2L4NA

Solution structure of the chemokine ccl21
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
b'SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 21
publication title Solution structure of CCL21 and identification of a putative CCR7 binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l4nA00
5EPJA 1X32A 2FHTA 2FINB 4IURA 2FMMA 1F9PA 1SDFA 1BF4A 3LWEA 4X3SA 4IUTA 1WTRA 1NR4A 3FPUB 1VMPA 1HRJA 4OIJA 1E0BA 1WTPA 1NAPA 2MP1A 2FJ2A 2EE1A 2XIWA 4X3KA 4ZKCB 1WTVA 1B50A 5T1IA 1WTXA 1BO0A 1PFNA 2BDNA 4IUPA 1HFNA 2HUGA 4IUVA 1RHPA 1KNEA 3H91A 2L4NA 5EKIA 3DEPA 4ZKBB 2Q8TA 1MSGA 1XX8A 1CA5A 1B4OA 1F2LA 1ESRA 2H1EA 2B2TA 2MPMA 3D6WA 4QUCA 3KBXA 1F9SA 2B2YC 3I3CA 5D65A 1DOLA 2RVLA 4CJ1B 1B3AA 1WD1A 4XT3B 3GV3A 5EQ0A 1C8CA 5AFWA 5DNFA 3GV6A 3TN2A 1AP0A 1SSOA 1WTQA 1QE6A 2KEEA 1HA6A 2B2UA 4RAUC 2L1BA 2HCIA 1LV9A 2Q8RE 2N88A 4HAEA 1DOKA 1ILQA 1X3QA 2B2VC 4HCSA 2B2WC 1MI2A 4CJ2C 2K03A 1CM9A 2KEDA 1RTOA 2NZ1D 5E4XA 2HDLA 1RJTA 2DY8A 3I90A 2L12A 3QO2A 4RA8A 4ZK9B 1PFMA 2EOTA 2NWGA 2K28A 4U68A 2K1BA 1G91A 1QG7A 3I8ZA 2HCCA 2VXWA 1JE4A 1B2TA 3SVMA 1WD0A 1RODA 1DOMA 1PLFA 5JJZA 2N55A 1PDQA 1J9OA 4NW2A 1MGSA 3F2UA 1HHVA 4R8IA 2B2YA 2X69A 2K05A 4HEDA 5EJWA 2J7ZA 1O7YA 1G6ZA 3DM1A 2NYZD 1WTOA 1O80A 1WTWA 1ZXTA 2FFKB 1J8IA 4X3UA 4QUFA 1EIGA 4DN4M 1U4MA 5EPKA 1EQTA 2RSNA 1ICWA 2L11A 3MTSA 1GUWA 3HP3A 3TZDA 2B2VA 2D9UA 4X3TA 2B2WA 2DY7A 1O7ZA 3IL8A 3ONAB 5E4WC 4CJ0B 5EPLA 1NCVA 2EPBA 2X6LA 3P7JA 1SAPA 2RSOA 1QNKA 2HDMA 1HUMA 1M8AA 1AZQA 1WVLA 1ILPA 1X3PA 3IFDA 1F9QA 1U4PA 4MN3A 2RA4A 5COYA 2KUMA 1G2SA 1EL0A 1XYIA 3UI2A 1IL8A 5D14A 4ZAIA 1HFGA 2MGSA 5CORA 3FDTA 4IUUA 3R93A 1Q3LA 4UAIA 4XDXA 4LMQD 4IUQA 2IL8A 1BBXC 2KVMA 1PFBA 1A15A 1U4LA 1EOTA 3I91A 2KECA 1TVXA 2B2UC 4HSVA 4ZLTF 2JYOA 1IKMA 1DZ1A 1MSHA 5CMDA 3Q6SA 1HUNA 5CBAE 1IKLA 1RTNA 2CVRA 1AZPA 2M2LA 3MWYW 4XT1B 5CBEE 2X6GA 1ML0D 2JP1A 2K01A 1F9RA 1NR2A 2K04A 1S4ZA 2L9HA 3N52A 4R9WA 4RWSC 1B53A 1BNZA 1DONA 2MJ8A 2R3ZA 1JICA 3DEOA 1U4RA 1KNAA 4OIKA 1EIHA 3KUPA 2SDFA 3G7LA 2B2TC 5T1GA 1G2TA 1CA6A 1VMCA 4MHEA 4O42A 2KOLA
chains in the Genus database with same CATH superfamily
4GLAC 5EPJA 2G5DA 1YZ6A 1Z47A 2A6EC 3RZDB 2E2HH 1VQIA 1TWHH 5IP7G 3T1YL 3OMGA 3BS1A 4LF7Q 2E2HB 3J80L 2B3GA 1TWHB 4A3DH 4IUPA 4BBSG 2NB0A 5I2YA 2KENA 1QNUA 5EGTA 4P72A 1WCMH 1TS2A 1ZYRC 3BDOA 4A3DB 4GZYC 4JK1C 1VQNA 1L1OB 1YITA 2JA7H 1F77A 4A93G 4FDBA 1WCMB 1XTCD 1IYJB 1T5XD 4JV5L 2RQXA 4YY3L 1S72A 3KFUA 2YYZA 2JA7B 2KEEA 5I6WA 3PGZA 2G9HD 3A0JA 1EOVA 2NN6I 1LABA 4HCSA 1ZKOA 3ER0A 3W5OA 1IBLQ 2JN4A 3K7AH 4A4IA 4UP9A 1F2ZA 1SJHD 4JBJA 3J81c 4GN4B 4L8JA 3IAYA 3L7ZC 5IWAL 3MHBA 1LT5D 4LF9L 3A5ZB 4DNTB 5IYDH 3K7AB 1G91A 4P73A 3I8ZA 3CF5A 4DV1Q 2CQOA 3SVMA 2RDGA 3CCVA 1AE2A 2J7ZA 4PMBA 5IGBA 2EJGC 4DN4M 3SK4A 3M4QA 2DJGC 1VDZA 4Y7NH 1NNXA 4RH6A 3LX0A 4YHHQ 3J7AV 1JCKB 4OO1I 3S24A 5DLQE 4Y7NB 3CPFA 1GHKA 5I9PA 2N8NA 1F9QA 3IFDA 5CR3A 4YCWA 2RA4A 5I2XA 1G2SA 3NK9A 1SE3A 1EQQA 2PNRC 4ZQ3A 1UE1A 4GOPC 5CORA 1I6HH 4LMQD 3HEJA 1A0IA 5I6YA 4K0KL 2IY5B 1XXGA 5C44G 3T1YQ 4N8X1 5M5WH 1S3OA 1I6HB 2KCTA 4K2KA 5M3FH 4X6AH 2F3WA 5M5WB 3MFGA 5CBEE 5FLXL 5JEAJ 4QF4A 1J5EL 2K04A 3N52A 1EWCA 4RWSC 1S5CD 5M3FB 2CQAA 4KJOA 4LW1A 4BWGB 1SNPA 2MFIA 3K8AA 1PH7A 5T1GA 5C4HA 2NZHA 4YY3Q 5KIXA 1Y69U 4A3LH 1Y8OB 2V4DA 2PO4A 3EVQA 4PZ7A 3QG1A 4KJNA 2F0DA 1TU2B 4L5QA 4NB3A 5IWAQ 3D3RA 1TT2A 3NE5B 3SE0A 4L5SA 1KDAA 5IGEA 5IYBH 1YNJD 1FR3A 2OTJA 3SK5A 1X55A 1YJWA 5C5LA 1B7YB 3ZJYC 4IFDI 3IKJA 1XMOQ 1EY8A 2JA8H 1D6EC 4CJ1B 1B3AA 4K5WA 2QEJC 1Q81C 3NXWA 1SNDA 2KHSA 4AH6A 2EDGA 1SSOA 2B8FA 4DR6L 3MAQA 2B2UA 2JA8B 1TXYA 1LV9A 1A63A 2PPBC 4LF4L 2KEDA 4ALPA 4P71A 3BZCA 2VS1A 2PNHA 3M3YH 1YVCA 4DR2Q 1VQAA 2D0OA 2VUMG 4BA2I 1H9MA 3OHXC 3M3YB 2SOBA 1QOHA 4F7XA 1YNJC 3R2IA 1MD2D 3QJYA 3G4SA 5CV7A 1SXTA 5FLMH 1GO3E 2A68D 2NTSA 4BY7H 3PIP3 2B2WA 2BH8A 4J8QA 4L5RC 1HTLD 3EBEA 3ITPA 1QNKA 4M1UB 3KBGA 3U9SA 4BY7B 5M3MG 2PW5A 3I4NH 3E3XA 4DV3L 4RHRA 1IL8A 3ERQA 2ZM6L 2F4VQ 3JAMc 1EQVA 1TQOA 1A15A 3I55A 3AEVA 5FOBB 1K28A 2NBFA 1JB3A 5A2QL 3VDYA 1CHPD 3Q6SA 2UU9L 1TKWB 2JA5H 2RHSB 4DV0L 1NJIC 1Y1WH 2JA5B 4LF6L 1STYA 2A68C 1Z6HA 1MJEA 2RDHA 3D0FA 3L3OC 1Y1WB 2UUAL 5IP9H 4MHEA 3K5OA 4CDFC 4LNQA 4G57A 4JI3L 4IURA 3Q0AA 3VR4A 3LWUA 1SDFA 4MTNA 4KTAA 1PYSB 2AUKA 2IWHA 2OQKA 1EUJA 2VL6A 1GUTA 5JVG3 1G51A 3U50C 4HSPA 3A8KE 4ZKCB 1WTVA 4LFBQ 3NUCA 5T1IA 2BDNA 2UXCL 3RLNA 3K5LA 2UUCQ 1KNEA 3H91A 1JWUD 1PRTF 4LF8Q 2KCNA 1LLRD 2H1EA 1PTOD 3MEFA 3OWEB 3UDXA 4UHVA 3KF6B 1HH2P 2WKDA 3PV0A 2IT1A 2KHIA 1QVGA 3GV6A 5K36H 2B29A 1FNVA 2ZXRA 4DAYB 4DGZA 2L1BA 4A3DG 3T53B 2K03A 5C4JH 3WOEA 1CQFA 1RJTA 1JE5A 4DV3Q 2NWGA 4JI4L 2F4IA 3WWVA 1P16A 1S5DD 4HN7A 4HJ9A 3KDFB 5C4JB 3J81L 2CW0D 3H15A 2XGTA 2WAQG 5C0XI 1OXUA 2C9OA 1EYGA 1EFWA 1V1QA 4F87A 2XVSA 4IPDA 1WTWA 2UU9Q 4A3GG 5M5YB 3RLOA 3NHHA 3RMHA 4DV0Q 1JMCA 1PTOC 2Q2UA 5IYDG 4X3TA 3DWQA 1K8MA 1XJVA 5CGKA 1PYWD 1IBKL 2UUAQ 1EY5A 3CCJA 1GUSA 1XYIA 4H13C 1BDOA 1K73C 4ZUJA 1PYBA 4JI3Q 1EYCA 4UAIA 4DXGA 3FMCA 2E8GA 3X3MA 4Q5VA 1K8OA 1KRTA 2K5WA 2JA9A 4BY1G 1TS5A 4C2MH 2CW0C 4X66Q 1DZ1A 1MSHA 2YTVA 3NBIA 3KK7A 2I5LX 1HUNA 2VY3A 4G4KA 2IPKD 3URYA 4B3RQ 4C2MB 3CAMA 1YJ9A 4DK6C 2K01A 2MHVA 4POGA 1L0YB 4OIKA 1A3TA 1CT1D 4JI8L 1KXLA 4OHJA 3UDFA 3KF8A 4A3BH 3JC66 5EPKA 2K4KA 1X32A 1MIUA 1SYEA 2FHTA 3SEBA 5C3EG 1PZJD 2E2JH 4A3BB 2KBNA 5F2DA 3HOUH 5K5PA 4TVAB 5A35A 4HIOA 1N32L 3RD4A 3CQZH 1UEBA 2E2JB 2DNEA 3HOUB 3KLWA 3CC4A 2E5LL 1RHPA 3CQZB 3LGJA 2F52A 2PCFB 4K6LA 1M1KC 1K8GA 2YU9H 1GD7A 3TQYA 1DYQA 3OYYA 2OQ0A 5BN4A 4JYAL 1F9SA 3MVVA 3G71A 1WTHA 2YU9B 2A5HA 1NBWA 2JK8A 3HRZC 5C0XH 3QWNA 1STAA 1EWIA 2B2WC 2ZTDA 1IYVA 1CM9A 3BZDB 2AMCB 3QO2A 1IBKQ 5KRUA 4DK0A 1SYGA 3PCOB 4RGMA 4PZ6A 1JB7A 2OT2A 1IL2A 2Z6BA 5HY6A 4Y52H 3I72A 2SEBD 1QCBD 1CSPA 3W2DA 1J9OA 1LTTD 3F2UA 4NW2A 3F1ZA 5JEAG 5EJWA 4RGTA 4FXGC 4DV7L 3EQLC 1L0XB 3WDNA 3BJUA 4FF2A 1D1IA 1W2BA 5C4ZA 2XTIA 4DR3L 4A3JH 4GS3A 3ONAB 4PNYA 1K9MC 2QKIC 2C35B 4KY5A 2DUDA 5IGDA 1SE2A 1Q12A 4JI8Q 4A3JB 5LMUL 3H3VC 3PMFA 1SE4A 4KN4C 4JI6L 4DU9A 1SFOH 5KGUA 1M90C 2EYFA 2F3VA 3J80i 1CHQD 1X65A 1O78A 1A2UA 2D5DA 2I07B 2DJFC 4DUZL 3JAML 4KMUC 4IJLA 1CFMA 3OWFA 3MFYA 5EKKA 3HOZH 1O7IA 1AEXA 3I4NG 3K5MA 1ML0D 4DAPA 3HOXG 3TMEA 2K52A 3T13A 2UXBL 3HOZB 1EIHA 3HOWG 1JJ2A 1W6KA 2LSSA 1UE6A 1UAPA 3H0GH 2FINB 1WFQA 4XYOA 3D4DA 4XQQA 4GOPB 5IT9E 3H0GB 1XNRL 4UDUC 4NXMQ 4QMGA 3ULPA 3GTQB 2BCOA 2JE6I 3MXNB 3CCLA 3RZOH 1B50A 1GKHA 2HHHL 3PO2H 3PQIA 4H7BA 4IUVA 3PIPA 1PHJA 3PUWA 2Q8TA 4DAVA 3RZOB 3PO2B 5IGCA 1R4QB 1ASZA 2F0EA 4DV4L 4A3CG 1JJGA 4HMIA 1N33Q 3VYTA 4DR3Q 3RR5A 4CDEC 4RAUC 3A5UA 2AHOB 4GLVB 4A75A 1LM0A 1SMXA 3VA7A 1RTOA 3AYHB 5LMUQ 4ZK9B 1LT4D 2K28A 3GTOH 4JI6Q 3K59A 4DR5L 4J1MA 3AQQA 3GQBA 1G6PA 4OGQC 3FKIH 3DMUA 2PW7A 4ME3A 4GKKQ 3GTOB 2N49A 4JI7Q 3NTHA 1RDPD 2F0KA 1VF7A 4JI5Q 3FKIB 2FFKB 1TWFH 2LFNA 1EFID 4UY8C 2IHEA 3MTSA 1FNUA 1N8RC 1TWFB 2UXBQ 3DXJC 2E2IH 5FO8B 1C0AA 1ILPA 1V43A 3HFZB 1R9TH 4MN3A 1FJGL 5EBCA 1HR0Q 1PH4A 2ZTCA 4OX9L 1VQ7A 2E2IB 4C3IH 4XQJA 3V96A 2F0NA 2B39A 3S9WA 1R9TB 3PF5A 1RL2A 1Y1VH 2KECA 1ONLA 2K6AA 3I4MH 5NUCA 3Q8DA 2UXDL 1IKMA 1SLJA 1XNQQ 4PQXA 5FJ8H 2CCZA 4KHPQ 1Y1VB 1AZPA 4TQUS 3D8GA 3I4MB 3AU7A 3CCQA 4N9PA 1HPCA 4R4QA 4B3MQ 1JJCB 2R3ZA 5J1ZA 2A6ED 1PH8A 2R92H 4DFAA 1BVSA 3R3OA 1D7QA 4O42A 1Z9FA 2IX0A 1ENAA 2R92B 1BF4A 3LWEA 2Z9HA 4DR1L 2UUBQ 2XWBB 3E9HA 5GAHC 1B8AA 1YHQA 4R4OA 1Q86C 1YBYA 4K14A 4A3BG 3CC7A 1MSGA 4DK3C 1F2LA 3SK8A 1FGUA 4QUCA 1B9NA 2KJXA 1L2FA 1PZKD 3CRLC 3HOUG 1U9RA 2OEOA 2RVLA 4DPGA 3S1QH 4NMZA 3HKZG 4K6DA 3ICEA 1X3QA 2YV5A 3CKIB 3S1QB 2PMZB 5E4XA 2N3SA 2PMZE 1HNZL 2I46A 2K1BA 2VQFL 3IRBA 1UWVA 2JEAI 1WD0A 4B3TQ 4A3KH 3TRZA 5FLXE 4DUYQ 3X3NA 1Q7YC 2UXDQ 1O7YA 3I2ZA 2F0FA 4A3KB 1I4XA 4ZYSA 4GNXC 2RDFA 1JOQA 1LYLA 1FYCA 5IY0A 1ENFA 2EYMA 4GKJL 1EYAA 2J4XA 2KCMA 1PH1A 3M7GA 4HIDA 1RF2D 5IYCH 3F2CA 3PUZA 5FO7B 4P74A 2WIIB 1HR0W 4L5TA 1J6QA 4F8MA 1D5ZC 5BR8L 1DCZA 4KK7A 3T4AC 3A74A 4EGVA 4HIKA 3HKSA 1K8AC 2K5VA 4XIGS 3T51B 1S5BD 1EZ6A 2CVRA 1X3FA 3M85A 2N78A 1PTOB 2L9HA 1SN8A 4K8JA 1KNAA 1HQMC 5C3WA 1VQ9A 2PZTA 1STGA 2RCFA 1JT8A 3GO5A 3OW7A 1BR9A 1O7LA 4R1JA 4JBKA 3J81i 1PH3A 4X3SA 1HRJA 2IHFA 5G3LD 3V05A 5KNDA 3H3VI 4I7AA 3ZYYX 2Q8IB 4R4CA 2D62A 3BYYB 4C3HH 2A73B 1PZID 1TWCH 3H0GG 2R7ZH 4I7ZC 3VR3A 1PVOA 4XTCS 1A2TA 3F8TA 4C3HB 1ESRA 3L2PA 2Z6KA 3KBXA 3T56B 1TWCB 4CDDC 3BVGA 4JV5Q 2R7ZB 2V1CC 2ICEC 3DLLA 2CWPA 3TN2A 1AP0A 5ELOA 5JJIA 1LTGD 2QW7A 3C1EA 1HA6A 2HCIA 3PO2G 3CW2C 4AYBB 4LUZA 1UE5A 4AYBE 4KKSA 3I90A 2BH2A 2KA7A 3G48A 2WACA 4LF9Q 2A8VA 3CCEA 2WV6D 4A3IG 1LTBD 2NN6H 3GTPH 3SK6A 1X3EA 4JI2L 1I94L 1DXMA 2JQOA 1YIJA 3VYRA 3GTPB 5GAGC 3NWTA 2NYZD 1X9NA 5JPMC 1IYUA 3C2PA 1RCVD 3VR2A 4R8NA 2AQ1B 3KLSX 2CFMA 1RIPA 4RG1A 2EPBA 2Y0SB 4K8IA 1SBBB 1GUOA 2Y0SE 4FXKC 2LMCB 4PMCA 1MJCA 3E5SA 4KKTA 1PA6A 2F1MA 2NVYH 4WRDA 3GTMH 4K0KQ 2F0IA 4OO1H 4K2LA 3TBIB 1D5MC 3EJIA 5ISRA 1PFBA 2EY2A 2NVYB 2CHBD 3GTMB 3CCMA 3C46A 4J6HA 5CMDA 5ELBA 4ZRZA 2B63G 3H6MA 1CZWA 3UDIA 3RN5A 2HIVA 2F0OA 1I4QA 1J5EQ 1VQJA 4C3IG 3K57A 1S4ZA 1VQFA 1OXSC 3A7LA 3MXPA 4DF7A 3H3VH 1Y1VG 1A3VA 1NMGA 3MA2B 2Q2TA 5AJ3L 2PZUA 4KLKA 3OW2A 2BA1A 4WORA 3OOCA 4G7HC 1KRSA 4H02A 4EQOA 5DM73 3STBD 2JA6H 3J81E 1N34L 1XMQL 3FHWA 2ALYB 5LL6S 2LXKA 3NSWA 1PH9A 1IW7D 3BZKA 2FJ2A 2DNCA 1PMRA 2QEXA 4X65L 1ESFA 3EROA 4ID6A 2JA6B 1BO0A 2WINB 2R92G 3DWPA 1HFNA 1DGSA 1I94Q 4IOAA 4TKOB 2Z8LA 1FD7D 1WOCA 4BXXG 5KNBA 1FL0A 4YCVA 1SE8A 5I9OA 4DR6Q 4LF4Q 1EIFA 4IFDH 1LTLA 4FP5D 2GN5A 4FXDA 3A55A 4FF4A 3I73A 3NP8A 3STBC 5LMNL 3JAMi 5C4XH 1E7ZA 1EY0A 1IW7C 5IOCA 3HGBA 4IZ8A 1VS0A 5C4XB 1J8IA 2SNSA 3U9OA 1E22A 1XWEA 1EWHA 1ICWA 1DD2A 3RN2A 2VNUD 2E76C 2ZXOA 1EY9A 3CP0A 5E4WC 4B9WA 1WCMG 2J0TD 5EAYA 3NENA 2ATWA 3K7UC 3OMCA 3QOLA 3S15H 3ULJA 2JA7G 5COYA 2ZM6Q 1B1ZA 1HFGA 5AJ3Q 5M5YH 4H44C 3S2HH 3S15B 4Q0FA 1GUNA 3I91A 1N34Q 1GOZA 4DAMA 3S2HB 1VQBA 1C9OA 2YTYA 1PH5A 4X65Q 1CZGA 5GQOA 3J7YW 1I4RA 3GTJH 1LTID 2K75A 4XT1B 1QJOA 3CXCA 5JPNC 4LF6Q 3S2DH 3GP7A 1F9RA 1TWAH 4AQYL 3GTJB 4DR4L 1U4RA 2RBMA 3Q24A 4LUVA 2SDFA 3S2DB 3Q22A 2Z6KC 3D4RA 4UP8A 1TWAB 5H1SE 3W1GA 2R93H 3HOYH 1A6XA 2EYJA 3ULLA 3TDQA 2FMMA 3I56A 3O13A 3KF8B 4LK1C 5L37A 5KYIA 2R93B 2QF7A 3HOYB 4KD4A 5IT9c 2F0JA 3L9AX 1VQOA 2XIWA 2Z1CA 3J7AF 1VQ4A 2UXCQ 5J3BA 1PFNA 5C0XJ 5I4DA 1QVCA 1A8VA 4FYDA 2L4NA 4WJWA 4ZKBB 1HNWL 1JWSD 1B4OA 2MPMA 3S16H 3FEWX 3E0JA 2Q2IA 1LO5D 1PH2A 3DUZA 1V9PA 4QL5A 1PV4A 5ELCA 3S16B 5M3FG 4LFAL 2F0LA 4ME5A 4C3HG 4HAEA 4G7ZC 3EA6A 4DV2L 1SEBD 3OTOL 3M9BA 1KQSA 1SNOA 2OCEA 4JI4Q 1EY4A 1SNQA 5CV4A 3F2DA 1Q46A 3JAME 2F0UA 3A54A 2AWNA 1VQLA 2B8GA 4A3LG 2L15A 1DOMA 1K3RA 1PLFA 1CTMA 3PO3B 1B44D 4K5XA 3BG3A 1IBML 1O80A 1HQRD 2XRQD 3HP3A 2D9UA 2NN6G 5IYBG 3IL8A 3K80C 1NY4A 2FXQA 1OO9B 2XSCA 4DV5L 2X6LA 1Y8PB 1B9MA 1SAPA 2RSOA 2E74C 4HJAA 3BDLA 1HJPA 1QZGA 2JA8G 4BBSH 5D14A 4LFCL 2MGSA 1E2VA 3EFXD 4RFBA 1H9SA 4IUQA 2IL8A 2IJ0A 3TZUA 5GROA 3S14H 3E0EA 4BBSB 4A3FH 3U58A 4A93H 4HSVA 1CUKA 4QIWB 3S14B 4QIWE 1H9JA 1RTNA 4A3FB 3MZ5A 4A93B 1P8LA 4DV6L 3P1HA 4RKLA 4GNXB 3UDGA 3L0OA 1BNZA 1LT3D 2H5XA 4IUNA 3A7AB 4O1NA 3GTKH 3KUPA 1CA6A 1I3QH 4QQBX 1PXUA 5FLMG 4LFAQ 2PYKA 3GTKB 3HOVH 2A1AA 3FP9A 4P2CB 3NBHA 4BY7G 1I3QB 3BDCA 1GJXA 2MNAA 2XN9C 4IUTA 4JI1L 3OTOQ 3FPUB 4DV2Q 1N32Q 4GNXA 1QVFA 3HOVB 2WKCA 2MP1A 2EE1A 5D3IB 5CV6A 1Q1BA 1WTXA 2E5LQ 1WYDA 1X3GA 1OXTA 4ULLA 4HJ8A 4JYAQ 3D6WA 2O5IC 2NTTA 1E1OA 2SNMA 3T1HL 5DNFA 3GTQH 2JA5G 4PG3A 1QE6A 1WTQA 3AFQA 2Q8RE 1B2TA 5C44H 1Y1WG 1OXVA 3TS0A 1KAWA 1I4GA 4N8FA 4YCUA 1SNCA 2WB1B 4Z9CB 5C44B 3PUVA 2GVBA 2WB1E 5IP9G 4LFCQ 2WFWA 4LJZC 1CKNA 2VZAA 1VQCA 4X62L 4DV7Q 4R8IA 2E2DC 3B6YA 5JJKA 4EX5A 2P5ZX 3GTLH 1EU3A 4RGNA 3K5NA 5CYUA 1LTRD 3QR8A 3PIO3 1BUVT 2RSNA 2VQEL 2L11A 3DWAA 4DV6Q 3GTLB 2AUJD 1VQ8A 1O7ZA 5C4XG 2R7FA 2F0GA 4NP5A 1U4PA 1Q1EA 4OXPA 4DK1A 2R61A 3I4OA 4RCOA 3R93A 1Q3LA 4XDXA 4M8AA 5K36G 2HQLA 1VCIA 5J22A 2F3IA 1A3UA 4DUZQ 4JI1Q 2LXJA 1EY7A 4NXNL 1Q90A 2XNAC 3PUYA 1HTPA 4QCLA 1Y14B 2JP1A 4R9WA 3VR6A 2LY7A 2O5JC 2QGQA 4KN7C 1TR5A 1ET6A 2A6HD 3E6ZX 2BA0A 3T1HQ 2VUMH 3J80E 5CV5A 4ABNA 2ASBA 1PTOF 4NPSA 3CCSA 1XNRQ 1F9PA 2VUMB 2CH4A 2HD3A 1NR4A 2NUCA 1VMPA 4J15A 1NE3A 4XYQA 2HHHQ 4HMJA 5E7NA 5BN3A 2ES2A 4LF7L 2EIFA 2EJFC 2QCPX 4BBRH 2IX3A 1E1TA 3D31A 3E9IA 1F2MA 1DJRD 2BOSA 3U4ZA 4X62Q 2K5DA 2G9DA 5FK9C 3KJOA 4KY6A 4MNOA 4DV4Q 2B2TA 1Q82C 4OWXB 4BBRB 3M4OH 1H95A 3K0YA 3I3CA 4JPBW 5D65A 4XT3B 4JBMA 3H09A 5M3MB 3QIAA 5FKAC 3M4OB 1G8ZD 1QUQA 2A6HC 4V190 4CJ2C 1H9KA 2KQ3A 5IIFA 3K58A 1PRTD 2NZOA 5DEHA 4E6IA 4DR5Q 3K81C 1QG7A 3CC2A 5GAEC 5C5MA 1NMFA 4DV1L 2RF4A 5EBDA 3HG9A 2ENBA 3BVZA 3F2BA 2B2YA 2EXDA 2X69A 4HR7B 1KAAA 4PV1C 4HJ5A 5D3DA 3OIPA 3H94A 2KCCA 1VQPA 2A74C 4O2DA 3W3AA 3C3LA 1IZ6A 4ODGA 2DN8A 4DKAC 1FJGQ 3P7JA 2HDMA 1HUMA 4OX9Q 3NWSA 3PUXA 1CSQA 3TSSA 1PRTC 1BBXC 5C0XG 2MUYA 4LWCA 1X54A 4EQNA 2AWOA 2F03A 4K5VA 2CWAA 2RHQB 3V2TA 2Z0SA 4MTKA 2Q2HA 1YEZA 1CKOA 1V8QA 2ZJPA 3N6RA 1HZAA 4DXFA 1D8LA 4JCVE 1HZCA 1M4VA 5KYLA 1V1PA 3BU2A 3OIQA 2IW3A 3P20A 4DA2A 2KHJA 2OXPA 3KJPA 1BOSA 4A3FG 3VR5A 2F0QA 1KHIA 4CBVA 1AW7A 5GADC 4OELB 2LS01 3QOJA 4XQNA 4DR1Q 4A3JG 1S5FD 1TY0A 2F0MA 4TRDA 1HCZA 2EYPA 4A3GH 1PTOH 2WAQB 5JJLA 4X3KA 1XPOA 2WAQE 4KHZA 3CMEA 3HS0C 4B3SL 3PSIA 2MQHA 1L1OA 4A3GB 5HGQA 4IO9A 1JOKA 1CA5A 2RCNA 4EQ5A 4TSSA 3HOVG 1I5FA 2BE5D 4C1NI 4RGOS 5J39A 1HZ9A 5KNCA 1KD1C 1STEA 4AIMA 1QWYA 1XMOL 1S40A 3RLFA 2IX1A 4RHSA 1F2YA 4OL7A 3HOZG 4RKBA 1Y8NB 4GN5A 4BY1H 1SRUA 1HNZQ 4FVMA 2XWJB 2HDLA 2L12A 5M9OA 2VQFQ 1PFMA 2EOTA 4BY1B 3A8JE 2AQ3B 4JW0A 4DR2L 5IGFA 4R4TA 1BBUA 1XPRA 3RUZA 2WB1G 4B08A 4ILWA 1WTOA 1UEAB 1EYDA 1ZXTA 4OEMB 2YTXA 1LTSD 5C3EH 2BE5C 4FNFA 2LKVA 2H4OA 3GTGH 4GKJQ 4LUOA 4C56C 5C3EB 1M8AA 5E1FA 1PFSA 3P75A 2A19A 1VF5C 5A2QE 3GTGB 1B3QA 2M00A 4ZAIA 1OXXK 1QB5D 5BR8Q 2F4VL 1I4HA 3S1NH 1EOTA 1K0RA 3W1BA 1AN8A 3A56A 1VQEA 4DR7L 3CU7A 2JJQA 3HZXA 3MC0B 3S1NB 2OTLA 4B3SQ 2EYLA 1SYDA 2AQ2B 4CDCC 1I6VC 2JEBI 1SJED 1NR2A 3D6CA 1DONA 3FKIG 1EQRA 5LL6X 2R6GA 2TSSA 4EVOA 3OPOA 1DM0B 1BQQT 4JBWA 3G7LA 2B2TC 4P75A 4F88A 3I7FA 1ENCA 2KOLA 2DGYA 3KLSA 1BCPD 1XPUA 1VQMA 5ELNA 3KYHC 4B9XA 3NQIA 3MXUA 5JVH3 3U4VA 4ZCKA 2OF1A 5JEAH 3J7A5 2VB3X 2K7VA 1E0BA 2JXMB 1WTPA 3TP7A 3I70A 3KLRA 1CI3M 1C7YA 4LFBL 3PIOA 4A3EH 4KHVA 4IFDJ 1RD9D 1SR3A 2UUCL 1Q8KA 1PH6A 1E2ZA 4LF8L 2QDLA 4A3EB 2B2YC 2EQSA 3K6OA 3I4MG 1BBWA 2L0CA 2Z4IA 5DM63 5FJ8G 5EQ0A 1C8CA 1OTCA 4A3MH 5AFWA 2HT1A 1AE3A 4HTHA 2CH4W 1EEID 4GN3B 4GLXA 2N88A 4BBRG 4A3MB 1BCPC 5CV9A 2NZ1D 1K0SA 4APVA 5C3XA 4NDXA 4G7OC 1KLUD 3NELA 3CCUA 1H9RA 4JI2Q 2HIXA 4JC0A 5EKLA 1TS4A 3HOXH 2M9VA 4OONA 2N55A 1GHJA 5JJZA 4OWWB 3I4NB 1MGSA 4XXEA 2PQAB 3HOWH 4DR7Q 1VQHA 3A8IE 3DM1A 2CKZB 1VQ6A 3HOXB 1EIGA 2QILA 2ID0A 3TP6A 1A62A 3TREA 3HOWB 2B2VA 2Z4HA 3J81j 5C6AA 5EPLA 1YJNA 3UE1A 1WVLA 3IFTA 2MO0A 2PQAA 1WJJA 5IGGA 1YHAA 1HNXL 4S3SA 1VQ5A 1GUGA 1LACA 4CHTB 1W3SA 4A3CH 1RKNA 4JOIA 4PZ8A 4L63B 4X66L 3M4YA 3K0XA 1IKLA 2F0VA 2D2CC 1TY2A 2X6GA 1L1OC 4B3RL 1FNWA 4QB4A 4A3KG 1D2BA 5IODA 1Q8IA 2NVQH 3PF4A 2QA4A 5M5XH 4L6TB 2JSOA 1X6OA 3CD6A 5DAUA 3VYSA 2NVQB 2E75C 1LTAD 3AMUA 5M5XB 4MZ9A 1XMQQ 2R7DA 3T16A 2F0TA 2FMCA 1KLGD 2EY1A 2K50A 2VW9A 4IN3A 3CMAA 4C1NK 2O2LD 4FF3A 5IYCG 2EXZA 1D5XC 1II3A 3SHLA 3KF6A 2F0HA 3DEPA 4YWLA 1FGBD 3OSOA 4DAYA 2PZWA 3GV3A 2L55A 1YNND 1DOKA 2K5QA 1B70B 3KDFA 4RA8A 4IJHA 5LMNQ 4I65A 2L5TA 4U68A 5ELEA 4IALA 1HNXQ 1N9WA 4QJFA 2I5HA 4BS9A 3TP5A 1VQDA 1SYBA 1JR0D 1I4PA 4QUFA 2K14A 1K83H 4C3JH 1GUWA 1NUCA 4ZUIA 4JI0L 2DY7A 4CJ0B 3NQTA 5HURA 2R7ZG 1K83B 1KC8C 4C3JB 3NTKA 1AZQA 4RCNA 1KDCA 1TWGH 2KUMA 4BA1I 3PO3H 3ND8A 1YNNC 1EL0A 4DNIA 3UI2A 3DHQA 1WI5A 4KD3A 3FDTA 4AYBG 3TEHB 1EZ8A 2WP8J 1TWGB 1JQYD 1E3PA 4RMFA 1JWMD 1EEFD 1STNA 4KY7A 3NEMA 1H9SB 1TVXA 2B2UC 1YI2A 1STHA 3S1RH 1R4PB 1BXTA 3DM3A 5IP7H 5G3LF 4AQYQ 1W6JA 3LNNA 4DR4Q 3S1RB 1B53A 2MJ8A 3HKZB 1JICA 4JVZA 3HKZE 2ICIA 3VYUA 1SROA 1VMCA 1LUZA 5CC4A 2Y0SG 4FF1A 4WJ3M 4LAAA 1L0WA 3J80c 1PRTB 1WTRA 1BKBA 4NKLA 4OIJA 4NXML 4WFN3 3NBHB 2ZTEA 4KKUA 3SR1A 1UUPA 3CPWA 2ZT9C 4OO1G 1JC7A 4IQZA 1HNWQ 2EY6A 1XX8A 3CCRA 1EY6A 3ERSX 1ICFB 2O4XA 2K5NA 1DOLA 1WD1A 1N36L 1G291 4JI0Q 2BDOA 4KI0A 1N33L 3MEHA 4O0AA 2OWOA 3MXGA 2B2VC 1TIID 4A3EG 1MI2A 4IPHA 3TP8A 3G6JB 2A69D 1KTKA 2GA4B 3I4LA 2K5HA 2F0WA 1NTGA 2PQEA 2VXWA 5FO9B 5JOBA 1YHBA 5LMNW 1NSNS 1RODA 4HIMA 4A3MG 1T9HA 1E2WA 2JA6G 4GKKL 4IOCA 2K05A 4HEDA 5ELDA 1IBMQ 1EIYB 1SYCA 4JI7L 1CKNB 1SFOB 1G6ZA 2PI2E 1BCPF 4JOIC 1D1KA 4X3UA 2ZXPA 4JI5L 1FVIA 1U4MA 1EQTA 1MBYA 3TZDA 1KABA 1SMYD 4DV5Q 2NVXH 2NVTH 1NCVA 4OWTB 1GVPA 3NTIA 4LF5L 5CV8A 4UPAA 2NVXB 2NVTB 4IPGA 4UP7A 4A76A 2F0PA 5IE8A 3S17H 2PI2A 1HR0L 4U673 3RNUA 4IUUA 2A69C 4N9TA 2KVMA 1GXDC 3FPPA 3CRKC 5LHY1 3S17B 2EY5A 4IFDG 3GDEA 1MHWC 4DNRB 4CGYB 5FLXc 4JG2A 1STBA 4KHPL 1XNQL 3TS2A 2HQEA 1HZBA 3MWYW 4YWKA 2GVAA 1KDBA 2K33A 2EVBA 1ZEQX 3DEOA 3AFPA 4H0LC 4HJ7A 1T5EA 4B3ML 1ET9A 1SMYC 4A3IH 4GOPA 1N36Q 2D0PA 3NPPA 1IHZA 5BN5A 3R2TA 4A3IB 3SXHA 3MXNA 3G6EA 1SYFA 2RKSA 2AKWB 1XTDA 1NAPA 2UUBL 3QB3A 1AFPA 4CKCA 5E3FA 1MKHA 2HUGA 4WJ4A 1S5ED 1QZHA 3VA5A 1LT6D 5EKIA 1K3BC 1Z7TA 4IPCA 1UNSA 1TS3A 2C5CA 3FRPB 1V1OA 5JAVA 4X64L 4POFA 1ASYA 2EYHA 3KOJA 1IXRA 1C4QA 3BYTB 4KV6A 2XRSD 1GM5A 1ILQA 3AB9A 1C48A 4LF5Q 1JORA 2DY8A 3EN2A 5HGTA 2F0SA 2B63H 1QUQB 2EYOA 1KIXA 4QY7A 5IT9L 4YIJA 3BVMA 2HCCA 1JE4A 3GD7A 1UE7A 2R93G 3HOYG 2B63B 3UE0A 3R8BA 1PDQA 2QDBA 5M3MH 4B3TL 1HHVA 2K32A 4C3IB 3CHBD 1JOOA 4DUYL 2TMPA 5KEEA 1CQVA 3WOFA 3ND9A 4MIUA 1VQGA 1KL9A 2VQEQ 1AH9A 1VQKA 2EJMA 2EZVA 5TSSA 4YWMA 3S1MH 1IBLL 4QGUA 2ZJQA 4CKBA 1X3PA 1CKMA 1BCPB 1U0LA 3S1MB 1I50H 3FVQA 3SDZA 2I0QA 1X56A 4C3JG 1U4LA 4NXNQ 1I50B 4PMWA 4BXXH 3EIVA 2I5MX 2ZJRA 3SGIA 4ZLTF 2JYOA 1U5KA 3J7ZC 5ELFA 1QILA 1HXYD 1ZYRD 5CBAE 4V0BA 2M2LA 1HA5A 1EU4A 2VB2X 3Q23A 3PO3G 4YHHL 1CK1A 1YNXA 3D4WA 4FO2A 4CKEA 4EQPA 3C1FA 1V1PB 4HCEA 4X64Q 3RZDH 1G2TA 1SNMA 2MO1A 4R4IA 3M7NA 3M4PA 1E24A
chains in the Genus database with same CATH topology
5EPJA 1Z47A 2A6EC 3RZDB 3OMGA 3BS1A 2E2HB 3J80L 1TWHB 4IUPA 2NB0A 5I2YA 1QNUA 5EGTA 1TS2A 1ZYRC 3BDOA 4A3DB 4GZYC 4JK1C 1F77A 1WCMB 1XTCD 1T5XD 2RQXA 2YYZA 2JA7B 2KEEA 5I6WA 2G9HD 2NN6I 1LABA 4HCSA 1ZKOA 1F2ZA 1SJHD 4L8JA 3IAYA 3L7ZC 3MHBA 1LT5D 4DNTB 3K7AB 1G91A 3I8ZA 3SVMA 2RDGA 2J7ZA 4PMBA 5IGBA 2EJGC 4DN4M 3SK4A 1VDZA 4RH6A 3LX0A 3J7AV 1JCKB 4OO1I 4Y7NB 1GHKA 5I9PA 3IFDA 1F9QA 5CR3A 2RA4A 5I2XA 1G2SA 3NK9A 1SE3A 2PNRC 4ZQ3A 5CORA 4LMQD 3HEJA 5I6YA 1XXGA 1I6HB 4K2KA 2F3WA 5M5WB 3MFGA 5CBEE 5FLXL 5JEAJ 4QF4A 2K04A 3N52A 1EWCA 4RWSC 1S5CD 5M3FB 2CQAA 4KJOA 4BWGB 1SNPA 5T1GA 5C4HA 5KIXA 1Y69U 1Y8OB 2V4DA 2PO4A 3EVQA 3QG1A 4KJNA 2F0DA 1TU2B 3D3RA 1TT2A 3NE5B 3SE0A 1KDAA 5IGEA 1YNJD 1FR3A 3SK5A 5C5LA 4IFDI 3IKJA 1EY8A 1D6EC 4CJ1B 1B3AA 4K5WA 2QEJC 3NXWA 1SNDA 2KHSA 2EDGA 1SSOA 2B8FA 3MAQA 2B2UA 2JA8B 1LV9A 2PPBC 2KEDA 4BA2I 1H9MA 3OHXC 3M3YB 2SOBA 1QOHA 4F7XA 1YNJC 3R2IA 1MD2D 3QJYA 5CV7A 1SXTA 2A68D 2NTSA 3PIP3 2B2WA 4J8QA 1HTLD 3ITPA 1QNKA 4M1UB 3KBGA 3U9SA 4BY7B 2PW5A 4RHRA 1IL8A 3ERQA 1EQVA 1TQOA 1A15A 5FOBB 2NBFA 1JB3A 5A2QL 1CHPD 3Q6SA 1TKWB 2JA5B 1STYA 2A68C 1Z6HA 2RDHA 3L3OC 1Y1WB 4MHEA 3K5OA 4G57A 4IURA 3Q0AA 3VR4A 3LWUA 1SDFA 4KTAA 2AUKA 2IWHA 1GUTA 5JVG3 4HSPA 3A8KE 4ZKCB 1WTVA 3NUCA 5T1IA 2BDNA 3K5LA 1KNEA 3H91A 1JWUD 1PRTF 2KCNA 1LLRD 2H1EA 1PTOD 3OWEB 2WKDA 3PV0A 2IT1A 3GV6A 5K36H 1FNVA 2ZXRA 4DGZA 2L1BA 3T53B 2K03A 3WOEA 1CQFA 1RJTA 2NWGA 2F4IA 1S5DD 4HN7A 5C4JB 3J81L 2CW0D 5C0XI 1OXUA 2C9OA 4F87A 2XVSA 5M5YB 1WTWA 3NHHA 3RMHA 1PTOC 4X3TA 3DWQA 1K8MA 5CGKA 1PYWD 1EY5A 1GUSA 1XYIA 4H13C 1BDOA 4ZUJA 1EYCA 4UAIA 4DXGA 3FMCA 3X3MA 4Q5VA 1K8OA 2K5WA 1TS5A 2CW0C 1DZ1A 1MSHA 3NBIA 3KK7A 1HUNA 4G4KA 3URYA 2IPKD 4C2MB 2K01A 2MHVA 1L0YB 4OIKA 1A3TA 1CT1D 4OHJA 3KF8A 5EPKA 1X32A 2FHTA 1SYEA 3SEBA 1PZJD 4A3BB 5F2DA 5K5PA 5A35A 3RD4A 2E2JB 2DNEA 3HOUB 1RHPA 3CQZB 4K6LA 2PCFB 1DYQA 5BN4A 1F9SA 3MVVA 2YU9B 2A5HA 3HRZC 5C0XH 3QWNA 1STAA 2B2WC 1IYVA 1CM9A 3BZDB 3QO2A 5KRUA 4DK0A 1SYGA 4RGMA 2OT2A 3I72A 2SEBD 1QCBD 3W2DA 1J9OA 1LTTD 3F2UA 4NW2A 5JEAG 5EJWA 4RGTA 4FXGC 3EQLC 1L0XB 3WDNA 4FF2A 1D1IA 5C4ZA 3ONAB 4PNYA 2QKIC 4KY5A 5IGDA 1SE2A 1Q12A 4A3JB 3H3VC 3PMFA 1SE4A 4KN4C 4DU9A 5KGUA 2EYFA 2F3VA 1CHQD 1O78A 1A2UA 2D5DA 2I07B 3JAML 4KMUC 1CFMA 3OWFA 3MFYA 5EKKA 1AEXA 3K5MA 1ML0D 4DAPA 3TMEA 3T13A 3HOZB 1EIHA 1W6KA 1UAPA 2FINB 4XYOA 3D4DA 4XQQA 5IT9E 3H0GB 4UDUC 4QMGA 3GTQB 2BCOA 2JE6I 1B50A 4H7BA 4IUVA 3PUWA 2Q8TA 4DAVA 3RZOB 3PO2B 5IGCA 1R4QB 2F0EA 4HMIA 3VYTA 4RAUC 3VA7A 1RTOA 4ZK9B 1LT4D 2K28A 3K59A 4J1MA 3GQBA 4OGQC 3DMUA 2PW7A 3GTOB 3NTHA 1RDPD 2F0KA 1VF7A 3FKIB 2FFKB 2LFNA 1EFID 3MTSA 1FNUA 1TWFB 3DXJC 5FO8B 1ILPA 1V43A 4MN3A 5EBCA 2E2IB 4XQJA 3V96A 2F0NA 2B39A 3S9WA 1R9TB 2KECA 1ONLA 2K6AA 5NUCA 1IKMA 4PQXA 1Y1VB 1AZPA 4TQUS 3D8GA 3I4MB 3AU7A 4N9PA 1HPCA 2R3ZA 5J1ZA 2A6ED 4DFAA 3R3OA 4O42A 2IX0A 1ENAA 2R92B 1BF4A 3LWEA 2XWBB 4K14A 1MSGA 1F2LA 3SK8A 4QUCA 1B9NA 2KJXA 1PZKD 3CRLC 1U9RA 2OEOA 2RVLA 4NMZA 4K6DA 1X3QA 3CKIB 3S1QB 2PMZB 5E4XA 2I46A 2K1BA 2JEAI 1WD0A 5FLXE 3X3NA 1O7YA 2F0FA 4A3KB 1I4XA 4ZYSA 2RDFA 1JOQA 1FYCA 1ENFA 2EYMA 1EYAA 2J4XA 3M7GA 1RF2D 3PUZA 5FO7B 2WIIB 4F8MA 1D5ZC 1DCZA 4KK7A 3T4AC 4EGVA 4XIGS 3T51B 1S5BD 1EZ6A 2CVRA 3M85A 1PTOB 2L9HA 4K8JA 1KNAA 1HQMC 5C3WA 2PZTA 1STGA 3GO5A 3OW7A 1BR9A 1O7LA 4X3SA 1HRJA 5G3LD 3V05A 5KNDA 3ZYYX 2Q8IB 2D62A 3BYYB 2A73B 1PZID 4I7ZC 3VR3A 4XTCS 1A2TA 4C3HB 1ESRA 3KBXA 3T56B 1TWCB 2R7ZB 3BVGA 2ICEC 3TN2A 1AP0A 1LTGD 3C1EA 1HA6A 2HCIA 4AYBB 4KKSA 3I90A 2KA7A 2WACA 2WV6D 1LTBD 2NN6H 3SK6A 1DXMA 3VYRA 3GTPB 3NWTA 2NYZD 5JPMC 1IYUA 3C2PA 3VR2A 1RCVD 4R8NA 2AQ1B 3KLSX 2EPBA 2Y0SB 4K8IA 1SBBB 1GUOA 4FXKC 2LMCB 4PMCA 4KKTA 3E5SA 2F1MA 4WRDA 2F0IA 4OO1H 4K2LA 3TBIB 1D5MC 3EJIA 5ISRA 1PFBA 2EY2A 2NVYB 2CHBD 3GTMB 3C46A 4J6HA 5CMDA 5ELBA 4ZRZA 3H6MA 1CZWA 2F0OA 1I4QA 4C3IG 3K57A 1S4ZA 1OXSC 3A7LA 3MXPA 4DF7A 1A3VA 3MA2B 2PZUA 2BA1A 4WORA 3OOCA 4G7HC 4EQOA 5DM73 3J81E 5LL6S 3NSWA 1IW7D 2FJ2A 2DNCA 1PMRA 2JA6B 1ESFA 3EROA 4ID6A 1BO0A 2WINB 3DWPA 1HFNA 4TKOB 2Z8LA 1FD7D 5KNBA 5I9OA 4IFDH 4FP5D 4FXDA 3A55A 4FF4A 3I73A 3NP8A 1EY0A 1IW7C 5IOCA 3HGBA 4IZ8A 5C4XB 1J8IA 2SNSA 3U9OA 1XWEA 1EWHA 1ICWA 1DD2A 2VNUD 2E76C 2ZXOA 1EY9A 5E4WC 4B9WA 2J0TD 3OMCA 3QOLA 5COYA 1B1ZA 1HFGA 4H44C 3S15B 4Q0FA 1GUNA 3I91A 1GOZA 3S2HB 1CZGA 3J7YW 1I4RA 1LTID 4XT1B 1QJOA 5JPNC 3GP7A 1F9RA 3GTJB 1U4RA 2RBMA 3Q24A 2SDFA 3S2DB 3Q22A 3D4RA 1TWAB 1A6XA 2EYJA 3TDQA 2FMMA 3O13A 4LK1C 5KYIA 2R93B 2QF7A 3HOYB 4KD4A 2F0JA 3L9AX 2XIWA 2Z1CA 3J7AF 1PFNA 5C0XJ 5I4DA 4FYDA 2L4NA 4WJWA 4ZKBB 1JWSD 1B4OA 2MPMA 3FEWX 3E0JA 1LO5D 3DUZA 5ELCA 3S16B 2F0LA 4ME5A 4C3HG 4HAEA 4G7ZC 3EA6A 1SEBD 1SNOA 1EY4A 1SNQA 5CV4A 3JAME 2F0UA 3A54A 2AWNA 2B8GA 1DOMA 1PLFA 1CTMA 3PO3B 1B44D 4K5XA 3BG3A 1O80A 1HQRD 2XRQD 3HP3A 2D9UA 2NN6G 3IL8A 1OO9B 2XSCA 2X6LA 1Y8PB 1B9MA 1SAPA 2RSOA 2E74C 3BDLA 5D14A 2MGSA 1E2VA 3EFXD 4RFBA 1H9SA 4IUQA 2IL8A 2IJ0A 3TZUA 4BBSB 4HSVA 4QIWB 3S14B 1RTNA 1H9JA 4A3FB 3MZ5A 4A93B 3P1HA 4RKLA 1BNZA 1LT3D 4IUNA 3A7AB 4O1NA 3KUPA 1CA6A 1PXUA 2PYKA 3GTKB 4P2CB 3NBHA 1I3QB 3BDCA 1GJXA 2XN9C 4IUTA 3FPUB 3HOVB 2WKCA 2MP1A 2EE1A 5D3IB 5CV6A 1Q1BA 1WTXA 1OXTA 4ULLA 3D6WA 2O5IC 2NTTA 2SNMA 5DNFA 1WTQA 1QE6A 2Q8RE 1B2TA 1OXVA 1I4GA 1SNCA 2WB1B 4Z9CB 5C44B 3PUVA 4LJZC 4R8IA 2E2DC 1EU3A 4RGNA 3K5NA 5CYUA 1LTRD 3PIO3 1BUVT 2RSNA 2L11A 3DWAA 3GTLB 2AUJD 1O7ZA 2F0GA 4NP5A 1U4PA 1Q1EA 4DK1A 2R61A 4RCOA 3R93A 1Q3LA 4XDXA 4M8AA 5K36G 1VCIA 5J22A 1A3UA 1EY7A 1Q90A 2XNAC 3PUYA 1HTPA 4QCLA 2JP1A 4R9WA 3VR6A 2LY7A 2O5JC 4KN7C 1TR5A 1ET6A 2A6HD 3E6ZX 2BA0A 3J80E 5CV5A 4ABNA 1PTOF 1F9PA 2VUMB 1NR4A 2NUCA 1VMPA 4XYQA 4HMJA 5BN3A 2EJFC 2QCPX 2IX3A 3D31A 1F2MA 1DJRD 2BOSA 2K5DA 2G9DA 5FK9C 4KY6A 2B2TA 4BBRB 3K0YA 3I3CA 5D65A 4XT3B 3H09A 5M3MB 3QIAA 5FKAC 3M4OB 1G8ZD 2A6HC 4V190 4CJ2C 1H9KA 2KQ3A 5IIFA 3K58A 1PRTD 5DEHA 4E6IA 1QG7A 5C5MA 5EBDA 3HG9A 2ENBA 3BVZA 2B2YA 4HR7B 2X69A 1KAAA 4PV1C 5D3DA 3OIPA 3H94A 2KCCA 2A74C 3W3AA 3C3LA 4ODGA 2DN8A 3P7JA 2HDMA 1HUMA 3NWSA 3PUXA 3TSSA 1PRTC 1BBXC 5C0XG 2MUYA 4EQNA 2AWOA 2F03A 4K5VA 3V2TA 1V8QA 3N6RA 4DXFA 5KYLA 1M4VA 1V1PA 3OIQA 2IW3A 3P20A 4DA2A 2OXPA 1BOSA 3VR5A 2F0QA 4CBVA 1AW7A 2LS01 3QOJA 4XQNA 1S5FD 1TY0A 2F0MA 4TRDA 1HCZA 2EYPA 1PTOH 2WAQB 4X3KA 4KHZA 3HS0C 4A3GB 1JOKA 1CA5A 4TSSA 2BE5D 4C1NI 4RGOS 5J39A 5KNCA 1STEA 1QWYA 3RLFA 2IX1A 4RHSA 1F2YA 4OL7A 4RKBA 1Y8NB 4FVMA 2XWJB 2HDLA 2L12A 5M9OA 1PFMA 2EOTA 4BY1B 3A8JE 2AQ3B 5IGFA 3RUZA 4B08A 4ILWA 1WTOA 1UEAB 1EYDA 1ZXTA 1LTSD 2BE5C 4FNFA 2LKVA 2H4OA 4C56C 5C3EB 1M8AA 5E1FA 3P75A 5A2QE 1VF5C 3GTGB 2M00A 4ZAIA 1OXXK 1QB5D 1I4HA 1EOTA 1AN8A 3A56A 3CU7A 3HZXA 3S1NB 3MC0B 2EYLA 1SYDA 2AQ2B 1I6VC 2JEBI 1SJED 1NR2A 3D6CA 1DONA 5LL6X 2R6GA 2TSSA 4EVOA 3OPOA 1DM0B 1BQQT 4JBWA 3G7LA 2B2TC 4F88A 1ENCA 2KOLA 3KLSA 1BCPD 4B9XA 3NQIA 3MXUA 5JVH3 2OF1A 5JEAH 2VB3X 2K7VA 1E0BA 2JXMB 1WTPA 3TP7A 3I70A 3KLRA 1CI3M 4KHVA 4IFDJ 1RD9D 1E2ZA 4A3EB 2B2YC 3K6OA 2L0CA 2Z4IA 5DM63 5EQ0A 1C8CA 5AFWA 4HTHA 1EEID 2N88A 4A3MB 1BCPC 5CV9A 2NZ1D 5C3XA 4G7OC 1KLUD 1H9RA 5EKLA 1TS4A 2M9VA 5JJZA 2N55A 1GHJA 3I4NB 1MGSA 4XXEA 3A8IE 3DM1A 3HOXB 1EIGA 2QILA 2ID0A 3TP6A 3HOWB 2B2VA 2Z4HA 5C6AA 5EPLA 1WVLA 3IFTA 5IGGA 4S3SA 1GUGA 1LACA 4CHTB 1RKNA 4L63B 3M4YA 1IKLA 2F0VA 2D2CC 1TY2A 2X6GA 1FNWA 4QB4A 1D2BA 5IODA 1Q8IA 4L6TB 2JSOA 5DAUA 3VYSA 2NVQB 2E75C 1LTAD 3AMUA 5M5XB 3T16A 2F0TA 2FMCA 1KLGD 2EY1A 4IN3A 4C1NK 2O2LD 4FF3A 2EXZA 1D5XC 1II3A 3SHLA 2F0HA 3DEPA 1FGBD 3OSOA 4DAYA 2PZWA 3GV3A 2L55A 1YNND 1DOKA 2K5QA 4RA8A 4I65A 2L5TA 4U68A 5ELEA 4IALA 4BS9A 3TP5A 1SYBA 1JR0D 1I4PA 4QUFA 1GUWA 1NUCA 4ZUIA 2DY7A 4CJ0B 3NQTA 5HURA 1K83B 4C3JB 3NTKA 1AZQA 4RCNA 1KDCA 2KUMA 4BA1I 1EL0A 3ND8A 1YNNC 3UI2A 3DHQA 4KD3A 3FDTA 1EZ8A 2WP8J 1TWGB 1JQYD 1JWMD 1EEFD 1STNA 4KY7A 1H9SB 1TVXA 2B2UC 1STHA 1R4PB 1BXTA 5G3LF 1W6JA 3LNNA 3S1RB 1B53A 2MJ8A 3HKZB 1JICA 3VYUA 2ICIA 1VMCA 5CC4A 4FF1A 4LAAA 1PRTB 1WTRA 4NKLA 4OIJA 4WFN3 4KKUA 3SR1A 1UUPA 2ZT9C 4OO1G 1JC7A 4IQZA 2EY6A 1XX8A 1EY6A 2O4XA 1DOLA 1WD1A 1G291 2BDOA 4KI0A 3MEHA 3MXGA 2B2VC 1TIID 1MI2A 3TP8A 3G6JB 2A69D 1KTKA 2GA4B 3I4LA 2F0WA 2PQEA 2VXWA 5FO9B 5JOBA 1NSNS 1RODA 1E2WA 2K05A 4HEDA 5ELDA 1SYCA 1SFOB 1G6ZA 1BCPF 1D1KA 4X3UA 2ZXPA 1U4MA 1EQTA 1MBYA 3TZDA 1KABA 1SMYD 1NCVA 3NTIA 5CV8A 2NVXB 2NVTB 2F0PA 4U673 4IUUA 2A69C 4N9TA 2KVMA 1GXDC 3FPPA 3CRKC 5LHY1 3S17B 2EY5A 4IFDG 4DNRB 4CGYB 1STBA 2HQEA 3MWYW 1KDBA 2K33A 2EVBA 1ZEQX 3DEOA 4H0LC 1T5EA 1ET9A 1SMYC 3NPPA 1IHZA 5BN5A 3R2TA 4A3IB 3SXHA 3MXNA 1SYFA 2RKSA 1NAPA 3QB3A 1AFPA 4CKCA 5E3FA 2HUGA 1S5ED 3VA5A 1LT6D 5EKIA 1Z7TA 1UNSA 1TS3A 2C5CA 3FRPB 1V1OA 5JAVA 2EYHA 3BYTB 1C4QA 4KV6A 2XRSD 1ILQA 3AB9A 1C48A 1JORA 2DY8A 5HGTA 2F0SA 2EYOA 5IT9L 4YIJA 3BVMA 2HCCA 1JE4A 3GD7A 2B63B 3R8BA 1PDQA 2QDBA 1HHVA 2K32A 4C3IB 3CHBD 1JOOA 2TMPA 5KEEA 1CQVA 3WOFA 3ND9A 4MIUA 2EJMA 2EZVA 5TSSA 4CKBA 1X3PA 1BCPB 3S1MB 3FVQA 3SDZA 4C3JG 1U4LA 1I50B 4PMWA 4ZLTF 2JYOA 5ELFA 1QILA 1HXYD 1ZYRD 5CBAE 4V0BA 2M2LA 1HA5A 1EU4A 2VB2X 3Q23A 1CK1A 3D4WA 4FO2A 4CKEA 4EQPA 3C1FA 1V1PB 4HCEA 1G2TA 1SNMA 3M7NA 4NDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPJ A;  1X32 A;  2FHT A;  2FIN B;  4IUR A;  2FMM A;  1F9P A;  1SDF A;  1BF4 A;  3LWE A;  4X3S A;  4IUT A;  1WTR A;  1NR4 A;  3FPU B;  1VMP A;  1HRJ A;  4OIJ A;  1E0B A;  1WTP A;  1NAP A;  2MP1 A;  2FJ2 A;  2EE1 A;  2XIW A;  4X3K A;  4ZKC B;  1WTV A;  1B50 A;  5T1I A;  1WTX A;  1BO0 A;  1PFN A;  2BDN A;  4IUP A;  1HFN A;  2HUG A;  4IUV A;  1RHP A;  1KNE A;  3H91 A;  2L4N A;  5EKI A;  3DEP A;  4ZKB B;  2Q8T A;  1MSG A;  1XX8 A;  1CA5 A;  1B4O A;  1F2L A;  1ESR A;  2H1E A;  2B2T A;  2MPM A;  3D6W A;  4QUC A;  3KBX A;  1F9S A;  2B2Y C;  3I3C A;  5D65 A;  1DOL A;  2RVL A;  4CJ1 B;  1B3A A;  1WD1 A;  4XT3 B;  3GV3 A;  5EQ0 A;  1C8C A;  5AFW A;  5DNF A;  3GV6 A;  3TN2 A;  1AP0 A;  1SSO A;  1WTQ A;  1QE6 A;  2KEE A;  1HA6 A;  2B2U A;  4RAU C;  2L1B A;  2HCI A;  1LV9 A;  2Q8R E;  2N88 A;  4HAE A;  1DOK A;  1ILQ A;  1X3Q A;  2B2V C;  4HCS A;  2B2W C;  1MI2 A;  4CJ2 C;  2K03 A;  1CM9 A;  2KED A;  1RTO A;  2NZ1 D;  5E4X A;  2HDL A;  1RJT A;  2DY8 A;  3I90 A;  2L12 A;  3QO2 A;  4RA8 A;  4ZK9 B;  1PFM A;  2EOT A;  2NWG A;  2K28 A;  4U68 A;  2K1B A;  1G91 A;  1QG7 A;  3I8Z A;  2HCC A;  2VXW A;  1JE4 A;  1B2T A;  3SVM A;  1WD0 A;  1ROD A;  1DOM A;  1PLF A;  5JJZ A;  2N55 A;  1PDQ A;  1J9O A;  4NW2 A;  1MGS A;  3F2U A;  1HHV A;  4R8I A;  2B2Y A;  2X69 A;  2K05 A;  4HED A;  5EJW A;  2J7Z A;  1O7Y A;  1G6Z A;  3DM1 A;  2NYZ D;  1WTO A;  1O80 A;  1WTW A;  1ZXT A;  2FFK B;  1J8I A;  4X3U A;  4QUF A;  1EIG A;  4DN4 M;  1U4M A;  5EPK A;  1EQT A;  2RSN A;  1ICW A;  2L11 A;  3MTS A;  1GUW A;  3HP3 A;  3TZD A;  2B2V A;  2D9U A;  4X3T A;  2B2W A;  2DY7 A;  1O7Z A;  3IL8 A;  3ONA B;  5E4W C;  4CJ0 B;  5EPL A;  1NCV A;  2EPB A;  2X6L A;  3P7J A;  1SAP A;  2RSO A;  1QNK A;  2HDM A;  1HUM A;  1M8A A;  1AZQ A;  1WVL A;  1ILP A;  1X3P A;  3IFD A;  1F9Q A;  1U4P A;  4MN3 A;  2RA4 A;  5COY A;  2KUM A;  1G2S A;  1EL0 A;  1XYI A;  3UI2 A;  1IL8 A;  5D14 A;  4ZAI A;  1HFG A;  2MGS A;  5COR A;  3FDT A;  4IUU A;  3R93 A;  1Q3L A;  4UAI A;  4XDX A;  4LMQ D;  4IUQ A;  2IL8 A;  1BBX C;  2KVM A;  1PFB A;  1A15 A;  1U4L A;  1EOT A;  3I91 A;  2KEC A;  1TVX A;  2B2U C;  4HSV A;  4ZLT F;  2JYO A;  1IKM A;  1DZ1 A;  1MSH A;  5CMD A;  3Q6S A;  1HUN A;  5CBA E;  1IKL A;  1RTN A;  2CVR A;  1AZP A;  2M2L A;  3MWY W;  4XT1 B;  5CBE E;  2X6G A;  1ML0 D;  2JP1 A;  2K01 A;  1F9R A;  1NR2 A;  2K04 A;  1S4Z A;  2L9H A;  3N52 A;  4R9W A;  4RWS C;  1B53 A;  1BNZ A;  1DON A;  2MJ8 A;  2R3Z A;  1JIC A;  3DEO A;  1U4R A;  1KNA A;  4OIK A;  1EIH A;  3KUP A;  2SDF A;  3G7L A;  2B2T C;  5T1G A;  1G2T A;  1CA6 A;  1VMC A;  4MHE A;  4O42 A;  2KOL A; 
#chains in the Genus database with same CATH topology
 4GLA C;  5EPJ A;  2G5D A;  1YZ6 A;  1Z47 A;  2A6E C;  3RZD B;  2E2H H;  1VQI A;  1TWH H;  5IP7 G;  3T1Y L;  3OMG A;  3BS1 A;  4LF7 Q;  2E2H B;  3J80 L;  2B3G A;  1TWH B;  4A3D H;  4IUP A;  4BBS G;  2NB0 A;  5I2Y A;  2KEN A;  1QNU A;  5EGT A;  4P72 A;  1WCM H;  1TS2 A;  1ZYR C;  3BDO A;  4A3D B;  4GZY C;  4JK1 C;  1VQN A;  1L1O B;  1YIT A;  2JA7 H;  1F77 A;  4A93 G;  4FDB A;  1WCM B;  1XTC D;  1IYJ B;  1T5X D;  4JV5 L;  2RQX A;  4YY3 L;  1S72 A;  3KFU A;  2YYZ A;  2JA7 B;  2KEE A;  5I6W A;  3PGZ A;  2G9H D;  3A0J A;  1EOV A;  2NN6 I;  1LAB A;  4HCS A;  1ZKO A;  3ER0 A;  3W5O A;  1IBL Q;  2JN4 A;  3K7A H;  4A4I A;  4UP9 A;  1F2Z A;  1SJH D;  4JBJ A;  3J81 c;  4GN4 B;  4L8J A;  3IAY A;  3L7Z C;  5IWA L;  3MHB A;  1LT5 D;  4LF9 L;  3A5Z B;  4DNT B;  5IYD H;  3K7A B;  1G91 A;  4P73 A;  3I8Z A;  3CF5 A;  4DV1 Q;  2CQO A;  3SVM A;  2RDG A;  3CCV A;  1AE2 A;  2J7Z A;  4PMB A;  5IGB A;  2EJG C;  4DN4 M;  3SK4 A;  3M4Q A;  2DJG C;  1VDZ A;  4Y7N H;  1NNX A;  4RH6 A;  3LX0 A;  4YHH Q;  3J7A V;  1JCK B;  4OO1 I;  3S24 A;  5DLQ E;  4Y7N B;  3CPF A;  1GHK A;  5I9P A;  2N8N A;  1F9Q A;  3IFD A;  5CR3 A;  4YCW A;  2RA4 A;  5I2X A;  1G2S A;  3NK9 A;  1SE3 A;  1EQQ A;  2PNR C;  4ZQ3 A;  1UE1 A;  4GOP C;  5COR A;  1I6H H;  4LMQ D;  3HEJ A;  1A0I A;  5I6Y A;  4K0K L;  2IY5 B;  1XXG A;  5C44 G;  3T1Y Q;  4N8X 1;  5M5W H;  1S3O A;  1I6H B;  2KCT A;  4K2K A;  5M3F H;  4X6A H;  2F3W A;  5M5W B;  3MFG A;  5CBE E;  5FLX L;  5JEA J;  4QF4 A;  1J5E L;  2K04 A;  3N52 A;  1EWC A;  4RWS C;  1S5C D;  5M3F B;  2CQA A;  4KJO A;  4LW1 A;  4BWG B;  1SNP A;  2MFI A;  3K8A A;  1PH7 A;  5T1G A;  5C4H A;  2NZH A;  4YY3 Q;  5KIX A;  1Y69 U;  4A3L H;  1Y8O B;  2V4D A;  2PO4 A;  3EVQ A;  4PZ7 A;  3QG1 A;  4KJN A;  2F0D A;  1TU2 B;  4L5Q A;  4NB3 A;  5IWA Q;  3D3R A;  1TT2 A;  3NE5 B;  3SE0 A;  4L5S A;  1KDA A;  5IGE A;  5IYB H;  1YNJ D;  1FR3 A;  2OTJ A;  3SK5 A;  1X55 A;  1YJW A;  5C5L A;  1B7Y B;  3ZJY C;  4IFD I;  3IKJ A;  1XMO Q;  1EY8 A;  2JA8 H;  1D6E C;  4CJ1 B;  1B3A A;  4K5W A;  2QEJ C;  1Q81 C;  3NXW A;  1SND A;  2KHS A;  4AH6 A;  2EDG A;  1SSO A;  2B8F A;  4DR6 L;  3MAQ A;  2B2U A;  2JA8 B;  1TXY A;  1LV9 A;  1A63 A;  2PPB C;  4LF4 L;  2KED A;  4ALP A;  4P71 A;  3BZC A;  2VS1 A;  2PNH A;  3M3Y H;  1YVC A;  4DR2 Q;  1VQA A;  2D0O A;  2VUM G;  4BA2 I;  1H9M A;  3OHX C;  3M3Y B;  2SOB A;  1QOH A;  4F7X A;  1YNJ C;  3R2I A;  1MD2 D;  3QJY A;  3G4S A;  5CV7 A;  1SXT A;  5FLM H;  1GO3 E;  2A68 D;  2NTS A;  4BY7 H;  3PIP 3;  2B2W A;  2BH8 A;  4J8Q A;  4L5R C;  1HTL D;  3EBE A;  3ITP A;  1QNK A;  4M1U B;  3KBG A;  3U9S A;  4BY7 B;  5M3M G;  2PW5 A;  3I4N H;  3E3X A;  4DV3 L;  4RHR A;  1IL8 A;  3ERQ A;  2ZM6 L;  2F4V Q;  3JAM c;  1EQV A;  1TQO A;  1A15 A;  3I55 A;  3AEV A;  5FOB B;  1K28 A;  2NBF A;  1JB3 A;  5A2Q L;  3VDY A;  1CHP D;  3Q6S A;  2UU9 L;  1TKW B;  2JA5 H;  2RHS B;  4DV0 L;  1NJI C;  1Y1W H;  2JA5 B;  4LF6 L;  1STY A;  2A68 C;  1Z6H A;  1MJE A;  2RDH A;  3D0F A;  3L3O C;  1Y1W B;  2UUA L;  5IP9 H;  4MHE A;  3K5O A;  4CDF C;  4LNQ A;  4G57 A;  4JI3 L;  4IUR A;  3Q0A A;  3VR4 A;  3LWU A;  1SDF A;  4MTN A;  4KTA A;  1PYS B;  2AUK A;  2IWH A;  2OQK A;  1EUJ A;  2VL6 A;  1GUT A;  5JVG 3;  1G51 A;  3U50 C;  4HSP A;  3A8K E;  4ZKC B;  1WTV A;  4LFB Q;  3NUC A;  5T1I A;  2BDN A;  2UXC L;  3RLN A;  3K5L A;  2UUC Q;  1KNE A;  3H91 A;  1JWU D;  1PRT F;  4LF8 Q;  2KCN A;  1LLR D;  2H1E A;  1PTO D;  3MEF A;  3OWE B;  3UDX A;  4UHV A;  3KF6 B;  1HH2 P;  2WKD A;  3PV0 A;  2IT1 A;  2KHI A;  1QVG A;  3GV6 A;  5K36 H;  2B29 A;  1FNV A;  2ZXR A;  4DAY B;  4DGZ A;  2L1B A;  4A3D G;  3T53 B;  2K03 A;  5C4J H;  3WOE A;  1CQF A;  1RJT A;  1JE5 A;  4DV3 Q;  2NWG A;  4JI4 L;  2F4I A;  3WWV A;  1P16 A;  1S5D D;  4HN7 A;  4HJ9 A;  3KDF B;  5C4J B;  3J81 L;  2CW0 D;  3H15 A;  2XGT A;  2WAQ G;  5C0X I;  1OXU A;  2C9O A;  1EYG A;  1EFW A;  1V1Q A;  4F87 A;  2XVS A;  4IPD A;  1WTW A;  2UU9 Q;  4A3G G;  5M5Y B;  3RLO A;  3NHH A;  3RMH A;  4DV0 Q;  1JMC A;  1PTO C;  2Q2U A;  5IYD G;  4X3T A;  3DWQ A;  1K8M A;  1XJV A;  5CGK A;  1PYW D;  1IBK L;  2UUA Q;  1EY5 A;  3CCJ A;  1GUS A;  1XYI A;  4H13 C;  1BDO A;  1K73 C;  4ZUJ A;  1PYB A;  4JI3 Q;  1EYC A;  4UAI A;  4DXG A;  3FMC A;  2E8G A;  3X3M A;  4Q5V A;  1K8O A;  1KRT A;  2K5W A;  2JA9 A;  4BY1 G;  1TS5 A;  4C2M H;  2CW0 C;  4X66 Q;  1DZ1 A;  1MSH A;  2YTV A;  3NBI A;  3KK7 A;  2I5L X;  1HUN A;  2VY3 A;  4G4K A;  2IPK D;  3URY A;  4B3R Q;  4C2M B;  3CAM A;  1YJ9 A;  4DK6 C;  2K01 A;  2MHV A;  4POG A;  1L0Y B;  4OIK A;  1A3T A;  1CT1 D;  4JI8 L;  1KXL A;  4OHJ A;  3UDF A;  3KF8 A;  4A3B H;  3JC6 6;  5EPK A;  2K4K A;  1X32 A;  1MIU A;  1SYE A;  2FHT A;  3SEB A;  5C3E G;  1PZJ D;  2E2J H;  4A3B B;  2KBN A;  5F2D A;  3HOU H;  5K5P A;  4TVA B;  5A35 A;  4HIO A;  1N32 L;  3RD4 A;  3CQZ H;  1UEB A;  2E2J B;  2DNE A;  3HOU B;  3KLW A;  3CC4 A;  2E5L L;  1RHP A;  3CQZ B;  3LGJ A;  2F52 A;  2PCF B;  4K6L A;  1M1K C;  1K8G A;  2YU9 H;  1GD7 A;  3TQY A;  1DYQ A;  3OYY A;  2OQ0 A;  5BN4 A;  4JYA L;  1F9S A;  3MVV A;  3G71 A;  1WTH A;  2YU9 B;  2A5H A;  1NBW A;  2JK8 A;  3HRZ C;  5C0X H;  3QWN A;  1STA A;  1EWI A;  2B2W C;  2ZTD A;  1IYV A;  1CM9 A;  3BZD B;  2AMC B;  3QO2 A;  1IBK Q;  5KRU A;  4DK0 A;  1SYG A;  3PCO B;  4RGM A;  4PZ6 A;  1JB7 A;  2OT2 A;  1IL2 A;  2Z6B A;  5HY6 A;  4Y52 H;  3I72 A;  2SEB D;  1QCB D;  1CSP A;  3W2D A;  1J9O A;  1LTT D;  3F2U A;  4NW2 A;  3F1Z A;  5JEA G;  5EJW A;  4RGT A;  4FXG C;  4DV7 L;  3EQL C;  1L0X B;  3WDN A;  3BJU A;  4FF2 A;  1D1I A;  1W2B A;  5C4Z A;  2XTI A;  4DR3 L;  4A3J H;  4GS3 A;  3ONA B;  4PNY A;  1K9M C;  2QKI C;  2C35 B;  4KY5 A;  2DUD A;  5IGD A;  1SE2 A;  1Q12 A;  4JI8 Q;  4A3J B;  5LMU L;  3H3V C;  3PMF A;  1SE4 A;  4KN4 C;  4JI6 L;  4DU9 A;  1SFO H;  5KGU A;  1M90 C;  2EYF A;  2F3V A;  3J80 i;  1CHQ D;  1X65 A;  1O78 A;  1A2U A;  2D5D A;  2I07 B;  2DJF C;  4DUZ L;  3JAM L;  4KMU C;  4IJL A;  1CFM A;  3OWF A;  3MFY A;  5EKK A;  3HOZ H;  1O7I A;  1AEX A;  3I4N G;  3K5M A;  1ML0 D;  4DAP A;  3HOX G;  3TME A;  2K52 A;  3T13 A;  2UXB L;  3HOZ B;  1EIH A;  3HOW G;  1JJ2 A;  1W6K A;  2LSS A;  1UE6 A;  1UAP A;  3H0G H;  2FIN B;  1WFQ A;  4XYO A;  3D4D A;  4XQQ A;  4GOP B;  5IT9 E;  3H0G B;  1XNR L;  4UDU C;  4NXM Q;  4QMG A;  3ULP A;  3GTQ B;  2BCO A;  2JE6 I;  3MXN B;  3CCL A;  3RZO H;  1B50 A;  1GKH A;  2HHH L;  3PO2 H;  3PQI A;  4H7B A;  4IUV A;  3PIP A;  1PHJ A;  3PUW A;  2Q8T A;  4DAV A;  3RZO B;  3PO2 B;  5IGC A;  1R4Q B;  1ASZ A;  2F0E A;  4DV4 L;  4A3C G;  1JJG A;  4HMI A;  1N33 Q;  3VYT A;  4DR3 Q;  3RR5 A;  4CDE C;  4RAU C;  3A5U A;  2AHO B;  4GLV B;  4A75 A;  1LM0 A;  1SMX A;  3VA7 A;  1RTO A;  3AYH B;  5LMU Q;  4ZK9 B;  1LT4 D;  2K28 A;  3GTO H;  4JI6 Q;  3K59 A;  4DR5 L;  4J1M A;  3AQQ A;  3GQB A;  1G6P A;  4OGQ C;  3FKI H;  3DMU A;  2PW7 A;  4ME3 A;  4GKK Q;  3GTO B;  2N49 A;  4JI7 Q;  3NTH A;  1RDP D;  2F0K A;  1VF7 A;  4JI5 Q;  3FKI B;  2FFK B;  1TWF H;  2LFN A;  1EFI D;  4UY8 C;  2IHE A;  3MTS A;  1FNU A;  1N8R C;  1TWF B;  2UXB Q;  3DXJ C;  2E2I H;  5FO8 B;  1C0A A;  1ILP A;  1V43 A;  3HFZ B;  1R9T H;  4MN3 A;  1FJG L;  5EBC A;  1HR0 Q;  1PH4 A;  2ZTC A;  4OX9 L;  1VQ7 A;  2E2I B;  4C3I H;  4XQJ A;  3V96 A;  2F0N A;  2B39 A;  3S9W A;  1R9T B;  3PF5 A;  1RL2 A;  1Y1V H;  2KEC A;  1ONL A;  2K6A A;  3I4M H;  5NUC A;  3Q8D A;  2UXD L;  1IKM A;  1SLJ A;  1XNQ Q;  4PQX A;  5FJ8 H;  2CCZ A;  4KHP Q;  1Y1V B;  1AZP A;  4TQU S;  3D8G A;  3I4M B;  3AU7 A;  3CCQ A;  4N9P A;  1HPC A;  4R4Q A;  4B3M Q;  1JJC B;  2R3Z A;  5J1Z A;  2A6E D;  1PH8 A;  2R92 H;  4DFA A;  1BVS A;  3R3O A;  1D7Q A;  4O42 A;  1Z9F A;  2IX0 A;  1ENA A;  2R92 B;  1BF4 A;  3LWE A;  2Z9H A;  4DR1 L;  2UUB Q;  2XWB B;  3E9H A;  5GAH C;  1B8A A;  1YHQ A;  4R4O A;  1Q86 C;  1YBY A;  4K14 A;  4A3B G;  3CC7 A;  1MSG A;  4DK3 C;  1F2L A;  3SK8 A;  1FGU A;  4QUC A;  1B9N A;  2KJX A;  1L2F A;  1PZK D;  3CRL C;  3HOU G;  1U9R A;  2OEO A;  2RVL A;  4DPG A;  3S1Q H;  4NMZ A;  3HKZ G;  4K6D A;  3ICE A;  1X3Q A;  2YV5 A;  3CKI B;  3S1Q B;  2PMZ B;  5E4X A;  2N3S A;  2PMZ E;  1HNZ L;  2I46 A;  2K1B A;  2VQF L;  3IRB A;  1UWV A;  2JEA I;  1WD0 A;  4B3T Q;  4A3K H;  3TRZ A;  5FLX E;  4DUY Q;  3X3N A;  1Q7Y C;  2UXD Q;  1O7Y A;  3I2Z A;  2F0F A;  4A3K B;  1I4X A;  4ZYS A;  4GNX C;  2RDF A;  1JOQ A;  1LYL A;  1FYC A;  5IY0 A;  1ENF A;  2EYM A;  4GKJ L;  1EYA A;  2J4X A;  2KCM A;  1PH1 A;  3M7G A;  4HID A;  1RF2 D;  5IYC H;  3F2C A;  3PUZ A;  5FO7 B;  4P74 A;  2WII B;  1HR0 W;  4L5T A;  1J6Q A;  4F8M A;  1D5Z C;  5BR8 L;  1DCZ A;  4KK7 A;  3T4A C;  3A74 A;  4EGV A;  4HIK A;  3HKS A;  1K8A C;  2K5V A;  4XIG S;  3T51 B;  1S5B D;  1EZ6 A;  2CVR A;  1X3F A;  3M85 A;  2N78 A;  1PTO B;  2L9H A;  1SN8 A;  4K8J A;  1KNA A;  1HQM C;  5C3W A;  1VQ9 A;  2PZT A;  1STG A;  2RCF A;  1JT8 A;  3GO5 A;  3OW7 A;  1BR9 A;  1O7L A;  4R1J A;  4JBK A;  3J81 i;  1PH3 A;  4X3S A;  1HRJ A;  2IHF A;  5G3L D;  3V05 A;  5KND A;  3H3V I;  4I7A A;  3ZYY X;  2Q8I B;  4R4C A;  2D62 A;  3BYY B;  4C3H H;  2A73 B;  1PZI D;  1TWC H;  3H0G G;  2R7Z H;  4I7Z C;  3VR3 A;  1PVO A;  4XTC S;  1A2T A;  3F8T A;  4C3H B;  1ESR A;  3L2P A;  2Z6K A;  3KBX A;  3T56 B;  1TWC B;  4CDD C;  3BVG A;  4JV5 Q;  2R7Z B;  2V1C C;  2ICE C;  3DLL A;  2CWP A;  3TN2 A;  1AP0 A;  5ELO A;  5JJI A;  1LTG D;  2QW7 A;  3C1E A;  1HA6 A;  2HCI A;  3PO2 G;  3CW2 C;  4AYB B;  4LUZ A;  1UE5 A;  4AYB E;  4KKS A;  3I90 A;  2BH2 A;  2KA7 A;  3G48 A;  2WAC A;  4LF9 Q;  2A8V A;  3CCE A;  2WV6 D;  4A3I G;  1LTB D;  2NN6 H;  3GTP H;  3SK6 A;  1X3E A;  4JI2 L;  1I94 L;  1DXM A;  2JQO A;  1YIJ A;  3VYR A;  3GTP B;  5GAG C;  3NWT A;  2NYZ D;  1X9N A;  5JPM C;  1IYU A;  3C2P A;  1RCV D;  3VR2 A;  4R8N A;  2AQ1 B;  3KLS X;  2CFM A;  1RIP A;  4RG1 A;  2EPB A;  2Y0S B;  4K8I A;  1SBB B;  1GUO A;  2Y0S E;  4FXK C;  2LMC B;  4PMC A;  1MJC A;  3E5S A;  4KKT A;  1PA6 A;  2F1M A;  2NVY H;  4WRD A;  3GTM H;  4K0K Q;  2F0I A;  4OO1 H;  4K2L A;  3TBI B;  1D5M C;  3EJI A;  5ISR A;  1PFB A;  2EY2 A;  2NVY B;  2CHB D;  3GTM B;  3CCM A;  3C46 A;  4J6H A;  5CMD A;  5ELB A;  4ZRZ A;  2B63 G;  3H6M A;  1CZW A;  3UDI A;  3RN5 A;  2HIV A;  2F0O A;  1I4Q A;  1J5E Q;  1VQJ A;  4C3I G;  3K57 A;  1S4Z A;  1VQF A;  1OXS C;  3A7L A;  3MXP A;  4DF7 A;  3H3V H;  1Y1V G;  1A3V A;  1NMG A;  3MA2 B;  2Q2T A;  5AJ3 L;  2PZU A;  4KLK A;  3OW2 A;  2BA1 A;  4WOR A;  3OOC A;  4G7H C;  1KRS A;  4H02 A;  4EQO A;  5DM7 3;  3STB D;  2JA6 H;  3J81 E;  1N34 L;  1XMQ L;  3FHW A;  2ALY B;  5LL6 S;  2LXK A;  3NSW A;  1PH9 A;  1IW7 D;  3BZK A;  2FJ2 A;  2DNC A;  1PMR A;  2QEX A;  4X65 L;  1ESF A;  3ERO A;  4ID6 A;  2JA6 B;  1BO0 A;  2WIN B;  2R92 G;  3DWP A;  1HFN A;  1DGS A;  1I94 Q;  4IOA A;  4TKO B;  2Z8L A;  1FD7 D;  1WOC A;  4BXX G;  5KNB A;  1FL0 A;  4YCV A;  1SE8 A;  5I9O A;  4DR6 Q;  4LF4 Q;  1EIF A;  4IFD H;  1LTL A;  4FP5 D;  2GN5 A;  4FXD A;  3A55 A;  4FF4 A;  3I73 A;  3NP8 A;  3STB C;  5LMN L;  3JAM i;  5C4X H;  1E7Z A;  1EY0 A;  1IW7 C;  5IOC A;  3HGB A;  4IZ8 A;  1VS0 A;  5C4X B;  1J8I A;  2SNS A;  3U9O A;  1E22 A;  1XWE A;  1EWH A;  1ICW A;  1DD2 A;  3RN2 A;  2VNU D;  2E76 C;  2ZXO A;  1EY9 A;  3CP0 A;  5E4W C;  4B9W A;  1WCM G;  2J0T D;  5EAY A;  3NEN A;  2ATW A;  3K7U C;  3OMC A;  3QOL A;  3S15 H;  3ULJ A;  2JA7 G;  5COY A;  2ZM6 Q;  1B1Z A;  1HFG A;  5AJ3 Q;  5M5Y H;  4H44 C;  3S2H H;  3S15 B;  4Q0F A;  1GUN A;  3I91 A;  1N34 Q;  1GOZ A;  4DAM A;  3S2H B;  1VQB A;  1C9O A;  2YTY A;  1PH5 A;  4X65 Q;  1CZG A;  5GQO A;  3J7Y W;  1I4R A;  3GTJ H;  1LTI D;  2K75 A;  4XT1 B;  1QJO A;  3CXC A;  5JPN C;  4LF6 Q;  3S2D H;  3GP7 A;  1F9R A;  1TWA H;  4AQY L;  3GTJ B;  4DR4 L;  1U4R A;  2RBM A;  3Q24 A;  4LUV A;  2SDF A;  3S2D B;  3Q22 A;  2Z6K C;  3D4R A;  4UP8 A;  1TWA B;  5H1S E;  3W1G A;  2R93 H;  3HOY H;  1A6X A;  2EYJ A;  3ULL A;  3TDQ A;  2FMM A;  3I56 A;  3O13 A;  3KF8 B;  4LK1 C;  5L37 A;  5KYI A;  2R93 B;  2QF7 A;  3HOY B;  4KD4 A;  5IT9 c;  2F0J A;  3L9A X;  1VQO A;  2XIW A;  2Z1C A;  3J7A F;  1VQ4 A;  2UXC Q;  5J3B A;  1PFN A;  5C0X J;  5I4D A;  1QVC A;  1A8V A;  4FYD A;  2L4N A;  4WJW A;  4ZKB B;  1HNW L;  1JWS D;  1B4O A;  2MPM A;  3S16 H;  3FEW X;  3E0J A;  2Q2I A;  1LO5 D;  1PH2 A;  3DUZ A;  1V9P A;  4QL5 A;  1PV4 A;  5ELC A;  3S16 B;  5M3F G;  4LFA L;  2F0L A;  4ME5 A;  4C3H G;  4HAE A;  4G7Z C;  3EA6 A;  4DV2 L;  1SEB D;  3OTO L;  3M9B A;  1KQS A;  1SNO A;  2OCE A;  4JI4 Q;  1EY4 A;  1SNQ A;  5CV4 A;  3F2D A;  1Q46 A;  3JAM E;  2F0U A;  3A54 A;  2AWN A;  1VQL A;  2B8G A;  4A3L G;  2L15 A;  1DOM A;  1K3R A;  1PLF A;  1CTM A;  3PO3 B;  1B44 D;  4K5X A;  3BG3 A;  1IBM L;  1O80 A;  1HQR D;  2XRQ D;  3HP3 A;  2D9U A;  2NN6 G;  5IYB G;  3IL8 A;  3K80 C;  1NY4 A;  2FXQ A;  1OO9 B;  2XSC A;  4DV5 L;  2X6L A;  1Y8P B;  1B9M A;  1SAP A;  2RSO A;  2E74 C;  4HJA A;  3BDL A;  1HJP A;  1QZG A;  2JA8 G;  4BBS H;  5D14 A;  4LFC L;  2MGS A;  1E2V A;  3EFX D;  4RFB A;  1H9S A;  4IUQ A;  2IL8 A;  2IJ0 A;  3TZU A;  5GRO A;  3S14 H;  3E0E A;  4BBS B;  4A3F H;  3U58 A;  4A93 H;  4HSV A;  1CUK A;  4QIW B;  3S14 B;  4QIW E;  1H9J A;  1RTN A;  4A3F B;  3MZ5 A;  4A93 B;  1P8L A;  4DV6 L;  3P1H A;  4RKL A;  4GNX B;  3UDG A;  3L0O A;  1BNZ A;  1LT3 D;  2H5X A;  4IUN A;  3A7A B;  4O1N A;  3GTK H;  3KUP A;  1CA6 A;  1I3Q H;  4QQB X;  1PXU A;  5FLM G;  4LFA Q;  2PYK A;  3GTK B;  3HOV H;  2A1A A;  3FP9 A;  4P2C B;  3NBH A;  4BY7 G;  1I3Q B;  3BDC A;  1GJX A;  2MNA A;  2XN9 C;  4IUT A;  4JI1 L;  3OTO Q;  3FPU B;  4DV2 Q;  1N32 Q;  4GNX A;  1QVF A;  3HOV B;  2WKC A;  2MP1 A;  2EE1 A;  5D3I B;  5CV6 A;  1Q1B A;  1WTX A;  2E5L Q;  1WYD A;  1X3G A;  1OXT A;  4ULL A;  4HJ8 A;  4JYA Q;  3D6W A;  2O5I C;  2NTT A;  1E1O A;  2SNM A;  3T1H L;  5DNF A;  3GTQ H;  2JA5 G;  4PG3 A;  1QE6 A;  1WTQ A;  3AFQ A;  2Q8R E;  1B2T A;  5C44 H;  1Y1W G;  1OXV A;  3TS0 A;  1KAW A;  1I4G A;  4N8F A;  4YCU A;  1SNC A;  2WB1 B;  4Z9C B;  5C44 B;  3PUV A;  2GVB A;  2WB1 E;  5IP9 G;  4LFC Q;  2WFW A;  4LJZ C;  1CKN A;  2VZA A;  1VQC A;  4X62 L;  4DV7 Q;  4R8I A;  2E2D C;  3B6Y A;  5JJK A;  4EX5 A;  2P5Z X;  3GTL H;  1EU3 A;  4RGN A;  3K5N A;  5CYU A;  1LTR D;  3QR8 A;  3PIO 3;  1BUV T;  2RSN A;  2VQE L;  2L11 A;  3DWA A;  4DV6 Q;  3GTL B;  2AUJ D;  1VQ8 A;  1O7Z A;  5C4X G;  2R7F A;  2F0G A;  4NP5 A;  1U4P A;  1Q1E A;  4OXP A;  4DK1 A;  2R61 A;  3I4O A;  4RCO A;  3R93 A;  1Q3L A;  4XDX A;  4M8A A;  5K36 G;  2HQL A;  1VCI A;  5J22 A;  2F3I A;  1A3U A;  4DUZ Q;  4JI1 Q;  2LXJ A;  1EY7 A;  4NXN L;  1Q90 A;  2XNA C;  3PUY A;  1HTP A;  4QCL A;  1Y14 B;  2JP1 A;  4R9W A;  3VR6 A;  2LY7 A;  2O5J C;  2QGQ A;  4KN7 C;  1TR5 A;  1ET6 A;  2A6H D;  3E6Z X;  2BA0 A;  3T1H Q;  2VUM H;  3J80 E;  5CV5 A;  4ABN A;  2ASB A;  1PTO F;  4NPS A;  3CCS A;  1XNR Q;  1F9P A;  2VUM B;  2CH4 A;  2HD3 A;  1NR4 A;  2NUC A;  1VMP A;  4J15 A;  1NE3 A;  4XYQ A;  2HHH Q;  4HMJ A;  5E7N A;  5BN3 A;  2ES2 A;  4LF7 L;  2EIF A;  2EJF C;  2QCP X;  4BBR H;  2IX3 A;  1E1T A;  3D31 A;  3E9I A;  1F2M A;  1DJR D;  2BOS A;  3U4Z A;  4X62 Q;  2K5D A;  2G9D A;  5FK9 C;  3KJO A;  4KY6 A;  4MNO A;  4DV4 Q;  2B2T A;  1Q82 C;  4OWX B;  4BBR B;  3M4O H;  1H95 A;  3K0Y A;  3I3C A;  4JPB W;  5D65 A;  4XT3 B;  4JBM A;  3H09 A;  5M3M B;  3QIA A;  5FKA C;  3M4O B;  1G8Z D;  1QUQ A;  2A6H C;  4V19 0;  4CJ2 C;  1H9K A;  2KQ3 A;  5IIF A;  3K58 A;  1PRT D;  2NZO A;  5DEH A;  4E6I A;  4DR5 Q;  3K81 C;  1QG7 A;  3CC2 A;  5GAE C;  5C5M A;  1NMF A;  4DV1 L;  2RF4 A;  5EBD A;  3HG9 A;  2ENB A;  3BVZ A;  3F2B A;  2B2Y A;  2EXD A;  2X69 A;  4HR7 B;  1KAA A;  4PV1 C;  4HJ5 A;  5D3D A;  3OIP A;  3H94 A;  2KCC A;  1VQP A;  2A74 C;  4O2D A;  3W3A A;  3C3L A;  1IZ6 A;  4ODG A;  2DN8 A;  4DKA C;  1FJG Q;  3P7J A;  2HDM A;  1HUM A;  4OX9 Q;  3NWS A;  3PUX A;  1CSQ A;  3TSS A;  1PRT C;  1BBX C;  5C0X G;  2MUY A;  4LWC A;  1X54 A;  4EQN A;  2AWO A;  2F03 A;  4K5V A;  2CWA A;  2RHQ B;  3V2T A;  2Z0S A;  4MTK A;  2Q2H A;  1YEZ A;  1CKO A;  1V8Q A;  2ZJP A;  3N6R A;  1HZA A;  4DXF A;  1D8L A;  4JCV E;  1HZC A;  1M4V A;  5KYL A;  1V1P A;  3BU2 A;  3OIQ A;  2IW3 A;  3P20 A;  4DA2 A;  2KHJ A;  2OXP A;  3KJP A;  1BOS A;  4A3F G;  3VR5 A;  2F0Q A;  1KHI A;  4CBV A;  1AW7 A;  5GAD C;  4OEL B;  2LS0 1;  3QOJ A;  4XQN A;  4DR1 Q;  4A3J G;  1S5F D;  1TY0 A;  2F0M A;  4TRD A;  1HCZ A;  2EYP A;  4A3G H;  1PTO H;  2WAQ B;  5JJL A;  4X3K A;  1XPO A;  2WAQ E;  4KHZ A;  3CME A;  3HS0 C;  4B3S L;  3PSI A;  2MQH A;  1L1O A;  4A3G B;  5HGQ A;  4IO9 A;  1JOK A;  1CA5 A;  2RCN A;  4EQ5 A;  4TSS A;  3HOV G;  1I5F A;  2BE5 D;  4C1N I;  4RGO S;  5J39 A;  1HZ9 A;  5KNC A;  1KD1 C;  1STE A;  4AIM A;  1QWY A;  1XMO L;  1S40 A;  3RLF A;  2IX1 A;  4RHS A;  1F2Y A;  4OL7 A;  3HOZ G;  4RKB A;  1Y8N B;  4GN5 A;  4BY1 H;  1SRU A;  1HNZ Q;  4FVM A;  2XWJ B;  2HDL A;  2L12 A;  5M9O A;  2VQF Q;  1PFM A;  2EOT A;  4BY1 B;  3A8J E;  2AQ3 B;  4JW0 A;  4DR2 L;  5IGF A;  4R4T A;  1BBU A;  1XPR A;  3RUZ A;  2WB1 G;  4B08 A;  4ILW A;  1WTO A;  1UEA B;  1EYD A;  1ZXT A;  4OEM B;  2YTX A;  1LTS D;  5C3E H;  2BE5 C;  4FNF A;  2LKV A;  2H4O A;  3GTG H;  4GKJ Q;  4LUO A;  4C56 C;  5C3E B;  1M8A A;  5E1F A;  1PFS A;  3P75 A;  2A19 A;  1VF5 C;  5A2Q E;  3GTG B;  1B3Q A;  2M00 A;  4ZAI A;  1OXX K;  1QB5 D;  5BR8 Q;  2F4V L;  1I4H A;  3S1N H;  1EOT A;  1K0R A;  3W1B A;  1AN8 A;  3A56 A;  1VQE A;  4DR7 L;  3CU7 A;  2JJQ A;  3HZX A;  3MC0 B;  3S1N B;  2OTL A;  4B3S Q;  2EYL A;  1SYD A;  2AQ2 B;  4CDC C;  1I6V C;  2JEB I;  1SJE D;  1NR2 A;  3D6C A;  1DON A;  3FKI G;  1EQR A;  5LL6 X;  2R6G A;  2TSS A;  4EVO A;  3OPO A;  1DM0 B;  1BQQ T;  4JBW A;  3G7L A;  2B2T C;  4P75 A;  4F88 A;  3I7F A;  1ENC A;  2KOL A;  2DGY A;  3KLS A;  1BCP D;  1XPU A;  1VQM A;  5ELN A;  3KYH C;  4B9X A;  3NQI A;  3MXU A;  5JVH 3;  3U4V A;  4ZCK A;  2OF1 A;  5JEA H;  3J7A 5;  2VB3 X;  2K7V A;  1E0B A;  2JXM B;  1WTP A;  3TP7 A;  3I70 A;  3KLR A;  1CI3 M;  1C7Y A;  4LFB L;  3PIO A;  4A3E H;  4KHV A;  4IFD J;  1RD9 D;  1SR3 A;  2UUC L;  1Q8K A;  1PH6 A;  1E2Z A;  4LF8 L;  2QDL A;  4A3E B;  2B2Y C;  2EQS A;  3K6O A;  3I4M G;  1BBW A;  2L0C A;  2Z4I A;  5DM6 3;  5FJ8 G;  5EQ0 A;  1C8C A;  1OTC A;  4A3M H;  5AFW A;  2HT1 A;  1AE3 A;  4HTH A;  2CH4 W;  1EEI D;  4GN3 B;  4GLX A;  2N88 A;  4BBR G;  4A3M B;  1BCP C;  5CV9 A;  2NZ1 D;  1K0S A;  4APV A;  5C3X A;  4NDX A;  4G7O C;  1KLU D;  3NEL A;  3CCU A;  1H9R A;  4JI2 Q;  2HIX A;  4JC0 A;  5EKL A;  1TS4 A;  3HOX H;  2M9V A;  4OON A;  2N55 A;  1GHJ A;  5JJZ A;  4OWW B;  3I4N B;  1MGS A;  4XXE A;  2PQA B;  3HOW H;  4DR7 Q;  1VQH A;  3A8I E;  3DM1 A;  2CKZ B;  1VQ6 A;  3HOX B;  1EIG A;  2QIL A;  2ID0 A;  3TP6 A;  1A62 A;  3TRE A;  3HOW B;  2B2V A;  2Z4H A;  3J81 j;  5C6A A;  5EPL A;  1YJN A;  3UE1 A;  1WVL A;  3IFT A;  2MO0 A;  2PQA A;  1WJJ A;  5IGG A;  1YHA A;  1HNX L;  4S3S A;  1VQ5 A;  1GUG A;  1LAC A;  4CHT B;  1W3S A;  4A3C H;  1RKN A;  4JOI A;  4PZ8 A;  4L63 B;  4X66 L;  3M4Y A;  3K0X A;  1IKL A;  2F0V A;  2D2C C;  1TY2 A;  2X6G A;  1L1O C;  4B3R L;  1FNW A;  4QB4 A;  4A3K G;  1D2B A;  5IOD A;  1Q8I A;  2NVQ H;  3PF4 A;  2QA4 A;  5M5X H;  4L6T B;  2JSO A;  1X6O A;  3CD6 A;  5DAU A;  3VYS A;  2NVQ B;  2E75 C;  1LTA D;  3AMU A;  5M5X B;  4MZ9 A;  1XMQ Q;  2R7D A;  3T16 A;  2F0T A;  2FMC A;  1KLG D;  2EY1 A;  2K50 A;  2VW9 A;  4IN3 A;  3CMA A;  4C1N K;  2O2L D;  4FF3 A;  5IYC G;  2EXZ A;  1D5X C;  1II3 A;  3SHL A;  3KF6 A;  2F0H A;  3DEP A;  4YWL A;  1FGB D;  3OSO A;  4DAY A;  2PZW A;  3GV3 A;  2L55 A;  1YNN D;  1DOK A;  2K5Q A;  1B70 B;  3KDF A;  4RA8 A;  4IJH A;  5LMN Q;  4I65 A;  2L5T A;  4U68 A;  5ELE A;  4IAL A;  1HNX Q;  1N9W A;  4QJF A;  2I5H A;  4BS9 A;  3TP5 A;  1VQD A;  1SYB A;  1JR0 D;  1I4P A;  4QUF A;  2K14 A;  1K83 H;  4C3J H;  1GUW A;  1NUC A;  4ZUI A;  4JI0 L;  2DY7 A;  4CJ0 B;  3NQT A;  5HUR A;  2R7Z G;  1K83 B;  1KC8 C;  4C3J B;  3NTK A;  1AZQ A;  4RCN A;  1KDC A;  1TWG H;  2KUM A;  4BA1 I;  3PO3 H;  3ND8 A;  1YNN C;  1EL0 A;  4DNI A;  3UI2 A;  3DHQ A;  1WI5 A;  4KD3 A;  3FDT A;  4AYB G;  3TEH B;  1EZ8 A;  2WP8 J;  1TWG B;  1JQY D;  1E3P A;  4RMF A;  1JWM D;  1EEF D;  1STN A;  4KY7 A;  3NEM A;  1H9S B;  1TVX A;  2B2U C;  1YI2 A;  1STH A;  3S1R H;  1R4P B;  1BXT A;  3DM3 A;  5IP7 H;  5G3L F;  4AQY Q;  1W6J A;  3LNN A;  4DR4 Q;  3S1R B;  1B53 A;  2MJ8 A;  3HKZ B;  1JIC A;  4JVZ A;  3HKZ E;  2ICI A;  3VYU A;  1SRO A;  1VMC A;  1LUZ A;  5CC4 A;  2Y0S G;  4FF1 A;  4WJ3 M;  4LAA A;  1L0W A;  3J80 c;  1PRT B;  1WTR A;  1BKB A;  4NKL A;  4OIJ A;  4NXM L;  4WFN 3;  3NBH B;  2ZTE A;  4KKU A;  3SR1 A;  1UUP A;  3CPW A;  2ZT9 C;  4OO1 G;  1JC7 A;  4IQZ A;  1HNW Q;  2EY6 A;  1XX8 A;  3CCR A;  1EY6 A;  3ERS X;  1ICF B;  2O4X A;  2K5N A;  1DOL A;  1WD1 A;  1N36 L;  1G29 1;  4JI0 Q;  2BDO A;  4KI0 A;  1N33 L;  3MEH A;  4O0A A;  2OWO A;  3MXG A;  2B2V C;  1TII D;  4A3E G;  1MI2 A;  4IPH A;  3TP8 A;  3G6J B;  2A69 D;  1KTK A;  2GA4 B;  3I4L A;  2K5H A;  2F0W A;  1NTG A;  2PQE A;  2VXW A;  5FO9 B;  5JOB A;  1YHB A;  5LMN W;  1NSN S;  1ROD A;  4HIM A;  4A3M G;  1T9H A;  1E2W A;  2JA6 G;  4GKK L;  4IOC A;  2K05 A;  4HED A;  5ELD A;  1IBM Q;  1EIY B;  1SYC A;  4JI7 L;  1CKN B;  1SFO B;  1G6Z A;  2PI2 E;  1BCP F;  4JOI C;  1D1K A;  4X3U A;  2ZXP A;  4JI5 L;  1FVI A;  1U4M A;  1EQT A;  1MBY A;  3TZD A;  1KAB A;  1SMY D;  4DV5 Q;  2NVX H;  2NVT H;  1NCV A;  4OWT B;  1GVP A;  3NTI A;  4LF5 L;  5CV8 A;  4UPA A;  2NVX B;  2NVT B;  4IPG A;  4UP7 A;  4A76 A;  2F0P A;  5IE8 A;  3S17 H;  2PI2 A;  1HR0 L;  4U67 3;  3RNU A;  4IUU A;  2A69 C;  4N9T A;  2KVM A;  1GXD C;  3FPP A;  3CRK C;  5LHY 1;  3S17 B;  2EY5 A;  4IFD G;  3GDE A;  1MHW C;  4DNR B;  4CGY B;  5FLX c;  4JG2 A;  1STB A;  4KHP L;  1XNQ L;  3TS2 A;  2HQE A;  1HZB A;  3MWY W;  4YWK A;  2GVA A;  1KDB A;  2K33 A;  2EVB A;  1ZEQ X;  3DEO A;  3AFP A;  4H0L C;  4HJ7 A;  1T5E A;  4B3M L;  1ET9 A;  1SMY C;  4A3I H;  4GOP A;  1N36 Q;  2D0P A;  3NPP A;  1IHZ A;  5BN5 A;  3R2T A;  4A3I B;  3SXH A;  3MXN A;  3G6E A;  1SYF A;  2RKS A;  2AKW B;  1XTD A;  1NAP A;  2UUB L;  3QB3 A;  1AFP A;  4CKC A;  5E3F A;  1MKH A;  2HUG A;  4WJ4 A;  1S5E D;  1QZH A;  3VA5 A;  1LT6 D;  5EKI A;  1K3B C;  1Z7T A;  4IPC A;  1UNS A;  1TS3 A;  2C5C A;  3FRP B;  1V1O A;  5JAV A;  4X64 L;  4POF A;  1ASY A;  2EYH A;  3KOJ A;  1IXR A;  1C4Q A;  3BYT B;  4KV6 A;  2XRS D;  1GM5 A;  1ILQ A;  3AB9 A;  1C48 A;  4LF5 Q;  1JOR A;  2DY8 A;  3EN2 A;  5HGT A;  2F0S A;  2B63 H;  1QUQ B;  2EYO A;  1KIX A;  4QY7 A;  5IT9 L;  4YIJ A;  3BVM A;  2HCC A;  1JE4 A;  3GD7 A;  1UE7 A;  2R93 G;  3HOY G;  2B63 B;  3UE0 A;  3R8B A;  1PDQ A;  2QDB A;  5M3M H;  4B3T L;  1HHV A;  2K32 A;  4C3I B;  3CHB D;  1JOO A;  4DUY L;  2TMP A;  5KEE A;  1CQV A;  3WOF A;  3ND9 A;  4MIU A;  1VQG A;  1KL9 A;  2VQE Q;  1AH9 A;  1VQK A;  2EJM A;  2EZV A;  5TSS A;  4YWM A;  3S1M H;  1IBL L;  4QGU A;  2ZJQ A;  4CKB A;  1X3P A;  1CKM A;  1BCP B;  1U0L A;  3S1M B;  1I50 H;  3FVQ A;  3SDZ A;  2I0Q A;  1X56 A;  4C3J G;  1U4L A;  4NXN Q;  1I50 B;  4PMW A;  4BXX H;  3EIV A;  2I5M X;  2ZJR A;  3SGI A;  4ZLT F;  2JYO A;  1U5K A;  3J7Z C;  5ELF A;  1QIL A;  1HXY D;  1ZYR D;  5CBA E;  4V0B A;  2M2L A;  1HA5 A;  1EU4 A;  2VB2 X;  3Q23 A;  3PO3 G;  4YHH L;  1CK1 A;  1YNX A;  3D4W A;  4FO2 A;  4CKE A;  4EQP A;  3C1F A;  1V1P B;  4HCE A;  4X64 Q;  3RZD H;  1G2T A;  1SNM A;  2MO1 A;  4R4I A;  3M7N A;  3M4P A;  1E24 A; 
#chains in the Genus database with same CATH homology
 5EPJ A;  1Z47 A;  2A6E C;  3RZD B;  3OMG A;  3BS1 A;  2E2H B;  3J80 L;  1TWH B;  4IUP A;  2NB0 A;  5I2Y A;  1QNU A;  5EGT A;  1TS2 A;  1ZYR C;  3BDO A;  4A3D B;  4GZY C;  4JK1 C;  1F77 A;  1WCM B;  1XTC D;  1T5X D;  2RQX A;  2YYZ A;  2JA7 B;  2KEE A;  5I6W A;  2G9H D;  2NN6 I;  1LAB A;  4HCS A;  1ZKO A;  1F2Z A;  1SJH D;  4L8J A;  3IAY A;  3L7Z C;  3MHB A;  1LT5 D;  4DNT B;  3K7A B;  1G91 A;  3I8Z A;  3SVM A;  2RDG A;  2J7Z A;  4PMB A;  5IGB A;  2EJG C;  4DN4 M;  3SK4 A;  1VDZ A;  4RH6 A;  3LX0 A;  3J7A V;  1JCK B;  4OO1 I;  4Y7N B;  1GHK A;  5I9P A;  3IFD A;  1F9Q A;  5CR3 A;  2RA4 A;  5I2X A;  1G2S A;  3NK9 A;  1SE3 A;  2PNR C;  4ZQ3 A;  5COR A;  4LMQ D;  3HEJ A;  5I6Y A;  1XXG A;  1I6H B;  4K2K A;  2F3W A;  5M5W B;  3MFG A;  5CBE E;  5FLX L;  5JEA J;  4QF4 A;  2K04 A;  3N52 A;  1EWC A;  4RWS C;  1S5C D;  5M3F B;  2CQA A;  4KJO A;  4BWG B;  1SNP A;  5T1G A;  5C4H A;  5KIX A;  1Y69 U;  1Y8O B;  2V4D A;  2PO4 A;  3EVQ A;  3QG1 A;  4KJN A;  2F0D A;  1TU2 B;  3D3R A;  1TT2 A;  3NE5 B;  3SE0 A;  1KDA A;  5IGE A;  1YNJ D;  1FR3 A;  3SK5 A;  5C5L A;  4IFD I;  3IKJ A;  1EY8 A;  1D6E C;  4CJ1 B;  1B3A A;  4K5W A;  2QEJ C;  3NXW A;  1SND A;  2KHS A;  2EDG A;  1SSO A;  2B8F A;  3MAQ A;  2B2U A;  2JA8 B;  1LV9 A;  2PPB C;  2KED A;  4BA2 I;  1H9M A;  3OHX C;  3M3Y B;  2SOB A;  1QOH A;  4F7X A;  1YNJ C;  3R2I A;  1MD2 D;  3QJY A;  5CV7 A;  1SXT A;  2A68 D;  2NTS A;  3PIP 3;  2B2W A;  4J8Q A;  1HTL D;  3ITP A;  1QNK A;  4M1U B;  3KBG A;  3U9S A;  4BY7 B;  2PW5 A;  4RHR A;  1IL8 A;  3ERQ A;  1EQV A;  1TQO A;  1A15 A;  5FOB B;  2NBF A;  1JB3 A;  5A2Q L;  1CHP D;  3Q6S A;  1TKW B;  2JA5 B;  1STY A;  2A68 C;  1Z6H A;  2RDH A;  3L3O C;  1Y1W B;  4MHE A;  3K5O A;  4G57 A;  4IUR A;  3Q0A A;  3VR4 A;  3LWU A;  1SDF A;  4KTA A;  2AUK A;  2IWH A;  1GUT A;  5JVG 3;  4HSP A;  3A8K E;  4ZKC B;  1WTV A;  3NUC A;  5T1I A;  2BDN A;  3K5L A;  1KNE A;  3H91 A;  1JWU D;  1PRT F;  2KCN A;  1LLR D;  2H1E A;  1PTO D;  3OWE B;  2WKD A;  3PV0 A;  2IT1 A;  3GV6 A;  5K36 H;  1FNV A;  2ZXR A;  4DGZ A;  2L1B A;  3T53 B;  2K03 A;  3WOE A;  1CQF A;  1RJT A;  2NWG A;  2F4I A;  1S5D D;  4HN7 A;  5C4J B;  3J81 L;  2CW0 D;  5C0X I;  1OXU A;  2C9O A;  4F87 A;  2XVS A;  5M5Y B;  1WTW A;  3NHH A;  3RMH A;  1PTO C;  4X3T A;  3DWQ A;  1K8M A;  5CGK A;  1PYW D;  1EY5 A;  1GUS A;  1XYI A;  4H13 C;  1BDO A;  4ZUJ A;  1EYC A;  4UAI A;  4DXG A;  3FMC A;  3X3M A;  4Q5V A;  1K8O A;  2K5W A;  1TS5 A;  2CW0 C;  1DZ1 A;  1MSH A;  3NBI A;  3KK7 A;  1HUN A;  4G4K A;  3URY A;  2IPK D;  4C2M B;  2K01 A;  2MHV A;  1L0Y B;  4OIK A;  1A3T A;  1CT1 D;  4OHJ A;  3KF8 A;  5EPK A;  1X32 A;  2FHT A;  1SYE A;  3SEB A;  1PZJ D;  4A3B B;  5F2D A;  5K5P A;  5A35 A;  3RD4 A;  2E2J B;  2DNE A;  3HOU B;  1RHP A;  3CQZ B;  4K6L A;  2PCF B;  1DYQ A;  5BN4 A;  1F9S A;  3MVV A;  2YU9 B;  2A5H A;  3HRZ C;  5C0X H;  3QWN A;  1STA A;  2B2W C;  1IYV A;  1CM9 A;  3BZD B;  3QO2 A;  5KRU A;  4DK0 A;  1SYG A;  4RGM A;  2OT2 A;  3I72 A;  2SEB D;  1QCB D;  3W2D A;  1J9O A;  1LTT D;  3F2U A;  4NW2 A;  5JEA G;  5EJW A;  4RGT A;  4FXG C;  3EQL C;  1L0X B;  3WDN A;  4FF2 A;  1D1I A;  5C4Z A;  3ONA B;  4PNY A;  2QKI C;  4KY5 A;  5IGD A;  1SE2 A;  1Q12 A;  4A3J B;  3H3V C;  3PMF A;  1SE4 A;  4KN4 C;  4DU9 A;  5KGU A;  2EYF A;  2F3V A;  1CHQ D;  1O78 A;  1A2U A;  2D5D A;  2I07 B;  3JAM L;  4KMU C;  1CFM A;  3OWF A;  3MFY A;  5EKK A;  1AEX A;  3K5M A;  1ML0 D;  4DAP A;  3TME A;  3T13 A;  3HOZ B;  1EIH A;  1W6K A;  1UAP A;  2FIN B;  4XYO A;  3D4D A;  4XQQ A;  5IT9 E;  3H0G B;  4UDU C;  4QMG A;  3GTQ B;  2BCO A;  2JE6 I;  1B50 A;  4H7B A;  4IUV A;  3PUW A;  2Q8T A;  4DAV A;  3RZO B;  3PO2 B;  5IGC A;  1R4Q B;  2F0E A;  4HMI A;  3VYT A;  4RAU C;  3VA7 A;  1RTO A;  4ZK9 B;  1LT4 D;  2K28 A;  3K59 A;  4J1M A;  3GQB A;  4OGQ C;  3DMU A;  2PW7 A;  3GTO B;  3NTH A;  1RDP D;  2F0K A;  1VF7 A;  3FKI B;  2FFK B;  2LFN A;  1EFI D;  3MTS A;  1FNU A;  1TWF B;  3DXJ C;  5FO8 B;  1ILP A;  1V43 A;  4MN3 A;  5EBC A;  2E2I B;  4XQJ A;  3V96 A;  2F0N A;  2B39 A;  3S9W A;  1R9T B;  2KEC A;  1ONL A;  2K6A A;  5NUC A;  1IKM A;  4PQX A;  1Y1V B;  1AZP A;  4TQU S;  3D8G A;  3I4M B;  3AU7 A;  4N9P A;  1HPC A;  2R3Z A;  5J1Z A;  2A6E D;  4DFA A;  3R3O A;  4O42 A;  2IX0 A;  1ENA A;  2R92 B;  1BF4 A;  3LWE A;  2XWB B;  4K14 A;  1MSG A;  1F2L A;  3SK8 A;  4QUC A;  1B9N A;  2KJX A;  1PZK D;  3CRL C;  1U9R A;  2OEO A;  2RVL A;  4NMZ A;  4K6D A;  1X3Q A;  3CKI B;  3S1Q B;  2PMZ B;  5E4X A;  2I46 A;  2K1B A;  2JEA I;  1WD0 A;  5FLX E;  3X3N A;  1O7Y A;  2F0F A;  4A3K B;  1I4X A;  4ZYS A;  2RDF A;  1JOQ A;  1FYC A;  1ENF A;  2EYM A;  1EYA A;  2J4X A;  3M7G A;  1RF2 D;  3PUZ A;  5FO7 B;  2WII B;  4F8M A;  1D5Z C;  1DCZ A;  4KK7 A;  3T4A C;  4EGV A;  4XIG S;  3T51 B;  1S5B D;  1EZ6 A;  2CVR A;  3M85 A;  1PTO B;  2L9H A;  4K8J A;  1KNA A;  1HQM C;  5C3W A;  2PZT A;  1STG A;  3GO5 A;  3OW7 A;  1BR9 A;  1O7L A;  4X3S A;  1HRJ A;  5G3L D;  3V05 A;  5KND A;  3ZYY X;  2Q8I B;  2D62 A;  3BYY B;  2A73 B;  1PZI D;  4I7Z C;  3VR3 A;  4XTC S;  1A2T A;  4C3H B;  1ESR A;  3KBX A;  3T56 B;  1TWC B;  2R7Z B;  3BVG A;  2ICE C;  3TN2 A;  1AP0 A;  1LTG D;  3C1E A;  1HA6 A;  2HCI A;  4AYB B;  4KKS A;  3I90 A;  2KA7 A;  2WAC A;  2WV6 D;  1LTB D;  2NN6 H;  3SK6 A;  1DXM A;  3VYR A;  3GTP B;  3NWT A;  2NYZ D;  5JPM C;  1IYU A;  3C2P A;  3VR2 A;  1RCV D;  4R8N A;  2AQ1 B;  3KLS X;  2EPB A;  2Y0S B;  4K8I A;  1SBB B;  1GUO A;  4FXK C;  2LMC B;  4PMC A;  4KKT A;  3E5S A;  2F1M A;  4WRD A;  2F0I A;  4OO1 H;  4K2L A;  3TBI B;  1D5M C;  3EJI A;  5ISR A;  1PFB A;  2EY2 A;  2NVY B;  2CHB D;  3GTM B;  3C46 A;  4J6H A;  5CMD A;  5ELB A;  4ZRZ A;  3H6M A;  1CZW A;  2F0O A;  1I4Q A;  4C3I G;  3K57 A;  1S4Z A;  1OXS C;  3A7L A;  3MXP A;  4DF7 A;  1A3V A;  3MA2 B;  2PZU A;  2BA1 A;  4WOR A;  3OOC A;  4G7H C;  4EQO A;  5DM7 3;  3J81 E;  5LL6 S;  3NSW A;  1IW7 D;  2FJ2 A;  2DNC A;  1PMR A;  2JA6 B;  1ESF A;  3ERO A;  4ID6 A;  1BO0 A;  2WIN B;  3DWP A;  1HFN A;  4TKO B;  2Z8L A;  1FD7 D;  5KNB A;  5I9O A;  4IFD H;  4FP5 D;  4FXD A;  3A55 A;  4FF4 A;  3I73 A;  3NP8 A;  1EY0 A;  1IW7 C;  5IOC A;  3HGB A;  4IZ8 A;  5C4X B;  1J8I A;  2SNS A;  3U9O A;  1XWE A;  1EWH A;  1ICW A;  1DD2 A;  2VNU D;  2E76 C;  2ZXO A;  1EY9 A;  5E4W C;  4B9W A;  2J0T D;  3OMC A;  3QOL A;  5COY A;  1B1Z A;  1HFG A;  4H44 C;  3S15 B;  4Q0F A;  1GUN A;  3I91 A;  1GOZ A;  3S2H B;  1CZG A;  3J7Y W;  1I4R A;  1LTI D;  4XT1 B;  1QJO A;  5JPN C;  3GP7 A;  1F9R A;  3GTJ B;  1U4R A;  2RBM A;  3Q24 A;  2SDF A;  3S2D B;  3Q22 A;  3D4R A;  1TWA B;  1A6X A;  2EYJ A;  3TDQ A;  2FMM A;  3O13 A;  4LK1 C;  5KYI A;  2R93 B;  2QF7 A;  3HOY B;  4KD4 A;  2F0J A;  3L9A X;  2XIW A;  2Z1C A;  3J7A F;  1PFN A;  5C0X J;  5I4D A;  4FYD A;  2L4N A;  4WJW A;  4ZKB B;  1JWS D;  1B4O A;  2MPM A;  3FEW X;  3E0J A;  1LO5 D;  3DUZ A;  5ELC A;  3S16 B;  2F0L A;  4ME5 A;  4C3H G;  4HAE A;  4G7Z C;  3EA6 A;  1SEB D;  1SNO A;  1EY4 A;  1SNQ A;  5CV4 A;  3JAM E;  2F0U A;  3A54 A;  2AWN A;  2B8G A;  1DOM A;  1PLF A;  1CTM A;  3PO3 B;  1B44 D;  4K5X A;  3BG3 A;  1O80 A;  1HQR D;  2XRQ D;  3HP3 A;  2D9U A;  2NN6 G;  3IL8 A;  1OO9 B;  2XSC A;  2X6L A;  1Y8P B;  1B9M A;  1SAP A;  2RSO A;  2E74 C;  3BDL A;  5D14 A;  2MGS A;  1E2V A;  3EFX D;  4RFB A;  1H9S A;  4IUQ A;  2IL8 A;  2IJ0 A;  3TZU A;  4BBS B;  4HSV A;  4QIW B;  3S14 B;  1RTN A;  1H9J A;  4A3F B;  3MZ5 A;  4A93 B;  3P1H A;  4RKL A;  1BNZ A;  1LT3 D;  4IUN A;  3A7A B;  4O1N A;  3KUP A;  1CA6 A;  1PXU A;  2PYK A;  3GTK B;  4P2C B;  3NBH A;  1I3Q B;  3BDC A;  1GJX A;  2XN9 C;  4IUT A;  3FPU B;  3HOV B;  2WKC A;  2MP1 A;  2EE1 A;  5D3I B;  5CV6 A;  1Q1B A;  1WTX A;  1OXT A;  4ULL A;  3D6W A;  2O5I C;  2NTT A;  2SNM A;  5DNF A;  1WTQ A;  1QE6 A;  2Q8R E;  1B2T A;  1OXV A;  1I4G A;  1SNC A;  2WB1 B;  4Z9C B;  5C44 B;  3PUV A;  4LJZ C;  4R8I A;  2E2D C;  1EU3 A;  4RGN A;  3K5N A;  5CYU A;  1LTR D;  3PIO 3;  1BUV T;  2RSN A;  2L11 A;  3DWA A;  3GTL B;  2AUJ D;  1O7Z A;  2F0G A;  4NP5 A;  1U4P A;  1Q1E A;  4DK1 A;  2R61 A;  4RCO A;  3R93 A;  1Q3L A;  4XDX A;  4M8A A;  5K36 G;  1VCI A;  5J22 A;  1A3U A;  1EY7 A;  1Q90 A;  2XNA C;  3PUY A;  1HTP A;  4QCL A;  2JP1 A;  4R9W A;  3VR6 A;  2LY7 A;  2O5J C;  4KN7 C;  1TR5 A;  1ET6 A;  2A6H D;  3E6Z X;  2BA0 A;  3J80 E;  5CV5 A;  4ABN A;  1PTO F;  1F9P A;  2VUM B;  1NR4 A;  2NUC A;  1VMP A;  4XYQ A;  4HMJ A;  5BN3 A;  2EJF C;  2QCP X;  2IX3 A;  3D31 A;  1F2M A;  1DJR D;  2BOS A;  2K5D A;  2G9D A;  5FK9 C;  4KY6 A;  2B2T A;  4BBR B;  3K0Y A;  3I3C A;  5D65 A;  4XT3 B;  3H09 A;  5M3M B;  3QIA A;  5FKA C;  3M4O B;  1G8Z D;  2A6H C;  4V19 0;  4CJ2 C;  1H9K A;  2KQ3 A;  5IIF A;  3K58 A;  1PRT D;  5DEH A;  4E6I A;  1QG7 A;  5C5M A;  5EBD A;  3HG9 A;  2ENB A;  3BVZ A;  2B2Y A;  4HR7 B;  2X69 A;  1KAA A;  4PV1 C;  5D3D A;  3OIP A;  3H94 A;  2KCC A;  2A74 C;  3W3A A;  3C3L A;  4ODG A;  2DN8 A;  3P7J A;  2HDM A;  1HUM A;  3NWS A;  3PUX A;  3TSS A;  1PRT C;  1BBX C;  5C0X G;  2MUY A;  4EQN A;  2AWO A;  2F03 A;  4K5V A;  3V2T A;  1V8Q A;  3N6R A;  4DXF A;  5KYL A;  1M4V A;  1V1P A;  3OIQ A;  2IW3 A;  3P20 A;  4DA2 A;  2OXP A;  1BOS A;  3VR5 A;  2F0Q A;  4CBV A;  1AW7 A;  2LS0 1;  3QOJ A;  4XQN A;  1S5F D;  1TY0 A;  2F0M A;  4TRD A;  1HCZ A;  2EYP A;  1PTO H;  2WAQ B;  4X3K A;  4KHZ A;  3HS0 C;  4A3G B;  1JOK A;  1CA5 A;  4TSS A;  2BE5 D;  4C1N I;  4RGO S;  5J39 A;  5KNC A;  1STE A;  1QWY A;  3RLF A;  2IX1 A;  4RHS A;  1F2Y A;  4OL7 A;  4RKB A;  1Y8N B;  4FVM A;  2XWJ B;  2HDL A;  2L12 A;  5M9O A;  1PFM A;  2EOT A;  4BY1 B;  3A8J E;  2AQ3 B;  5IGF A;  3RUZ A;  4B08 A;  4ILW A;  1WTO A;  1UEA B;  1EYD A;  1ZXT A;  1LTS D;  2BE5 C;  4FNF A;  2LKV A;  2H4O A;  4C56 C;  5C3E B;  1M8A A;  5E1F A;  3P75 A;  5A2Q E;  1VF5 C;  3GTG B;  2M00 A;  4ZAI A;  1OXX K;  1QB5 D;  1I4H A;  1EOT A;  1AN8 A;  3A56 A;  3CU7 A;  3HZX A;  3S1N B;  3MC0 B;  2EYL A;  1SYD A;  2AQ2 B;  1I6V C;  2JEB I;  1SJE D;  1NR2 A;  3D6C A;  1DON A;  5LL6 X;  2R6G A;  2TSS A;  4EVO A;  3OPO A;  1DM0 B;  1BQQ T;  4JBW A;  3G7L A;  2B2T C;  4F88 A;  1ENC A;  2KOL A;  3KLS A;  1BCP D;  4B9X A;  3NQI A;  3MXU A;  5JVH 3;  2OF1 A;  5JEA H;  2VB3 X;  2K7V A;  1E0B A;  2JXM B;  1WTP A;  3TP7 A;  3I70 A;  3KLR A;  1CI3 M;  4KHV A;  4IFD J;  1RD9 D;  1E2Z A;  4A3E B;  2B2Y C;  3K6O A;  2L0C A;  2Z4I A;  5DM6 3;  5EQ0 A;  1C8C A;  5AFW A;  4HTH A;  1EEI D;  2N88 A;  4A3M B;  1BCP C;  5CV9 A;  2NZ1 D;  5C3X A;  4G7O C;  1KLU D;  1H9R A;  5EKL A;  1TS4 A;  2M9V A;  5JJZ A;  2N55 A;  1GHJ A;  3I4N B;  1MGS A;  4XXE A;  3A8I E;  3DM1 A;  3HOX B;  1EIG A;  2QIL A;  2ID0 A;  3TP6 A;  3HOW B;  2B2V A;  2Z4H A;  5C6A A;  5EPL A;  1WVL A;  3IFT A;  5IGG A;  4S3S A;  1GUG A;  1LAC A;  4CHT B;  1RKN A;  4L63 B;  3M4Y A;  1IKL A;  2F0V A;  2D2C C;  1TY2 A;  2X6G A;  1FNW A;  4QB4 A;  1D2B A;  5IOD A;  1Q8I A;  4L6T B;  2JSO A;  5DAU A;  3VYS A;  2NVQ B;  2E75 C;  1LTA D;  3AMU A;  5M5X B;  3T16 A;  2F0T A;  2FMC A;  1KLG D;  2EY1 A;  4IN3 A;  4C1N K;  2O2L D;  4FF3 A;  2EXZ A;  1D5X C;  1II3 A;  3SHL A;  2F0H A;  3DEP A;  1FGB D;  3OSO A;  4DAY A;  2PZW A;  3GV3 A;  2L55 A;  1YNN D;  1DOK A;  2K5Q A;  4RA8 A;  4I65 A;  2L5T A;  4U68 A;  5ELE A;  4IAL A;  4BS9 A;  3TP5 A;  1SYB A;  1JR0 D;  1I4P A;  4QUF A;  1GUW A;  1NUC A;  4ZUI A;  2DY7 A;  4CJ0 B;  3NQT A;  5HUR A;  1K83 B;  4C3J B;  3NTK A;  1AZQ A;  4RCN A;  1KDC A;  2KUM A;  4BA1 I;  1EL0 A;  3ND8 A;  1YNN C;  3UI2 A;  3DHQ A;  4KD3 A;  3FDT A;  1EZ8 A;  2WP8 J;  1TWG B;  1JQY D;  1JWM D;  1EEF D;  1STN A;  4KY7 A;  1H9S B;  1TVX A;  2B2U C;  1STH A;  1R4P B;  1BXT A;  5G3L F;  1W6J A;  3LNN A;  3S1R B;  1B53 A;  2MJ8 A;  3HKZ B;  1JIC A;  3VYU A;  2ICI A;  1VMC A;  5CC4 A;  4FF1 A;  4LAA A;  1PRT B;  1WTR A;  4NKL A;  4OIJ A;  4WFN 3;  4KKU A;  3SR1 A;  1UUP A;  2ZT9 C;  4OO1 G;  1JC7 A;  4IQZ A;  2EY6 A;  1XX8 A;  1EY6 A;  2O4X A;  1DOL A;  1WD1 A;  1G29 1;  2BDO A;  4KI0 A;  3MEH A;  3MXG A;  2B2V C;  1TII D;  1MI2 A;  3TP8 A;  3G6J B;  2A69 D;  1KTK A;  2GA4 B;  3I4L A;  2F0W A;  2PQE A;  2VXW A;  5FO9 B;  5JOB A;  1NSN S;  1ROD A;  1E2W A;  2K05 A;  4HED A;  5ELD A;  1SYC A;  1SFO B;  1G6Z A;  1BCP F;  1D1K A;  4X3U A;  2ZXP A;  1U4M A;  1EQT A;  1MBY A;  3TZD A;  1KAB A;  1SMY D;  1NCV A;  3NTI A;  5CV8 A;  2NVX B;  2NVT B;  2F0P A;  4U67 3;  4IUU A;  2A69 C;  4N9T A;  2KVM A;  1GXD C;  3FPP A;  3CRK C;  5LHY 1;  3S17 B;  2EY5 A;  4IFD G;  4DNR B;  4CGY B;  1STB A;  2HQE A;  3MWY W;  1KDB A;  2K33 A;  2EVB A;  1ZEQ X;  3DEO A;  4H0L C;  1T5E A;  1ET9 A;  1SMY C;  3NPP A;  1IHZ A;  5BN5 A;  3R2T A;  4A3I B;  3SXH A;  3MXN A;  1SYF A;  2RKS A;  1NAP A;  3QB3 A;  1AFP A;  4CKC A;  5E3F A;  2HUG A;  1S5E D;  3VA5 A;  1LT6 D;  5EKI A;  1Z7T A;  1UNS A;  1TS3 A;  2C5C A;  3FRP B;  1V1O A;  5JAV A;  2EYH A;  3BYT B;  1C4Q A;  4KV6 A;  2XRS D;  1ILQ A;  3AB9 A;  1C48 A;  1JOR A;  2DY8 A;  5HGT A;  2F0S A;  2EYO A;  5IT9 L;  4YIJ A;  3BVM A;  2HCC A;  1JE4 A;  3GD7 A;  2B63 B;  3R8B A;  1PDQ A;  2QDB A;  1HHV A;  2K32 A;  4C3I B;  3CHB D;  1JOO A;  2TMP A;  5KEE A;  1CQV A;  3WOF A;  3ND9 A;  4MIU A;  2EJM A;  2EZV A;  5TSS A;  4CKB A;  1X3P A;  1BCP B;  3S1M B;  3FVQ A;  3SDZ A;  4C3J G;  1U4L A;  1I50 B;  4PMW A;  4ZLT F;  2JYO A;  5ELF A;  1QIL A;  1HXY D;  1ZYR D;  5CBA E;  4V0B A;  2M2L A;  1HA5 A;  1EU4 A;  2VB2 X;  3Q23 A;  1CK1 A;  3D4W A;  4FO2 A;  4CKE A;  4EQP A;  3C1F A;  1V1P B;  4HCE A;  1G2T A;  1SNM A;  3M7N A;  4NDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...