2L3UA

Solution structure of domain iv from the ybbr family protein of desulfitobacterium hafniense: northeast structural genomics consortium target dhr29a
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
98
structure length
98
Chain Sequence
b'MKTLYDLPIVLRNLPEDLVLEKPLPEVSVTIRAYPEILNNLTKEQISLWIDATGKAVGEHTVKIYWQLPAGIEMVSIPDVTYTLKAKEDPLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YbbR family protein
publication title Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 5
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2010-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2l3uA00
2KPUA 2L5NA 2L3UA 2KQ1A 5HQHA 3LYWA
chains in the Genus database with same CATH superfamily
4MQ9A 1Y1VC 4A3EC 2ZJQS 4OIRA 2VUMC 3I4NC 2L3UA 5C44C 2E2HC 2NVTC 4A3BC 4LK0A 4BY7C 3RZDC 3HOXC 3S17C 1TWFC 2O5IA 4XLPA 1TWGC 3FKIC 5C4JC 2PMZD 3S1MC 4Y7NC 3S2DC 3HOZC 1I6HC 5IP9C 4ZH4A 1Y1WC 4WF9S 5HL7S 2R93C 5C3EC 1I3QC 4GZYA 1TWCC 3S14C 3H0GC 1ZYRA 5JVGS 1SMYA 4BBSC 3GTLC 2KXYA 4IOCS 4MEYA 3S16C 2CW0A 2ZJPS 4OINA 5DM6S 2JA7C 4A3JC 2KPUA 3HOUC 3LYWA 2A6HA 1TWAC 3GTQC 2WAQD 4IOAS 4KN7A 3K7AC 4A93C 4U67S 2E2JC 2JA5C 2A6EA 4A3GC 2R92C 3GTMC 3S1NC 2NVXC 3M3YC 1I6VA 3EQLA 2JA8C 1WCMC 3HOVC 3I4MC 4YFNA 2O5JA 3WODA 5TMCA 5IP7C 1R9TC 2NVYC 4QIWD 4MEXA 4A3CC 3HOYC 4BXXC 1K83C 1YNJA 1YNNA 2A69A 2JA6C 4XSZA 3HOWC 2A68A 5D4DA 1BDFA 1TWHC 2YU9C 4A3LC 4C3HC 1I50C 4YFXA 4WFBS 3S2HC 4C2MC 4A3DC 4XLNA 4A3KC 4A3IC 3GTJC 3GTKC 2WB1D 3GTOC 1IW7A 3S1RC 4A3MC 4AYBD 2L5NA 1SFOC 5IYBC 1HQMA 2NVQC 3PO2C 4YFKA 3S1QC 4OIQA 2BE5A 4KMUA 4LK1A 3PIPS 2PA8D 4KN4A 3CF5S 4QJVA 4NOIA 4JK1A 3DXJA 2Y0SD 4YG2A 3GTPC 4BY1C 4C3IC 4Q5SA 2PPBA 3GTGC 4Q4ZA 5DM7S 4WCES 4G7HA 3H3VD 3DLLS 4A3FC 4WFNS 2KQ1A 3CQZC 3PIOS 5IYCC 5JVHS 4C3JC 3HKZD 3RZOC 4X6AC 2ZJRS 5TMFA 5FLMC 4LJZA 2R7ZC 2E2IC 5IYDC 4Y52C 3S15C 4G7OA 4OIOA 4LLGA 4OIPA 4XSXA 3M4OC 2B63C 3PO3C 4G7ZA 4IO9S 1FEUA 5HQHA 4WFAS 5C4XC 4BBRC
chains in the Genus database with same CATH topology
3LYWA 2KPUA 2L5NA 2KXYA 2KQ1A 5HQHA 2L3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPU A;  2L5N A;  2L3U A;  2KQ1 A;  5HQH A;  3LYW A; 
#chains in the Genus database with same CATH topology
 4MQ9 A;  1Y1V C;  4A3E C;  2ZJQ S;  4OIR A;  2VUM C;  3I4N C;  2L3U A;  5C44 C;  2E2H C;  2NVT C;  4A3B C;  4LK0 A;  4BY7 C;  3RZD C;  3HOX C;  3S17 C;  1TWF C;  2O5I A;  4XLP A;  1TWG C;  3FKI C;  5C4J C;  2PMZ D;  3S1M C;  4Y7N C;  3S2D C;  3HOZ C;  1I6H C;  5IP9 C;  4ZH4 A;  1Y1W C;  4WF9 S;  5HL7 S;  2R93 C;  5C3E C;  1I3Q C;  4GZY A;  1TWC C;  3S14 C;  3H0G C;  1ZYR A;  5JVG S;  1SMY A;  4BBS C;  3GTL C;  2KXY A;  4IOC S;  4MEY A;  3S16 C;  2CW0 A;  2ZJP S;  4OIN A;  5DM6 S;  2JA7 C;  4A3J C;  2KPU A;  3HOU C;  3LYW A;  2A6H A;  1TWA C;  3GTQ C;  2WAQ D;  4IOA S;  4KN7 A;  3K7A C;  4A93 C;  4U67 S;  2E2J C;  2JA5 C;  2A6E A;  4A3G C;  2R92 C;  3GTM C;  3S1N C;  2NVX C;  3M3Y C;  1I6V A;  3EQL A;  2JA8 C;  1WCM C;  3HOV C;  3I4M C;  4YFN A;  2O5J A;  3WOD A;  5TMC A;  5IP7 C;  1R9T C;  2NVY C;  4QIW D;  4MEX A;  4A3C C;  3HOY C;  4BXX C;  1K83 C;  1YNJ A;  1YNN A;  2A69 A;  2JA6 C;  4XSZ A;  3HOW C;  2A68 A;  5D4D A;  1BDF A;  1TWH C;  2YU9 C;  4A3L C;  4C3H C;  1I50 C;  4YFX A;  4WFB S;  3S2H C;  4C2M C;  4A3D C;  4XLN A;  4A3K C;  4A3I C;  3GTJ C;  3GTK C;  2WB1 D;  3GTO C;  1IW7 A;  3S1R C;  4A3M C;  4AYB D;  2L5N A;  1SFO C;  5IYB C;  1HQM A;  2NVQ C;  3PO2 C;  4YFK A;  3S1Q C;  4OIQ A;  2BE5 A;  4KMU A;  4LK1 A;  3PIP S;  2PA8 D;  4KN4 A;  3CF5 S;  4QJV A;  4NOI A;  4JK1 A;  3DXJ A;  2Y0S D;  4YG2 A;  3GTP C;  4BY1 C;  4C3I C;  4Q5S A;  2PPB A;  3GTG C;  4Q4Z A;  5DM7 S;  4WCE S;  4G7H A;  3H3V D;  3DLL S;  4A3F C;  4WFN S;  2KQ1 A;  3CQZ C;  3PIO S;  5IYC C;  5JVH S;  4C3J C;  3HKZ D;  3RZO C;  4X6A C;  2ZJR S;  5TMF A;  5FLM C;  4LJZ A;  2R7Z C;  2E2I C;  5IYD C;  4Y52 C;  3S15 C;  4G7O A;  4OIO A;  4LLG A;  4OIP A;  4XSX A;  3M4O C;  2B63 C;  3PO3 C;  4G7Z A;  4IO9 S;  1FEU A;  5HQH A;  4WFA S;  5C4X C;  4BBR C; 
#chains in the Genus database with same CATH homology
 3LYW A;  2KPU A;  2L5N A;  2KXY A;  2KQ1 A;  5HQH A;  2L3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...