The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
143
|
structure length |
143
|
Chain Sequence |
MPLEWRAGASSDEINAIIRAVYRQVLGNDYVMSTERLTSAESLLRGGEISVRDFVRAVALSELYREKFFHNNAHNRFIELNFKHLLGRAPYDQAEVAAHAATYHSHGYDADINSYIDSAEYTESFGDNVVPYFRGLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Photosynthesis
|
molecule keywords |
Phycobilisome rod linker polypeptide
|
publication title |
Solution NMR Structure of the PBS linker domain of phycobilisome rod linker polypeptide from Synechococcus elongatus, Northeast Structural Genomics Consortium Target SnR168A
rcsb |
source organism |
Synechococcus elongatus
|
total genus |
45
|
structure length |
143
|
sequence length |
143
|
ec nomenclature | |
pdb deposition date | 2010-09-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00427 | PBS_linker_poly | Phycobilisome Linker polypeptide |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | serine acetyltransferase, domain 1 | serine acetyltransferase, domain 1 |
#chains in the Genus database with same CATH superfamily 3PRU A; 2KY4 A; 2L8V A; 3OHW A; 2L3W A; 2L06 A; 3OSJ A; 3NPH B; #chains in the Genus database with same CATH topology 3GVD A; 2KY4 A; 4N69 A; 1S80 A; 4HZD A; 3Q1X A; 1T3D A; 3MC4 A; 4N6B A; 2L06 A; 2L3W A; 3NPH B; 2L8V A; 1SSM A; 4N6A A; 3P1B A; 4H7O A; 3OSJ A; 3P47 A; 1SSQ A; 3F1X A; 4HZC A; 3PRU A; 3OHW A; 1SST A; #chains in the Genus database with same CATH homology 3GVD A; 2KY4 A; 4N69 A; 1S80 A; 4HZD A; 3Q1X A; 1T3D A; 3MC4 A; 4N6B A; 2L06 A; 2L3W A; 3NPH B; 2L8V A; 1SSM A; 4N6A A; 3P1B A; 4H7O A; 3OSJ A; 3P47 A; 1SSQ A; 3F1X A; 4HZC A; 3PRU A; 3OHW A; 1SST A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...