2L3UA

Solution structure of domain iv from the ybbr family protein of desulfitobacterium hafniense: northeast structural genomics consortium target dhr29a
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
98
structure length
98
Chain Sequence
MKTLYDLPIVLRNLPEDLVLEKPLPEVSVTIRAYPEILNNLTKEQISLWIDATGKAVGEHTVKIYWQLPAGIEMVSIPDVTYTLKAKEDPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YbbR family protein
publication title Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 5
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2010-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2l3uA00
2L5NA 2KQ1A 3LYWA 2L3UA 5HQHA 2KPUA
chains in the Genus database with same CATH superfamily
4LLGA 3GTPC 4OIPA 2B63C 2YU9C 3HKZD 4AYBD 4YFNA 5TMFA 4WF9S 2A69A 4YFKA 3HOUC 1Y1VC 4NOIA 3S14C 3S15C 4OIOA 4MEYA 4A3KC 4LK0A 4G7ZA 1I6VA 4YG2A 3EQLA 3H0GC 4A3FC 4YFXA 3GTOC 2O5IA 3S16C 3GTKC 1Y1WC 4KN4A 4LK1A 2KPUA 5IP7C 2JA6C 3I4NC 4BBRC 4G7OA 5JVHS 5IYBC 3HOZC 2CW0A 4WFNS 1K83C 1YNNA 4QJVA 3S1MC 4QIWD 4ZH4A 5DM7S 2PA8D 2Y0SD 5IYDC 4A3EC 3GTMC 5DM6S 3S2HC 2O5JA 2KQ1A 3K7AC 4MQ9A 4X6AC 4BXXC 3S17C 1FEUA 2VUMC 4WFBS 2BE5A 4BBSC 3DLLS 2JA5C 2ZJPS 4OINA 4A3LC 1TWCC 1R9TC 4G7HA 3RZOC 2E2JC 4Y52C 4Y7NC 2E2IC 5IP9C 2L3UA 4XLNA 3RZDC 5HQHA 4C2MC 2JA8C 1BDFA 3GTQC 1IW7A 3S1QC 3HOVC 2R92C 4KMUA 4OIRA 2ZJRS 4KN7A 5HL7S 2R7ZC 4A93C 3PO2C 4JK1A 3M3YC 2L5NA 4OIQA 2WB1D 4XSZA 2A6EA 1YNJA 3S2DC 5C4XC 2NVTC 5IYCC 4A3MC 3HOXC 1TWFC 4A3JC 4A3DC 3CQZC 3S1RC 4C3JC 4IOCS 4WCES 4A3GC 4XSXA 2R93C 3GTJC 3GTGC 2PPBA 2NVYC 3FKIC 4C3IC 4BY7C 4MEXA 1HQMA 3H3VD 4C3HC 3GTLC 5JVGS 2A68A 5C3EC 3PIOS 1WCMC 1SFOC 4Q4ZA 3DXJA 2NVQC 4U67S 4BY1C 3PIPS 3M4OC 4GZYA 3LYWA 4A3IC 5D4DA 2NVXC 3PO3C 4LJZA 3I4MC 1TWHC 4IOAS 1I6HC 4XLPA 3WODA 1TWGC 2WAQD 5FLMC 3S1NC 3HOWC 4Q5SA 3HOYC 1I50C 2A6HA 2PMZD 2E2HC 4A3BC 1I3QC 5C44C 4A3CC 5C4JC 2JA7C 1ZYRA 2ZJQS 4WFAS 1SMYA 5TMCA 4IO9S 1TWAC 3CF5S 2KXYA
chains in the Genus database with same CATH topology
2L5NA 2KQ1A 3LYWA 2L3UA 5HQHA 2KPUA 2KXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5N A;  2KQ1 A;  3LYW A;  2L3U A;  5HQH A;  2KPU A; 
#chains in the Genus database with same CATH topology
 4LLG A;  3GTP C;  4OIP A;  2B63 C;  2YU9 C;  3HKZ D;  4AYB D;  4YFN A;  5TMF A;  4WF9 S;  2A69 A;  4YFK A;  3HOU C;  1Y1V C;  4NOI A;  3S14 C;  3S15 C;  4OIO A;  4MEY A;  4A3K C;  4LK0 A;  4G7Z A;  1I6V A;  4YG2 A;  3EQL A;  3H0G C;  4A3F C;  4YFX A;  3GTO C;  2O5I A;  3S16 C;  3GTK C;  1Y1W C;  4KN4 A;  4LK1 A;  2KPU A;  5IP7 C;  2JA6 C;  3I4N C;  4BBR C;  4G7O A;  5JVH S;  5IYB C;  3HOZ C;  2CW0 A;  4WFN S;  1K83 C;  1YNN A;  4QJV A;  3S1M C;  4QIW D;  4ZH4 A;  5DM7 S;  2PA8 D;  2Y0S D;  5IYD C;  4A3E C;  3GTM C;  5DM6 S;  3S2H C;  2O5J A;  2KQ1 A;  3K7A C;  4MQ9 A;  4X6A C;  4BXX C;  3S17 C;  1FEU A;  2VUM C;  4WFB S;  2BE5 A;  4BBS C;  3DLL S;  2JA5 C;  2ZJP S;  4OIN A;  4A3L C;  1TWC C;  1R9T C;  4G7H A;  3RZO C;  2E2J C;  4Y52 C;  4Y7N C;  2E2I C;  5IP9 C;  2L3U A;  4XLN A;  3RZD C;  5HQH A;  4C2M C;  2JA8 C;  1BDF A;  3GTQ C;  1IW7 A;  3S1Q C;  3HOV C;  2R92 C;  4KMU A;  4OIR A;  2ZJR S;  4KN7 A;  5HL7 S;  2R7Z C;  4A93 C;  3PO2 C;  4JK1 A;  3M3Y C;  2L5N A;  4OIQ A;  2WB1 D;  4XSZ A;  2A6E A;  1YNJ A;  3S2D C;  5C4X C;  2NVT C;  5IYC C;  4A3M C;  3HOX C;  1TWF C;  4A3J C;  4A3D C;  3CQZ C;  3S1R C;  4C3J C;  4IOC S;  4WCE S;  4A3G C;  4XSX A;  2R93 C;  3GTJ C;  3GTG C;  2PPB A;  2NVY C;  3FKI C;  4C3I C;  4BY7 C;  4MEX A;  1HQM A;  3H3V D;  4C3H C;  3GTL C;  5JVG S;  2A68 A;  5C3E C;  3PIO S;  1WCM C;  1SFO C;  4Q4Z A;  3DXJ A;  2NVQ C;  4U67 S;  4BY1 C;  3PIP S;  3M4O C;  4GZY A;  3LYW A;  4A3I C;  5D4D A;  2NVX C;  3PO3 C;  4LJZ A;  3I4M C;  1TWH C;  4IOA S;  1I6H C;  4XLP A;  3WOD A;  1TWG C;  2WAQ D;  5FLM C;  3S1N C;  3HOW C;  4Q5S A;  3HOY C;  1I50 C;  2A6H A;  2PMZ D;  2E2H C;  4A3B C;  1I3Q C;  5C44 C;  4A3C C;  5C4J C;  2JA7 C;  1ZYR A;  2ZJQ S;  4WFA S;  1SMY A;  5TMC A;  4IO9 S;  1TWA C;  3CF5 S;  2KXY A; 
#chains in the Genus database with same CATH homology
 2L5N A;  2KQ1 A;  3LYW A;  2L3U A;  5HQH A;  2KPU A;  2KXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...