2L3UA

Solution structure of domain iv from the ybbr family protein of desulfitobacterium hafniense: northeast structural genomics consortium target dhr29a
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
98
structure length
98
Chain Sequence
MKTLYDLPIVLRNLPEDLVLEKPLPEVSVTIRAYPEILNNLTKEQISLWIDATGKAVGEHTVKIYWQLPAGIEMVSIPDVTYTLKAKEDPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
molecule keywords YbbR family protein
total genus 5
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2010-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2l3uA00
2L3UA 5HQHA 2L5NA 3LYWA 2KQ1A 2KPUA
chains in the Genus database with same CATH superfamily
4A3MC 4C3JC 4QJVA 4Y7NC 3RZOC 4A3JC 3S1QC 3GTPC 3S2HC 4KN7A 2JA8C 3GTMC 2E2HC 4U67S 4C2MC 2YU9C 3HKZD 3DXJA 3S15C 5IP9C 2KQ1A 2A6HA 1ZYRA 1BDFA 1TWFC 4A3GC 3S17C 4WCES 5IYDC 2O5JA 3PIOS 4BXXC 2NVYC 4KMUA 5JVHS 1R9TC 3I4NC 1TWAC 3PO2C 3DLLS 2KXYA 4X6AC 2VUMC 4YFNA 2ZJQS 2E2JC 2L5NA 5C44C 2O5IA 4IO9S 3GTLC 2NVQC 5TMFA 3PO3C 3FKIC 5IP7C 4JK1A 2A68A 2PA8D 4WFNS 5C4XC 3WODA 2R93C 1I3QC 2NVXC 4LJZA 2A69A 5HQHA 1I6HC 4Y52C 1TWGC 2NVTC 2PPBA 1YNJA 3CQZC 4ZH4A 4QIWD 3H0GC 2A6EA 3GTKC 3H3VD 4XSZA 3S1MC 2PMZD 3S1NC 1I50C 4OIPA 1TWHC 3CF5S 4A93C 1WCMC 5HL7S 4G7HA 4YFKA 2ZJRS 2R92C 1SFOC 4LK1A 3GTQC 3M4OC 2L3UA 3M3YC 4C3IC 4G7OA 2WB1D 3PIPS 1Y1WC 4OIRA 4BY7C 3I4MC 4XLNA 4MEXA 2CW0A 4OIOA 2JA5C 1FEUA 3HOUC 2E2IC 1TWCC 4MEYA 3HOVC 3S2DC 5DM7S 4IOAS 4WF9S 1K83C 1HQMA 3S14C 1Y1VC 4A3IC 4WFBS 5JVGS 1SMYA 3GTOC 3HOWC 5TMCA 4A3DC 2WAQD 4YFXA 3RZDC 4BBRC 2BE5A 4G7ZA 3S1RC 4A3CC 2Y0SD 5IYBC 4LLGA 4NOIA 4Q5SA 4IOCS 3LYWA 4A3FC 3HOXC 2KPUA 4BBSC 4GZYA 4AYBD 3GTGC 4Q4ZA 2R7ZC 4OIQA 3K7AC 2B63C 2JA7C 3S16C 1I6VA 4YG2A 5C3EC 5IYCC 3HOYC 4XSXA 4MQ9A 4XLPA 5D4DA 4BY1C 4A3BC 4KN4A 1YNNA 1IW7A 5FLMC 3GTJC 4A3LC 4LK0A 3HOZC 4C3HC 5C4JC 4A3EC 5DM6S 4OINA 2JA6C 4A3KC 4WFAS 2ZJPS 3EQLA
chains in the Genus database with same CATH topology
2L3UA 5HQHA 2L5NA 3LYWA 2KQ1A 2KPUA 2KXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3U A;  5HQH A;  2L5N A;  3LYW A;  2KQ1 A;  2KPU A; 
#chains in the Genus database with same CATH topology
 4A3M C;  4C3J C;  4QJV A;  4Y7N C;  3RZO C;  4A3J C;  3S1Q C;  3GTP C;  3S2H C;  4KN7 A;  2JA8 C;  3GTM C;  2E2H C;  4U67 S;  4C2M C;  2YU9 C;  3HKZ D;  3DXJ A;  3S15 C;  5IP9 C;  2KQ1 A;  2A6H A;  1ZYR A;  1BDF A;  1TWF C;  4A3G C;  3S17 C;  4WCE S;  5IYD C;  2O5J A;  3PIO S;  4BXX C;  2NVY C;  4KMU A;  5JVH S;  1R9T C;  3I4N C;  1TWA C;  3PO2 C;  3DLL S;  2KXY A;  4X6A C;  2VUM C;  4YFN A;  2ZJQ S;  2E2J C;  2L5N A;  5C44 C;  2O5I A;  4IO9 S;  3GTL C;  2NVQ C;  5TMF A;  3PO3 C;  3FKI C;  5IP7 C;  4JK1 A;  2A68 A;  2PA8 D;  4WFN S;  5C4X C;  3WOD A;  2R93 C;  1I3Q C;  2NVX C;  4LJZ A;  2A69 A;  5HQH A;  1I6H C;  4Y52 C;  1TWG C;  2NVT C;  2PPB A;  1YNJ A;  3CQZ C;  4ZH4 A;  4QIW D;  3H0G C;  2A6E A;  3GTK C;  3H3V D;  4XSZ A;  3S1M C;  2PMZ D;  3S1N C;  1I50 C;  4OIP A;  1TWH C;  3CF5 S;  4A93 C;  1WCM C;  5HL7 S;  4G7H A;  4YFK A;  2ZJR S;  2R92 C;  1SFO C;  4LK1 A;  3GTQ C;  3M4O C;  2L3U A;  3M3Y C;  4C3I C;  4G7O A;  2WB1 D;  3PIP S;  1Y1W C;  4OIR A;  4BY7 C;  3I4M C;  4XLN A;  4MEX A;  2CW0 A;  4OIO A;  2JA5 C;  1FEU A;  3HOU C;  2E2I C;  1TWC C;  4MEY A;  3HOV C;  3S2D C;  5DM7 S;  4IOA S;  4WF9 S;  1K83 C;  1HQM A;  3S14 C;  1Y1V C;  4A3I C;  4WFB S;  5JVG S;  1SMY A;  3GTO C;  3HOW C;  5TMC A;  4A3D C;  2WAQ D;  4YFX A;  3RZD C;  4BBR C;  2BE5 A;  4G7Z A;  3S1R C;  4A3C C;  2Y0S D;  5IYB C;  4LLG A;  4NOI A;  4Q5S A;  4IOC S;  3LYW A;  4A3F C;  3HOX C;  2KPU A;  4BBS C;  4GZY A;  4AYB D;  3GTG C;  4Q4Z A;  2R7Z C;  4OIQ A;  3K7A C;  2B63 C;  2JA7 C;  3S16 C;  1I6V A;  4YG2 A;  5C3E C;  5IYC C;  3HOY C;  4XSX A;  4MQ9 A;  4XLP A;  5D4D A;  4BY1 C;  4A3B C;  4KN4 A;  1YNN A;  1IW7 A;  5FLM C;  3GTJ C;  4A3L C;  4LK0 A;  3HOZ C;  4C3H C;  5C4J C;  4A3E C;  5DM6 S;  4OIN A;  2JA6 C;  4A3K C;  4WFA S;  2ZJP S;  3EQL A; 
#chains in the Genus database with same CATH homology
 2L3U A;  5HQH A;  2L5N A;  3LYW A;  2KQ1 A;  2KPU A;  2KXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...