2L3WA

Solution nmr structure of the pbs linker domain of phycobilisome rod linker polypeptide from synechococcus elongatus, northeast structural genomics consortium target snr168a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
MPLEWRAGASSDEINAIIRAVYRQVLGNDYVMSTERLTSAESLLRGGEISVRDFVRAVALSELYREKFFHNNAHNRFIELNFKHLLGRAPYDQAEVAAHAATYHSHGYDADINSYIDSAEYTESFGDNVVPYFRGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phycobilisome rod linker polypeptide
publication title Solution NMR Structure of the PBS linker domain of phycobilisome rod linker polypeptide from Synechococcus elongatus, Northeast Structural Genomics Consortium Target SnR168A
rcsb
source organism Synechococcus elongatus
molecule tags Photosynthesis
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00427 PBS_linker_poly Phycobilisome Linker polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.20 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 2l3wA01
3OHWA 3PRUA 3NPHB 3OSJA 2L06A 2L8VA 2KY4A 2L3WA
chains in the Genus database with same CATH superfamily
3PRUA 3OSJA 3MC4A 1SSQA 1SSTA 2L8VA 1S80A 4HZDA 2KY4A 4N69A 2L06A 3P1BA 4H7OA 4HZCA 3Q1XA 3OHWA 4N6BA 3GVDA 3P47A 3F1XA 3NPHB 4N6AA 1T3DA 1SSMA 2L3WA
chains in the Genus database with same CATH topology
3PRUA 3OSJA 3MC4A 1SSQA 1SSTA 2L8VA 1S80A 4HZDA 2KY4A 4N69A 2L06A 3P1BA 4H7OA 4HZCA 3Q1XA 3OHWA 4N6BA 3GVDA 3P47A 3F1XA 3NPHB 4N6AA 1T3DA 1SSMA 2L3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHW A;  3PRU A;  3NPH B;  3OSJ A;  2L06 A;  2L8V A;  2KY4 A;  2L3W A; 
#chains in the Genus database with same CATH topology
 3PRU A;  3OSJ A;  3MC4 A;  1SSQ A;  1SST A;  2L8V A;  1S80 A;  4HZD A;  2KY4 A;  4N69 A;  2L06 A;  3P1B A;  4H7O A;  4HZC A;  3Q1X A;  3OHW A;  4N6B A;  3GVD A;  3P47 A;  3F1X A;  3NPH B;  4N6A A;  1T3D A;  1SSM A;  2L3W A; 
#chains in the Genus database with same CATH homology
 3PRU A;  3OSJ A;  3MC4 A;  1SSQ A;  1SST A;  2L8V A;  1S80 A;  4HZD A;  2KY4 A;  4N69 A;  2L06 A;  3P1B A;  4H7O A;  4HZC A;  3Q1X A;  3OHW A;  4N6B A;  3GVD A;  3P47 A;  3F1X A;  3NPH B;  4N6A A;  1T3D A;  1SSM A;  2L3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...