2L3QA

Structure of the prolyl trans isomer of the crk protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
78
structure length
78
Chain Sequence
b'GPYAQPSINTPLPNLQNGPFYARVIQKRVPNAYDKTALALEVGELVKVTKINMSGQWEGECNGKRGHFPFTHVRLLDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trans isomer of Crk protein
molecule tags Structural protein
source organism Gallus gallus
publication title Structural basis for regulation of the Crk signaling protein by a proline switch.
pubmed doi rcsb
total genus 7
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l3qA00
1ABQA 1GRIA 4J9GA 1ZUKA 2CT3A 1ZBJA 2KGTA 2K9GA 3PVLA 1T0JA 2ROTA 1T3SA 4AFZC 2O9VA 3EGUA 2BZ8A 2V1QA 4RTYA 3NGPA 4ZNXA 2CREA 2DM1A 2B86A 1UJ0A 2DBMA 1YN8A 2JW4A 4X1VA 1NM7A 1GCQC 3VS5A 2JMAA 2GTOA 1J3TA 1EFNA 2K7AA 1K9AA 2FPEA 3QWYA 2LP5A 5ECAA 2YUNA 3UF4A 1QWFA 2LMJA 4J9HA 1W6XA 1TG0A 2J05A 2LCSA 2ED1A 1UDLA 1UHFA 1RLPC 2CSQA 3REAB 5IHIA 1B3QA 3M0PA 2QDLA 1PRMC 1AWOA 2KE9A 1GBQA 2DLPA 1UUEA 2AK5A 1ABOA 2YUOA 2YUPA 1OPLA 2FRWA 2O9SA 3EHQA 3VS2A 1E6HA 2DL5A 2O88A 2RQVA 5HCKA 2L0AA 1JEGA 2GTJA 2LJ3A 1Y57A 4K11A 1PKTA 2LQWA 4RTZA 1LCKA 3H0IA 3VS1A 1HJDA 2W0ZA 2KT1A 1NEBA 3VS6A 1PWTA 5GJVB 3VRYA 2EGEA 2KR3A 3RNJA 1K1ZA 2VVKA 2EYWA 2PNIA 2KRNA 4JZ3A 1YNZA 2EKHA 2F2XA 1VYUA 1I07A 3EG1A 2BTTA 2JMCA 1SSHA 2SEMA 3R6NA 2DA9A 5FWBA 1AVZC 2OI3A 2RQUA 2ED0A 2DL7A 2LX7A 2DE0X 1AZGB 2L2PA 2D8HA 2K3BA 2KXDA 3EHRA 2J7IA 2MCNA 3EG0A 1OV3A 3H0FA 4OMQA 4RTWA 3NHNA 2A36A 2FEIA 4AFUC 2LJ1A 1X27A 4OMLA 2GGRA 3EG3A 4Z8AA 1BU1A 2DL3A 4F17A 3VS0A 4LE9A 1KIKA 4IIOA 4JZ4A 2EYXA 5GJWB 2MIOA 3SEMA 1VYTA 1AWJA 1NLOC 2C0TA 1OEBA 1WYXA 1QWEA 1H92A 1SRLA 2IIMA 1M27C 1HD3A 2AKKA 5EC7A 4F14A 2KBTA 2V1RA 3LH5A 1YP5A 4D8DA 2DVJA 2KROA 5IH2A 5FW9A 1TUDA 2EBPA 1U06A 3ZL7C 3TVTA 2YDLA 4HXJA 2DRMA 1MV3A 2FPFA 2LZ6B 2EPDA 1CKAA 4J9EA 1K4US 1BBZA 4RTTA 1BB9A 2HCKA 2L3PA 2JM9A 1UGVA 2HSPA 3M0QA 1UJYA 3CQTA 3SHWA 4J9BA 1AEYA 2CH4A 3C0CA 1FYNA 2SRCA 2OAWA 2LQNA 3M0TA 1GBRA 3EG2A 5I22A 3A98A 3M0UA 2EGAA 1JXOA 2KT8A 3H0HA 1H3HA 4J9FA 4Y92A 2CH4W 2FPDA 2RQTA 2RQWA 4KRTA 1UE9A 2RQRA 4LN2A 3M0SA 2A37A 1AD5A 1B07A 4OMPA 1E7OA 3I5SA 2ESWA 4QT7A 2L3QA 1NLPC 3THKA 2O2OA 1M30A 1RI9A 4LUEA 4E6RA 2D0NA 4CC4B 2JS2A 4CC3A 4AG2C 1X6GA 2J06A 1VA7A 1NYGA 2W10A 3O5ZA 1CSKA 2EYZA 4Z88A 1K76A 3VS4A 2L3SA 5L23A 1X2QA 1SEMA 2JS0A 2RPNA 3I35A 5IHNA 4CC7A 2AZSA 3ULRB 4JJCA 2LNHB 2HDAA 4EIKA 2KXCA 1PHTA 2RN8A 2F2VA 2DRKA 1M8MA 1PRLC 2EGCA 2DL4A 2NWMA 1X2KA 3VS7A 1U3OA 1Z9ZA 1QKWA 2KYMA 2FO0A 1JO8A 2P4RA 2YSQA 4JJBA 1WIEA 2D1XA 1WFWA 3KFVA 4JPBW 3QWXX 1YWOA 2C0OA 4M4ZA 1ZUYA 3UA6A 1G83A 1GFCA 2A08A 2HBWA 1MV0B 1U5SA 4HVWA 2AKLA 2OJ2A 2D8JA 4AFQC 1N5ZA 1XOVA 2A28A 2JM8A 4LNPA 1KFZA 1X69A 4IIMA 1ARKA 2CUBA 2MOXA 1KJWA 1G2BA 2X3XD 2ENMA 3I5RA 4OMNA 4HVUA 3M0RA 4RTXA 1NEGA 1WX6A 2DJQA 1YCSB 1OPKA 3TSZA 1K0SA 2ROLA 3FJ5A 5IXFA 2EVRA 3GBQA 5IHKA 4F16A 1KSWA 2O31A 3VRZA 3UA7A 1W1FA 2ABLA 2CUDA 4HCKA 1T3LA 1X6BA 2GNCA 2EQIA 1IO6A 1Y0MA 4J9IA 1W70A 4ORZA 1GCQA 1JU5C 1ZUUA 4A63B 2HEQA 5I11A 1A0NB 4J9DA 4ESRA 2M0YA 4FSSA 4CC2A 1UHCA 1M3AA 2K79A 1NYFA 2YUQA 2GBQA 1WI7A 1WXUA 1X43A 2CDTA 2J6OA 2VWFA 1AZEA 2NUZA 2X3WD 3VS3A 3RBBB 4RUGA 1PNJA 2EYYA 1K0XA 2DYBA 2H8HA 2JT4A 2KRSA 2J6KA 2VKNA 2PZ1A 1WDXA 4GLMA 2KEAA 3TSWA 2JTEA 1GCPA 2K2MA 2PTKA 1WXTA 3I9QA 1UG1A 4DEYA 2M51A 1OOTA 2BZXA 2DBKA 2EW3A 4D8KA 1S1NA 2FG0A 2LJ0A 3H41A 1RLQC 3IQLA 1QLYA 3NPFA 2KRMA 2DX1A 2E5KA 2JXBA 1FMKA 2AZVA 1UTIA 4J9CA 4DEXA 1WLPB 3PE0A 2G6FX 4LUDA 1RUWA 3PVQA 1ZLMA 3REBB 1SHFA 2DNUA 1VYVA 1SRMA 1UFFA 2KNBB 4AG1C 2YT6A 5IXBA 1UECA 2GQIA 4AFSC 1I0CA 2I0NA 2DILA 2XMFA 1GFDA 1GL5A 3UATA 1MUZA 1JQQA 1WA7A 1V1CA 2DL8A 4WCIA 2F2WA 2RNAA 2RMOA 4OMOA 1M3CA 1SPKA 1I1JA 1WXBA 1JXMA 1YWPA 2C0IA 2RF0A 2J6FA 3U23A 4OMMA 2CSIA 4RTUA 3JV3A 4Z89A 2FRYA 3NMZC 4R0KA 1ZSGA 1BK2A 2DF6A 1AWXA 2ECZA 2K6DA 4JJDA 4GBQA 1TUCA 1AOJA 1E6GA 1Z9QA 4HVVA 1PKSA 1QCFA 1ZX6A 1AWWA 1NG2A 1H8KA 1HSQA 1T0HA 1CKBA 2CT4A 4RTVA 5FWCA 2DMOA 1SHGA 2KYBA 1QKXA 2BZYA 1M3BA
chains in the Genus database with same CATH superfamily
1WHLA 3BDUA 2CGHA 4EMGA 2VGMA 4JJNK 1VQNA 4EMKB 2K9GA 2E65A 5KE3A 4XTZA 1T3SA 1D1CA 5CKFA 1IREB 2F5KA 4C92F 4E7LA 3OA6A 5J39A 1EZZB 2DBMA 5GAOp 1YN8A 1WGSA 2DXBA 2JW4A 3EFRA 1QVGS 1GCQC 2COZA 1D0XA 2K7AA 1KD1C 3QWYA 1U1SA 5ECAA 3UF4A 1OULA 4J9HA 2LCSA 3META 4GLKA 2G3RA 1EX4A 1VQPT 1B3QA 3V7RA 4R55A 4J83A 2KE9A 2DLPA 1D09B 2M9UA 5EG2A 1OPLA 5KYUA 1B7TA 2V26A 3CCEA 2DL5A 2QG9B 2QA4T 1Y57A 1PKTA 3ZFJA 2LQWA 4XK8E 1HJDA 2W0ZA 4J8OA 2CKKA 5GJVB 3RNJA 1HYOA 2VC8A 2VVKA 5FRMA 2PNIA 3FB9A 1KQSS 1I07A 3D7SB 2QGFB 4EMKC 2BTTA 3I55A 3OY9A 2SEMA 1AVZC 1M2OA 2E70A 1K9MC 3QYGB 1Y7XA 2DE0X 1AZGB 3SFMA 2L2PA 2KXDA 2J7IA 4TVRA 3G1JA 2LCCA 2A36A 2DVEA 3GF5A 3CCRQ 4C8QA 2LJ1A 1X27A 1VQ8A 3EG3A 3CC7A 4BUGA 4XAXB 2DL3A 5GAMe 4LE9A 4M7AC 4IIOA 2JN0A 2M0OA 2CP3A 3EGXB 5GJWB 2MIOA 4EMHA 1BI2A 3SWNB 5D7UA 5GAOl 3CD6T 1NLOC 5GANg 4M7AF 2C0TA 1OEBA 1WYXA 1QWEA 1SRLA 2IIMA 3BY7A 3OQ5A 3I55Q 5LJ5g 2AKKA 1QW1A 2KBTA 2V1RA 4D8DA 2QEXQ 5IH2A 1UGPB 5LJ3e 2DD5A 1O75A 1YJNA 5HY6A 4L5GA 3QIIA 3E9FA 4HXJA 4EMKA 1CKAA 3CC4T 1BBZA 2EYQA 2HCKA 1X01A 1UGVA 1YI2T 4J9BA 1I5LA 5GMKe 3C0CA 4HCZA 1WHKA 1W2BS 2SRCA 1SG5A 2HQEA 3CXCP 3M0TA 3ASKA 2NUTA 1FMVA 1VQ7A 5I22A 3RKWA 2QQAA 4B6MA 2DIQA 4PJOB 4LD6A 2CH4W 2FPDA 2RQWA 2YXYA 3EFOA 1SF9A 1YCYA 3M0SA 2A37A 2QA4Q 3CD6A 1P92A 4QT7A 2L3QA 4AT1B 1NLPC 5HK0A 3FEOA 1N8RU 4LUEA 2BIVA 1M90U 4BI3A 1D1BA 3RMQA 1UGQB 1VQPQ 2JS2A 4JLIA 1VQMA 3PGGA 1X6GA 2J06A 4O5VA 2R5AA 1VA7A 2EWNA 2EYZA 3TREA 5I2SA 2L3SA 2XKOC 4FYXB 1UB4A 2KK4A 3C4SA 4A4GA 3I56T 4EIKA 3BW1A 3OYCA 4M7AG 2XDDA 1PHTA 2DRKA 3C94A 5GAN5 2DL4A 3JCMJ 1X2KA 4FYWB 1QKWA 3NTKA 4ELYC 3CCRT 1YJNT 2FO0A 1JO8A 4XU2A 1PCXA 2DETA 1N27A 2HBPA 4QVDA 1WIEA 2D1XA 3QWXX 4UC4A 1TOVA 1OQKA 2OTJQ 3OBYA 3LWIA 4M78D 4RCCA 1U5SA 4HVWA 2E1HA 1NJIU 3OYYA 2CP5A 2D8JA 4C0DC 3A8HB 3J7AF 1XOVA 2A28A 2EQMA 4LDYA 2JM8A 5LJ5j 2E6NA 4IIMA 3JCMh 4PJOC 4M7AB 3E2UA 1BIBA 1G2BA 2AIRB 2X3XD 5GAMf 2EQKA 3I5RA 3OSSC 1YHQT 3OW2P 3TCJA 4M7AA 3I56A 3TEEA 4LDWA 2ROLA 3S3OA 5IXFA 1WNLA 2EVRA 2JOYA 1BI0A 4OVAA 3JB9D 3RKXA 4KH0B 1VQ6T 3VYHB 3UA7A 3MHXA 4PKCC 5LL6S 1ZSZB 1YIJQ 4II1A 2ABLA 2CUDA 5CAIA 4XQ3A 1VQ6Q 2EQIA 1IO6A 1G3SA 4PJMA 4J7IA 1W70A 2L5QA 4JDSA 2EQJA 1GCQA 4ANJA 4C8QG 1ZUUA 4A63B 3CC4Q 1UEBA 4KGXB 2QTVA 4E7ZA 4FSSA 4CC2A 2K79A 1NYFA 2E5QA 5GMKh 1TH7A 4C92C 2OAUA 3PIOA 3CCQQ 4E7KA 2WSFE 5GAOq 1VQ7Q 2H8HA 2KRSA 4F7UG 2WACA 3QJYA 4IUUA 2XIDA 3HFNA 3TSWA 1XJWB 2CP0A 2JTEA 2IVWA 2QK0A 4PJNA 3LWHA 2RO0A 2P84A 2E41A 4F04B 3CBMA 3I9QA 3UT1A 4DEYA 1PG5B 2GFUA 4BE1A 4KULA 1NBEB 3HRUA 5CKDA 3JB9F 2DKGA 3L2WA 1ZSZC 3JCMX 1JJ2S 1QLYA 4DQ2A 2NYSA 1G5VA 1FMKA 4J9CA 4DEXA 1VQ9Q 2CYZB 3PE0A 4FT4A 3CCJA 1K8AU 2DAQA 2QQSA 3REBB 3HRSA 1UGRB 5GAOn 2JUFA 2XD0A 3MEWA 1SRMA 1YHQQ 5IXBA 1VQ9T 2FYKA 4AFSC 4M7DE 1YITA 1GL5A 1ZHIA 5CKEA 4FIBA 1KG1A 4AMCA 1QQJA 4OMOA 1M3CA 1WXBA 1KD1R 2J6FA 1Q82C 2HQHA 4RTUA 2HKQB 3QHSA 4M7DA 2K3YA 2IG0A 1AWXA 1VQ5T 3INZA 2KMTA 2RM4A 2DXTA 4JUVA 3I55T 1AOJA 1Z9QA 2HD0A 5KYNA 1OU8A 2X4WA 1WPYA 2QTXA 5FWCA 3KUFA 1ACMB 2DMOA 2D9TA 2WSEE 4M7DC 2R5MA 4M7DD 5J26A 3PVLA 3MO8A 2O9VA 4E47A 2C06A 4BE2A 2KY9A 2V1QA 4RTYA 3PTAA 1S72T 3JB9H 1UJ0A 4J6YA 1JJ2P 4X1VA 2QQ9A 2EJ9A 2JMAA 1IHVA 2XHCA 1EFNA 2Y90A 3EAEA 1PM3A 2YUNA 2QAZA 5FU6B 2LRQA 3CC4A 2LMJA 2DEQA 1W6XA 1TG0A 2J05A 3G4SA 2CP2A 2ED1A 2MYSA 1VQ5A 1UHFA 1YITT 1RLPC 3REAB 4YTLA 4NL3A 2F1LA 3CBOA 4PJOG 1VQ9A 3CMAQ 2QDLA 5CKHA 1M90R 4IUVA 3OYEA 4FU6A 1GBQA 1MNDA 2XK0A 3LX7A 3L2QA 2AK5A 3RMSA 4MZPA 2YUOA 2YUPA 3V8JA 3CCMT 3E9GA 2XDBA 2QI2A 1VQKT 3JSCA 4M77B 1K9MR 3SWNC 5KCOA 1X75C 4OF1A 2L0AA 1JEGA 2LJ3A 4K11A 4N0AC 2O01E 2DO3A 3C12A 3JB9G 2EQUA 3PFSA 5GANh 4N0AA 3OYFA 4V2SA 3CMEA 3EGDA 4XTUA 1K1ZA 2KRNA 1YNZA 3CCQA 2EKHA 2F2XA 3TQ7P 3CCUQ 2F5TX 3R6NA 3P8BB 5GAMg 5FWBA 2OI3A 4BACA 5LJ5h 1PD1A 1Q82R 3G7ZA 4BY6C 3EHRA 4FYYB 2K5FA 3EG0A 3MCAB 1OV3A 4OMQA 4PL6A 3NFCA 4RTWA 2V8IA 4OB1B 4HCBA 1QVFA 2FVUA 2FEIA 2P0KA 2DZCA 1PC0A 1KHIA 5I2MA 3RUXA 1K8AC 1UGSB 4JZ4A 1VYTA 3VYGA 1AWJA 3JAME 1U1TA 4M78E 3G71T 3QPHA 2VV5A 1N9SA 3JCMW 4J6WA 2P0QA 4JS4A 1HD3A 4OB3B 2KSSA 4A4EA 2DVJA 2KROA 3QKJA 4WF2A 1U06A 2DRMA 3CXCA 2MK5A 3G6EQ 1K4US 5D6WA 1IB8A 4A4KA 4M78F 4MDXA 5L8RE 5FU6C 1UJYA 3CQTA 2LTOA 2NUPA 2X4JA 3SHWA 4BI8B 3OMGA 1OU9A 4M77E 1O9SA 4C0GA 1FYNA 1JRIA 4LD9K 3A98A 4KUIA 2FZGB 4IKFA 4GY5A 3CCEQ 4IUTA 1VQKQ 2RQTA 3O8VA 2FL7A 4BY6B 2RQRA 4LN2A 4OMPA 2YRCA 1E7OA 3HSBA 2ESWA 1YHQA 3CPFA 2JNGA 3JCMf 3THKA 1M2VB 2O2OA 4QVCA 2D0NA 3V7CA 2QEXA 2HAXA 4CC3A 3J80E 3OYGA 4PFZA 4M75F 4J6XA 1NYGA 3S6WA 3DLMA 3CXCS 1LNXA 1CSKA 3CEYA 1K76A 3VS4A 5L23A 2XG8D 2HL5C 3PMIA 5CK9A 1SEMA 3P8DA 1YJWQ 2MF2A 2X4YA 5LJ3g 2X35A 1WQ7A 3L1AA 5A0LA 1VQMT 3QDFA 3CMAA 1Q81U 3JCMQ 4M7DB 2RN8A 1BI3A 1MHNA 2F2VA 1DJ7B 2FZCB 2EGCA 1Q81C 3VS7A 3M58A 1Z9ZA 3QSUA 2D6FA 2KYMA 3OBWA 3WXMB 4C5GA 2O4XB 3JCMP 2YSQA 3CD6Q 3RERA 1ZSZA 1WFWA 2ZPGB 1LPLA 2PUOB 3A8OB 1TU0B 2YLCA 4M4ZA 3KXTA 1G83A 1M9SA 2A08A 2JZ2A 2EAYA 2VXEA 2VYTA 1N5ZA 2FB7A 1XQHA 1ARKA 5IN1A 3OW2S 2ZAEA 2DD4A 4HT9A 4OMNA 1M2VA 1X6OA 2Y4XA 4NS5A 2PVOB 3BE3A 3A5ZB 4RTXA 4QQDA 3TSZA 1K0SA 1ZA2B 9ATCB 3BDLA 4LXCA 1KSWA 3ZEHA 2KDSA 1W1FA 5IAYA 3LGFA 2A0FB 1T3LA 2GNCA 4A4FA 1Y0MA 4J9IA 3MEUA 2LCLA 3OYMA 4DBRA 3CCSQ 2LQ8A 4M77A 5CO7A 4F7UB 3HKSA 3R6OA 1BIAA 2PVDB 4MDWA 3CCRA 2P0PA 3FIFA 1VQLA 2E12A 1WI7A 4PNOA 1X43A 1RAHB 3MEVA 4HT8A 3JB9I 2CDTA 2J6OA 5KYWA 2X3WD 1NE8A 1I5OB 5A0DA 1VQ4Q 4BB7A 4FW1A 1K0XA 1V76A 2DYBA 4A4HA 2JTFA 2BE7D 1M4ZA 2J6KA 2LT4A 1RADB 2PZ1A 2DERA 4A54A 1MGQA 3S3MA 2PVGB 2P4TA 1EIFA 4PJJA 1GCPA 3CCVQ 2PTKA 5GMKi 1W4SA 5FROA 1WXTA 2M51A 1YJ9T 4J7FA 2EW3A 4D8KA 1RACB 2FG0A 2LJ0A 3H41A 1RLQC 4PLIA 1QVGP 3ZBDA 1Q86C 1BCMA 2KRMA 2DXCA 1VUBA 2E5KA 2RJFA 2XICA 5M9OA 3OS1A 2M1HA 1Y07A 1MMGA 4LUDA 4N4IA 3PVQA 4N4HA 3CC2T 3SWNA 1ZA1B 1HXDA 2DNUA 4C92E 3UWNA 5GMKm 2YT6A 1QVFS 1UECA 3L2ZA 2I0NA 2DILA 3HTRA 1NPRA 2A7YA 1GFDA 3UATA 1JQQA 5CQXA 1WA7A 1G3TA 2QASA 2X4XA 1V1CA 1K73C 3V7SA 1U8RA 2PU9B 4FM4B 2RNAA 1QCNA 4C8QB 4PFOA 1SPKA 1I1JA 3CCLA 2COWA 2LT1A 2RF0A 2BKDN 2LQKA 4OMMA 4DBHA 4ZTJA 4DBQA 2DYIA 4CI0C 4Y28E 4R0KA 1ZBXA 5IT9E 3SB2A 2E64A 5CCAA 4JJDA 2BE9B 3VV0A 3M56A 3JCMc 1ZX6A 1RAFB 1H8KA 2FZKB 4ME7A 3EGDB 5GANf 2L8DA 2ZPHB 1CKBA 6AT1B 2RH2A 3OYKA 2RK2A 1SHGA 2KYBA 1QKXA 2BZYA 4FCYA 4C5IA 1M3BA 2RI5A 1ABQA 1GRIA 4J9GA 1ZUKA 2E4HA 3J81E 4BDYA 1ZBJA 3CMAT 4AFZC 3EGUA 2BZ8A 3AHUA 3NGPA 5GAMj 3M57A 4ZNXA 1YJ9A 2CREA 2DM1A 5GANe 1M1KU 3UPUA 1Q82U 2B86A 2EJFA 5GAN7 4XU3A 2OTLA 2GQVA 2FHDA 1QP3A 4FSXA 4WTOB 3VS5A 2FPEA 1VQ4T 1XTDA 3M53A 1AHJB 1D0YA 4X9DA 3JCMg 3OYLA 1UDLA 2I2LA 3OMCA 1IRXA 5IHIA 4JRKA 4KH1B 1PRMC 2K5LA 4NL2A 1AWOA 1YJ9Q 2LX9A 1UUEA 1Q86U 3EHQA 2XDPA 3L2UA 2O88A 1FMWA 2RQVA 2OTLQ 5D6YA 2KVQG 7AT1B 1WJSA 5GANj 3C95A 4RTZA 3VS1A 1NEBA 4N4GA 4OB0B 1PWTA 3VRYA 3EGXA 2MWOA 4HKEA 4C92A 2KR3A 3M59A 1OYXA 3CCMA 3A8GB 2EYWA 4OMFB 2WSCE 1WHHA 3EG1A 1VYUA 4E7IA 4OGCA 5CQYA 3QG1A 5LJ3j 2JMCA 1SSHA 4X34A 3MKDA 1YIJT 3G71Q 4DBFA 2RQUA 2LVMA 2ED0A 5KH6A 5DM7R 1KK7A 2DL7A 3JCMV 1QMCA 2K3BA 1TSFA 4JRIA 1BKBA 2QQBA 3OB9A 1Y71A 3JCMe 4RCBA 4AFUC 4OMLA 3OYAA 3HL8A 3M9QA 4Z8AA 1R77A 1BU1A 4F17A 3VS0A 4R56A 3MPUB 4NOYA 1RAGB 1KIKA 3HHTB 3CPWP 1Q95G 3VUZA 2LDMA 1NJIR 1QVPA 2EYXA 4C8QC 1YIJA 2MMPA 2KI7A 1M27C 3CCUA 3AT1B 8ATCB 3LH5A 5LJ3d 4F7UE 1VQOT 4MZTA 3DKMA 2IPOB 5FW9A 5KCHA 2VUBA 3PT9A 1N9RA 3ZL7C 4XU1A 3CCVA 3TVTA 4B9WA 2YDLA 1XNIA 2FPFA 2L3RA 3CMEQ 5KYYA 2LC4A 5GMKl 4J9EA 2JTMA 1VQNQ 2L3PA 3QYHB 3QBYA 2HSPA 3E19A 3QJ6A 3HRTA 2HKNA 4FW2A 2K4YA 2HL3A 3M5AA 5KE2A 2DPPB 1VQ8T 1AT1B 1RABB 3EG2A 1C0MA 2AT1B 1I8FA 1JXOA 1H3HA 2RD1A 2DJZA 4M75E 4KRTA 2CZ1B 3FC3A 1M1FA 1W2BA 1UE9A 1G3YA 3FRNA 1B07A 2K3XA 3CPWA 4J5YA 2QQRA 4ZN3A 1RI9A 4C0DB 3VKIA 2NUTB 2XI9A 4CC4B 3X24B 4AG2C 5GAMd 4M75D 3MEAA 2NLUA 4C8QD 2W10A 3O5ZA 4C8QF 1YJWA 5D6XA 3GNFB 4C5HA 3OYHA 1X2QA 1RL2A 5HK3A 2O4XA 2AZSA 3RESA 1TXQA 4JJCA 5GMKj 2R57A 2L89A 4PFPA 3FJPA 2NWMA 2P4RA 4E7HA 2E3HA 1OI1A 1R0CB 3KFVA 4JPBW 3OS2A 1YWOA 1Y96A 2C0OA 5DLQE 3GNGA 1GFCA 4HCCA 1WHGA 4RMOA 2HBWA 3GLXA 1MV0B 1VIEA 2CP7A 1F1BB 2YRVA 3CCLQ 2ZPEB 5KYXA 3JRZA 5KYYB 1KFZA 1MNEA 4EPCA 4IUQA 4Z02A 3ME9A 4IURA 5GAMh 1NEGA 4QVZA 4QKUA 2DJQA 2GCXA 2CZ0B 4QW2A 4A53A 4M78B 1VQNT 2RJEA 1LVKA 2O31A 3VRZA 3CMET 1QCOA 4JRPA 3OYBA 4KBMB 1YJWT 1VQ8Q 4M77G 1I81A 3QZ5B 1H3ZA 4KT0E 1K73R 5CKBA 2H3JA 3I56Q 1JU5C 2DXUA 1BI1A 1PD0A 1RI0A 2HEQA 5FU7C 5I11A 1K9MU 4J9DA 2PUKB 1UHCA 1M3AA 4FT2A 2YUQA 2XU8A 3L42A 2VWFA 1AZEA 4IUPA 1WJQA 2NUZA 3LW5E 3VS3A 5DLOA 1PNJA 2EYYA 3EFSA 1YFNA 5A2QE 4LDVA 2DZ9A 2RHIA 1V29B 1BYMA 2K2MA 2HZYA 4M7DG 2VASA 1UG1A 3A8LB 4M77C 1MMNA 2AHJB 3N5BB 3MP6A 1IZ6A 3IQLA 2RHYA 2RI3A 5C0MA 3NPFA 2DX1A 2JXBA 4OGEA 4M78G 2AZVA 1UTIA 4Q5WA 1WQWA 4ELZC 2G6FX 1KHCA 5LJ5e 4ZGDB 4C92D 2RHZA 5LJ5d 2BUDA 3OYIA 2K2VA 2KNBB 5GANd 2GQIA 2VXFA 1I0CA 4O6JA 1MUZA 4M78A 2DL8A 4WCIA 3GIBA 4B9XA 5LJ5f 2KAFA 3F70A 3OSVA 1JXMA 5C6SA 4MMKA 3U23A 1OZ2A 2CSIA 4E7SA 3EG9B 4EDUA 3CCET 3OYJA 1BK2A 1OX8A 2ECZA 2DFUA 1IXDA 4GBQA 4XU0A 3PIPA 1QCFA 1AWWA 1NG2A 1HSQA 3CCLT 3CC7T 1T0HA 1B34A 2R58A 1OZ3A 4ATOA 3CCMQ 1D1AA 2OTJT 1QVFP 1M1GA 1Y96B 3KBGA 2CT3A 2KGTA 2V8KA 1T0JA 2ROTA 3DB3A 3VUBA 1M5Q1 1WHJA 1YJNQ 5CR2A 1FXXA 3QZ9B 1W2BP 2Y4YA 1NM7A 2E6ZA 5J3BA 3VU3C 2GTOA 1J3TA 5CIUA 1K9AA 2QGGA 1R8OB 2LP5A 3CCUT 1QWFA 4C0FA 3E1SA 2CSQA 3FLGA 2RA2A 1TTHB 2E3IA 5CVIA 1VQLT 1M8VA 4BI4A 2MI6A 2RHXA 1N8RC 3M0PA 3X25B 2VGNA 3LGLA 1VOMA 4D6WA 3CBPA 2M02A 3LYIA 1KD1U 1ABOA 2RB6A 4XTVA 3M54A 2FRWA 2DTIA 2O9SA 3VS2A 1E6HA 4C0ZA 5HCKA 1OX9A 1KC8U 2GTJA 2HMAA 4FL6A 1VQPA 4RG2A 4VUBA 3RIRA 1LCKA 3H0IA 2F69A 2KT1A 3VS6A 2MPXC 2GFAA 2D0QB 2MAMA 2EGEA 5HKCA 4PJOE 3L2VA 1WHMA 2GF7A 2ZPFB 2CZ6B 4JZ3A 1D0ZA 2MWPA 4XTYA 4M77D 4PK4A 3QO3A 2RI2A 1JJ2A 3OW2A 2ZZDA 4OB2B 3ER0A 3GPLA 3T9NA 2DA9A 3WVDB 3M4YA 3Q1JA 4RG8A 2ZPIB 2CZ7B 2LX7A 3A8MB 2D8HA 1WZOA 3L2RA 1QVGA 2MCNA 3LLRA 3H0FA 1KQSP 2KQWA 3NHNA 4JRQA 3H9NA 1B34B 2ZPBB 2GGRA 4M77F 2RJCA 2HQXA 2LNVA 3DLLA 2ATCB 4E2FB 2VB6A 3CCQT 3H6ZA 3SEMA 1KC8R 2RK1A 2ZCFB 1VQMQ 1C6VX 5FU7B 5AYFA 3EFOB 1VQOQ 1H92A 1GXIE 1JBMA 5EC7A 4F14A 4PJOA 4Y91A 1G8XA 1VIFA 1YP5A 4P5NA 1TUDA 5I21A 1VQKA 2EBPA 1Q7YR 3OYDA 1LOJA 1MV3A 3TU4K 1HK9A 2YHTA 2LZ6B 4M75G 2EPDA 4C5EA 3NTHA 1IGUA 4RTTA 2Z0WA 2JJ9A 1BB9A 4FYVB 2JM9A 2ZGWA 1D3BB 3UDCA 3M0QA 3MJXA 4ZGEB 1AEYA 2CH4A 1VQLQ 4HA8A 1YI2Q 4XTWA 1NPPA 2HSEB 2OTJA 3CCVT 2OAWA 2LQNA 4KGVB 1GBRA 3OS5A 3M0UA 2EGAA 1VQ4A 1I4K1 2KT8A 3H0HA 2YWWA 4C8QE 4J9FA 4LDUA 4Y92A 1M1KR 4CRIA 3BFMA 1WJRA 1AD5A 2E10A 5DY9A 3I5SA 3MP8A 2QYZA 2HNIA 2EKOA 4M75B 1M30A 3EH1A 4E6RA 1TUGB 8AT1B 3CC2Q 1FWZA 5GAN6 3S3NA 2RHUA 1VQ5Q 3QXEB 3G4SQ 3QDRB 4Z88A 4RKUE 1NJIC 4M7AD 3RKYA 2JS0A 2RPNA 3I35A 1M90C 3G71A 1KC8C 5IHNA 4CC7A 2DTHA 3ULRB 2LNHB 2X9HA 1Q86R 4XTXA 1LJOA 2HDAA 1NZ9A 2KXCA 1VQ7T 3CC2A 3NTIA 4L6V5 5LJ3f 1M8MA 1PRLC 4QQGA 4F7UA 2B8AA 1U3OA 4JS5A 3RR6A 3P8HA 1K73U 1IGQA 4JJBA 3JCMd 5KYXB 1Q7YC 4KGZB 4F7UF 2K5IA 3M55A 1ZUYA 3UA6A 1MMDA 3MP1A 5GAOm 3CCST 4E7JA 3HP9A 4M7AE 2AKLA 1KQ1A 2OJ2A 3CPWS 4AFQC 5GAN3 4DA4A 1ZQ1A 4LNPA 1X69A 4BD3A 4DOVA 2CUBA 2MOXA 1KJWA 3GOXA 3CCSA 2ENMA 4M75A 2EFIA 3EH2A 2A3LA 2YLBA 4HVUA 3M0RA 3OYNA 1R0BG 1WX6A 2EIFA 1YCSB 1OPKA 3V8LA 2CS7A 1JB0E 3FJ5A 3GBQA 5IHKA 4F16A 1C1AA 3CCJT 4LDXA 2CP6A 1FX7A 4PLLA 2COYA 1VQOA 1SKUB 4HCKA 1X6BA 3CCJQ 2JVVA 2QA4A 3M4GA 2OX7A 2M16A 4DOWA 2X51A 3VJPA 4BDZA 4ORZA 2YRDA 3G4ST 3V8KA 1A0NB 4ESRA 2M0YA 3URGA 1KQ2A 3PNWC 1M1KC 3LH0A 2H3EB 2GBQA 1WXUA 5GAOr 3DB4A 4M75C 2DK3A 3RBBB 4RUGA 1MMAA 1RAEB 1RAIB 1G3WA 1S72Q 1D3BA 2QXFA 2JT4A 4M7DF 3G6EA 2VKNA 1WDXA 4GLMA 5KYWB 2KEAA 1N6AA 3QUIA 1SSFA 1PSFA 1N8RR 4QQ6A 1K8AR 2DIGA 1Q81R 1OOTA 2BZXA 2DBKA 1S1NA 2DTOA 3X20B 1IHWA 3A1PA 5A0GA 5FLXE 4ZN1A 5GAN2 4OP0A 1KQSA 3JCMb 1WLPB 3FDRA 1TS9A 3X28B 2QDYB 4X9CA 5GAN4 1VQ6A 1RUWA 1TWBA 4M78C 5FRNA 1ZLMA 4ZTFA 1SHFA 4BE0A 1VYVA 1UFFA 3G6ET 4AG1C 3CC7Q 2NUPB 2XMFA 2PQWA 4ZGJB 2K57A 4PJOD 1YITQ 3HFOA 3WVEB 2F2WA 2RMOA 5AT1B 3EG9A 4JLGA 2RJDA 3H8ZA 3RDVA 4MMLA 1YWPA 2C0IA 5KYUB 4MZMA 3PMTA 2EJGA 1YI2A 3X26B 3JV3A 4Z89A 1H641 1YBYA 2FRYA 2OTLT 3NMZC 1PSEA 1ZSGA 2DF6A 1QP2A 1RAAB 1BCOA 2K6DA 2V8JA 4C92G 1TUCA 1E6GA 4HVVA 1PKSA 3HPWA 2QEXT 5GAN8 4L59A 5LJ3h 4PJOF 3SD4A 4PJLA 2CT4A 4RTVA 2DEUA 4KUDK 3JB9J 1S72A 1Q7YU 3SDZA 3OS0A 3GP8A 4C92B
chains in the Genus database with same CATH topology
1ABQA 1GRIA 4J9GA 1ZUKA 2CT3A 1ZBJA 2KGTA 2K9GA 3PVLA 1T0JA 2ROTA 1T3SA 4AFZC 2O9VA 3EGUA 2BZ8A 2V1QA 4RTYA 3NGPA 4ZNXA 2CREA 2DM1A 2B86A 1UJ0A 2DBMA 1YN8A 2JW4A 4X1VA 1NM7A 1GCQC 3VS5A 2JMAA 2GTOA 1J3TA 1EFNA 2K7AA 1K9AA 2FPEA 3QWYA 2LP5A 5ECAA 2YUNA 3UF4A 1QWFA 2LMJA 4J9HA 1W6XA 1TG0A 2J05A 2LCSA 2ED1A 1UDLA 1UHFA 1RLPC 2CSQA 3REAB 5IHIA 1B3QA 3M0PA 2QDLA 1PRMC 1AWOA 2KE9A 1GBQA 2DLPA 1UUEA 2AK5A 1ABOA 2YUOA 2YUPA 1OPLA 2FRWA 2O9SA 3EHQA 3VS2A 1E6HA 2DL5A 2O88A 2RQVA 5HCKA 2L0AA 1JEGA 2GTJA 2LJ3A 1Y57A 4K11A 1PKTA 2LQWA 4RTZA 1LCKA 3H0IA 3VS1A 1HJDA 2W0ZA 2KT1A 1NEBA 3VS6A 1PWTA 5GJVB 3VRYA 2EGEA 2KR3A 3RNJA 1K1ZA 2VVKA 2EYWA 2PNIA 2KRNA 4JZ3A 1YNZA 2EKHA 2F2XA 1VYUA 1I07A 3EG1A 2BTTA 2JMCA 1SSHA 2SEMA 3R6NA 2DA9A 5FWBA 1AVZC 2OI3A 2RQUA 2ED0A 2DL7A 2LX7A 2DE0X 1AZGB 2L2PA 2D8HA 2K3BA 2KXDA 3EHRA 2J7IA 2MCNA 3EG0A 1OV3A 3H0FA 4OMQA 4RTWA 3NHNA 2A36A 2FEIA 4AFUC 2LJ1A 1X27A 4OMLA 2GGRA 3EG3A 4Z8AA 1BU1A 2DL3A 4F17A 3VS0A 4LE9A 1KIKA 4IIOA 4JZ4A 2EYXA 5GJWB 2MIOA 3SEMA 1VYTA 1AWJA 1NLOC 2C0TA 1OEBA 1WYXA 1QWEA 1H92A 1SRLA 2IIMA 1M27C 1HD3A 2AKKA 5EC7A 4F14A 2KBTA 2V1RA 3LH5A 1YP5A 4D8DA 2DVJA 2KROA 5IH2A 5FW9A 1TUDA 2EBPA 1U06A 3ZL7C 3TVTA 2YDLA 4HXJA 2DRMA 1MV3A 2FPFA 2LZ6B 2EPDA 1CKAA 4J9EA 1K4US 1BBZA 4RTTA 1BB9A 2HCKA 2L3PA 2JM9A 1UGVA 2HSPA 3M0QA 1UJYA 3CQTA 3SHWA 4J9BA 1AEYA 2CH4A 3C0CA 1FYNA 2SRCA 2OAWA 2LQNA 3M0TA 1GBRA 3EG2A 5I22A 3A98A 3M0UA 2EGAA 1JXOA 2KT8A 3H0HA 1H3HA 4J9FA 4Y92A 2CH4W 2FPDA 2RQTA 2RQWA 4KRTA 1UE9A 2RQRA 4LN2A 3M0SA 2A37A 1AD5A 1B07A 4OMPA 1E7OA 3I5SA 2ESWA 4QT7A 2L3QA 1NLPC 3THKA 2O2OA 1M30A 1RI9A 4LUEA 4E6RA 2D0NA 4CC4B 2JS2A 4CC3A 4AG2C 1X6GA 2J06A 1VA7A 1NYGA 2W10A 3O5ZA 1CSKA 2EYZA 4Z88A 1K76A 3VS4A 2L3SA 5L23A 1X2QA 1SEMA 2JS0A 2RPNA 3I35A 5IHNA 4CC7A 2AZSA 3ULRB 4JJCA 2LNHB 2HDAA 4EIKA 2KXCA 1PHTA 2RN8A 2F2VA 2DRKA 1M8MA 1PRLC 2EGCA 2DL4A 2NWMA 1X2KA 3VS7A 1U3OA 1Z9ZA 1QKWA 2KYMA 2FO0A 1JO8A 2P4RA 2YSQA 4JJBA 1WIEA 2D1XA 1WFWA 3KFVA 4JPBW 3QWXX 1YWOA 2C0OA 4M4ZA 1ZUYA 3UA6A 1G83A 1GFCA 2A08A 2HBWA 1MV0B 1U5SA 4HVWA 2AKLA 2OJ2A 2D8JA 4AFQC 1N5ZA 1XOVA 2A28A 2JM8A 4LNPA 1KFZA 1X69A 4IIMA 1ARKA 2CUBA 2MOXA 1KJWA 1G2BA 2X3XD 2ENMA 3I5RA 4OMNA 4HVUA 3M0RA 4RTXA 1NEGA 1WX6A 2DJQA 1YCSB 1OPKA 3TSZA 1K0SA 2ROLA 3FJ5A 5IXFA 2EVRA 3GBQA 5IHKA 4F16A 1KSWA 2O31A 3VRZA 3UA7A 1W1FA 2ABLA 2CUDA 4HCKA 1T3LA 1X6BA 2GNCA 2EQIA 1IO6A 1Y0MA 4J9IA 1W70A 4ORZA 1GCQA 1JU5C 1ZUUA 4A63B 2HEQA 5I11A 1A0NB 4J9DA 4ESRA 2M0YA 4FSSA 4CC2A 1UHCA 1M3AA 2K79A 1NYFA 2YUQA 2GBQA 1WI7A 1WXUA 1X43A 2CDTA 2J6OA 2VWFA 1AZEA 2NUZA 2X3WD 3VS3A 3RBBB 4RUGA 1PNJA 2EYYA 1K0XA 2DYBA 2H8HA 2JT4A 2KRSA 2J6KA 2VKNA 2PZ1A 1WDXA 4GLMA 2KEAA 3TSWA 2JTEA 1GCPA 2K2MA 2PTKA 1WXTA 3I9QA 1UG1A 4DEYA 2M51A 1OOTA 2BZXA 2DBKA 2EW3A 4D8KA 1S1NA 2FG0A 2LJ0A 3H41A 1RLQC 3IQLA 1QLYA 3NPFA 2KRMA 2DX1A 2E5KA 2JXBA 1FMKA 2AZVA 1UTIA 4J9CA 4DEXA 1WLPB 3PE0A 2G6FX 4LUDA 1RUWA 3PVQA 1ZLMA 3REBB 1SHFA 2DNUA 1VYVA 1SRMA 1UFFA 2KNBB 4AG1C 2YT6A 5IXBA 1UECA 2GQIA 4AFSC 1I0CA 2I0NA 2DILA 2XMFA 1GFDA 1GL5A 3UATA 1MUZA 1JQQA 1WA7A 1V1CA 2DL8A 4WCIA 2F2WA 2RNAA 2RMOA 4OMOA 1M3CA 1SPKA 1I1JA 1WXBA 1JXMA 1YWPA 2C0IA 2RF0A 2J6FA 3U23A 4OMMA 2CSIA 4RTUA 3JV3A 4Z89A 2FRYA 3NMZC 4R0KA 1ZSGA 1BK2A 2DF6A 1AWXA 2ECZA 2K6DA 4JJDA 4GBQA 1TUCA 1AOJA 1E6GA 1Z9QA 4HVVA 1PKSA 1QCFA 1ZX6A 1AWWA 1NG2A 1H8KA 1HSQA 1T0HA 1CKBA 2CT4A 4RTVA 5FWCA 2DMOA 1SHGA 2KYBA 1QKXA 2BZYA 1M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ABQ A;  1GRI A;  4J9G A;  1ZUK A;  2CT3 A;  1ZBJ A;  2KGT A;  2K9G A;  3PVL A;  1T0J A;  2ROT A;  1T3S A;  4AFZ C;  2O9V A;  3EGU A;  2BZ8 A;  2V1Q A;  4RTY A;  3NGP A;  4ZNX A;  2CRE A;  2DM1 A;  2B86 A;  1UJ0 A;  2DBM A;  1YN8 A;  2JW4 A;  4X1V A;  1NM7 A;  1GCQ C;  3VS5 A;  2JMA A;  2GTO A;  1J3T A;  1EFN A;  2K7A A;  1K9A A;  2FPE A;  3QWY A;  2LP5 A;  5ECA A;  2YUN A;  3UF4 A;  1QWF A;  2LMJ A;  4J9H A;  1W6X A;  1TG0 A;  2J05 A;  2LCS A;  2ED1 A;  1UDL A;  1UHF A;  1RLP C;  2CSQ A;  3REA B;  5IHI A;  1B3Q A;  3M0P A;  2QDL A;  1PRM C;  1AWO A;  2KE9 A;  1GBQ A;  2DLP A;  1UUE A;  2AK5 A;  1ABO A;  2YUO A;  2YUP A;  1OPL A;  2FRW A;  2O9S A;  3EHQ A;  3VS2 A;  1E6H A;  2DL5 A;  2O88 A;  2RQV A;  5HCK A;  2L0A A;  1JEG A;  2GTJ A;  2LJ3 A;  1Y57 A;  4K11 A;  1PKT A;  2LQW A;  4RTZ A;  1LCK A;  3H0I A;  3VS1 A;  1HJD A;  2W0Z A;  2KT1 A;  1NEB A;  3VS6 A;  1PWT A;  5GJV B;  3VRY A;  2EGE A;  2KR3 A;  3RNJ A;  1K1Z A;  2VVK A;  2EYW A;  2PNI A;  2KRN A;  4JZ3 A;  1YNZ A;  2EKH A;  2F2X A;  1VYU A;  1I07 A;  3EG1 A;  2BTT A;  2JMC A;  1SSH A;  2SEM A;  3R6N A;  2DA9 A;  5FWB A;  1AVZ C;  2OI3 A;  2RQU A;  2ED0 A;  2DL7 A;  2LX7 A;  2DE0 X;  1AZG B;  2L2P A;  2D8H A;  2K3B A;  2KXD A;  3EHR A;  2J7I A;  2MCN A;  3EG0 A;  1OV3 A;  3H0F A;  4OMQ A;  4RTW A;  3NHN A;  2A36 A;  2FEI A;  4AFU C;  2LJ1 A;  1X27 A;  4OML A;  2GGR A;  3EG3 A;  4Z8A A;  1BU1 A;  2DL3 A;  4F17 A;  3VS0 A;  4LE9 A;  1KIK A;  4IIO A;  4JZ4 A;  2EYX A;  5GJW B;  2MIO A;  3SEM A;  1VYT A;  1AWJ A;  1NLO C;  2C0T A;  1OEB A;  1WYX A;  1QWE A;  1H92 A;  1SRL A;  2IIM A;  1M27 C;  1HD3 A;  2AKK A;  5EC7 A;  4F14 A;  2KBT A;  2V1R A;  3LH5 A;  1YP5 A;  4D8D A;  2DVJ A;  2KRO A;  5IH2 A;  5FW9 A;  1TUD A;  2EBP A;  1U06 A;  3ZL7 C;  3TVT A;  2YDL A;  4HXJ A;  2DRM A;  1MV3 A;  2FPF A;  2LZ6 B;  2EPD A;  1CKA A;  4J9E A;  1K4U S;  1BBZ A;  4RTT A;  1BB9 A;  2HCK A;  2L3P A;  2JM9 A;  1UGV A;  2HSP A;  3M0Q A;  1UJY A;  3CQT A;  3SHW A;  4J9B A;  1AEY A;  2CH4 A;  3C0C A;  1FYN A;  2SRC A;  2OAW A;  2LQN A;  3M0T A;  1GBR A;  3EG2 A;  5I22 A;  3A98 A;  3M0U A;  2EGA A;  1JXO A;  2KT8 A;  3H0H A;  1H3H A;  4J9F A;  4Y92 A;  2CH4 W;  2FPD A;  2RQT A;  2RQW A;  4KRT A;  1UE9 A;  2RQR A;  4LN2 A;  3M0S A;  2A37 A;  1AD5 A;  1B07 A;  4OMP A;  1E7O A;  3I5S A;  2ESW A;  4QT7 A;  2L3Q A;  1NLP C;  3THK A;  2O2O A;  1M30 A;  1RI9 A;  4LUE A;  4E6R A;  2D0N A;  4CC4 B;  2JS2 A;  4CC3 A;  4AG2 C;  1X6G A;  2J06 A;  1VA7 A;  1NYG A;  2W10 A;  3O5Z A;  1CSK A;  2EYZ A;  4Z88 A;  1K76 A;  3VS4 A;  2L3S A;  5L23 A;  1X2Q A;  1SEM A;  2JS0 A;  2RPN A;  3I35 A;  5IHN A;  4CC7 A;  2AZS A;  3ULR B;  4JJC A;  2LNH B;  2HDA A;  4EIK A;  2KXC A;  1PHT A;  2RN8 A;  2F2V A;  2DRK A;  1M8M A;  1PRL C;  2EGC A;  2DL4 A;  2NWM A;  1X2K A;  3VS7 A;  1U3O A;  1Z9Z A;  1QKW A;  2KYM A;  2FO0 A;  1JO8 A;  2P4R A;  2YSQ A;  4JJB A;  1WIE A;  2D1X A;  1WFW A;  3KFV A;  4JPB W;  3QWX X;  1YWO A;  2C0O A;  4M4Z A;  1ZUY A;  3UA6 A;  1G83 A;  1GFC A;  2A08 A;  2HBW A;  1MV0 B;  1U5S A;  4HVW A;  2AKL A;  2OJ2 A;  2D8J A;  4AFQ C;  1N5Z A;  1XOV A;  2A28 A;  2JM8 A;  4LNP A;  1KFZ A;  1X69 A;  4IIM A;  1ARK A;  2CUB A;  2MOX A;  1KJW A;  1G2B A;  2X3X D;  2ENM A;  3I5R A;  4OMN A;  4HVU A;  3M0R A;  4RTX A;  1NEG A;  1WX6 A;  2DJQ A;  1YCS B;  1OPK A;  3TSZ A;  1K0S A;  2ROL A;  3FJ5 A;  5IXF A;  2EVR A;  3GBQ A;  5IHK A;  4F16 A;  1KSW A;  2O31 A;  3VRZ A;  3UA7 A;  1W1F A;  2ABL A;  2CUD A;  4HCK A;  1T3L A;  1X6B A;  2GNC A;  2EQI A;  1IO6 A;  1Y0M A;  4J9I A;  1W70 A;  4ORZ A;  1GCQ A;  1JU5 C;  1ZUU A;  4A63 B;  2HEQ A;  5I11 A;  1A0N B;  4J9D A;  4ESR A;  2M0Y A;  4FSS A;  4CC2 A;  1UHC A;  1M3A A;  2K79 A;  1NYF A;  2YUQ A;  2GBQ A;  1WI7 A;  1WXU A;  1X43 A;  2CDT A;  2J6O A;  2VWF A;  1AZE A;  2NUZ A;  2X3W D;  3VS3 A;  3RBB B;  4RUG A;  1PNJ A;  2EYY A;  1K0X A;  2DYB A;  2H8H A;  2JT4 A;  2KRS A;  2J6K A;  2VKN A;  2PZ1 A;  1WDX A;  4GLM A;  2KEA A;  3TSW A;  2JTE A;  1GCP A;  2K2M A;  2PTK A;  1WXT A;  3I9Q A;  1UG1 A;  4DEY A;  2M51 A;  1OOT A;  2BZX A;  2DBK A;  2EW3 A;  4D8K A;  1S1N A;  2FG0 A;  2LJ0 A;  3H41 A;  1RLQ C;  3IQL A;  1QLY A;  3NPF A;  2KRM A;  2DX1 A;  2E5K A;  2JXB A;  1FMK A;  2AZV A;  1UTI A;  4J9C A;  4DEX A;  1WLP B;  3PE0 A;  2G6F X;  4LUD A;  1RUW A;  3PVQ A;  1ZLM A;  3REB B;  1SHF A;  2DNU A;  1VYV A;  1SRM A;  1UFF A;  2KNB B;  4AG1 C;  2YT6 A;  5IXB A;  1UEC A;  2GQI A;  4AFS C;  1I0C A;  2I0N A;  2DIL A;  2XMF A;  1GFD A;  1GL5 A;  3UAT A;  1MUZ A;  1JQQ A;  1WA7 A;  1V1C A;  2DL8 A;  4WCI A;  2F2W A;  2RNA A;  2RMO A;  4OMO A;  1M3C A;  1SPK A;  1I1J A;  1WXB A;  1JXM A;  1YWP A;  2C0I A;  2RF0 A;  2J6F A;  3U23 A;  4OMM A;  2CSI A;  4RTU A;  3JV3 A;  4Z89 A;  2FRY A;  3NMZ C;  4R0K A;  1ZSG A;  1BK2 A;  2DF6 A;  1AWX A;  2ECZ A;  2K6D A;  4JJD A;  4GBQ A;  1TUC A;  1AOJ A;  1E6G A;  1Z9Q A;  4HVV A;  1PKS A;  1QCF A;  1ZX6 A;  1AWW A;  1NG2 A;  1H8K A;  1HSQ A;  1T0H A;  1CKB A;  2CT4 A;  4RTV A;  5FWC A;  2DMO A;  1SHG A;  2KYB A;  1QKX A;  2BZY A;  1M3B A; 
#chains in the Genus database with same CATH topology
 1WHL A;  3BDU A;  2CGH A;  4EMG A;  2VGM A;  4JJN K;  1VQN A;  4EMK B;  2K9G A;  2E65 A;  5KE3 A;  4XTZ A;  1T3S A;  1D1C A;  5CKF A;  1IRE B;  2F5K A;  4C92 F;  4E7L A;  3OA6 A;  5J39 A;  1EZZ B;  2DBM A;  5GAO p;  1YN8 A;  1WGS A;  2DXB A;  2JW4 A;  3EFR A;  1QVG S;  1GCQ C;  2COZ A;  1D0X A;  2K7A A;  1KD1 C;  3QWY A;  1U1S A;  5ECA A;  3UF4 A;  1OUL A;  4J9H A;  2LCS A;  3MET A;  4GLK A;  2G3R A;  1EX4 A;  1VQP T;  1B3Q A;  3V7R A;  4R55 A;  4J83 A;  2KE9 A;  2DLP A;  1D09 B;  2M9U A;  5EG2 A;  1OPL A;  5KYU A;  1B7T A;  2V26 A;  3CCE A;  2DL5 A;  2QG9 B;  2QA4 T;  1Y57 A;  1PKT A;  3ZFJ A;  2LQW A;  4XK8 E;  1HJD A;  2W0Z A;  4J8O A;  2CKK A;  5GJV B;  3RNJ A;  1HYO A;  2VC8 A;  2VVK A;  5FRM A;  2PNI A;  3FB9 A;  1KQS S;  1I07 A;  3D7S B;  2QGF B;  4EMK C;  2BTT A;  3I55 A;  3OY9 A;  2SEM A;  1AVZ C;  1M2O A;  2E70 A;  1K9M C;  3QYG B;  1Y7X A;  2DE0 X;  1AZG B;  3SFM A;  2L2P A;  2KXD A;  2J7I A;  4TVR A;  3G1J A;  2LCC A;  2A36 A;  2DVE A;  3GF5 A;  3CCR Q;  4C8Q A;  2LJ1 A;  1X27 A;  1VQ8 A;  3EG3 A;  3CC7 A;  4BUG A;  4XAX B;  2DL3 A;  5GAM e;  4LE9 A;  4M7A C;  4IIO A;  2JN0 A;  2M0O A;  2CP3 A;  3EGX B;  5GJW B;  2MIO A;  4EMH A;  1BI2 A;  3SWN B;  5D7U A;  5GAO l;  3CD6 T;  1NLO C;  5GAN g;  4M7A F;  2C0T A;  1OEB A;  1WYX A;  1QWE A;  1SRL A;  2IIM A;  3BY7 A;  3OQ5 A;  3I55 Q;  5LJ5 g;  2AKK A;  1QW1 A;  2KBT A;  2V1R A;  4D8D A;  2QEX Q;  5IH2 A;  1UGP B;  5LJ3 e;  2DD5 A;  1O75 A;  1YJN A;  5HY6 A;  4L5G A;  3QII A;  3E9F A;  4HXJ A;  4EMK A;  1CKA A;  3CC4 T;  1BBZ A;  2EYQ A;  2HCK A;  1X01 A;  1UGV A;  1YI2 T;  4J9B A;  1I5L A;  5GMK e;  3C0C A;  4HCZ A;  1WHK A;  1W2B S;  2SRC A;  1SG5 A;  2HQE A;  3CXC P;  3M0T A;  3ASK A;  2NUT A;  1FMV A;  1VQ7 A;  5I22 A;  3RKW A;  2QQA A;  4B6M A;  2DIQ A;  4PJO B;  4LD6 A;  2CH4 W;  2FPD A;  2RQW A;  2YXY A;  3EFO A;  1SF9 A;  1YCY A;  3M0S A;  2A37 A;  2QA4 Q;  3CD6 A;  1P92 A;  4QT7 A;  2L3Q A;  4AT1 B;  1NLP C;  5HK0 A;  3FEO A;  1N8R U;  4LUE A;  2BIV A;  1M90 U;  4BI3 A;  1D1B A;  3RMQ A;  1UGQ B;  1VQP Q;  2JS2 A;  4JLI A;  1VQM A;  3PGG A;  1X6G A;  2J06 A;  4O5V A;  2R5A A;  1VA7 A;  2EWN A;  2EYZ A;  3TRE A;  5I2S A;  2L3S A;  2XKO C;  4FYX B;  1UB4 A;  2KK4 A;  3C4S A;  4A4G A;  3I56 T;  4EIK A;  3BW1 A;  3OYC A;  4M7A G;  2XDD A;  1PHT A;  2DRK A;  3C94 A;  5GAN 5;  2DL4 A;  3JCM J;  1X2K A;  4FYW B;  1QKW A;  3NTK A;  4ELY C;  3CCR T;  1YJN T;  2FO0 A;  1JO8 A;  4XU2 A;  1PCX A;  2DET A;  1N27 A;  2HBP A;  4QVD A;  1WIE A;  2D1X A;  3QWX X;  4UC4 A;  1TOV A;  1OQK A;  2OTJ Q;  3OBY A;  3LWI A;  4M78 D;  4RCC A;  1U5S A;  4HVW A;  2E1H A;  1NJI U;  3OYY A;  2CP5 A;  2D8J A;  4C0D C;  3A8H B;  3J7A F;  1XOV A;  2A28 A;  2EQM A;  4LDY A;  2JM8 A;  5LJ5 j;  2E6N A;  4IIM A;  3JCM h;  4PJO C;  4M7A B;  3E2U A;  1BIB A;  1G2B A;  2AIR B;  2X3X D;  5GAM f;  2EQK A;  3I5R A;  3OSS C;  1YHQ T;  3OW2 P;  3TCJ A;  4M7A A;  3I56 A;  3TEE A;  4LDW A;  2ROL A;  3S3O A;  5IXF A;  1WNL A;  2EVR A;  2JOY A;  1BI0 A;  4OVA A;  3JB9 D;  3RKX A;  4KH0 B;  1VQ6 T;  3VYH B;  3UA7 A;  3MHX A;  4PKC C;  5LL6 S;  1ZSZ B;  1YIJ Q;  4II1 A;  2ABL A;  2CUD A;  5CAI A;  4XQ3 A;  1VQ6 Q;  2EQI A;  1IO6 A;  1G3S A;  4PJM A;  4J7I A;  1W70 A;  2L5Q A;  4JDS A;  2EQJ A;  1GCQ A;  4ANJ A;  4C8Q G;  1ZUU A;  4A63 B;  3CC4 Q;  1UEB A;  4KGX B;  2QTV A;  4E7Z A;  4FSS A;  4CC2 A;  2K79 A;  1NYF A;  2E5Q A;  5GMK h;  1TH7 A;  4C92 C;  2OAU A;  3PIO A;  3CCQ Q;  4E7K A;  2WSF E;  5GAO q;  1VQ7 Q;  2H8H A;  2KRS A;  4F7U G;  2WAC A;  3QJY A;  4IUU A;  2XID A;  3HFN A;  3TSW A;  1XJW B;  2CP0 A;  2JTE A;  2IVW A;  2QK0 A;  4PJN A;  3LWH A;  2RO0 A;  2P84 A;  2E41 A;  4F04 B;  3CBM A;  3I9Q A;  3UT1 A;  4DEY A;  1PG5 B;  2GFU A;  4BE1 A;  4KUL A;  1NBE B;  3HRU A;  5CKD A;  3JB9 F;  2DKG A;  3L2W A;  1ZSZ C;  3JCM X;  1JJ2 S;  1QLY A;  4DQ2 A;  2NYS A;  1G5V A;  1FMK A;  4J9C A;  4DEX A;  1VQ9 Q;  2CYZ B;  3PE0 A;  4FT4 A;  3CCJ A;  1K8A U;  2DAQ A;  2QQS A;  3REB B;  3HRS A;  1UGR B;  5GAO n;  2JUF A;  2XD0 A;  3MEW A;  1SRM A;  1YHQ Q;  5IXB A;  1VQ9 T;  2FYK A;  4AFS C;  4M7D E;  1YIT A;  1GL5 A;  1ZHI A;  5CKE A;  4FIB A;  1KG1 A;  4AMC A;  1QQJ A;  4OMO A;  1M3C A;  1WXB A;  1KD1 R;  2J6F A;  1Q82 C;  2HQH A;  4RTU A;  2HKQ B;  3QHS A;  4M7D A;  2K3Y A;  2IG0 A;  1AWX A;  1VQ5 T;  3INZ A;  2KMT A;  2RM4 A;  2DXT A;  4JUV A;  3I55 T;  1AOJ A;  1Z9Q A;  2HD0 A;  5KYN A;  1OU8 A;  2X4W A;  1WPY A;  2QTX A;  5FWC A;  3KUF A;  1ACM B;  2DMO A;  2D9T A;  2WSE E;  4M7D C;  2R5M A;  4M7D D;  5J26 A;  3PVL A;  3MO8 A;  2O9V A;  4E47 A;  2C06 A;  4BE2 A;  2KY9 A;  2V1Q A;  4RTY A;  3PTA A;  1S72 T;  3JB9 H;  1UJ0 A;  4J6Y A;  1JJ2 P;  4X1V A;  2QQ9 A;  2EJ9 A;  2JMA A;  1IHV A;  2XHC A;  1EFN A;  2Y90 A;  3EAE A;  1PM3 A;  2YUN A;  2QAZ A;  5FU6 B;  2LRQ A;  3CC4 A;  2LMJ A;  2DEQ A;  1W6X A;  1TG0 A;  2J05 A;  3G4S A;  2CP2 A;  2ED1 A;  2MYS A;  1VQ5 A;  1UHF A;  1YIT T;  1RLP C;  3REA B;  4YTL A;  4NL3 A;  2F1L A;  3CBO A;  4PJO G;  1VQ9 A;  3CMA Q;  2QDL A;  5CKH A;  1M90 R;  4IUV A;  3OYE A;  4FU6 A;  1GBQ A;  1MND A;  2XK0 A;  3LX7 A;  3L2Q A;  2AK5 A;  3RMS A;  4MZP A;  2YUO A;  2YUP A;  3V8J A;  3CCM T;  3E9G A;  2XDB A;  2QI2 A;  1VQK T;  3JSC A;  4M77 B;  1K9M R;  3SWN C;  5KCO A;  1X75 C;  4OF1 A;  2L0A A;  1JEG A;  2LJ3 A;  4K11 A;  4N0A C;  2O01 E;  2DO3 A;  3C12 A;  3JB9 G;  2EQU A;  3PFS A;  5GAN h;  4N0A A;  3OYF A;  4V2S A;  3CME A;  3EGD A;  4XTU A;  1K1Z A;  2KRN A;  1YNZ A;  3CCQ A;  2EKH A;  2F2X A;  3TQ7 P;  3CCU Q;  2F5T X;  3R6N A;  3P8B B;  5GAM g;  5FWB A;  2OI3 A;  4BAC A;  5LJ5 h;  1PD1 A;  1Q82 R;  3G7Z A;  4BY6 C;  3EHR A;  4FYY B;  2K5F A;  3EG0 A;  3MCA B;  1OV3 A;  4OMQ A;  4PL6 A;  3NFC A;  4RTW A;  2V8I A;  4OB1 B;  4HCB A;  1QVF A;  2FVU A;  2FEI A;  2P0K A;  2DZC A;  1PC0 A;  1KHI A;  5I2M A;  3RUX A;  1K8A C;  1UGS B;  4JZ4 A;  1VYT A;  3VYG A;  1AWJ A;  3JAM E;  1U1T A;  4M78 E;  3G71 T;  3QPH A;  2VV5 A;  1N9S A;  3JCM W;  4J6W A;  2P0Q A;  4JS4 A;  1HD3 A;  4OB3 B;  2KSS A;  4A4E A;  2DVJ A;  2KRO A;  3QKJ A;  4WF2 A;  1U06 A;  2DRM A;  3CXC A;  2MK5 A;  3G6E Q;  1K4U S;  5D6W A;  1IB8 A;  4A4K A;  4M78 F;  4MDX A;  5L8R E;  5FU6 C;  1UJY A;  3CQT A;  2LTO A;  2NUP A;  2X4J A;  3SHW A;  4BI8 B;  3OMG A;  1OU9 A;  4M77 E;  1O9S A;  4C0G A;  1FYN A;  1JRI A;  4LD9 K;  3A98 A;  4KUI A;  2FZG B;  4IKF A;  4GY5 A;  3CCE Q;  4IUT A;  1VQK Q;  2RQT A;  3O8V A;  2FL7 A;  4BY6 B;  2RQR A;  4LN2 A;  4OMP A;  2YRC A;  1E7O A;  3HSB A;  2ESW A;  1YHQ A;  3CPF A;  2JNG A;  3JCM f;  3THK A;  1M2V B;  2O2O A;  4QVC A;  2D0N A;  3V7C A;  2QEX A;  2HAX A;  4CC3 A;  3J80 E;  3OYG A;  4PFZ A;  4M75 F;  4J6X A;  1NYG A;  3S6W A;  3DLM A;  3CXC S;  1LNX A;  1CSK A;  3CEY A;  1K76 A;  3VS4 A;  5L23 A;  2XG8 D;  2HL5 C;  3PMI A;  5CK9 A;  1SEM A;  3P8D A;  1YJW Q;  2MF2 A;  2X4Y A;  5LJ3 g;  2X35 A;  1WQ7 A;  3L1A A;  5A0L A;  1VQM T;  3QDF A;  3CMA A;  1Q81 U;  3JCM Q;  4M7D B;  2RN8 A;  1BI3 A;  1MHN A;  2F2V A;  1DJ7 B;  2FZC B;  2EGC A;  1Q81 C;  3VS7 A;  3M58 A;  1Z9Z A;  3QSU A;  2D6F A;  2KYM A;  3OBW A;  3WXM B;  4C5G A;  2O4X B;  3JCM P;  2YSQ A;  3CD6 Q;  3RER A;  1ZSZ A;  1WFW A;  2ZPG B;  1LPL A;  2PUO B;  3A8O B;  1TU0 B;  2YLC A;  4M4Z A;  3KXT A;  1G83 A;  1M9S A;  2A08 A;  2JZ2 A;  2EAY A;  2VXE A;  2VYT A;  1N5Z A;  2FB7 A;  1XQH A;  1ARK A;  5IN1 A;  3OW2 S;  2ZAE A;  2DD4 A;  4HT9 A;  4OMN A;  1M2V A;  1X6O A;  2Y4X A;  4NS5 A;  2PVO B;  3BE3 A;  3A5Z B;  4RTX A;  4QQD A;  3TSZ A;  1K0S A;  1ZA2 B;  9ATC B;  3BDL A;  4LXC A;  1KSW A;  3ZEH A;  2KDS A;  1W1F A;  5IAY A;  3LGF A;  2A0F B;  1T3L A;  2GNC A;  4A4F A;  1Y0M A;  4J9I A;  3MEU A;  2LCL A;  3OYM A;  4DBR A;  3CCS Q;  2LQ8 A;  4M77 A;  5CO7 A;  4F7U B;  3HKS A;  3R6O A;  1BIA A;  2PVD B;  4MDW A;  3CCR A;  2P0P A;  3FIF A;  1VQL A;  2E12 A;  1WI7 A;  4PNO A;  1X43 A;  1RAH B;  3MEV A;  4HT8 A;  3JB9 I;  2CDT A;  2J6O A;  5KYW A;  2X3W D;  1NE8 A;  1I5O B;  5A0D A;  1VQ4 Q;  4BB7 A;  4FW1 A;  1K0X A;  1V76 A;  2DYB A;  4A4H A;  2JTF A;  2BE7 D;  1M4Z A;  2J6K A;  2LT4 A;  1RAD B;  2PZ1 A;  2DER A;  4A54 A;  1MGQ A;  3S3M A;  2PVG B;  2P4T A;  1EIF A;  4PJJ A;  1GCP A;  3CCV Q;  2PTK A;  5GMK i;  1W4S A;  5FRO A;  1WXT A;  2M51 A;  1YJ9 T;  4J7F A;  2EW3 A;  4D8K A;  1RAC B;  2FG0 A;  2LJ0 A;  3H41 A;  1RLQ C;  4PLI A;  1QVG P;  3ZBD A;  1Q86 C;  1BCM A;  2KRM A;  2DXC A;  1VUB A;  2E5K A;  2RJF A;  2XIC A;  5M9O A;  3OS1 A;  2M1H A;  1Y07 A;  1MMG A;  4LUD A;  4N4I A;  3PVQ A;  4N4H A;  3CC2 T;  3SWN A;  1ZA1 B;  1HXD A;  2DNU A;  4C92 E;  3UWN A;  5GMK m;  2YT6 A;  1QVF S;  1UEC A;  3L2Z A;  2I0N A;  2DIL A;  3HTR A;  1NPR A;  2A7Y A;  1GFD A;  3UAT A;  1JQQ A;  5CQX A;  1WA7 A;  1G3T A;  2QAS A;  2X4X A;  1V1C A;  1K73 C;  3V7S A;  1U8R A;  2PU9 B;  4FM4 B;  2RNA A;  1QCN A;  4C8Q B;  4PFO A;  1SPK A;  1I1J A;  3CCL A;  2COW A;  2LT1 A;  2RF0 A;  2BKD N;  2LQK A;  4OMM A;  4DBH A;  4ZTJ A;  4DBQ A;  2DYI A;  4CI0 C;  4Y28 E;  4R0K A;  1ZBX A;  5IT9 E;  3SB2 A;  2E64 A;  5CCA A;  4JJD A;  2BE9 B;  3VV0 A;  3M56 A;  3JCM c;  1ZX6 A;  1RAF B;  1H8K A;  2FZK B;  4ME7 A;  3EGD B;  5GAN f;  2L8D A;  2ZPH B;  1CKB A;  6AT1 B;  2RH2 A;  3OYK A;  2RK2 A;  1SHG A;  2KYB A;  1QKX A;  2BZY A;  4FCY A;  4C5I A;  1M3B A;  2RI5 A;  1ABQ A;  1GRI A;  4J9G A;  1ZUK A;  2E4H A;  3J81 E;  4BDY A;  1ZBJ A;  3CMA T;  4AFZ C;  3EGU A;  2BZ8 A;  3AHU A;  3NGP A;  5GAM j;  3M57 A;  4ZNX A;  1YJ9 A;  2CRE A;  2DM1 A;  5GAN e;  1M1K U;  3UPU A;  1Q82 U;  2B86 A;  2EJF A;  5GAN 7;  4XU3 A;  2OTL A;  2GQV A;  2FHD A;  1QP3 A;  4FSX A;  4WTO B;  3VS5 A;  2FPE A;  1VQ4 T;  1XTD A;  3M53 A;  1AHJ B;  1D0Y A;  4X9D A;  3JCM g;  3OYL A;  1UDL A;  2I2L A;  3OMC A;  1IRX A;  5IHI A;  4JRK A;  4KH1 B;  1PRM C;  2K5L A;  4NL2 A;  1AWO A;  1YJ9 Q;  2LX9 A;  1UUE A;  1Q86 U;  3EHQ A;  2XDP A;  3L2U A;  2O88 A;  1FMW A;  2RQV A;  2OTL Q;  5D6Y A;  2KVQ G;  7AT1 B;  1WJS A;  5GAN j;  3C95 A;  4RTZ A;  3VS1 A;  1NEB A;  4N4G A;  4OB0 B;  1PWT A;  3VRY A;  3EGX A;  2MWO A;  4HKE A;  4C92 A;  2KR3 A;  3M59 A;  1OYX A;  3CCM A;  3A8G B;  2EYW A;  4OMF B;  2WSC E;  1WHH A;  3EG1 A;  1VYU A;  4E7I A;  4OGC A;  5CQY A;  3QG1 A;  5LJ3 j;  2JMC A;  1SSH A;  4X34 A;  3MKD A;  1YIJ T;  3G71 Q;  4DBF A;  2RQU A;  2LVM A;  2ED0 A;  5KH6 A;  5DM7 R;  1KK7 A;  2DL7 A;  3JCM V;  1QMC A;  2K3B A;  1TSF A;  4JRI A;  1BKB A;  2QQB A;  3OB9 A;  1Y71 A;  3JCM e;  4RCB A;  4AFU C;  4OML A;  3OYA A;  3HL8 A;  3M9Q A;  4Z8A A;  1R77 A;  1BU1 A;  4F17 A;  3VS0 A;  4R56 A;  3MPU B;  4NOY A;  1RAG B;  1KIK A;  3HHT B;  3CPW P;  1Q95 G;  3VUZ A;  2LDM A;  1NJI R;  1QVP A;  2EYX A;  4C8Q C;  1YIJ A;  2MMP A;  2KI7 A;  1M27 C;  3CCU A;  3AT1 B;  8ATC B;  3LH5 A;  5LJ3 d;  4F7U E;  1VQO T;  4MZT A;  3DKM A;  2IPO B;  5FW9 A;  5KCH A;  2VUB A;  3PT9 A;  1N9R A;  3ZL7 C;  4XU1 A;  3CCV A;  3TVT A;  4B9W A;  2YDL A;  1XNI A;  2FPF A;  2L3R A;  3CME Q;  5KYY A;  2LC4 A;  5GMK l;  4J9E A;  2JTM A;  1VQN Q;  2L3P A;  3QYH B;  3QBY A;  2HSP A;  3E19 A;  3QJ6 A;  3HRT A;  2HKN A;  4FW2 A;  2K4Y A;  2HL3 A;  3M5A A;  5KE2 A;  2DPP B;  1VQ8 T;  1AT1 B;  1RAB B;  3EG2 A;  1C0M A;  2AT1 B;  1I8F A;  1JXO A;  1H3H A;  2RD1 A;  2DJZ A;  4M75 E;  4KRT A;  2CZ1 B;  3FC3 A;  1M1F A;  1W2B A;  1UE9 A;  1G3Y A;  3FRN A;  1B07 A;  2K3X A;  3CPW A;  4J5Y A;  2QQR A;  4ZN3 A;  1RI9 A;  4C0D B;  3VKI A;  2NUT B;  2XI9 A;  4CC4 B;  3X24 B;  4AG2 C;  5GAM d;  4M75 D;  3MEA A;  2NLU A;  4C8Q D;  2W10 A;  3O5Z A;  4C8Q F;  1YJW A;  5D6X A;  3GNF B;  4C5H A;  3OYH A;  1X2Q A;  1RL2 A;  5HK3 A;  2O4X A;  2AZS A;  3RES A;  1TXQ A;  4JJC A;  5GMK j;  2R57 A;  2L89 A;  4PFP A;  3FJP A;  2NWM A;  2P4R A;  4E7H A;  2E3H A;  1OI1 A;  1R0C B;  3KFV A;  4JPB W;  3OS2 A;  1YWO A;  1Y96 A;  2C0O A;  5DLQ E;  3GNG A;  1GFC A;  4HCC A;  1WHG A;  4RMO A;  2HBW A;  3GLX A;  1MV0 B;  1VIE A;  2CP7 A;  1F1B B;  2YRV A;  3CCL Q;  2ZPE B;  5KYX A;  3JRZ A;  5KYY B;  1KFZ A;  1MNE A;  4EPC A;  4IUQ A;  4Z02 A;  3ME9 A;  4IUR A;  5GAM h;  1NEG A;  4QVZ A;  4QKU A;  2DJQ A;  2GCX A;  2CZ0 B;  4QW2 A;  4A53 A;  4M78 B;  1VQN T;  2RJE A;  1LVK A;  2O31 A;  3VRZ A;  3CME T;  1QCO A;  4JRP A;  3OYB A;  4KBM B;  1YJW T;  1VQ8 Q;  4M77 G;  1I81 A;  3QZ5 B;  1H3Z A;  4KT0 E;  1K73 R;  5CKB A;  2H3J A;  3I56 Q;  1JU5 C;  2DXU A;  1BI1 A;  1PD0 A;  1RI0 A;  2HEQ A;  5FU7 C;  5I11 A;  1K9M U;  4J9D A;  2PUK B;  1UHC A;  1M3A A;  4FT2 A;  2YUQ A;  2XU8 A;  3L42 A;  2VWF A;  1AZE A;  4IUP A;  1WJQ A;  2NUZ A;  3LW5 E;  3VS3 A;  5DLO A;  1PNJ A;  2EYY A;  3EFS A;  1YFN A;  5A2Q E;  4LDV A;  2DZ9 A;  2RHI A;  1V29 B;  1BYM A;  2K2M A;  2HZY A;  4M7D G;  2VAS A;  1UG1 A;  3A8L B;  4M77 C;  1MMN A;  2AHJ B;  3N5B B;  3MP6 A;  1IZ6 A;  3IQL A;  2RHY A;  2RI3 A;  5C0M A;  3NPF A;  2DX1 A;  2JXB A;  4OGE A;  4M78 G;  2AZV A;  1UTI A;  4Q5W A;  1WQW A;  4ELZ C;  2G6F X;  1KHC A;  5LJ5 e;  4ZGD B;  4C92 D;  2RHZ A;  5LJ5 d;  2BUD A;  3OYI A;  2K2V A;  2KNB B;  5GAN d;  2GQI A;  2VXF A;  1I0C A;  4O6J A;  1MUZ A;  4M78 A;  2DL8 A;  4WCI A;  3GIB A;  4B9X A;  5LJ5 f;  2KAF A;  3F70 A;  3OSV A;  1JXM A;  5C6S A;  4MMK A;  3U23 A;  1OZ2 A;  2CSI A;  4E7S A;  3EG9 B;  4EDU A;  3CCE T;  3OYJ A;  1BK2 A;  1OX8 A;  2ECZ A;  2DFU A;  1IXD A;  4GBQ A;  4XU0 A;  3PIP A;  1QCF A;  1AWW A;  1NG2 A;  1HSQ A;  3CCL T;  3CC7 T;  1T0H A;  1B34 A;  2R58 A;  1OZ3 A;  4ATO A;  3CCM Q;  1D1A A;  2OTJ T;  1QVF P;  1M1G A;  1Y96 B;  3KBG A;  2CT3 A;  2KGT A;  2V8K A;  1T0J A;  2ROT A;  3DB3 A;  3VUB A;  1M5Q 1;  1WHJ A;  1YJN Q;  5CR2 A;  1FXX A;  3QZ9 B;  1W2B P;  2Y4Y A;  1NM7 A;  2E6Z A;  5J3B A;  3VU3 C;  2GTO A;  1J3T A;  5CIU A;  1K9A A;  2QGG A;  1R8O B;  2LP5 A;  3CCU T;  1QWF A;  4C0F A;  3E1S A;  2CSQ A;  3FLG A;  2RA2 A;  1TTH B;  2E3I A;  5CVI A;  1VQL T;  1M8V A;  4BI4 A;  2MI6 A;  2RHX A;  1N8R C;  3M0P A;  3X25 B;  2VGN A;  3LGL A;  1VOM A;  4D6W A;  3CBP A;  2M02 A;  3LYI A;  1KD1 U;  1ABO A;  2RB6 A;  4XTV A;  3M54 A;  2FRW A;  2DTI A;  2O9S A;  3VS2 A;  1E6H A;  4C0Z A;  5HCK A;  1OX9 A;  1KC8 U;  2GTJ A;  2HMA A;  4FL6 A;  1VQP A;  4RG2 A;  4VUB A;  3RIR A;  1LCK A;  3H0I A;  2F69 A;  2KT1 A;  3VS6 A;  2MPX C;  2GFA A;  2D0Q B;  2MAM A;  2EGE A;  5HKC A;  4PJO E;  3L2V A;  1WHM A;  2GF7 A;  2ZPF B;  2CZ6 B;  4JZ3 A;  1D0Z A;  2MWP A;  4XTY A;  4M77 D;  4PK4 A;  3QO3 A;  2RI2 A;  1JJ2 A;  3OW2 A;  2ZZD A;  4OB2 B;  3ER0 A;  3GPL A;  3T9N A;  2DA9 A;  3WVD B;  3M4Y A;  3Q1J A;  4RG8 A;  2ZPI B;  2CZ7 B;  2LX7 A;  3A8M B;  2D8H A;  1WZO A;  3L2R A;  1QVG A;  2MCN A;  3LLR A;  3H0F A;  1KQS P;  2KQW A;  3NHN A;  4JRQ A;  3H9N A;  1B34 B;  2ZPB B;  2GGR A;  4M77 F;  2RJC A;  2HQX A;  2LNV A;  3DLL A;  2ATC B;  4E2F B;  2VB6 A;  3CCQ T;  3H6Z A;  3SEM A;  1KC8 R;  2RK1 A;  2ZCF B;  1VQM Q;  1C6V X;  5FU7 B;  5AYF A;  3EFO B;  1VQO Q;  1H92 A;  1GXI E;  1JBM A;  5EC7 A;  4F14 A;  4PJO A;  4Y91 A;  1G8X A;  1VIF A;  1YP5 A;  4P5N A;  1TUD A;  5I21 A;  1VQK A;  2EBP A;  1Q7Y R;  3OYD A;  1LOJ A;  1MV3 A;  3TU4 K;  1HK9 A;  2YHT A;  2LZ6 B;  4M75 G;  2EPD A;  4C5E A;  3NTH A;  1IGU A;  4RTT A;  2Z0W A;  2JJ9 A;  1BB9 A;  4FYV B;  2JM9 A;  2ZGW A;  1D3B B;  3UDC A;  3M0Q A;  3MJX A;  4ZGE B;  1AEY A;  2CH4 A;  1VQL Q;  4HA8 A;  1YI2 Q;  4XTW A;  1NPP A;  2HSE B;  2OTJ A;  3CCV T;  2OAW A;  2LQN A;  4KGV B;  1GBR A;  3OS5 A;  3M0U A;  2EGA A;  1VQ4 A;  1I4K 1;  2KT8 A;  3H0H A;  2YWW A;  4C8Q E;  4J9F A;  4LDU A;  4Y92 A;  1M1K R;  4CRI A;  3BFM A;  1WJR A;  1AD5 A;  2E10 A;  5DY9 A;  3I5S A;  3MP8 A;  2QYZ A;  2HNI A;  2EKO A;  4M75 B;  1M30 A;  3EH1 A;  4E6R A;  1TUG B;  8AT1 B;  3CC2 Q;  1FWZ A;  5GAN 6;  3S3N A;  2RHU A;  1VQ5 Q;  3QXE B;  3G4S Q;  3QDR B;  4Z88 A;  4RKU E;  1NJI C;  4M7A D;  3RKY A;  2JS0 A;  2RPN A;  3I35 A;  1M90 C;  3G71 A;  1KC8 C;  5IHN A;  4CC7 A;  2DTH A;  3ULR B;  2LNH B;  2X9H A;  1Q86 R;  4XTX A;  1LJO A;  2HDA A;  1NZ9 A;  2KXC A;  1VQ7 T;  3CC2 A;  3NTI A;  4L6V 5;  5LJ3 f;  1M8M A;  1PRL C;  4QQG A;  4F7U A;  2B8A A;  1U3O A;  4JS5 A;  3RR6 A;  3P8H A;  1K73 U;  1IGQ A;  4JJB A;  3JCM d;  5KYX B;  1Q7Y C;  4KGZ B;  4F7U F;  2K5I A;  3M55 A;  1ZUY A;  3UA6 A;  1MMD A;  3MP1 A;  5GAO m;  3CCS T;  4E7J A;  3HP9 A;  4M7A E;  2AKL A;  1KQ1 A;  2OJ2 A;  3CPW S;  4AFQ C;  5GAN 3;  4DA4 A;  1ZQ1 A;  4LNP A;  1X69 A;  4BD3 A;  4DOV A;  2CUB A;  2MOX A;  1KJW A;  3GOX A;  3CCS A;  2ENM A;  4M75 A;  2EFI A;  3EH2 A;  2A3L A;  2YLB A;  4HVU A;  3M0R A;  3OYN A;  1R0B G;  1WX6 A;  2EIF A;  1YCS B;  1OPK A;  3V8L A;  2CS7 A;  1JB0 E;  3FJ5 A;  3GBQ A;  5IHK A;  4F16 A;  1C1A A;  3CCJ T;  4LDX A;  2CP6 A;  1FX7 A;  4PLL A;  2COY A;  1VQO A;  1SKU B;  4HCK A;  1X6B A;  3CCJ Q;  2JVV A;  2QA4 A;  3M4G A;  2OX7 A;  2M16 A;  4DOW A;  2X51 A;  3VJP A;  4BDZ A;  4ORZ A;  2YRD A;  3G4S T;  3V8K A;  1A0N B;  4ESR A;  2M0Y A;  3URG A;  1KQ2 A;  3PNW C;  1M1K C;  3LH0 A;  2H3E B;  2GBQ A;  1WXU A;  5GAO r;  3DB4 A;  4M75 C;  2DK3 A;  3RBB B;  4RUG A;  1MMA A;  1RAE B;  1RAI B;  1G3W A;  1S72 Q;  1D3B A;  2QXF A;  2JT4 A;  4M7D F;  3G6E A;  2VKN A;  1WDX A;  4GLM A;  5KYW B;  2KEA A;  1N6A A;  3QUI A;  1SSF A;  1PSF A;  1N8R R;  4QQ6 A;  1K8A R;  2DIG A;  1Q81 R;  1OOT A;  2BZX A;  2DBK A;  1S1N A;  2DTO A;  3X20 B;  1IHW A;  3A1P A;  5A0G A;  5FLX E;  4ZN1 A;  5GAN 2;  4OP0 A;  1KQS A;  3JCM b;  1WLP B;  3FDR A;  1TS9 A;  3X28 B;  2QDY B;  4X9C A;  5GAN 4;  1VQ6 A;  1RUW A;  1TWB A;  4M78 C;  5FRN A;  1ZLM A;  4ZTF A;  1SHF A;  4BE0 A;  1VYV A;  1UFF A;  3G6E T;  4AG1 C;  3CC7 Q;  2NUP B;  2XMF A;  2PQW A;  4ZGJ B;  2K57 A;  4PJO D;  1YIT Q;  3HFO A;  3WVE B;  2F2W A;  2RMO A;  5AT1 B;  3EG9 A;  4JLG A;  2RJD A;  3H8Z A;  3RDV A;  4MML A;  1YWP A;  2C0I A;  5KYU B;  4MZM A;  3PMT A;  2EJG A;  1YI2 A;  3X26 B;  3JV3 A;  4Z89 A;  1H64 1;  1YBY A;  2FRY A;  2OTL T;  3NMZ C;  1PSE A;  1ZSG A;  2DF6 A;  1QP2 A;  1RAA B;  1BCO A;  2K6D A;  2V8J A;  4C92 G;  1TUC A;  1E6G A;  4HVV A;  1PKS A;  3HPW A;  2QEX T;  5GAN 8;  4L59 A;  5LJ3 h;  4PJO F;  3SD4 A;  4PJL A;  2CT4 A;  4RTV A;  2DEU A;  4KUD K;  3JB9 J;  1S72 A;  1Q7Y U;  3SDZ A;  3OS0 A;  3GP8 A;  4C92 B; 
#chains in the Genus database with same CATH homology
 1ABQ A;  1GRI A;  4J9G A;  1ZUK A;  2CT3 A;  1ZBJ A;  2KGT A;  2K9G A;  3PVL A;  1T0J A;  2ROT A;  1T3S A;  4AFZ C;  2O9V A;  3EGU A;  2BZ8 A;  2V1Q A;  4RTY A;  3NGP A;  4ZNX A;  2CRE A;  2DM1 A;  2B86 A;  1UJ0 A;  2DBM A;  1YN8 A;  2JW4 A;  4X1V A;  1NM7 A;  1GCQ C;  3VS5 A;  2JMA A;  2GTO A;  1J3T A;  1EFN A;  2K7A A;  1K9A A;  2FPE A;  3QWY A;  2LP5 A;  5ECA A;  2YUN A;  3UF4 A;  1QWF A;  2LMJ A;  4J9H A;  1W6X A;  1TG0 A;  2J05 A;  2LCS A;  2ED1 A;  1UDL A;  1UHF A;  1RLP C;  2CSQ A;  3REA B;  5IHI A;  1B3Q A;  3M0P A;  2QDL A;  1PRM C;  1AWO A;  2KE9 A;  1GBQ A;  2DLP A;  1UUE A;  2AK5 A;  1ABO A;  2YUO A;  2YUP A;  1OPL A;  2FRW A;  2O9S A;  3EHQ A;  3VS2 A;  1E6H A;  2DL5 A;  2O88 A;  2RQV A;  5HCK A;  2L0A A;  1JEG A;  2GTJ A;  2LJ3 A;  1Y57 A;  4K11 A;  1PKT A;  2LQW A;  4RTZ A;  1LCK A;  3H0I A;  3VS1 A;  1HJD A;  2W0Z A;  2KT1 A;  1NEB A;  3VS6 A;  1PWT A;  5GJV B;  3VRY A;  2EGE A;  2KR3 A;  3RNJ A;  1K1Z A;  2VVK A;  2EYW A;  2PNI A;  2KRN A;  4JZ3 A;  1YNZ A;  2EKH A;  2F2X A;  1VYU A;  1I07 A;  3EG1 A;  2BTT A;  2JMC A;  1SSH A;  2SEM A;  3R6N A;  2DA9 A;  5FWB A;  1AVZ C;  2OI3 A;  2RQU A;  2ED0 A;  2DL7 A;  2LX7 A;  2DE0 X;  1AZG B;  2L2P A;  2D8H A;  2K3B A;  2KXD A;  3EHR A;  2J7I A;  2MCN A;  3EG0 A;  1OV3 A;  3H0F A;  4OMQ A;  4RTW A;  3NHN A;  2A36 A;  2FEI A;  4AFU C;  2LJ1 A;  1X27 A;  4OML A;  2GGR A;  3EG3 A;  4Z8A A;  1BU1 A;  2DL3 A;  4F17 A;  3VS0 A;  4LE9 A;  1KIK A;  4IIO A;  4JZ4 A;  2EYX A;  5GJW B;  2MIO A;  3SEM A;  1VYT A;  1AWJ A;  1NLO C;  2C0T A;  1OEB A;  1WYX A;  1QWE A;  1H92 A;  1SRL A;  2IIM A;  1M27 C;  1HD3 A;  2AKK A;  5EC7 A;  4F14 A;  2KBT A;  2V1R A;  3LH5 A;  1YP5 A;  4D8D A;  2DVJ A;  2KRO A;  5IH2 A;  5FW9 A;  1TUD A;  2EBP A;  1U06 A;  3ZL7 C;  3TVT A;  2YDL A;  4HXJ A;  2DRM A;  1MV3 A;  2FPF A;  2LZ6 B;  2EPD A;  1CKA A;  4J9E A;  1K4U S;  1BBZ A;  4RTT A;  1BB9 A;  2HCK A;  2L3P A;  2JM9 A;  1UGV A;  2HSP A;  3M0Q A;  1UJY A;  3CQT A;  3SHW A;  4J9B A;  1AEY A;  2CH4 A;  3C0C A;  1FYN A;  2SRC A;  2OAW A;  2LQN A;  3M0T A;  1GBR A;  3EG2 A;  5I22 A;  3A98 A;  3M0U A;  2EGA A;  1JXO A;  2KT8 A;  3H0H A;  1H3H A;  4J9F A;  4Y92 A;  2CH4 W;  2FPD A;  2RQT A;  2RQW A;  4KRT A;  1UE9 A;  2RQR A;  4LN2 A;  3M0S A;  2A37 A;  1AD5 A;  1B07 A;  4OMP A;  1E7O A;  3I5S A;  2ESW A;  4QT7 A;  2L3Q A;  1NLP C;  3THK A;  2O2O A;  1M30 A;  1RI9 A;  4LUE A;  4E6R A;  2D0N A;  4CC4 B;  2JS2 A;  4CC3 A;  4AG2 C;  1X6G A;  2J06 A;  1VA7 A;  1NYG A;  2W10 A;  3O5Z A;  1CSK A;  2EYZ A;  4Z88 A;  1K76 A;  3VS4 A;  2L3S A;  5L23 A;  1X2Q A;  1SEM A;  2JS0 A;  2RPN A;  3I35 A;  5IHN A;  4CC7 A;  2AZS A;  3ULR B;  4JJC A;  2LNH B;  2HDA A;  4EIK A;  2KXC A;  1PHT A;  2RN8 A;  2F2V A;  2DRK A;  1M8M A;  1PRL C;  2EGC A;  2DL4 A;  2NWM A;  1X2K A;  3VS7 A;  1U3O A;  1Z9Z A;  1QKW A;  2KYM A;  2FO0 A;  1JO8 A;  2P4R A;  2YSQ A;  4JJB A;  1WIE A;  2D1X A;  1WFW A;  3KFV A;  4JPB W;  3QWX X;  1YWO A;  2C0O A;  4M4Z A;  1ZUY A;  3UA6 A;  1G83 A;  1GFC A;  2A08 A;  2HBW A;  1MV0 B;  1U5S A;  4HVW A;  2AKL A;  2OJ2 A;  2D8J A;  4AFQ C;  1N5Z A;  1XOV A;  2A28 A;  2JM8 A;  4LNP A;  1KFZ A;  1X69 A;  4IIM A;  1ARK A;  2CUB A;  2MOX A;  1KJW A;  1G2B A;  2X3X D;  2ENM A;  3I5R A;  4OMN A;  4HVU A;  3M0R A;  4RTX A;  1NEG A;  1WX6 A;  2DJQ A;  1YCS B;  1OPK A;  3TSZ A;  1K0S A;  2ROL A;  3FJ5 A;  5IXF A;  2EVR A;  3GBQ A;  5IHK A;  4F16 A;  1KSW A;  2O31 A;  3VRZ A;  3UA7 A;  1W1F A;  2ABL A;  2CUD A;  4HCK A;  1T3L A;  1X6B A;  2GNC A;  2EQI A;  1IO6 A;  1Y0M A;  4J9I A;  1W70 A;  4ORZ A;  1GCQ A;  1JU5 C;  1ZUU A;  4A63 B;  2HEQ A;  5I11 A;  1A0N B;  4J9D A;  4ESR A;  2M0Y A;  4FSS A;  4CC2 A;  1UHC A;  1M3A A;  2K79 A;  1NYF A;  2YUQ A;  2GBQ A;  1WI7 A;  1WXU A;  1X43 A;  2CDT A;  2J6O A;  2VWF A;  1AZE A;  2NUZ A;  2X3W D;  3VS3 A;  3RBB B;  4RUG A;  1PNJ A;  2EYY A;  1K0X A;  2DYB A;  2H8H A;  2JT4 A;  2KRS A;  2J6K A;  2VKN A;  2PZ1 A;  1WDX A;  4GLM A;  2KEA A;  3TSW A;  2JTE A;  1GCP A;  2K2M A;  2PTK A;  1WXT A;  3I9Q A;  1UG1 A;  4DEY A;  2M51 A;  1OOT A;  2BZX A;  2DBK A;  2EW3 A;  4D8K A;  1S1N A;  2FG0 A;  2LJ0 A;  3H41 A;  1RLQ C;  3IQL A;  1QLY A;  3NPF A;  2KRM A;  2DX1 A;  2E5K A;  2JXB A;  1FMK A;  2AZV A;  1UTI A;  4J9C A;  4DEX A;  1WLP B;  3PE0 A;  2G6F X;  4LUD A;  1RUW A;  3PVQ A;  1ZLM A;  3REB B;  1SHF A;  2DNU A;  1VYV A;  1SRM A;  1UFF A;  2KNB B;  4AG1 C;  2YT6 A;  5IXB A;  1UEC A;  2GQI A;  4AFS C;  1I0C A;  2I0N A;  2DIL A;  2XMF A;  1GFD A;  1GL5 A;  3UAT A;  1MUZ A;  1JQQ A;  1WA7 A;  1V1C A;  2DL8 A;  4WCI A;  2F2W A;  2RNA A;  2RMO A;  4OMO A;  1M3C A;  1SPK A;  1I1J A;  1WXB A;  1JXM A;  1YWP A;  2C0I A;  2RF0 A;  2J6F A;  3U23 A;  4OMM A;  2CSI A;  4RTU A;  3JV3 A;  4Z89 A;  2FRY A;  3NMZ C;  4R0K A;  1ZSG A;  1BK2 A;  2DF6 A;  1AWX A;  2ECZ A;  2K6D A;  4JJD A;  4GBQ A;  1TUC A;  1AOJ A;  1E6G A;  1Z9Q A;  4HVV A;  1PKS A;  1QCF A;  1ZX6 A;  1AWW A;  1NG2 A;  1H8K A;  1HSQ A;  1T0H A;  1CKB A;  2CT4 A;  4RTV A;  5FWC A;  2DMO A;  1SHG A;  2KYB A;  1QKX A;  2BZY A;  1M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...