A;  1SHG A;  2J7I A;  2FG0 A;  2KRN A;  1UJ0 A;  4AFZ C;  1NM7 A;  2EPD A;  4HVU A;  3M0U A;  1E6H A;  2JTE A;  1MV3 A;  2RQR A;  2KT1 A;  3SHW A;  4RTT A;  1OV3 A;  2J06 A;  1NYF A;  3RBB B;  2GTJ A;  2DL3 A;  1IO6 A;  3UF4 A;  1WX6 A;  1JXO A;  4AFU C;  2J6O A;  2AK5 A;  4EIK A;  2BZY A;  3VS5 A;  2LJ0 A;  3M0Q A;  3VRZ A;  2YUP A;  4J9G A;  3NGP A;  1PWT A;  4OML A;  1QKX A;  2DJQ A;  1B3Q A;  4JJD A;  4GBQ A;  1HJD A;  3PE0 A;  1WIE A;  2CDT A;  1TUD A;  3H0I A;  2AKL A;  2F2V A;  2K6D A;  2PTK A;  1SHF A;  2ESW A;  2L3Q A;  1WXT A;  1KFZ A;  1NLO C;  5FWC A;  2ENM A;  3NMZ C;  2MOX A;  1M3B A;  2RMO A;  2VVK A;  2AKK A;  1WXU A;  1AWJ A;  2V1R A;  4R0K A;  3UA7 A;  1FYN A;  3RNJ A;  1GFD A;  1GL5 A;  3VS6 A;  1YN8 A;  2D0N A;  4LUD A;  4CC2 A;  1XOV A;  5ECA A;  2O9S A;  2M0Y A;  2DYB A;  4LN2 A;  3VS3 A;  1UFF A;  2KYB A;  3UA6 A;  1AOJ A;  1TUC A;  1WDX A;  1VYU A;  3VS2 A;  2DL4 A;  1QLY A;  1AWX A;  1ZLM A;  1S1N A;  3EG3 A;  1SRM A;  4RTW A;  4HVW A;  1Y57 A;  1X27 A;  2I0N A;  2EW3 A;  1B07 A;  1BK2 A;  4HVV A;  1KIK A;  2EYX A;  1SEM A;  1PRM C;  1UHC A;  2KBT A;  1E7O A;  3VS0 A;  1RUW A;  1ZUU A;  3VRY A;  1Y0M A;  4Y92 A;  1T0J A;  2C0T A;  1AEY A;  2KR3 A;  2P4R A;  4JJC A;  3ZL7 C;  2CT3 A;  1GFC A;  2EYW A;  1AWO A;  1H92 A;  1AD5 A;  2D1X A;  1GBR A;  2KGT A;  1JXM A;  1I0C A;  2KYM A;  2EYY A;  1GCQ C;  4GLM A;  1VYV A;  2CUD A;  1SRL A;  2W0Z A;  2K2M A;  2V1Q A;  1T3L A;  4KRT A;  2RN8 A;  4AG1 C;  1X6G A;  2DL5 A;  1OPL A;  1HD3 A;  4D8D A;  2RQT A;  4F14 A;  5IXB A;  2RPN A;  3NPF A;  2O31 A;  2SEM A;  4LUE A;  2LQN A;  4JZ4 A;  4E6R A;  1A0N B;  1PHT A;  1WA7 A;  5HCK A;  2J6K A;  2OJ2 A;  1BBZ A;  2PNI A;  4IIM A;  5IHN A;  2O9V A;  1QWF A;  2CSI A;  5IHI A;  2EGC A;  2KT8 A;  2LJ3 A;  3A98 A;  2AZV A;  1SSH A;  5FWB A;  1JEG A;  2DVJ A;  2DA9 A;  2CT4 A;  1X69 A;  4WCI A;  1I07 A;  2RQW A;  2GTO A;  2H8H A;  2C0I A;  4OMQ A;  1KSW A;  2A37 A;  2DF6 A;  1UUE A;  2ECZ A;  1U3O A;  2CSQ A;  2DBK A;  2GGR A;  2X3W D;  1AZE A;  1M3A A;  1ZUY A;  4HXJ A;  1HSQ A;  1JU5 C;  1UEC A;  2EKH A;  4M4Z A;  1ZSG A;  1K4U S;  2VKN A;  2RNA A;  3U23 A;  1GCP A;  1UTI A;  2DMO A;  4Z88 A;  3EGU A;  2DM1 A;  4RTX A;  1LCK A;  1UE9 A;  1YP5 A;  1UGV A;  4J9B A;  2FPF A;  1K0S A;  2CH4 A;  5IH2 A;  2KXC A;  2HBW A;  1YCS B;  2F2X A;  5IXF A;  1FMK A;  1YWO A;  2L2P A;  3C0C A;  2LP5 A;  1G83 A;  1JQQ A;  2KRS A;  2OI3 A;  2EGA A;  2GQI A;  4RTY A;  2ED0 A;  1PKS A;  1VA7 A;  2JS2 A;  2DL8 A;  2GBQ A;  2JXB A;  2JM8 A;  1PRL C;  4AFQ C;  1RLP C;  1OPK A;  3I5S A;  2JT4 A;  5GJV B;  3VS1 A;  5I11 A;  4HCK A;  2VWF A;  5FW9 A;  4OMP A;  1GRI A;  2FRW A;  2K3B A;  3NHN A;  2LQW A;  4AG2 C;  5EC7 A;  3EG2 A;  3SEM A;  3TSZ A;  2MIO A;  1QKW A;  1SPK A;  3TVT A;  3TSW A;  2BZ8 A;  2HSP A;  2E5K A;  3R6N A;  3VS7 A;  2DX1 A;  1JO8 A;  2X3X D;  4LE9 A;  2RF0 A;  3M0S A;  1N5Z A;  2YUQ A;  2A36 A;  1Z9Q A;  4RTU A;  2GNC A;  4J9E A;  1WI7 A;  1NG2 A;  2A28 A;  2ROT A;  2KRO A;  1ZUK A;  1VYT A;  2QDL A;  2LZ6 B;  1WXB A;  2ED1 A;  2K9G A;  1WYX A;  3QWY A;  1WFW A;  1NLP C;  3IQL A;  2OAW A;  1MV0 B;  2BTT A;  4JPB W;  1MUZ A;  2EYZ A;  2FO0 A;  4DEX A;  1PKT A;  2F2W A;  3PVQ A;  2CUB A;  1NYG A;  2L0A A;  1X6B A;  2J6F A;  1ARK A;  4ESR A;  5I22 A;  2G6F X;  2JMA A;  2YUN A;  4F16 A;  1AWW A;  3JV3 A;  2CRE A;  4CC3 A;  3QWX X;  1K0X A;  1X2Q A;  4J9H A;  2EGE A;  2FPE A;  2FRY A;  1ZBJ A;  2MCN A;  1NEB A;  1YWP A;  1M3C A;  2CH4 W;  4IIO A;  2ABL A;  2LCS A;  1NEG A;  4ZNX A;  4RTZ A;  1E6G A;  2DRM A;  3PVL A;  3EHQ A;  2D8J A;  4Z8A A;  1W1F A;  3UAT A;  1UG1 A;  1GBQ A;  2BZX A;  3I9Q A;  1BB9 A;  1WLP B;  2JW4 A;  2SRC A;  1RI9 A;  1V1C A;  4D8K A;  1I1J A;  2DRK A;  2EBP A;  2K79 A;  3M0R A;  2LMJ A;  4RTV A;  1YNZ A;  3O5Z A;  4CC4 B;  2J05 A;  2O88 A;  2RQV A;  1K1Z A;  2LNH B;  3VS4 A;  1K9A A;  4JZ3 A;  1K76 A;  2DL7 A;  2RQU A;  3H41 A;  2JM9 A;  1T0H A;  3EG1 A;  2D8H A;  4J9F A;  1H8K A;  1G2B A;  2PZ1 A;  3LH5 A;  1M30 A;  2C0O A;  3KFV A;  4J9C A;  2KNB B;  4ORZ A;  2YUO A;  1W6X A;  1ABQ A;  1CKA A;  2W10 A;  2M51 A;  3M0P A;  4LNP A;  1M27 C;  4CC7 A;  3I5R A;  1OEB A;  4FSS A;  1UHF A;  4K11 A;  1J3T A;  5IHK A;  2DE0 X;  2ROL A;  1EFN A;  1UDL A;  2HDA A;  3CQT A;  1QWE A;  1OOT A;  3THK A;  2L3P A;  1H3H A;  1ABO A;  4A63 B;  1M8M A;  1X2K A;  2YT6 A;  1AZG B;  2JMC A;  1Z9Z A;  3M0T A;  2DLP A;  4OMN A;  4Z89 A;  3ULR B;  4QT7 A;  2NUZ A;  2EQI A;  5GJW B;  1ZX6 A;  2LJ1 A; 
#chains in the Genus database with same CATH topology
 2LX7 A;  2RJE A;  1QVF A;  3CCR Q;  3H0H A;  1TG0 A;  1WHL A;  2RHZ A;  5GAN j;  2DK3 A;  2KMT A;  4JJB A;  2B86 A;  4DBR A;  2L3S A;  3PGG A;  2VXF A;  1VQO Q;  3OYY A;  4LD9 K;  4PJO F;  3SWN B;  4DA4 A;  1K73 C;  1M90 R;  1M2O A;  3CEY A;  2JOY A;  4ZGJ B;  4JLG A;  1KQS P;  2DEQ A;  4J9I A;  2RHI A;  3R6O A;  4E7S A;  5KCO A;  1UGS B;  1QCF A;  3EHR A;  1U5S A;  2K7A A;  1KQ1 A;  8AT1 B;  2RJC A;  2CGH A;  3OW2 A;  1X43 A;  5CKB A;  1VQP T;  3EFS A;  4XAX B;  4AFZ C;  1NM7 A;  2K4Y A;  4HVU A;  3M0U A;  2JTE A;  1W2B P;  4JS5 A;  3VKI A;  1Y96 A;  3SHW A;  4PFZ A;  1ZSZ A;  3RBB B;  2GTJ A;  1VQ9 T;  3UF4 A;  4O5V A;  4IUT A;  5EG2 A;  2RD1 A;  1DJ7 B;  4C8Q E;  2MI6 A;  4J9G A;  4DBH A;  3EGX A;  2JUF A;  2RJF A;  4OML A;  1M9S A;  4A4F A;  5CKF A;  2VB6 A;  1YI2 Q;  4C5I A;  4OF1 A;  3H0I A;  1TUD A;  1WHM A;  2K6D A;  4BY6 B;  3X25 B;  4II1 A;  1NLO C;  3NMZ C;  2VVK A;  2NUT B;  3VS6 A;  5KCH A;  2D0N A;  2LT4 A;  2HKN A;  1OZ3 A;  2O9S A;  3VS3 A;  4LN2 A;  3UA6 A;  1TUC A;  1JRI A;  2L89 A;  1GXI E;  1QLY A;  3URG A;  1YJ9 Q;  1Q82 U;  4PJO D;  4HVW A;  2EW3 A;  1B07 A;  4C0F A;  4EPC A;  1KK7 A;  1SEM A;  2OTJ A;  2M02 A;  5GAM e;  2Y4Y A;  3VJP A;  1UHC A;  3I56 A;  4PNO A;  3M4Y A;  1ZUU A;  2X4X A;  3CPF A;  3D7S B;  1MMA A;  4A53 A;  3J7A F;  1W2B S;  5LJ3 g;  1AEY A;  2P4R A;  3GNG A;  1GFC A;  1AWO A;  3GIB A;  4R55 A;  3JCM b;  1RAE B;  1IRE B;  1GCQ C;  2MWP A;  1VQ8 T;  4FSX A;  4YTL A;  1EIF A;  1KQ2 A;  3TCJ A;  2PUO B;  2AT1 B;  3QZ5 B;  1S72 T;  4XTV A;  2DL5 A;  4M7A B;  3V7S A;  4C0G A;  4F14 A;  1QVG P;  3M59 A;  2RPN A;  3PIO A;  2LQN A;  4JZ4 A;  4E6R A;  4E7I A;  5C0M A;  1D1C A;  1Q81 C;  1OU8 A;  2J6K A;  1U1T A;  3CMA T;  2O9V A;  1QWF A;  2MPX C;  4E7K A;  4NL2 A;  3A98 A;  1U1S A;  2E6Z A;  1JEG A;  4QW2 A;  2PVO B;  4AT1 B;  2V8I A;  1M1K C;  2CT4 A;  2K5F A;  4BE2 A;  2RQW A;  3G6E A;  2C0I A;  4EMG A;  1G3S A;  4OMQ A;  2A37 A;  2BIV A;  1UUE A;  3RKW A;  1U3O A;  2X3W D;  4FW2 A;  1YIT T;  1ZQ1 A;  2EKH A;  1K4U S;  2RNA A;  1UTI A;  3PMI A;  1LCK A;  2G3R A;  2PUK B;  2V8J A;  2ZAE A;  3E1S A;  3CCS Q;  3Q1J A;  5GMK l;  5IH2 A;  4L5G A;  4Y91 A;  2HBW A;  2PVG B;  5CVI A;  5LJ5 f;  2RHY A;  1WQ7 A;  1QCN A;  3C0C A;  8ATC B;  2FYK A;  2M16 A;  1LPL A;  2EGA A;  1BI1 A;  5KYY B;  1IB8 A;  2JS2 A;  1C6V X;  2PQW A;  2QQ9 A;  2GBQ A;  3QYH B;  1PRL C;  2A0F B;  3CCE T;  1VQ4 A;  3HFO A;  1VQ8 Q;  2MK5 A;  5I11 A;  4WTO B;  5KYX A;  2E6N A;  1WQW A;  2ZCF B;  1GRI A;  2FRW A;  4PJO C;  2F5T X;  4QVZ A;  4FCY A;  1VQP A;  4F7U B;  1VQ6 A;  3MCA B;  2DAQ A;  2JTF A;  3MEW A;  2QA4 A;  3QUI A;  2RA2 A;  5IT9 E;  4J6X A;  2HQE A;  2NYS A;  2QTV A;  4LE9 A;  4J8O A;  1N5Z A;  2FZG B;  2WAC A;  2A36 A;  2XU8 A;  3CCJ T;  5GMK h;  4BB7 A;  3MJX A;  1WI7 A;  1PSF A;  3ZFJ A;  4DQ2 A;  2VV5 A;  2E65 A;  3QG1 A;  1I4K 1;  2X4W A;  2HSE B;  3VV0 A;  3DLM A;  2VAS A;  3OYC A;  2CZ6 B;  1M1K R;  1D3B B;  5GAO n;  1WFW A;  2OAW A;  1MV0 B;  1MUZ A;  2HD0 A;  2EYZ A;  3E2U A;  4DEX A;  3JCM e;  1PKT A;  3CC2 T;  4A4G A;  5LJ3 f;  1M4Z A;  5CCA A;  4BY6 C;  1ZHI A;  4ZN3 A;  5KE2 A;  5IAY A;  2YUN A;  3BFM A;  3M55 A;  2CRE A;  3EH2 A;  2EGE A;  3QHS A;  1VQ9 A;  3L2V A;  2MCN A;  1YWP A;  4F7U E;  5GAN f;  4PJJ A;  1ZSZ C;  2CH4 W;  2COZ A;  4IIO A;  4B9W A;  2DIQ A;  2COY A;  2DRM A;  2O4X A;  5HK0 A;  3PVL A;  2L3R A;  4RKU E;  2BZX A;  1FWZ A;  2E64 A;  2JW4 A;  4KGZ B;  5GAM f;  1RI9 A;  3OYG A;  1I1J A;  2DRK A;  4DBQ A;  2XDB A;  3KUF A;  5J3B A;  2LVM A;  1TH7 A;  3M0R A;  3JCM h;  1YNZ A;  3OB9 A;  1BKB A;  4MZT A;  2HL3 A;  4CC4 B;  5GAN g;  3CBM A;  1TS9 A;  2LNH B;  3VS4 A;  2GCX A;  3LYI A;  4HCZ A;  2XID A;  3EG1 A;  3JB9 G;  4M7D F;  1TSF A;  2QGG A;  4M75 D;  2RI5 A;  2YLC A;  4GLK A;  4HCB A;  3BW1 A;  3OW2 P;  1RAD B;  1W6X A;  3RER A;  1CKA A;  2W10 A;  5D6X A;  1JJ2 P;  3DKM A;  1VIE A;  3CXC S;  4FSS A;  4B9X A;  3CC7 A;  2L8D A;  5IHK A;  4JUV A;  2DE0 X;  3RR6 A;  2YHT A;  2ROL A;  3C12 A;  2HDA A;  1QWE A;  1ABO A;  5GAN e;  1N8R U;  1K8A C;  1AZG B;  2JMC A;  1Z9Z A;  4LD6 A;  4OMN A;  2LNV A;  3E9G A;  4LDX A;  5GAN 6;  2R58 A;  1VQ9 Q;  4XU0 A;  2NUZ A;  5GJW B;  1ZX6 A;  1VQ7 T;  2LJ1 A;  3QJ6 A;  4OMM A;  1QVG A;  3GBQ A;  1U8R A;  5GAO r;  3CCM T;  1ZA1 B;  3QDR B;  4M77 F;  3LWH A;  3A8M B;  3MHX A;  2DNU A;  2YSQ A;  2CP7 A;  4AFS C;  1GCQ A;  2A08 A;  2O2O A;  3SD4 A;  2XMF A;  3ZEH A;  1CSK A;  3V8J A;  1PD1 A;  1RAI B;  2MF2 A;  4IKF A;  2IIM A;  5I2M A;  3WVE B;  1N8R R;  4M7A E;  2GQV A;  3V8K A;  3HTR A;  4FT4 A;  3QO3 A;  4BI8 B;  1CKB A;  2DVE A;  2FB7 A;  2NWM A;  3MKD A;  3EGD A;  4X1V A;  1YJN Q;  2DJZ A;  5CK9 A;  3CC7 T;  3T9N A;  1AVZ C;  2QQA A;  1BU1 A;  1NPP A;  1SF9 A;  2DIL A;  1M1F A;  3OYH A;  4PL6 A;  1SHG A;  4BI4 A;  2FG0 A;  3I55 T;  3M53 A;  4MDW A;  3L42 A;  2RQR A;  4MMK A;  2EQM A;  2KT1 A;  3QBY A;  4A4H A;  5CKH A;  1OV3 A;  2J06 A;  4HT9 A;  1H64 1;  1JXO A;  4EIK A;  2BZY A;  3RKX A;  4PJM A;  2ZPB B;  4XK8 E;  1VQ4 Q;  2LTO A;  1KD1 R;  2CP6 A;  3H6Z A;  3CCQ A;  2JTM A;  1K9M R;  1B3Q A;  4OGC A;  4RG2 A;  4JRP A;  3FDR A;  1X6O A;  3CCL Q;  2F2V A;  2PTK A;  5LJ3 d;  4C92 B;  3NTH A;  2IG0 A;  1M3B A;  4M75 C;  3A1P A;  3JB9 I;  3HL8 A;  4J6W A;  1FYN A;  5KYW A;  2V8K A;  5A0D A;  3GOX A;  3C94 A;  3ASK A;  2YRV A;  3G71 Q;  5CKE A;  2NLU A;  3EG9 B;  2DL4 A;  3PMT A;  1AWX A;  2Z0W A;  1IRX A;  3EG3 A;  4RTW A;  4VUB A;  4ANJ A;  1X27 A;  2I0N A;  1VQN T;  2EWN A;  3CPW A;  4FYV B;  4M7A A;  2BE7 D;  2EYX A;  5FRO A;  2QXF A;  3JSC A;  2KBT A;  4PJO B;  1E7O A;  2E3H A;  2OTJ T;  2E10 A;  3CMA Q;  2CP2 A;  3VRY A;  4Y92 A;  1T0J A;  2C0T A;  4F04 B;  2KR3 A;  3JB9 H;  1QW1 A;  4C5G A;  1AD5 A;  2D1X A;  5GMK i;  1JXM A;  1I0C A;  2KYM A;  2EYY A;  3JB9 J;  4GLM A;  1VYV A;  2CUD A;  1SRL A;  1VIF A;  5DM7 R;  2K2M A;  4M7D D;  2V1Q A;  4KRT A;  4AG1 C;  3J81 E;  4AMC A;  1NBE B;  1X6G A;  1HD3 A;  4D8D A;  2RQT A;  5IXB A;  1QVF P;  1S72 A;  3LGL A;  3UDC A;  5CKD A;  3NPF A;  2SEM A;  3NTI A;  9ATC B;  5GAN 3;  4LUE A;  4M78 C;  1Y96 B;  1C0M A;  1D1A A;  2PNI A;  2BKD N;  3DB3 A;  2CSI A;  5IHI A;  2KT8 A;  1YJN A;  3CMA A;  2AZV A;  3A5Z B;  5FRN A;  1ZBX A;  1R0C B;  2DA9 A;  4ELY C;  4JRQ A;  4J7F A;  3C95 A;  2LQ8 A;  3E19 A;  2H8H A;  3MPU B;  3EH1 A;  4M77 D;  3I56 T;  2CSQ A;  2DYI A;  1AZE A;  2JZ2 A;  1M3A A;  4M78 E;  4HXJ A;  5CIU A;  2CKK A;  3G71 A;  3OS2 A;  2VKN A;  1GCP A;  2OTL T;  4Z88 A;  2EJF A;  4CRI A;  1UE9 A;  1YP5 A;  1UGV A;  4CI0 C;  3VYG A;  2KXC A;  4F7U A;  4M7A G;  5IXF A;  4Y28 E;  1VQL A;  2QTX A;  1G83 A;  1WHG A;  2MMP A;  4N4H A;  5CQX A;  3JCM f;  1PKS A;  1VA7 A;  1TXQ A;  3SFM A;  4KUI A;  1Q7Y R;  3CC7 Q;  2EIF A;  2VGN A;  3FLG A;  3I5S A;  2JNG A;  4C92 D;  4BAC A;  3OYK A;  1YCY A;  1KHI A;  4V2S A;  2QK0 A;  4HCK A;  3OYB A;  3GF5 A;  5FW9 A;  4OMP A;  2HKQ B;  4RCC A;  4RMO A;  2RI3 A;  3JCM c;  4AG2 C;  3SEM A;  2MIO A;  3CD6 Q;  3JCM Q;  1SPK A;  5D6W A;  3TVT A;  3TSW A;  3L2Q A;  2KK4 A;  3G71 T;  1K8A U;  2RJD A;  2E5K A;  5LJ3 e;  3EFO A;  4JRK A;  1JO8 A;  3V8L A;  2K57 A;  1WZO A;  4E7J A;  2K3X A;  4Q5W A;  3CXC P;  1Z9Q A;  4RTU A;  1BCO A;  3MEU A;  2GNC A;  4J9E A;  3SDZ A;  2A28 A;  2V26 A;  4C8Q C;  3OS5 A;  1Q86 R;  2R5A A;  1N27 A;  4MZM A;  1ZUK A;  3HKS A;  2QDL A;  2Y90 A;  4C8Q F;  2ED1 A;  3OYL A;  1WYX A;  3QWY A;  4NS5 A;  3PFS A;  3HRT A;  1JJ2 S;  2ATC B;  1SG5 A;  3G1J A;  2F2W A;  1BYM A;  2E5Q A;  1NPR A;  1ZSZ B;  2L0A A;  1X6B A;  3MO8 A;  5GAO p;  2LC4 A;  4EMK A;  3OS0 A;  1UGP B;  3KXT A;  4F16 A;  2VXE A;  5GAO l;  2ZPG B;  1WHJ A;  3QWX X;  1K0X A;  2X4Y A;  4QQ6 A;  4J9H A;  2A7Y A;  3M57 A;  2L5Q A;  1WJQ A;  3JB9 F;  1ZBJ A;  4NL3 A;  1D1B A;  3FEO A;  1M90 U;  4HT8 A;  4PFP A;  4IUP A;  2HAX A;  2DIG A;  3VUB A;  1VQN A;  2LCS A;  4IUR A;  3RKY A;  1NEG A;  2P0Q A;  2VGM A;  4Z8A A;  3CCQ T;  4ELZ C;  3UAT A;  4HKE A;  1UG1 A;  1V29 B;  1GBQ A;  4DBF A;  4E47 A;  1VUB A;  3CME T;  4D8K A;  3QJY A;  2FZC B;  1LNX A;  2EBP A;  2AIR B;  5GAO m;  1BIA A;  2EYQ A;  2RI2 A;  2EQK A;  2JJ9 A;  1HK9 A;  2MAM A;  3CCV T;  1RAC B;  1K76 A;  2JM9 A;  3DLL A;  3CD6 A;  4ME7 A;  2E1H A;  1MHN A;  3CCR T;  1VQ4 T;  1VQP Q;  5KH6 A;  1OQK A;  2PZ1 A;  3LH5 A;  4WF2 A;  1M30 A;  2C0O A;  4J9C A;  2KNB B;  4ORZ A;  3CC2 A;  2YUO A;  4FW1 A;  1ABQ A;  4F7U G;  1VQ8 A;  3M0P A;  2GFU A;  4LNP A;  1M27 C;  3CCU A;  4M75 B;  4CC7 A;  3H8Z A;  3A8H B;  3BDL A;  5GAO q;  1UHF A;  5CO7 A;  1OI1 A;  2XDD A;  3GPL A;  1R77 A;  4M7A F;  2BUD A;  1OOT A;  1SKU B;  4L59 A;  1H3H A;  3QSU A;  4R56 A;  4PJO G;  4KUD K;  1N6A A;  1X2K A;  2YT6 A;  4OMF B;  2EKO A;  1VQL Q;  2WSF E;  5LJ5 j;  5GAN 5;  2DLP A;  1M8V A;  4C8Q D;  2EQI A;  3CCS A;  3I35 A;  2FEI A;  1JB0 E;  2H3E B;  2AZS A;  4XTY A;  1K9M C;  3J80 E;  4C8Q B;  1KD1 C;  2KXD A;  5FU7 C;  2YXY A;  4PJO A;  2EVR A;  2M1H A;  1IHV A;  5KYW B;  3CD6 T;  3G6E T;  2BE9 B;  2XKO C;  2YDL A;  2QAS A;  3VU3 C;  4OMO A;  2KE9 A;  3FIF A;  1RLQ C;  3JRZ A;  4RCB A;  1H3Z A;  1YHQ T;  6AT1 B;  1YJ9 T;  3CCU T;  1VQK Q;  4JJN K;  4DOW A;  2OAU A;  3H0F A;  1VQL T;  4IUQ A;  3OYE A;  1M90 C;  1U06 A;  5LL6 S;  3HRS A;  1UJY A;  4C0D C;  1W70 A;  2HCK A;  3OA6 A;  2P84 A;  4E7Z A;  1EX4 A;  3FJ5 A;  4PJO E;  1T3S A;  2B8A A;  4DEY A;  3P8D A;  4M7D C;  3OW2 S;  2DD4 A;  1LJO A;  3CPW P;  2QEX T;  4FYY B;  3PNW C;  1S72 Q;  2VYT A;  4ZN1 A;  5CR2 A;  2EPD A;  1BI0 A;  2P0K A;  2XIC A;  1MV3 A;  1VQ6 Q;  4RTT A;  1Y07 A;  2CS7 A;  2ZGW A;  1N8R C;  2DL3 A;  1G5V A;  1IO6 A;  2LRQ A;  1WX6 A;  1Q7Y U;  2J6O A;  4QQG A;  3OYA A;  5LJ5 g;  4ZGD B;  3FRN A;  4KGX B;  4X9D A;  3NGP A;  4M75 F;  2DZ9 A;  2AHJ B;  1QKX A;  4BE1 A;  1OYX A;  2DJQ A;  5LJ5 d;  4JJD A;  1HJD A;  3I56 Q;  1X75 C;  3MP8 A;  1WIE A;  2CDT A;  2AKL A;  1SHF A;  2ESW A;  2L3Q A;  3OYM A;  1WXT A;  2ENM A;  2MOX A;  2FVU A;  3QII A;  1YIJ A;  1QQJ A;  1AWJ A;  2V1R A;  3UA7 A;  5A0G A;  1GL5 A;  1GFD A;  4M78 G;  4HCC A;  2D0Q B;  1QVP A;  1OX8 A;  2K5I A;  1D0Y A;  2LX9 A;  4C92 F;  2DYB A;  4JLI A;  2I2L A;  1R8O B;  1VYU A;  3ZBD A;  3VS2 A;  1YIT Q;  3G7Z A;  3M9Q A;  1SRM A;  3INZ A;  3RDV A;  2YWW A;  1BK2 A;  1XQH A;  2XK0 A;  4HVV A;  3E9F A;  1PRM C;  3CCL A;  3VS0 A;  4X34 A;  1RUW A;  2O01 E;  4C5E A;  1X01 A;  1Y0M A;  4NOY A;  4MZP A;  4N4I A;  5DY9 A;  3CCQ Q;  1B7T A;  1W2B A;  5FU7 B;  4Z02 A;  3M54 A;  3ZL7 C;  2CT3 A;  3HP9 A;  3UT1 A;  3WXM B;  2EYW A;  2DEU A;  1H92 A;  1N9R A;  2ZPI B;  2KGT A;  4M7D A;  3CCE Q;  4KH0 B;  1Q95 G;  2EJG A;  2VUB A;  3M4G A;  5CQY A;  3TQ7 P;  1C1A A;  1I5O B;  1UB4 A;  2W0Z A;  4KUL A;  1T3L A;  2CP0 A;  5AYF A;  3GNF B;  3L1A A;  2QQR A;  3M5A A;  4XU2 A;  2O31 A;  1Y7X A;  1YHQ Q;  1MMD A;  1A0N B;  5LJ3 h;  2KVQ G;  2A3L A;  2OJ2 A;  1BBZ A;  5IHN A;  2LDM A;  1NJI R;  5DLO A;  3UWN A;  3S3N A;  2LCC A;  3X24 B;  2EGC A;  2LJ3 A;  2F5K A;  1SSH A;  5FWB A;  2DVJ A;  2R57 A;  2OTJ Q;  3FJP A;  5A0L A;  1X69 A;  3S3O A;  4J5Y A;  3JCM V;  1KSW A;  2DF6 A;  2DBK A;  3HPW A;  3A8G B;  1OZ2 A;  1VQO A;  4J7I A;  4M4Z A;  3V7C A;  1ZSG A;  3U23 A;  1ZA2 B;  1Q7Y C;  2RK1 A;  3EGU A;  2DM1 A;  3CCR A;  3GLX A;  2D9T A;  4J9B A;  2CH4 A;  3HFN A;  1YCS B;  1G3Y A;  3P8H A;  2GFA A;  4M77 G;  3MP6 A;  4M77 B;  1JQQ A;  1F1B B;  1PC0 A;  2KRS A;  2OI3 A;  1YI2 A;  2P0P A;  1YFN A;  2ZPE B;  2GQI A;  4QQD A;  2ED0 A;  4M75 G;  2DL8 A;  2JXB A;  5IN1 A;  2JN0 A;  1TTH B;  4AFQ C;  1IGU A;  2WSC E;  3LH0 A;  4FYX B;  1WGS A;  1WJS A;  5FU6 C;  5GJV B;  3VS1 A;  3RMQ A;  2VWF A;  4XQ3 A;  4XTZ A;  4QKU A;  1VQ5 T;  2HQX A;  2YLB A;  1WHH A;  1RAA B;  5EC7 A;  3EG2 A;  1B34 B;  5GAM h;  3MET A;  4M75 A;  4FT2 A;  1BIB A;  3DB4 A;  3JCM g;  1Q82 C;  1W4S A;  3RMS A;  3HSB A;  2BZ8 A;  4PK4 A;  2NUT A;  4C5H A;  2HSP A;  3R6N A;  1VQ7 A;  5D7U A;  5DLQ E;  4C8Q G;  4C92 G;  2EAY A;  2X3X D;  2RF0 A;  1FMV A;  3CBP A;  2YUQ A;  4DOV A;  2E4H A;  5KYN A;  4OVA A;  1VQM T;  1NG2 A;  4XU1 A;  5A2Q E;  3S3M A;  4M7A C;  3LLR A;  4M75 E;  5LJ3 j;  1VYT A;  1WXB A;  2LZ6 B;  1M2V B;  3JCM W;  1WJR A;  2E70 A;  4FM4 B;  1NLP C;  4KT0 E;  2BTT A;  5FLX E;  4X9C A;  3LX7 A;  2CUB A;  1NYG A;  1D09 B;  1YBY A;  1QVF S;  5AT1 B;  1MGQ A;  2J6F A;  4ESR A;  5I22 A;  1OU9 A;  2IVW A;  3G4S A;  1AWW A;  3CBO A;  3JV3 A;  1M1G A;  1PCX A;  4L6V 5;  3JCM P;  4CC3 A;  3S6W A;  1X2Q A;  5GAM g;  3CCM Q;  2FPE A;  1VQM Q;  1NE8 A;  4HA8 A;  4ATO A;  1M3C A;  5KYU A;  4M78 F;  2ABL A;  2OTL A;  3OSS C;  4ZNX A;  3KBG A;  4M78 A;  1E6G A;  1Q86 U;  2CP5 A;  4KH1 B;  1I5L A;  2QQS A;  1NZ9 A;  5GAN 2;  5GAN 4;  3I9Q A;  2F1L A;  2RO0 A;  4D6W A;  2LCL A;  2SRC A;  1HXD A;  4GY5 A;  4JS4 A;  2C06 A;  1V1C A;  4FL6 A;  2XHC A;  2K79 A;  2CZ0 B;  2LMJ A;  2DER A;  1OX9 A;  3O5Z A;  2QGF B;  2J05 A;  3EG9 A;  2RQV A;  5HK3 A;  2DFU A;  1YIJ T;  1K1Z A;  3H9N A;  3EFO B;  5GAM j;  2QA4 Q;  2DL7 A;  2RQU A;  2DTI A;  3H41 A;  1T0H A;  4J9F A;  2X51 A;  1G2B A;  5M9O A;  2E3I A;  3MP1 A;  4ZGE B;  1K9M U;  1AHJ B;  4LDU A;  2NUP A;  2HMA A;  4M7D G;  2HL5 C;  4OB3 B;  2OTL Q;  2COW A;  2L3P A;  4A63 B;  1VQ6 T;  1M8M A;  3M0T A;  4EMK B;  3AHU A;  3ULR B;  2QA4 T;  4E7H A;  4XTW A;  1ACM B;  2DXC A;  4RG8 A;  3CC4 Q;  2CYZ B;  3LWI A;  4OP0 A;  1KJW A;  1KQS S;  3G4S Q;  5J26 A;  5GMK e;  4E7L A;  2VC8 A;  2DBM A;  3QXE B;  1LOJ A;  5J39 A;  3REA B;  5GAN d;  3OMG A;  5L23 A;  2HZY A;  2KI7 A;  2MYS A;  4M77 C;  4QVD A;  2FPD A;  2X35 A;  4RUG A;  3G6E Q;  3RUX A;  4F17 A;  1G8X A;  2HEQ A;  2KEA A;  3OY9 A;  5GAN 8;  1QP2 A;  4LDW A;  2KRM A;  3L2U A;  4J9D A;  4LDY A;  1MMN A;  2FL7 A;  2R5M A;  1MND A;  1G3W A;  2LQK A;  3REB B;  1BI3 A;  2IPO B;  3EGX B;  4BE0 A;  2JS0 A;  1WPY A;  3EG0 A;  4LXC A;  1PNJ A;  1WHK A;  4C8Q A;  5C6S A;  3OMC A;  2QEX Q;  2J7I A;  2QQB A;  3NTK A;  2KRN A;  3A8L B;  3SWN C;  3V7R A;  4XU3 A;  4C0D B;  1UJ0 A;  2QYZ A;  3CME Q;  3CCJ A;  5L8R E;  1K8A R;  1E6H A;  1D3B A;  4C92 C;  5HY6 A;  3TEE A;  1VQ5 A;  4KGV B;  3X28 B;  2XG8 D;  1NYF A;  4EDU A;  2D6F A;  3X20 B;  1FXX A;  4AFU C;  4EMK C;  1YJW A;  2AK5 A;  3VS5 A;  2LJ0 A;  3MEA A;  3M0Q A;  3VRZ A;  1K73 R;  2YUP A;  3TRE A;  1IGQ A;  3OBY A;  1PWT A;  1LVK A;  3FC3 A;  1VQK T;  4M7D E;  2DO3 A;  3PIP A;  1YI2 T;  2DPP B;  1Y71 A;  4GBQ A;  1M1K U;  3QKJ A;  3PE0 A;  1RI0 A;  1RAG B;  1RAH B;  4PJL A;  3QDF A;  4OB0 B;  1TWB A;  1TUG B;  1HYO A;  2FZK B;  1KFZ A;  2MWO A;  4M7A D;  5FWC A;  4OB1 B;  2RMO A;  2RK2 A;  2AKK A;  3OYD A;  3L2W A;  1YJ9 A;  1WXU A;  4R0K A;  3RNJ A;  1YN8 A;  2ZZD A;  1IXD A;  4LUD A;  1KQS A;  1D0X A;  4CC2 A;  1XOV A;  5ECA A;  3JCM J;  1QCO A;  2HBP A;  2M0Y A;  1UFF A;  2KYB A;  2KSS A;  1AOJ A;  1WDX A;  4JRI A;  4M77 A;  1PG5 B;  1ZLM A;  2CZ7 B;  1S1N A;  3JCM X;  1Y57 A;  4N0A C;  3OSV A;  4PLL A;  1AT1 B;  1KC8 R;  4M77 E;  1KIK A;  1YJW T;  3CPW S;  2KQW A;  2HNI A;  2PU9 B;  2DKG A;  3PT9 A;  1UGR B;  3VUZ A;  4IUU A;  1PSE A;  1V76 A;  7AT1 B;  3I55 Q;  2X9H A;  4ZTF A;  3JAM E;  4JJC A;  4MDX A;  2KY9 A;  2K3Y A;  1XNI A;  2ZPH B;  1K73 U;  1B34 A;  1GBR A;  2FHD A;  5KYY A;  4UC4 A;  1YHQ A;  1YJW Q;  1I81 A;  4FU6 A;  2RN8 A;  4BD3 A;  1RL2 A;  3HHT B;  2QI2 A;  1KHC A;  1OPL A;  3CME A;  1PM3 A;  3CCJ Q;  2LT1 A;  2P4T A;  5GAM d;  1UGQ B;  3G4S T;  2QG9 B;  2JVV A;  2GF7 A;  2RH2 A;  2HQH A;  4C92 E;  3CCE A;  3HRU A;  4EMH A;  1VOM A;  1BCM A;  3BDU A;  1PHT A;  1WA7 A;  3OYI A;  5HCK A;  4IIM A;  1R0B G;  2YRD A;  3I55 A;  4M7D B;  3M56 A;  5GMK m;  3EFR A;  3OYN A;  5GMK j;  1G3T A;  4BDY A;  1Q82 R;  2QDY B;  3RES A;  5D6Y A;  5LJ5 h;  3EGD B;  4WCI A;  4F7U F;  4A4K A;  3F70 A;  1I07 A;  3JCM d;  2GTO A;  3SB2 A;  5FRM A;  1QMC A;  3C4S A;  2RM4 A;  1YIT A;  2ECZ A;  2GGR A;  2EFI A;  1Q86 C;  4XTX A;  3MEV A;  1ZUY A;  2M9U A;  1Q81 U;  1HSQ A;  1JU5 C;  1EZZ B;  1UEC A;  4E2F B;  3ER0 A;  4BI3 A;  2ZPF B;  2DMO A;  2DD5 A;  2Y4X A;  3CC4 A;  1M5Q 1;  4RTX A;  3QYG B;  2FPF A;  4J6Y A;  1K0S A;  1YIJ Q;  3OQ5 A;  4N0A A;  3CCV A;  2EQJ A;  1XTD A;  2F2X A;  2K2V A;  3OYJ A;  1XJW B;  1FMK A;  1YWO A;  2L2P A;  2LP5 A;  2RB6 A;  3LW5 E;  5CAI A;  4RTY A;  5KYU B;  3O8V A;  2JM8 A;  1IZ6 A;  1OPK A;  5FU6 B;  4PLI A;  3WVD B;  3RIR A;  1KD1 U;  2JT4 A;  1FX7 A;  3BE3 A;  3CCL T;  3SWN A;  2DET A;  1TOV A;  2X4J A;  2K3B A;  3NHN A;  2LQW A;  3TSZ A;  1VQ5 Q;  4C92 A;  4A54 A;  3UPU A;  5HKC A;  4B6M A;  1I8F A;  1QKW A;  3NFC A;  2H3J A;  5LJ5 e;  3PTA A;  4ZTJ A;  5KE3 A;  1IHW A;  3VS7 A;  2NUP B;  4BDZ A;  2DX1 A;  3CCS T;  1NJI C;  2QEX A;  3CC4 T;  1KC8 U;  1RAB B;  2E41 A;  3M0S A;  4QVC A;  1Q81 R;  1O75 A;  3M58 A;  2F69 A;  3ME9 A;  4M78 D;  2M0O A;  1SSF A;  2RHX A;  4N4G A;  1RAF B;  4IUV A;  1UEB A;  1KG1 A;  1TU0 B;  2ROT A;  1VQK A;  2KRO A;  3OYF A;  3X26 B;  2WSE E;  2K9G A;  4JDS A;  1WNL A;  3IQL A;  1QP3 A;  4JPB W;  2FO0 A;  4P5N A;  1JJ2 A;  3PVQ A;  1FMW A;  1QVG S;  1ARK A;  2CP3 A;  2DTH A;  3TU4 K;  4J83 A;  4MML A;  1OUL A;  2G6F X;  2JMA A;  2KDS A;  4PKC C;  2PVD B;  3EAE A;  2XD0 A;  3BY7 A;  4LDV A;  1P92 A;  5I21 A;  4PFO A;  2KAF A;  2FRY A;  4O6J A;  4PJN A;  4BUG A;  1NEB A;  2YRC A;  1VQO T;  1D0Z A;  4RTZ A;  4XTU A;  3JB9 D;  3EHQ A;  2D8J A;  1W1F A;  5KYX B;  3L2R A;  1BB9 A;  1WLP B;  1N9S A;  2K5L A;  1MNE A;  4FYW B;  4TVR A;  3L2Z A;  3CCU Q;  4FIB A;  5GAN 7;  3P8B B;  2QAZ A;  3VYH B;  4RTV A;  3CC2 Q;  2OX7 A;  5GAN h;  1VQ7 Q;  2O88 A;  2E12 A;  5I2S A;  1PD0 A;  4JZ3 A;  3QZ9 B;  1K9A A;  1O9S A;  4OB2 B;  2DZC A;  2RHU A;  2DXB A;  4A4E A;  1BI2 A;  2D8H A;  1H8K A;  1KC8 C;  4OGE A;  3FB9 A;  1YJN T;  2EJ9 A;  3OBW A;  4M78 B;  3KFV A;  2O4X B;  2XI9 A;  3OS1 A;  2DTO A;  2XDP A;  2M51 A;  2DXT A;  4C0Z A;  3CXC A;  3N5B B;  2CZ1 B;  2EQU A;  3I5R A;  1OEB A;  3QPH A;  4K11 A;  1J3T A;  1M2V A;  1EFN A;  1UDL A;  3CQT A;  3GP8 A;  1NJI U;  3AT1 B;  3THK A;  1VQN Q;  4KBM B;  3LGF A;  1MMG A;  3A8O B;  4Z89 A;  3CCV Q;  4QT7 A;  2DXU A;  1VQM A;  1JBM A;  1RLP C;  3CCM A; 
#chains in the Genus database with same CATH homology
 2LX7 A;  4OMM A;  3GBQ A;  3H0H A;  3I35 A;  1TG0 A;  2FEI A;  2AZS A;  4JJB A;  1KJW A;  2B86 A;  2L3S A;  2DNU A;  2DBM A;  2YSQ A;  4AFS C;  1GCQ A;  2A08 A;  2O2O A;  2KXD A;  2XMF A;  1CSK A;  3REA B;  5L23 A;  2EVR A;  2FPD A;  2IIM A;  4RUG A;  2YDL A;  4OMO A;  4F17 A;  2KE9 A;  2HEQ A;  2KEA A;  1CKB A;  1RLQ C;  2NWM A;  4X1V A;  2KRM A;  4J9D A;  4J9I A;  3H0F A;  1U06 A;  1QCF A;  1UJY A;  1AVZ C;  1W70 A;  2HCK A;  1BU1 A;  1U5S A;  3EHR A;  2K7A A;  3REB B;  2DIL A;  3FJ5 A;  2JS0 A;  1T3S A;  3EG0 A;  1PNJ A;  4DEY A;  1X43 A;  1SHG A;  2J7I A;  2FG0 A;  2KRN A;  1UJ0 A;  4AFZ C;  1NM7 A;  2EPD A;  4HVU A;  3M0U A;  1E6H A;  2JTE A;  1MV3 A;  2RQR A;  2KT1 A;  3SHW A;  4RTT A;  1OV3 A;  2J06 A;  1NYF A;  3RBB B;  2GTJ A;  2DL3 A;  1IO6 A;  3UF4 A;  1WX6 A;  1JXO A;  4AFU C;  2J6O A;  2AK5 A;  4EIK A;  2BZY A;  3VS5 A;  2LJ0 A;  3M0Q A;  3VRZ A;  2YUP A;  4J9G A;  3NGP A;  1PWT A;  4OML A;  1QKX A;  2DJQ A;  1B3Q A;  4JJD A;  4GBQ A;  1HJD A;  3PE0 A;  1WIE A;  2CDT A;  1TUD A;  3H0I A;  2AKL A;  2F2V A;  2K6D A;  2PTK A;  1SHF A;  2ESW A;  2L3Q A;  1WXT A;  1KFZ A;  1NLO C;  5FWC A;  2ENM A;  3NMZ C;  2MOX A;  1M3B A;  2RMO A;  2VVK A;  2AKK A;  1WXU A;  1AWJ A;  2V1R A;  4R0K A;  3UA7 A;  1FYN A;  3RNJ A;  1GFD A;  1GL5 A;  3VS6 A;  1YN8 A;  2D0N A;  4LUD A;  4CC2 A;  1XOV A;  5ECA A;  2O9S A;  2M0Y A;  2DYB A;  4LN2 A;  3VS3 A;  1UFF A;  2KYB A;  3UA6 A;  1AOJ A;  1TUC A;  1WDX A;  1VYU A;  3VS2 A;  2DL4 A;  1QLY A;  1AWX A;  1ZLM A;  1S1N A;  3EG3 A;  1SRM A;  4RTW A;  4HVW A;  1Y57 A;  1X27 A;  2I0N A;  2EW3 A;  1B07 A;  1BK2 A;  4HVV A;  1KIK A;  2EYX A;  1SEM A;  1PRM C;  1UHC A;  2KBT A;  1E7O A;  3VS0 A;  1RUW A;  1ZUU A;  3VRY A;  1Y0M A;  4Y92 A;  1T0J A;  2C0T A;  1AEY A;  2KR3 A;  2P4R A;  4JJC A;  3ZL7 C;  2CT3 A;  1GFC A;  2EYW A;  1AWO A;  1H92 A;  1AD5 A;  2D1X A;  1GBR A;  2KGT A;  1JXM A;  1I0C A;  2KYM A;  2EYY A;  1GCQ C;  4GLM A;  1VYV A;  2CUD A;  1SRL A;  2W0Z A;  2K2M A;  2V1Q A;  1T3L A;  4KRT A;  2RN8 A;  4AG1 C;  1X6G A;  2DL5 A;  1OPL A;  1HD3 A;  4D8D A;  2RQT A;  4F14 A;  5IXB A;  2RPN A;  3NPF A;  2O31 A;  2SEM A;  4LUE A;  2LQN A;  4JZ4 A;  4E6R A;  1A0N B;  1PHT A;  1WA7 A;  5HCK A;  2J6K A;  2OJ2 A;  1BBZ A;  2PNI A;  4IIM A;  5IHN A;  2O9V A;  1QWF A;  2CSI A;  5IHI A;  2EGC A;  2KT8 A;  2LJ3 A;  3A98 A;  2AZV A;  1SSH A;  5FWB A;  1JEG A;  2DVJ A;  2DA9 A;  2CT4 A;  1X69 A;  4WCI A;  1I07 A;  2RQW A;  2GTO A;  2H8H A;  2C0I A;  4OMQ A;  1KSW A;  2A37 A;  2DF6 A;  1UUE A;  2ECZ A;  1U3O A;  2CSQ A;  2DBK A;  2GGR A;  2X3W D;  1AZE A;  1M3A A;  1ZUY A;  4HXJ A;  1HSQ A;  1JU5 C;  1UEC A;  2EKH A;  4M4Z A;  1ZSG A;  1K4U S;  2VKN A;  2RNA A;  3U23 A;  1GCP A;  1UTI A;  2DMO A;  4Z88 A;  3EGU A;  2DM1 A;  4RTX A;  1LCK A;  1UE9 A;  1YP5 A;  1UGV A;  4J9B A;  2FPF A;  1K0S A;  2CH4 A;  5IH2 A;  2KXC A;  2HBW A;  1YCS B;  2F2X A;  5IXF A;  1FMK A;  1YWO A;  2L2P A;  3C0C A;  2LP5 A;  1G83 A;  1JQQ A;  2KRS A;  2OI3 A;  2EGA A;  2GQI A;  4RTY A;  2ED0 A;  1PKS A;  1VA7 A;  2JS2 A;  2DL8 A;  2GBQ A;  2JXB A;  2JM8 A;  1PRL C;  4AFQ C;  1RLP C;  1OPK A;  3I5S A;  2JT4 A;  5GJV B;  3VS1 A;  5I11 A;  4HCK A;  2VWF A;  5FW9 A;  4OMP A;  1GRI A;  2FRW A;  2K3B A;  3NHN A;  2LQW A;  4AG2 C;  5EC7 A;  3EG2 A;  3SEM A;  3TSZ A;  2MIO A;  1QKW A;  1SPK A;  3TVT A;  3TSW A;  2BZ8 A;  2HSP A;  2E5K A;  3R6N A;  3VS7 A;  2DX1 A;  1JO8 A;  2X3X D;  4LE9 A;  2RF0 A;  3M0S A;  1N5Z A;  2YUQ A;  2A36 A;  1Z9Q A;  4RTU A;  2GNC A;  4J9E A;  1WI7 A;  1NG2 A;  2A28 A;  2ROT A;  2KRO A;  1ZUK A;  1VYT A;  2QDL A;  2LZ6 B;  1WXB A;  2ED1 A;  2K9G A;  1WYX A;  3QWY A;  1WFW A;  1NLP C;  3IQL A;  2OAW A;  1MV0 B;  2BTT A;  4JPB W;  1MUZ A;  2EYZ A;  2FO0 A;  4DEX A;  1PKT A;  2F2W A;  3PVQ A;  2CUB A;  1NYG A;  2L0A A;  1X6B A;  2J6F A;  1ARK A;  4ESR A;  5I22 A;  2G6F X;  2JMA A;  2YUN A;  4F16 A;  1AWW A;  3JV3 A;  2CRE A;  4CC3 A;  3QWX X;  1K0X A;  1X2Q A;  4J9H A;  2EGE A;  2FPE A;  2FRY A;  1ZBJ A;  2MCN A;  1NEB A;  1YWP A;  1M3C A;  2CH4 W;  4IIO A;  2ABL A;  2LCS A;  1NEG A;  4ZNX A;  4RTZ A;  1E6G A;  2DRM A;  3PVL A;  3EHQ A;  2D8J A;  4Z8A A;  1W1F A;  3UAT A;  1UG1 A;  1GBQ A;  2BZX A;  3I9Q A;  1BB9 A;  1WLP B;  2JW4 A;  2SRC A;  1RI9 A;  1V1C A;  4D8K A;  1I1J A;  2DRK A;  2EBP A;  2K79 A;  3M0R A;  2LMJ A;  4RTV A;  1YNZ A;  3O5Z A;  4CC4 B;  2J05 A;  2O88 A;  2RQV A;  1K1Z A;  2LNH B;  3VS4 A;  1K9A A;  4JZ3 A;  1K76 A;  2DL7 A;  2RQU A;  3H41 A;  2JM9 A;  1T0H A;  3EG1 A;  2D8H A;  4J9F A;  1H8K A;  1G2B A;  2PZ1 A;  3LH5 A;  1M30 A;  2C0O A;  3KFV A;  4J9C A;  2KNB B;  4ORZ A;  2YUO A;  1W6X A;  1ABQ A;  1CKA A;  2W10 A;  2M51 A;  3M0P A;  4LNP A;  1M27 C;  4CC7 A;  3I5R A;  1OEB A;  4FSS A;  1UHF A;  4K11 A;  1J3T A;  5IHK A;  2DE0 X;  2ROL A;  1EFN A;  1UDL A;  2HDA A;  3CQT A;  1QWE A;  1OOT A;  3THK A;  2L3P A;  1H3H A;  1ABO A;  4A63 B;  1M8M A;  1X2K A;  2YT6 A;  1AZG B;  2JMC A;  1Z9Z A;  3M0T A;  2DLP A;  4OMN A;  4Z89 A;  3ULR B;  4QT7 A;  2NUZ A;  2EQI A;  5GJW B;  1ZX6 A;  2LJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...