2L4NA

Solution structure of the chemokine ccl21
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 21
publication title Solution structure of CCL21 and identification of a putative CCR7 binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l4nA00
2L9HA 4MN3A 2B2UC 3D6WA 1RHPA 4OIKA 4X3TA 3SVMA 2X6LA 1WD1A 2DY8A 2JYOA 2K1BA 2R3ZA 1ZXTA 4RWSC 2EPBA 1G91A 1RTOA 1DOKA 1M8AA 2X69A 3GV6A 2MP1A 4XT3B 4HAEA 5DNFA 2KUMA 2EOTA 2FMMA 2B2TC 4CJ2C 2XIWA 1B4OA 1X32A 2HUGA 1HUNA 3I91A 1PFMA 1CA5A 1RODA 4HSVA 1SAPA 3IFDA 4ZKBB 1E0BA 5D65A 4QUCA 2FFKB 3KBXA 4ZK9B 3F2UA 4UAIA 1HA6A 4XDXA 2D9UA 5EPKA 1U4RA 1BF4A 1A15A 1ICWA 3MWYW 4HEDA 2B2VA 1KNEA 2B2YA 5CBAE 3I90A 2K03A 1AZPA 1XYIA 1AP0A 4HCSA 1LV9A 1VMPA 1BBXC 1X3QA 4X3UA 1WVLA 2FJ2A 2M2LA 4IUQA 2HDLA 1BO0A 1QE6A 4O42A 5EPJA 3N52A 1MI2A 2J7ZA 2NWGA 2SDFA 2FINB 2K04A 2N55A 4RAUC 1B3AA 3MTSA 4DN4M 1NCVA 3QO2A 5EKIA 1MSGA 1NR2A 3Q6SA 1IKMA 1DZ1A 1SDFA 1U4LA 2HCCA 5EPLA 1SSOA 1MGSA 1GUWA 2B2VC 2B2YC 1TVXA 3I3CA 2MJ8A 3P7JA 1XX8A 4MHEA 1HFNA 1HRJA 1PFNA 1DONA 4ZKCB 4IUTA 5EJWA 5E4WC 2MPMA 5T1IA 5CMDA 5CBEE 1QG7A 1B2TA 1F2LA 5COYA 2K01A 2K28A 2Q8TA 1B50A 2Q8RE 1ILQA 2IL8A 1EIGA 3DEPA 1JE4A 3FPUB 2BDNA 1IL8A 1RJTA 1VMCA 1HHVA 1F9PA 2RA4A 1JICA 2KEEA 2RSOA 1BNZA 2FHTA 1WTXA 1X3PA 1U4PA 2K05A 4X3SA 4U68A 1O7ZA 1O80A 3R93A 4NW2A 4XT1B 3TZDA 1WTWA 4IUVA 1WTRA 5EQ0A 2H1EA 3H91A 1G2SA 1O7YA 2L11A 1DOLA 2CVRA 2N88A 2EE1A 4QUFA 2NYZD 1J8IA 4CJ1B 2RSNA 2HDMA 4IUUA 1CA6A 3UI2A 4CJ0B 1HUMA 2B2WA 1J9OA 3I8ZA 1WTPA 5D14A 1ESRA 3TN2A 4ZLTF 1EIHA 1U4MA 1C8CA 1EOTA 1CM9A 1HFGA 3KUPA 1MSHA 1NR4A 3G7LA 2KEDA 2DY7A 1PLFA 2L4NA 2NZ1D 3LWEA 4ZAIA 1WD0A 1WTVA 3FDTA 5CORA 1WTOA 1QNKA 1IKLA 2X6GA 5JJZA 1EL0A 3HP3A 1EQTA 1RTNA 3DM1A 1WTQA 1G6ZA 1G2TA 1F9SA 4X3KA 2B2UA 2B2WC 4R8IA 1F9QA 2L12A 3GV3A 2KECA 5AFWA 2VXWA 4LMQD 2RVLA 3ONAB 2MGSA 3IL8A 1ML0D 1NAPA 1Q3LA 4IURA 1S4ZA 2B2TA 1DOMA 5T1GA 5E4XA 1B53A 1PDQA 3DEOA 1ILPA 2JP1A 1KNAA 2KVMA 2L1BA 4RA8A 1AZQA 1PFBA 2KOLA 4IUPA 1F9RA 4OIJA 4R9WA 2HCIA
chains in the Genus database with same CATH superfamily
5C5LA 4JI3Q 3SK5A 4X3TA 4X66L 4IPHA 2R61A 4HR7B 5C4JB 3AB9A 4DV1Q 2B2TC 3BU2A 3Q8DA 2NZHA 1SAPA 3I4MH 1K83H 3KJPA 2HD3A 5I9OA 3DLLA 4JBKA 4LF6L 1FGUA 4RGTA 4DR6L 1EY7A 3VR3A 3J81j 3VR5A 4R1JA 1D5XC 4DAPA 4ILWA 2FMCA 4NMZA 5A2QE 3E5SA 2FJ2A 3C1EA 3KF6B 1BO0A 1CZWA 1XJVA 1QJOA 2UUCQ 2SDFA 5C3EB 1KTKA 1NCVA 1MSGA 4B3MQ 1C0AA 4C3IB 2I5MX 1EY9A 1N9WA 3S14H 3M3YH 4A3BH 2KCNA 2CH4W 1GOZA 4FXKC 1DYQA 1JWMD 3KOJA 1A8VA 1D5ZC 1IYUA 4LWCA 2L0CA 3S1MB 1AE2A 2KHJA 1SYFA 5JJKA 1RJTA 1YJWA 2F0IA 2ICEC 3TREA 3S24A 3C3LA 2UUAQ 4KHPQ 1A2TA 4GN4B 2AHOB 2N88A 1FVIA 3HOUH 3S2DH 1Z47A 2QILA 4HMJA 2KJXA 4ZRZA 3S16B 4DPGA 1N36Q 1ESRA 1VQMA 2RDHA 1UE6A 5EKKA 4BBRH 1XNRQ 2KEDA 1WD0A 4JOIC 3S1RB 2LKVA 4RHSA 3HOWG 4F8MA 1EQTA 3SDZA 4UP7A 2AUJD 2D0PA 2DNEA 4J1MA 4KKSA 4KHZA 1K83B 3IAYA 5M3FG 1CHQD 3DUZA 4R4CA 2R93H 3OOCA 1O7LA 1GKHA 5D3IB 5F2DA 4LF5L 2J4XA 3CPFA 4DV4Q 4IPGA 1MD2D 1K8MA 1STBA 1OXUA 3PGZA 5KNBA 3MVVA 2OWOA 1U9RA 2F4IA 3CCJA 1MIUA 1X32A 2ATWA 3BVGA 1H9MA 5EGTA 2Q2UA 1X6OA 2HUGA 3DWQA 3CU7A 5JEAG 1VQDA 4V190 1HQMC 2FFKB 1EFID 3PQIA 2KCMA 4CHTB 4L6TB 1HA6A 1WCMG 4ZYSA 4DV7L 4ODGA 1PRTF 4A3LH 2B2YA 2UXBQ 3D4WA 1VCIA 1VMPA 5C4XB 1CFMA 3T13A 4A93H 2J7ZA 5JOBA 4L63B 5FLXc 2Z4HA 3A56A 2TMPA 2IJ0A 5EPLA 4ZQ3A 1SNQA 1IL2A 2F0MA 4OO1I 3HOYH 1HNWQ 2EJFC 1TS2A 4Y7NH 1DONA 3HOXB 2M00A 1XPRA 2QKIC 5T1IA 5CMDA 3NTKA 1F2LA 4DR5L 3K7UC 3EVQA 2PNRC 1IL8A 4J6HA 3MEFA 5DLQE 3PO2B 2EQSA 5CV7A 3M4OH 4NW2A 2E76C 4HN7A 3HOZH 2WAQE 1UAPA 1ZEQX 2IPKD 2IX0A 2R92B 3FKIB 3DWAA 1Q8KA 1CHPD 1HJPA 4A3EG 2R93B 2EYHA 1EIHA 2EY6A 3AYHB 4JI8L 2AQ1B 4PZ7A 1NR4A 5AJ3Q 1PLFA 4PZ6A 1J5EQ 1RL2A 4PMCA 4UPAA 1V9PA 3HRZC 1O7IA 1G6ZA 1G2TA 1VQ5A 2B2WC 3EBEA 1VS0A 3F2CA 3HOWH 3CCMA 3OTOQ 3J81L 1JJ2A 4JI5Q 1XMQL 2NN6G 4Q5VA 1S4ZA 4K0KQ 4TKOB 1PDQA 2NVTH 5M3MH 4X65L 1KNAA 1LTGD 5FOBB 2JA5H 4LF7L 1CKNB 3KLSA 2QCPX 2WB1E 4DV2L 1Z7TA 1N32L 2K6AA 1VDZA 2K5HA 1E1OA 1E22A 5KYLA 5IGFA 4G7ZC 4P75A 2Q8IB 4H44C 4JI4L 2FMMA 5HGTA 1H9KA 4XIGS 2XIWA 1TWGB 1L0WA 4GNXB 1GD7A 4IFDH 3GTKH 2VS1A 4NXML 2K5WA 5FKAC 4CDCC 3F2UA 4JBWA 3PSIA 2CH4A 1W6JA 1WYDA 3BDOA 3EFXD 5CYUA 3TP7A 2EYMA 1N33Q 4A3DH 4IOCA 4A3JG 1SBBB 2B8GA 5LMNW 1VQKA 3P20A 2Q2IA 4B9WA 2NUCA 2Z0SA 1IBLQ 1MJCA 4NXNQ 3Q6SA 1V1PB 1EY5A 1IW7D 3JAML 5ELDA 4R4OA 3J80L 2AWOA 2MJ8A 4ZUIA 1JORA 4DNIA 4IUTA 4KHVA 2ENBA 4JI7Q 2I5LX 2K5DA 4G7HC 5ELCA 5GQOA 3S1QB 4NB3A 4DR3Q 4JI2L 4CDDC 3VA7A 1JB7A 1PTOD 1HZBA 1GVPA 1NTGA 2RSOA 3MAQA 1U4PA 1K8GA 3BG3A 2H1EA 3VR6A 3HOVB 1XMOL 2PMZB 2UUBL 5C6AA 3ITPA 1TWCB 3A55A 3HKZG 1S5ED 4IALA 3R2IA 1UEAB 2ZTDA 5M3MB 1CQVA 1PVOA 2PQEA 2EIFA 2YV5A 1C8CA 3FVQA 4P2CB 3G7LA 3K81C 1V1OA 1IBKQ 2XN9C 2K52A 5K36G 1Y1VG 1HNZQ 2BE5D 4A3KG 4A75A 2JQOA 4RKLA 5NUCA 1PTOC 3EA6A 1X9NA 2JA8B 1F9QA 1VQ9A 3WWVA 1TU2B 2CQOA 3H6MA 2ZM6L 1X65A 3I73A 4KD4A 3IL8A 5I2YA 2CQAA 3CP0A 2B2TA 4DFAA 4XQJA 4HTHA 1SFOH 2HQEA 3RN2A 1RDPD 4A3IH 2B2UC 3D6WA 4E6IA 4R8NA 5C44G 3NP8A 1W2BA 1N34Q 3HGBA 4RWSC 4FF1A 1PH1A 4HIKA 1ASYA 4A76A 4DV5L 2BE5C 1KL9A 4C3JG 4L8JA 3SGIA 5ELEA 2CKZB 1CSPA 2GA4B 3VYUA 1LM0A 2JJQA 3SEBA 1SMXA 1A15A 1YNXA 3I7FA 1LTBD 3L2PA 4JPBW 2H4OA 2ZXOA 3QJYA 2EYPA 3SR1A 3SXHA 3UDFA 3C1FA 4I7AA 3NWSA 4B3SQ 3H0GH 4DXGA 4Q0FA 3PUWA 2K04A 4YHHL 3PIOA 2EYFA 1PRTC 1MGSA 2UU9Q 4F87A 5JJIA 2F3WA 3G6EA 4C1NI 5LMUQ 4J8QA 3C2PA 1LTID 5C0XG 2O5JC 2VUMH 2CW0D 2ALYB 3HZXA 5FO7B 2K01A 1EYCA 4C3HG 4CKBA 3NENA 1V8QA 2Y0SG 3PIPA 1HR0Q 1FNVA 1F9PA 1JICA 4IPDA 1B50A 1W6KA 5DM73 3E6ZX 1WTRA 4JOIA 5CV5A 4BS9A 1E1TA 2NVXH 3FPPA 1SRUA 3U58A 1AFPA 4QCLA 3WOFA 5IIFA 1EQRA 1L0XB 1LT6D 4A3CH 3CRLC 1SFOB 2KENA 2Z6KC 3CW2C 1N8RC 3TN2A 3C46A 4A3IB 1DJRD 5KNCA 5KEEA 4K2LA 4H0LC 1YITA 3S2HH 3MFGA 3CMAA 1RTNA 4A3FH 3M4YA 2RDGA 2F0GA 1CI3M 2L5TA 3KLWA 2VXWA 1IBML 4DR7Q 3CMEA 3I4NH 3OMGA 4PQXA 1O78A 3KBGA 1QWYA 3M4QA 4RA8A 1FJGQ 1F9RA 4CDFC 4IFDJ 1XNQL 2F0DA 2KHSA 1IYJB 4C3IG 3H0GB 1WD1A 4XT3B 1BUVT 2MP1A 5HGQA 1PMRA 1A0IA 3EJIA 3N6RA 4QB4A 1EWIA 3J81E 1ONLA 2EY5A 3TMEA 1GHKA 3J7AV 2J0TD 4OO1H 2JA7H 1VF7A 4ZK9B 1Q82C 4AQYL 1VQCA 5M5XB 2VUMB 2O4XA 3D6CA 3GTLH 3KDFB 2F0LA 3ZYYX 1TS3A 4JC0A 2K03A 3BYYB 4DK0A 2HHHQ 3K7AH 3GTOB 1EQQA 2HIXA 1SMYC 2PQAA 4EQOA 4AYBB 1S72A 1WI5A 1I4PA 1VQ7A 4QF4A 1YBYA 4WJWA 4RCNA 3CHBD 3P7JA 1XX8A 1YNND 3EROA 3ND8A 3SK4A 1D2BA 1VQOA 2AMCB 2A8VA 3F8TA 1X55A 4RHRA 4LFAL 4RCOA 4RGNA 4V0BA 1LACA 2XVSA 2Q8RE 1BOSA 2F0PA 2BDNA 1A3UA 3CD6A 1JMCA 1MJEA 4A3FB 2VQFQ 2A19A 4X3SA 3L9AX 2UXDQ 2OXPA 1AH9A 1LT4D 4C3HH 3PO3G 4AYBE 1DOLA 3JAME 3AU7A 1B3QA 4HIDA 3J80E 3I4NB 3J81i 3ICEA 3A7LA 3CCVA 2B2WA 1EEID 2O5IC 5IYDG 4LF8Q 3G4SA 4BBSH 1MSHA 4DV0L 1ET6A 3G48A 1PH9A 2B29A 3T1HQ 1SLJA 1E2WA 1DD2A 2B63H 2ZTEA 4JCVE 2JSOA 2NTTA 4RKBA 1KDAA 3PUXA 4LFCQ 4QQBX 4LFBQ 2JA7B 2MGSA 4BA2I 2RBMA 3BJUA 2EYLA 1TWAB 4FVMA 5C4XG 5BN5A 1B53A 1ILPA 1QB5D 4JYAL 1YVCA 3NBIA 4MNOA 1HCZA 1PH8A 3BDCA 2JK8A 3K7AB 4GS3A 2XSCA 3M4PA 5TSSA 2V4DA 1BR9A 4R4IA 1EZ6A 4JI6Q 5J22A 2R7ZB 2F0NA 2EOTA 3QB3A 4YY3Q 2I07B 1CA5A 5CV4A 3A8JE 2EY1A 2JA6G 5D65A 2HIVA 3KBXA 1B9MA 2RKSA 3T56B 3KYHC 2LSSA 3PO2G 2D5DA 4KMUC 5IP7G 5C3XA 3UDGA 1I94L 3OWEB 1JT8A 1KIXA 1KNEA 5CBAE 3FP9A 3DXJC 5IOCA 1XTDA 5EBDA 1LV9A 2K33A 4FF3A 3LNNA 4QGUA 2RDFA 3N52A 4YCVA 4G57A 4R4QA 1STEA 1AW7A 4DK1A 4X66Q 4FXDA 5CV8A 2XRSD 2CWPA 3CPWA 3NBHA 1G51A 3VR4A 1L2FA 5IP9H 3D0FA 4JI3L 5IGDA 4BBSB 1HTLD 1SJHD 4IPCA 3W1BA 4DV1L 2ZJQA 2NN6I 2WFWA 3AEVA 3RMHA 1PXUA 2IT1A 1HHVA 2B63B 2KEEA 2FHTA 4UY8C 2K05A 1STGA 2EXZA 3PF4A 3H91A 4L5SA 2Y0SE 1WJJA 4QUFA 1B9NA 1KLUD 1FNWA 3EQLC 3UI2A 1HUMA 1BCPB 2QEXA 4BA1I 2UUCL 4K6DA 1STYA 3E3XA 3TP5A 2BCOA 2M9VA 4B3ML 5CORA 4IN3A 1WTOA 4XYOA 5IYDH 1CSQA 1LT5D 4B08A 1EL0A 5C5MA 2B2UA 4R8IA 1I3QB 3MXPA 4N9TA 2JEBI 4DNTB 4S3SA 1K8AC 2A6HD 3GO5A 3BVMA 4IURA 1L1OA 2F0UA 4JI1Q 3E0EA 1QVCA 1QILA 1T9HA 2O2LD 3M7GA 4R9WA 2UXCQ 1VF5C 1K0SA 4P71A 1KHIA 1T5EA 4OIKA 1JCKB 2X6LA 3GTPH 3H15A 2YYZA 5FJ8H 4U673 2L55A 1KQSA 1B4OA 1N36L 3Q0AA 3I91A 4JW0A 2MUYA 1XNRL 1RD9D 3I4MB 5I9PA 2K7VA 4DUZQ 4C2MH 1TWHH 1X56A 1K0RA 4BY1H 2A6HC 5IGCA 3MZ5A 2JA6H 1YJ9A 3HOVG 2YTYA 3W1GA 4BY7G 1VQLA 1ZYRC 4X64Q 1WVLA 4OHJA 2HDLA 1Y8PB 1MI2A 2QW7A 2XWBB 2C9OA 3ERSX 5IT9L 3R3OA 4YWMA 1VQHA 2EY2A 3ZJYC 4RG1A 5JJLA 2RF4A 1FGBD 3S14B 1K8OA 1S5FD 3OWFA 3CF5A 5ELBA 3M3YB 4A3BB 4ZKCB 4DV4L 4YIJA 4IZ8A 5DM63 4HIMA 3K0YA 1QG7A 1B2TA 1VQFA 3A54A 2JA8G 4DA2A 2Z6KA 2Q2TA 4K5VA 4DV7Q 2QA4A 1ZKOA 1Y1WG 2WAQB 5KRUA 5FO8B 4JV5Q 5LHY1 3HOUB 1AEXA 2EE1A 3S2DB 4DAYA 2UXBL 2D2CC 2NVYH 3L7ZC 3S15H 1PTOH 4ZLTF 1M1KC 4HMIA 2XTIA 4K8IA 4BBRB 3T1YQ 4ZAIA 1YNJD 3ND9A 2AKWB 2R7FA 1D1KA 5DEHA 1IKLA 3BZDB 3HP3A 3VYTA 4O1NA 4YCWA 1E3PA 1HNWL 4NPSA 1NY4A 1PZJD 4ZUJA 3D3RA 2F3IA 2LXKA 1PV4A 2IY5B 5DAUA 3DEOA 5K5PA 2F4VQ 2KVMA 4ID6A 4KKTA 4IUPA 4EQPA 3DMUA 2WB1B 1NMFA 1PFSA 3CRKC 2MO1A 3HFZB 1EIFA 5FLMG 1RHPA 1CUKA 5C0XI 1B44D 4C56C 1YNJC 3MA2B 1UNSA 1YJNA 1A63A 3GTMH 3MC0B 5KIXA 1WTHA 4M8AA 4FXGC 3GTJH 2OTJA 2H5XA 4HSVA 2KCTA 3CCQA 5AJ3L 4LF9L 2V1CC 3KF8A 2PZUA 1YHAA 1TY0A 3HEJA 1XMQQ 2E2HH 5G3LF 4JI0Q 2A6EC 3TP8A 2K14A 4GN5A 5M3FH 4JVZA 1EZ8A 4X3UA 3OTOL 3UE0A 1UE7A 4JI5L 4A93B 1AE3A 3I55A 1I4XA 4K0KL 5EKIA 4I65A 1IKMA 1NR2A 4BY7H 3I70A 1K3RA 1UE5A 1EYAA 1SN8A 3GDEA 3GTGH 3K5OA 5I4DA 1ET9A 3HOYB 2ASBA 3S15B 1PTOB 5EAYA 4Y7NB 1HR0W 1PFNA 4A3MG 1TKWB 1STHA 5JEAH 2LFNA 3BS1A 4XQNA 3FPUB 4EQ5A 1WCMH 2VNUD 4EQNA 4LW1A 1WTXA 3DM3A 3M4OB 5IGBA 4XT1B 5M5YH 3U9OA 3HOZB 3CC2A 1N33L 1H9JA 1Q81C 3K58A 1L1OB 1TIID 3TQYA 2VL6A 2QDLA 1G291 5ISRA 1XWEA 1CT1D 4QL5A 1IBLL 3UE1A 3HS0C 4B3RQ 4NXNL 4WORA 1YI2A 4GKJL 1K73C 4MTKA 3STBD 3IFTA 3T53B 1VQ8A 2A74C 3HOWB 2SOBA 1NNXA 3J7AF 3NQTA 4LF4Q 4XTCS 1E24A 1NAPA 4DR3L 1LTLA 1XMOQ 1SROA 2NVTB 1JWSD 2JP1A 3M85A 2JA5B 2DJFC 2I5HA 3KLRA 5BR8Q 1GUGA 4CKEA 5M3FB 4A3EH 1SNPA 1STNA 2N49A 4OONA 2JYOA 2KA7A 3T16A 5JPMC 5IYBG 1QUQA 2RCNA 4ULLA 3STBC 3J7ZC 3B6YA 4HJ7A 3GTKB 2YU9H 3TSSA 1PHJA 5IYCG 1IBKL 5BN4A 4PV1C 2ZM6Q 1EFWA 1HNZL 4M1UB 4TQUS 1F2ZA 2PO4A 4A3DB 3KLSX 3PF5A 1Y14B 2NN6H 4AH6A 4HCSA 4APVA 4GNXC 3Q23A 1EYGA 2MQHA 3ULLA 3OMCA 4O42A 1PRTD 2Z6BA 3SE0A 5M5YB 1PZID 3RN5A 1E2ZA 1PH6A 1SDFA 1UEBA 5I6YA 2EDGA 1BBWA 2E2IH 4YWLA 4DAYB 3TS0A 1VQ4A 4QIWE 1A3VA 2RCFA 4A3GG 1HRJA 5GROA 2F0WA 3CCUA 1N34L 4HJ8A 4RGMA 2F0TA 5E4WC 4POFA 2K28A 3QIAA 3X3MA 1JE4A 4A3MH 5FLXL 4IO9A 2A68D 1LT3D 3CQZH 2WKDA 5IT9E 1YHBA 1O7ZA 2I46A 4GLVB 1RCVD 4BXXG 4KJNA 4A3JH 5C4HA 4NDXA 1B8AA 3CKIB 3MXNA 1K28A 5D14A 1MKHA 1EY8A 1CM9A 1FL0A 2OQ0A 1LTAD 4GOPC 2E74C 2R7ZG 4AIMA 2OQKA 2K5NA 3PUYA 1LTTD 1QCBD 1SXTA 4GLAC 3M9BA 5J3BA 2UU9L 1GJXA 4UP8A 5JJZA 1M90C 3URYA 2WACA 3MXGA 2AQ2B 1F9SA 3EIVA 1NUCA 2A68C 3GV3A 2KECA 1FR3A 2E5LQ 2B39A 4I7ZC 2LMCB 4WRDA 2E2JH 1TXYA 1STAA 2K50A 3D4DA 3K59A 4DR4Q 4WJ4A 3AQQA 2K75A 1HR0L 4L5RC 5GAEC 1XXGA 3Q24A 2BH2A 2WINB 3AFQA 2L9HA 5ELOA 3S1NH 5IWAL 1DOKA 2F0EA 1D7QA 4HAEA 5DNFA 3RR5A 2G9HD 1JJCB 2PI2A 3NTHA 1EU4A 3RLOA 3W5OA 4OX9Q 4B9XA 4J15A 3RZOH 3OW7A 4P73A 3U9SA 5K36H 5LMNQ 1Y1VH 1QZGA 4ABNA 3IFDA 1IHZA 4A3KH 4KLKA 3TBIB 4FYDA 4HEDA 3T51B 5H1SE 4OWTB 5C3EG 5IYCH 2LY7A 3VYRA 3CQZB 5D3DA 1SMYD 3TS2A 1T5XD 3KF6A 4DR7L 1VQNA 1RF2D 5JEAJ 1AZQA 2FINB 1JJGA 1VQJA 1B3AA 1P8LA 1SYEA 2HCCA 5C44H 1I6HH 4DV6L 2EYOA 4CBVA 4OWXB 2SNMA 4O2DA 4C3JH 1E7ZA 1ENFA 4DKAC 2HT1A 2DGYA 3RD4A 1EIGA 4DV3L 1MHWC 1F77A 1VMCA 4LUZA 4DUYQ 4GKKQ 2QGQA 2XGTA 3R93A 2DNCA 3LX0A 3W2DA 2P5ZX 3K57A 4N9PA 2NVXB 3J7YW 4B3TL 1LYLA 2E2JB 1H9SA 1CA6A 4CDEC 2ZJRA 1TWFH 1C4QA 2R7DA 4PNYA 1KRTA 2A69D 3V2TA 3CC7A 1U4MA 3SK8A 1EOTA 4DR1Q 1BCPF 2ZJPA 3S1NB 5GAGC 5CGKA 4POGA 3RLNA 3H94A 4X62Q 5C0XH 1QNKA 4IUNA 4PG3A 4LFAQ 1GXDC 3S2HB 2BA1A 1PYBA 3I4MG 1Q1BA 3K5NA 1SYCA 1GUSA 4IOAA 3W3AA 1SE4A 4LUVA 1Y1VB 3K6OA 4A3KB 3ONAB 3WOEA 1SEBD 4OL7A 1D5MC 2KOLA 2VQFL 1GUTA 2DJGC 1HXYD 4OEMB 3HKZE 2A69C 2MNAA 1ENCA 5IE8A 1YIJA 1ZXTA 1G91A 1QVGA 4IJLA 4DR2Q 1WFQA 5C4JH 3I56A 5C4ZA 4A3BG 1W3SA 4DGZA 1TT2A 1IXRA 1PFMA 2VQEL 1JC7A 5IY0A 4HJ5A 2OT2A 1YZ6A 1EWHA 1HNXL 1BKBA 3BDLA 2D9UA 3A7AB 5LL6S 3GTLB 1I4HA 4JBMA 3T1HL 1ENAA 2XNAC 3TEHB 4K5XA 1SYBA 3HOUG 1X3QA 4LFCL 2M2LA 1GUNA 2K4KA 4LFBL 1LABA 1QE6A 4RAUC 5M9OA 3MTSA 4K5WA 1DCZA 3HOXG 1NMGA 4C3IH 3RZDH 4BBRG 1HZAA 4ME5A 2NTSA 1EU3A 2RHQB 2F0VA 1S5DD 3MXNB 1GUOA 3NEMA 4KY6A 4UDUC 2MPMA 1FD7D 5CBEE 4JI6L 5COYA 4YY3L 2IL8A 3S1MH 3HG9A 1MBYA 2RA4A 2R92G 3FKIG 2F03A 2C35B 1BNZA 1RKNA 4GN3B 1WTWA 1O80A 4UP9A 5EQ0A 4C3HB 3K5LA 2R93G 1OXVA 4UHVA 2Y0SB 4HSPA 2BH8A 4C1NK 2IX1A 1SNOA 4CJ1B 1EWCA 4L5TA 3J81c 3S16H 4HJ9A 2KBNA 1JOKA 2L4NA 3U4VA 5JVH3 5FLXE 3S1RH 2AUKA 4LF6Q 1VQGA 1M4VA 4DR6Q 2E2DC 5FK9C 1A3TA 1R9TH 1EIYB 2GVBA 5JPNC 1JWUD 1S5BD 5AFWA 4Y52H 3VYSA 2BDOA 2Z1CA 4A3LG 2A1AA 3G71A 3PUZA 1ML0D 3QOJA 3A5UA 1JOOA 2ES2A 5JAVA 2D62A 2CHBD 3PO3H 1PFBA 1CKNA 4A93G 2HCIA 4MN3A 5J1ZA 1Q7YC 2PNHA 2SEBD 4HJAA 1B7YB 2R3ZA 2CWAA 4MZ9A 2KQ3A 3HOYG 5A35A 2PI2E 3RZDB 3BYTB 4GNXA 1TS4A 3IRBA 4ZKBB 2EJGC 4KD3A 3MXUA 4JG2A 4UAIA 1KDBA 3JAMc 2PPBC 5EPKA 1S3OA 2ID0A 3P75A 1SE8A 1ICWA 3J80c 4P74A 2WKCA 1CZGA 1ZYRD 5IGGA 2UUAL 3HOZG 4KHPL 1U5KA 5C4XH 4KK7A 1PH7A 3DHQA 3QWNA 3OPOA 1Y8OB 4JI1L 2PQAB 1PH4A 1V1PA 2CCZA 1OXSC 1X3FA 1SSOA 3L0OA 3H3VC 1GUWA 2B2VC 2UXCL 3ERQA 1H9SB 4F7XA 4JBJA 3VR2A 1HFNA 3MHBA 3HOXH 1PTOF 2N8NA 5L37A 3CCRA 1VQBA 4NKLA 1K9MC 2A73B 3QOLA 1Z9FA 1BCPD 1KRSA 3NXWA 5C3WA 5LL6X 1CQFA 2F0HA 1R9TB 3PO2H 4TSSA 1SYGA 5IP7H 4GOPA 4LF5Q 5M3MG 2DUDA 4DUZL 1G2SA 2JA5G 1I50H 5C0XJ 4HIOA 1KC8C 1KDCA 1KAAA 3FKIH 2R92H 3V05A 1B1ZA 4L5QA 1PA6A 1J9OA 3PO3B 4K6LA 1PH5A 4X64L 3BZCA 1H9RA 4K2KA 2B3GA 1A2UA 3KUPA 4IFDG 2C5CA 3AFPA 2X6GA 1WTQA 3VA5A 1IZ6A 2F0JA 1BCPC 3UDXA 3E9HA 3BZKA 2OF1A 1IYVA 4A3DG 3V96A 4X6AH 3WDNA 1F2MA 1Q3LA 1Q46A 1CK1A 4K14A 2L1BA 5HY6A 4LNQA 3CAMA 1I6VC 1L0YB 5CV6A 5M5WH 3GTPB 4JV5L 3KFUA 1BVSA 2KCCA 1RTOA 2JA9A 2X69A 5BN3A 1VQ6A 2OEOA 4DR5Q 2K32A 4K8JA 1EYDA 2N3SA 4FP5D 3QR8A 4LUOA 1TWGH 2F0QA 2N78A 3T1YL 4QUCA 1SE2A 3A74A 1TWHB 4C2MB 1U4RA 1NBWA 4BY1B 4MIUA 3MWYW 2A6ED 2WIIB 3K5MA 2JA6B 2NBFA 5KNDA 1AZPA 3S9WA 1BBXC 1QZHA 2RHSB 4JI8Q 2VB2X 3ULJA 4DXFA 4RFBA 1I50B 2F4VL 3MEHA 3RLFA 3F1ZA 3D31A 4IJHA 3NBHB 4F88A 1CKMA 3I3CA 4FDBA 1X3GA 1J5EL 2ZXRA 5EJWA 3RNUA 3I4OA 1C9OA 1Q86C 3H09A 3BVZA 1F2YA 3H3VI 3S1QH 4YWKA 5IGEA 4LF9Q 1ILQA 1XPOA 3AMUA 4FO2A 4X65Q 1OO9B 4LF7Q 4GLXA 5GAHC 4LK1C 3K80C 3TZDA 4H02A 4ZCKA 4PZ8A 4DV2Q 3O13A 3LWUA 1S40A 1N32Q 4IUVA 4IQZA 5KGUA 2NVQH 1UWVA 3HOVH 2BOSA 1PYWD 2WP8J 4OWWB 4A3IG 2A5HA 1TWCH 2RSNA 1D6EC 1Q1EA 2RQXA 4JI0L 4JI4Q 2NVYB 1UUPA 2EYJA 1WTPA 1A6XA 1OXXK 4NXMQ 3E0JA 2MO0A 3PV0A 2XWJB 3LWEA 3TP6A 2ZT9C 3IKJA 5M5WB 4KN4C 3PIO3 3ER0A 3FHWA 1DGSA 1EY0A 2QEJC 4XYQA 4X3KA 2JA8H 5I6WA 4N8FA 2NZOA 1LLRD 4LMQD 3U4ZA 1DXMA 4KN7C 1ESFA 1JE5A 1OXTA 2F0SA 5T1GA 1Y1WH 2VZAA 3H0GG 4FF2A 3PIP3 2WV6D 1V1QA 1A62A 1TS5A 3SVMA 2D0OA 4LAAA 1EOVA 2VB3X 3PUVA 3GV6A 1S5CD 3GTMB 3X3NA 4BWGB 2MFIA 4JI2Q 4GKJQ 2IHEA 2VUMG 2YTXA 3GTJB 2F52A 3NSWA 1RODA 4JI7L 5EBCA 3Q22A 4B3RL 5CC4A 1CTMA 4XDXA 1VQIA 1BF4A 1PRTB 3KDFA 2UUBQ 4DK3C 1LO5D 3NPPA 2R6GA 3LGJA 2NB0A 2E2HB 2ZXPA 2Z8LA 3NE5B 4RGOS 3HKSA 4PMWA 4AYBG 5KYIA 1U0LA 4IUQA 4GOPB 4DF7A 4LF4L 3OSOA 4A3CG 2NVQB 2JXMB 3DWPA 3QO2A 5FLMH 3R8BA 4BY7B 1K3BC 2QDBA 5CR3A 3GTGB 5BR8L 4QIWB 1IW7C 5E3FA 4DAMA 2EJMA 4KY5A 1HH2P 1HTPA 1HPCA 1I4RA 1HQRD 5ELNA 4A3FG 3JC66 4A4IA 1FYCA 2Q8TA 1SYDA 2PYKA 4DNRB 2LS01 1WCMB 1V43A 2Z4IA 2VW9A 1SNDA 3T4AC 3I4NG 4N8X1 1X3PA 4TVAB 1DM0B 1KAWA 2VY3A 1O7YA 2CVRA 1GM5A 2PMZE 5CV9A 2NYZD 4KJOA 1J8IA 2HDMA 5IODA 2IHFA 4IUUA 4DV5Q 1Y1WB 1KLGD 1SR3A 3ULPA 5HURA 1SNCA 1NSNS 3CCSA 1EUJA 1BXTA 1I5FA 2XRQD 1Z6HA 3FDTA 4WFN3 4NP5A 4XXEA 1Q12A 4OO1G 2JA7G 4QJFA 1L1OC 3GP7A 4H7BA 2E75C 4OXPA 3K0XA 2L12A 2E8GA 3NQIA 1CKOA 1QNUA 2HQLA 4MTNA 4YHHQ 1D8LA 1DOMA 5E7NA 4B3SL 1X54A 4OIJA 1RIPA 1JB3A 4A3EB 3I72A 2DY8A 4LJZC 1P16A 1LTRD 5A2QL 3S17H 1C7YA 5LMUL 1E2VA 1I4QA 1H95A 4XQQA 1HUNA 3FRPB 2YU9B 1Y8NB 2F0FA 4G4KA 2EZVA 1G6PA 5M5XH 3P1HA 3KF8B 4HCEA 4OELB 1AN8A 1LUZA 2B2VA 3G6JB 4G7OC 2EVBA 2MHVA 3I90A 2LXJA 3U50C 3CXCA 1X3EA 2E5LL 2JE6I 1BBUA 3I4LA 3GTOH 5EPJA 5G3LD 2NWGA 1VQAA 5IWAQ 2N55A 4FF4A 3NELA 1GHJA 4DR4L 1SNMA 1DZ1A 1U4LA 4BBSG 3NUCA 4DU9A 2E2IB 3A5ZB 1KABA 1Q90A 2B2YC 1TVXA 5IYBH 5EKLA 4PMBA 1IBMQ 2B63G 3TDQA 2ZTCA 1BQQT 1R4PB 1UE1A 2CW0C 2DN8A 4OX9L 4A3MB 2JEAI 1JQYD 3M7NA 2JN4A 5LMNL 3GTQH 2IW3A 1XNQQ 4DK6C 4KY7A 1OTCA 2CFMA 2L11A 4A3JB 5GADC 1XTCD 1FJGL 3SK6A 4GZYC 3CC4A 1PH3A 3OYYA 3I8ZA 3A8KE 1KXLA 4DV6Q 1QVFA 3TRZA 1TY2A 3A0JA 3OW2A 4KTAA 2DY7A 2I0QA 2EXDA 4AQYQ 5I2XA 4A3GH 1J6QA 3FMCA 1QOHA 1WOCA 3S17B 2Q2HA 3KJOA 3I2ZA 4DV3Q 3E9IA 1LTSD 2RVLA 3GQBA 3NHHA 1EQVA 1TWAH 1PZKD 2G9DA 4BXXH 2HHHL 4B3TQ 4DUYL 4GKKL 1HZCA 1VQPA 3HKZB 1HA5A 3D4RA 4CGYB 2K1BA 2PW5A 2EPBA 3NWTA 1M8AA 5IP9G 2IWHA 4R4TA 3D8GA 2KUMA 2IX3A 1Y69U 2R7ZH 4CJ2C 1QUQB 1SE3A 3VDYA 4EGVA 1R4QB 3OIPA 4FNFA 3RZOB 3L3OC 4KI0A 3CCLA 4DR1L 5IT9c 3SHLA 1E0BA 3K8AA 3NK9A 2PCFB 4X62L 2PW7A 4CKCA 3MFYA 1EY4A 3H3VH 2SNSA 3OHXC 2UXDL 5E1FA 3PCOB 2KHIA 3KK7A 1XYIA 1AP0A 3RUZA 2K5QA 1NE3A 2OTLA 2BA0A 3GTQB 2F0OA 4ME3A 3NTIA 4EX5A 4DAVA 1EY6A 4DN4M 1KD1C 1PYSB 4DV0Q 2YTVA 1JOQA 5C44B 4IFDI 4LF8L 1I6HB 1BDOA 2FXQA 3FEWX 4H13C 2B8FA 3F2BA 4MHEA 1NJIC 4KKUA 3EN2A 4OGQC 1C48A 4RH6A 2AQ3B 4C3JB 2VQEQ 1YNNC 3GD7A 4DR2L 3TZUA 4KV6A 2ICIA 4TRDA 1HNXQ 4JK1C 2AWNA 3DEPA 2WAQG 4A3GB 1G8ZD 1VQEA 5FO9B 1YHQA 3OIQA 4JYAQ 4P72A 4QMGA 4YCUA 5JVG3 4ALPA 3CCEA 4Z9CB 4U68A 2QF7A 2GN5A 1Q8IA 1B70B 5C3EH 1XPUA 3UDIA 3R2TA 1JR0D 1II3A 4QY7A 3PMFA 4RMFA 4CJ0B 1TWFB 2OCEA 2L15A 1ICFB 1HFGA 1EEFD 2G5DA 1SJED 5FJ8G 1TQOA 4EVOA 2NZ1D 1YEZA 3A8IE 5J39A 1WTVA 2TSSA 2PZWA 5ELFA 1PH2A 1TR5A 1I94Q 3DM1A 3F2DA 3J7A5 1GO3E 2K5VA 1FNUA 4BY1G 1I3QH 2F0KA 2PZTA 2F1MA 3JAMi 3QG1A 2GVAA 2WB1G 2Z9HA 1HZ9A 3J80i 4WJ3M 2F3VA 5E4XA 1ASZA 4O0AA 1I4GA 1D1IA
chains in the Genus database with same CATH topology
5C5LA 3SK5A 4X3TA 2R61A 4HR7B 5C4JB 3AB9A 2B2TC 1SAPA 5I9OA 4RGTA 1EY7A 3VR3A 3VR5A 1D5XC 4DAPA 4ILWA 2FMCA 4NMZA 5A2QE 3E5SA 2FJ2A 3C1EA 1BO0A 1CZWA 1QJOA 2SDFA 5C3EB 1KTKA 1NCVA 1MSGA 4C3IB 1EY9A 2KCNA 1GOZA 4FXKC 1DYQA 1JWMD 1D5ZC 1IYUA 2L0CA 3S1MB 1SYFA 1RJTA 2F0IA 2ICEC 3C3LA 1A2TA 2N88A 1Z47A 2QILA 4HMJA 2KJXA 4ZRZA 3S16B 1ESRA 2RDHA 5EKKA 2KEDA 1WD0A 3S1RB 2LKVA 4RHSA 4F8MA 1EQTA 3SDZA 2AUJD 2DNEA 4J1MA 4KKSA 4KHZA 1K83B 3IAYA 1CHQD 3DUZA 3OOCA 1O7LA 5D3IB 5F2DA 2J4XA 1MD2D 1K8MA 1STBA 1OXUA 5KNBA 3MVVA 1U9RA 2F4IA 1X32A 3BVGA 1H9MA 5EGTA 2HUGA 3DWQA 3CU7A 5JEAG 4V190 1HQMC 2FFKB 1EFID 4CHTB 4L6TB 1HA6A 4ZYSA 4ODGA 1PRTF 2B2YA 3D4WA 1VCIA 1VMPA 5C4XB 1CFMA 3T13A 2J7ZA 5JOBA 4L63B 2Z4HA 3A56A 2TMPA 2IJ0A 5EPLA 4ZQ3A 1SNQA 2F0MA 4OO1I 2EJFC 1TS2A 1DONA 3HOXB 2M00A 2QKIC 5T1IA 5CMDA 3NTKA 1F2LA 3EVQA 2PNRC 1IL8A 4J6HA 3PO2B 5CV7A 4NW2A 2E76C 4HN7A 1UAPA 1ZEQX 2IPKD 2IX0A 2R92B 3FKIB 3DWAA 1CHPD 2R93B 2EYHA 1EIHA 2EY6A 2AQ1B 1NR4A 1PLFA 4PMCA 3HRZC 1G6ZA 1G2TA 2B2WC 3J81L 2NN6G 4Q5VA 1S4ZA 4TKOB 1PDQA 1KNAA 1LTGD 5FOBB 3KLSA 2QCPX 1Z7TA 2K6AA 1VDZA 5KYLA 5IGFA 4G7ZC 2Q8IB 4H44C 2FMMA 5HGTA 1H9KA 4XIGS 2XIWA 1TWGB 4IFDH 2K5WA 5FKAC 3F2UA 4JBWA 1W6JA 3TP7A 3BDOA 3EFXD 5CYUA 2EYMA 1SBBB 2B8GA 3P20A 4B9WA 2NUCA 3Q6SA 1V1PB 1EY5A 1IW7D 3JAML 5ELDA 3J80L 2AWOA 2MJ8A 4ZUIA 1JORA 4IUTA 4KHVA 2ENBA 2K5DA 4G7HC 5ELCA 3S1QB 3VA7A 1PTOD 2RSOA 3MAQA 1U4PA 3BG3A 2H1EA 3VR6A 3HOVB 2PMZB 5C6AA 3ITPA 1TWCB 3A55A 1S5ED 4IALA 1UEAB 3R2IA 5M3MB 1CQVA 2PQEA 1C8CA 3FVQA 4P2CB 3G7LA 1V1OA 2XN9C 5K36G 2BE5D 4RKLA 5NUCA 1PTOC 3EA6A 2JA8B 1F9QA 1TU2B 3H6MA 4KD4A 3I73A 3IL8A 5I2YA 2CQAA 4DFAA 2B2TA 4XQJA 4HTHA 2HQEA 1RDPD 2B2UC 3D6WA 4E6IA 4R8NA 3NP8A 4FF1A 3HGBA 4RWSC 2BE5C 4C3JG 4L8JA 5ELEA 2GA4B 3VYUA 3SEBA 1A15A 1LTBD 2H4OA 2ZXOA 3QJYA 2EYPA 3SR1A 3SXHA 3C1FA 3NWSA 4DXGA 4Q0FA 3PUWA 2K04A 2EYFA 1PRTC 1MGSA 4F87A 2F3WA 4C1NI 4J8QA 3C2PA 1LTID 5C0XG 2O5JC 2CW0D 3HZXA 5FO7B 2K01A 1EYCA 4C3HG 4CKBA 1V8QA 1FNVA 1F9PA 1JICA 1B50A 1W6KA 5DM73 3E6ZX 1WTRA 5CV5A 4BS9A 3FPPA 1AFPA 4QCLA 3WOFA 5IIFA 1L0XB 1LT6D 3CRLC 1SFOB 3TN2A 3C46A 4A3IB 1DJRD 5KNCA 5KEEA 4K2LA 4H0LC 3MFGA 1RTNA 3M4YA 2RDGA 2F0GA 1CI3M 2L5TA 2VXWA 3OMGA 4PQXA 1O78A 3KBGA 1QWYA 4RA8A 1F9RA 4IFDJ 2F0DA 2KHSA 4C3IG 3H0GB 1WD1A 4XT3B 1BUVT 2MP1A 1PMRA 3EJIA 3N6RA 4QB4A 3J81E 1ONLA 2EY5A 3TMEA 1GHKA 3J7AV 2J0TD 4OO1H 1VF7A 4ZK9B 5M5XB 2VUMB 2O4XA 3D6CA 2F0LA 3ZYYX 1TS3A 2K03A 3BYYB 4DK0A 3GTOB 1SMYC 4EQOA 4AYBB 1I4PA 4QF4A 4WJWA 4RCNA 3CHBD 3P7JA 1XX8A 1YNND 3EROA 3ND8A 3SK4A 1D2BA 4RHRA 4RCOA 4RGNA 4V0BA 1LACA 2XVSA 2Q8RE 1BOSA 2F0PA 2BDNA 1A3UA 4A3FB 4X3SA 3L9AX 2OXPA 1LT4D 3JAME 1DOLA 3AU7A 3J80E 3I4NB 3A7LA 2B2WA 1EEID 2O5IC 1MSHA 1ET6A 1E2WA 1DD2A 2JSOA 2NTTA 4RKBA 1KDAA 3PUXA 2JA7B 2MGSA 4BA2I 2RBMA 2EYLA 1TWAB 4FVMA 5BN5A 1B53A 1ILPA 1QB5D 3NBIA 1HCZA 3BDCA 3K7AB 2XSCA 5TSSA 2V4DA 1BR9A 1EZ6A 5J22A 2R7ZB 2F0NA 2EOTA 3QB3A 2I07B 1CA5A 5CV4A 3A8JE 2EY1A 5D65A 3KBXA 1B9MA 2RKSA 3T56B 2D5DA 4KMUC 5C3XA 3OWEB 1KNEA 5CBAE 3DXJC 5IOCA 5EBDA 1LV9A 2K33A 4FF3A 3LNNA 2RDFA 3N52A 4G57A 1STEA 1AW7A 4DK1A 4FXDA 5CV8A 2XRSD 3NBHA 3VR4A 5IGDA 4BBSB 1HTLD 1SJHD 2NN6I 3RMHA 1PXUA 2IT1A 1HHVA 2B63B 2KEEA 2FHTA 2K05A 1STGA 2EXZA 3H91A 4QUFA 1B9NA 1KLUD 1FNWA 3EQLC 3UI2A 1HUMA 1BCPB 4BA1I 4K6DA 1STYA 3TP5A 2BCOA 2M9VA 5CORA 4IN3A 1WTOA 4XYOA 1LT5D 4B08A 1EL0A 5C5MA 2B2UA 4R8IA 1I3QB 3MXPA 4N9TA 2JEBI 4DNTB 4S3SA 2A6HD 3GO5A 3BVMA 4IURA 2F0UA 1QILA 2O2LD 3M7GA 4R9WA 1VF5C 1T5EA 4OIKA 1JCKB 2X6LA 2YYZA 4U673 2L55A 1B4OA 3Q0AA 3I91A 2MUYA 1RD9D 3I4MB 5I9PA 2K7VA 2A6HC 5IGCA 3MZ5A 1ZYRC 1WVLA 4OHJA 2HDLA 1Y8PB 1MI2A 2XWBB 2C9OA 5IT9L 3R3OA 2EY2A 1FGBD 3S14B 1K8OA 1S5FD 3OWFA 5ELBA 3M3YB 4A3BB 4ZKCB 4YIJA 4IZ8A 5DM63 3K0YA 1QG7A 1B2TA 3A54A 4DA2A 4K5VA 1ZKOA 2WAQB 5KRUA 5FO8B 5LHY1 3HOUB 1AEXA 2EE1A 3S2DB 4DAYA 2D2CC 3L7ZC 1PTOH 4ZLTF 4HMIA 4K8IA 4BBRB 4ZAIA 1YNJD 3ND9A 1D1KA 5DEHA 1IKLA 3BZDB 3HP3A 3VYTA 4O1NA 1PZJD 4ZUJA 3D3RA 5DAUA 3DEOA 5K5PA 2KVMA 4ID6A 4KKTA 4IUPA 4EQPA 3DMUA 2WB1B 3CRKC 1RHPA 5C0XI 1B44D 4C56C 1YNJC 3MA2B 1UNSA 3MC0B 5KIXA 4M8AA 4FXGC 4HSVA 3KF8A 2PZUA 1TY0A 3HEJA 5G3LF 2A6EC 3TP8A 1EZ8A 4X3UA 4A93B 1I4XA 5EKIA 4I65A 1IKMA 1NR2A 3I70A 1EYAA 3K5OA 5I4DA 1ET9A 3HOYB 3S15B 1PTOB 4Y7NB 1PFNA 1TKWB 1STHA 5JEAH 2LFNA 3BS1A 4XQNA 3FPUB 2VNUD 4EQNA 1WTXA 3M4OB 5IGBA 4XT1B 3U9OA 3HOZB 1H9JA 3K58A 1TIID 1G291 5ISRA 1XWEA 1CT1D 3HS0C 4WORA 3IFTA 3T53B 2A74C 3HOWB 2SOBA 3J7AF 3NQTA 4XTCS 1NAPA 2NVTB 1JWSD 2JP1A 3M85A 2JA5B 3KLRA 1GUGA 4CKEA 5M3FB 1SNPA 1STNA 2JYOA 2KA7A 3T16A 5JPMC 4ULLA 3GTKB 3TSSA 5BN4A 4PV1C 4M1UB 4TQUS 1F2ZA 2PO4A 4A3DB 3KLSX 2NN6H 4HCSA 3Q23A 3OMCA 4O42A 1PRTD 3SE0A 5M5YB 1PZID 1E2ZA 1SDFA 5I6YA 2EDGA 1A3VA 1HRJA 2F0WA 4RGMA 2F0TA 5E4WC 2K28A 3QIAA 3X3MA 1JE4A 5FLXL 2A68D 1LT3D 2WKDA 5IT9E 1O7ZA 2I46A 1RCVD 4KJNA 5C4HA 4NDXA 3CKIB 3MXNA 5D14A 1EY8A 1CM9A 1LTAD 2E74C 3PUYA 1LTTD 1QCBD 1SXTA 1GJXA 5JJZA 3URYA 2WACA 3MXGA 2AQ2B 1F9SA 1NUCA 2A68C 3GV3A 2KECA 1FR3A 2B39A 4I7ZC 2LMCB 4WRDA 1STAA 3D4DA 3K59A 1XXGA 3Q24A 2WINB 2L9HA 1DOKA 2F0EA 4HAEA 5DNFA 2G9HD 3NTHA 1EU4A 4B9XA 3OW7A 3U9SA 5K36H 4ABNA 3IFDA 1IHZA 3TBIB 4FYDA 4HEDA 3T51B 2LY7A 3VYRA 3CQZB 5D3DA 1SMYD 1T5XD 1RF2D 5JEAJ 1AZQA 2FINB 1B3AA 1SYEA 2HCCA 2EYOA 4CBVA 2SNMA 1ENFA 3RD4A 1EIGA 1F77A 1VMCA 3R93A 2DNCA 3LX0A 3W2DA 3K57A 4N9PA 2NVXB 3J7YW 2E2JB 1H9SA 1CA6A 4PNYA 1C4QA 2A69D 3V2TA 1U4MA 3SK8A 1EOTA 1BCPF 3S1NB 5CGKA 3H94A 5C0XH 1QNKA 4IUNA 3S2HB 1GXDC 2BA1A 1Q1BA 3K5NA 1SYCA 1GUSA 3W3AA 1SE4A 1Y1VB 3K6OA 4A3KB 3ONAB 3WOEA 1SEBD 4OL7A 1D5MC 2KOLA 1GUTA 1HXYD 2A69C 1ENCA 1ZXTA 1G91A 5C4ZA 4DGZA 1TT2A 1PFMA 1JC7A 2OT2A 1EWHA 3BDLA 2D9UA 3A7AB 5LL6S 3GTLB 1I4HA 1ENAA 2XNAC 4K5XA 1SYBA 1X3QA 2M2LA 1GUNA 1LABA 1QE6A 4RAUC 5M9OA 3MTSA 4K5WA 1DCZA 4ME5A 2NTSA 1EU3A 2F0VA 1S5DD 1GUOA 4KY6A 4UDUC 2MPMA 1FD7D 5CBEE 5COYA 2IL8A 3HG9A 1MBYA 2RA4A 2F03A 1BNZA 1RKNA 1WTWA 1O80A 5EQ0A 4C3HB 3K5LA 1OXVA 2Y0SB 4HSPA 4C1NK 2IX1A 1SNOA 4CJ1B 1EWCA 1JOKA 2L4NA 5JVH3 5FLXE 2AUKA 1M4VA 2E2DC 5FK9C 1A3TA 5JPNC 1JWUD 1S5BD 5AFWA 3VYSA 2BDOA 2Z1CA 3PUZA 1ML0D 3QOJA 1JOOA 5JAVA 2D62A 2CHBD 1PFBA 2HCIA 4MN3A 5J1ZA 2SEBD 2R3ZA 2KQ3A 5A35A 3RZDB 3BYTB 1TS4A 4ZKBB 2EJGC 4KD3A 3MXUA 4UAIA 1KDBA 2PPBC 5EPKA 2ID0A 3P75A 1ICWA 2WKCA 1CZGA 1ZYRD 5IGGA 4KK7A 3DHQA 3QWNA 3OPOA 1Y8OB 1V1PA 1OXSC 1SSOA 3H3VC 1GUWA 2B2VC 3ERQA 1H9SB 4F7XA 3VR2A 1HFNA 3MHBA 1PTOF 4NKLA 2A73B 3QOLA 1BCPD 3NXWA 5C3WA 5LL6X 1CQFA 2F0HA 1R9TB 4TSSA 1SYGA 1G2SA 5C0XJ 1KDCA 1KAAA 3V05A 1B1ZA 1J9OA 3PO3B 4K6LA 1H9RA 4K2KA 1A2UA 3KUPA 4IFDG 2C5CA 2X6GA 1WTQA 3VA5A 2F0JA 1BCPC 2OF1A 1IYVA 3V96A 3WDNA 1F2MA 1Q3LA 1CK1A 4K14A 2L1BA 1I6VC 1L0YB 5CV6A 3GTPB 2KCCA 5BN3A 1RTOA 2X69A 2OEOA 2K32A 4K8JA 1EYDA 4FP5D 2F0QA 4QUCA 1SE2A 4C2MB 1TWHB 1U4RA 4BY1B 4MIUA 3MWYW 2A6ED 2WIIB 3K5MA 2JA6B 2NBFA 5KNDA 1AZPA 3S9WA 1BBXC 2VB2X 4DXFA 4RFBA 1I50B 3MEHA 3RLFA 3D31A 4F88A 3I3CA 2ZXRA 5EJWA 3H09A 3BVZA 1F2YA 5IGEA 1ILQA 3AMUA 4FO2A 1OO9B 4LK1C 3TZDA 3O13A 3LWUA 4IUVA 4IQZA 5KGUA 2BOSA 1PYWD 2WP8J 2A5HA 2RSNA 1D6EC 1Q1EA 2RQXA 2NVYB 1UUPA 2EYJA 1WTPA 1A6XA 1OXXK 3E0JA 3PV0A 2XWJB 3LWEA 3TP6A 2ZT9C 3IKJA 5M5WB 4KN4C 3PIO3 1EY0A 2QEJC 4XYQA 4X3KA 5I6WA 1LLRD 4LMQD 1DXMA 4KN7C 1ESFA 1OXTA 2F0SA 5T1GA 4FF2A 3PIP3 2WV6D 1TS5A 3SVMA 4LAAA 2VB3X 3PUVA 3GV6A 1S5CD 3GTMB 3X3NA 4BWGB 3GTJB 3NSWA 1RODA 5EBCA 3Q22A 5CC4A 1CTMA 4XDXA 1BF4A 1PRTB 1LO5D 3NPPA 2R6GA 2NB0A 2E2HB 2ZXPA 2Z8LA 3NE5B 4RGOS 4PMWA 5KYIA 4IUQA 4DF7A 3OSOA 2NVQB 2JXMB 3DWPA 3QO2A 3R8BA 4BY7B 2QDBA 5CR3A 3GTGB 4QIWB 1IW7C 5E3FA 2EJMA 4KY5A 1HTPA 1HPCA 1I4RA 1HQRD 1FYCA 2Q8TA 1SYDA 2PYKA 4DNRB 2LS01 1WCMB 1V43A 2Z4IA 1SNDA 3T4AC 1X3PA 1DM0B 1O7YA 2CVRA 5CV9A 2NYZD 4KJOA 1J8IA 2HDMA 5IODA 4IUUA 1Y1WB 1KLGD 5HURA 1SNCA 1NSNS 1BXTA 2XRQD 1Z6HA 3FDTA 4WFN3 4NP5A 4XXEA 1Q12A 4OO1G 3GP7A 4H7BA 2E75C 2L12A 3NQIA 1QNUA 1DOMA 4OIJA 1JB3A 4A3EB 3I72A 2DY8A 4LJZC 1LTRD 5A2QL 1E2VA 1I4QA 4XQQA 1HUNA 3FRPB 2YU9B 1Y8NB 2F0FA 4G4KA 2EZVA 3P1HA 4HCEA 1AN8A 2B2VA 3G6JB 4G7OC 2EVBA 2MHVA 3I90A 2JE6I 3I4LA 5EPJA 5G3LD 2NWGA 2N55A 4FF4A 1GHJA 1SNMA 1DZ1A 1U4LA 3NUCA 4DU9A 2E2IB 1KABA 1Q90A 2B2YC 1TVXA 5EKLA 4PMBA 3TDQA 1BQQT 1R4PB 2CW0C 2DN8A 2JEAI 4A3MB 1JQYD 3M7NA 2IW3A 4KY7A 2L11A 4A3JB 1XTCD 3SK6A 4GZYC 3I8ZA 3A8KE 1TY2A 4KTAA 2DY7A 5I2XA 3FMCA 1QOHA 3S17B 1LTSD 2RVLA 3GQBA 3NHHA 1EQVA 2G9DA 1PZKD 3HKZB 1HA5A 3D4RA 4CGYB 2K1BA 2PW5A 2EPBA 3NWTA 1M8AA 2IWHA 1Y69U 3D8GA 2KUMA 2IX3A 4CJ2C 1SE3A 4EGVA 1R4QB 3OIPA 4FNFA 3RZOB 3L3OC 4KI0A 3SHLA 1E0BA 3NK9A 2PCFB 2PW7A 4CKCA 3MFYA 1EY4A 2SNSA 3OHXC 5E1FA 3KK7A 1XYIA 1AP0A 3RUZA 2K5QA 2BA0A 3GTQB 2F0OA 3NTIA 4DAVA 1EY6A 4DN4M 1JOQA 5C44B 4IFDI 1I6HB 1BDOA 3FEWX 4H13C 2B8FA 4MHEA 4KKUA 4OGQC 1C48A 4RH6A 2AQ3B 4C3JB 1YNNC 3GD7A 3TZUA 4KV6A 2ICIA 4TRDA 4JK1C 2AWNA 3DEPA 4A3GB 1G8ZD 5FO9B 3OIQA 4QMGA 5JVG3 4Z9CB 4U68A 2QF7A 1Q8IA 3R2TA 1JR0D 1II3A 3PMFA 4CJ0B 1TWFB 1HFGA 1EEFD 1SJED 1TQOA 4EVOA 2NZ1D 3A8IE 5J39A 1WTVA 2TSSA 2PZWA 5ELFA 1TR5A 3DM1A 1FNUA 2F0KA 2PZTA 2F1MA 3QG1A 2F3VA 5E4XA 1I4GA 1D1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9H A;  4MN3 A;  2B2U C;  3D6W A;  1RHP A;  4OIK A;  4X3T A;  3SVM A;  2X6L A;  1WD1 A;  2DY8 A;  2JYO A;  2K1B A;  2R3Z A;  1ZXT A;  4RWS C;  2EPB A;  1G91 A;  1RTO A;  1DOK A;  1M8A A;  2X69 A;  3GV6 A;  2MP1 A;  4XT3 B;  4HAE A;  5DNF A;  2KUM A;  2EOT A;  2FMM A;  2B2T C;  4CJ2 C;  2XIW A;  1B4O A;  1X32 A;  2HUG A;  1HUN A;  3I91 A;  1PFM A;  1CA5 A;  1ROD A;  4HSV A;  1SAP A;  3IFD A;  4ZKB B;  1E0B A;  5D65 A;  4QUC A;  2FFK B;  3KBX A;  4ZK9 B;  3F2U A;  4UAI A;  1HA6 A;  4XDX A;  2D9U A;  5EPK A;  1U4R A;  1BF4 A;  1A15 A;  1ICW A;  3MWY W;  4HED A;  2B2V A;  1KNE A;  2B2Y A;  5CBA E;  3I90 A;  2K03 A;  1AZP A;  1XYI A;  1AP0 A;  4HCS A;  1LV9 A;  1VMP A;  1BBX C;  1X3Q A;  4X3U A;  1WVL A;  2FJ2 A;  2M2L A;  4IUQ A;  2HDL A;  1BO0 A;  1QE6 A;  4O42 A;  5EPJ A;  3N52 A;  1MI2 A;  2J7Z A;  2NWG A;  2SDF A;  2FIN B;  2K04 A;  2N55 A;  4RAU C;  1B3A A;  3MTS A;  4DN4 M;  1NCV A;  3QO2 A;  5EKI A;  1MSG A;  1NR2 A;  3Q6S A;  1IKM A;  1DZ1 A;  1SDF A;  1U4L A;  2HCC A;  5EPL A;  1SSO A;  1MGS A;  1GUW A;  2B2V C;  2B2Y C;  1TVX A;  3I3C A;  2MJ8 A;  3P7J A;  1XX8 A;  4MHE A;  1HFN A;  1HRJ A;  1PFN A;  1DON A;  4ZKC B;  4IUT A;  5EJW A;  5E4W C;  2MPM A;  5T1I A;  5CMD A;  5CBE E;  1QG7 A;  1B2T A;  1F2L A;  5COY A;  2K01 A;  2K28 A;  2Q8T A;  1B50 A;  2Q8R E;  1ILQ A;  2IL8 A;  1EIG A;  3DEP A;  1JE4 A;  3FPU B;  2BDN A;  1IL8 A;  1RJT A;  1VMC A;  1HHV A;  1F9P A;  2RA4 A;  1JIC A;  2KEE A;  2RSO A;  1BNZ A;  2FHT A;  1WTX A;  1X3P A;  1U4P A;  2K05 A;  4X3S A;  4U68 A;  1O7Z A;  1O80 A;  3R93 A;  4NW2 A;  4XT1 B;  3TZD A;  1WTW A;  4IUV A;  1WTR A;  5EQ0 A;  2H1E A;  3H91 A;  1G2S A;  1O7Y A;  2L11 A;  1DOL A;  2CVR A;  2N88 A;  2EE1 A;  4QUF A;  2NYZ D;  1J8I A;  4CJ1 B;  2RSN A;  2HDM A;  4IUU A;  1CA6 A;  3UI2 A;  4CJ0 B;  1HUM A;  2B2W A;  1J9O A;  3I8Z A;  1WTP A;  5D14 A;  1ESR A;  3TN2 A;  4ZLT F;  1EIH A;  1U4M A;  1C8C A;  1EOT A;  1CM9 A;  1HFG A;  3KUP A;  1MSH A;  1NR4 A;  3G7L A;  2KED A;  2DY7 A;  1PLF A;  2L4N A;  2NZ1 D;  3LWE A;  4ZAI A;  1WD0 A;  1WTV A;  3FDT A;  5COR A;  1WTO A;  1QNK A;  1IKL A;  2X6G A;  5JJZ A;  1EL0 A;  3HP3 A;  1EQT A;  1RTN A;  3DM1 A;  1WTQ A;  1G6Z A;  1G2T A;  1F9S A;  4X3K A;  2B2U A;  2B2W C;  4R8I A;  1F9Q A;  2L12 A;  3GV3 A;  2KEC A;  5AFW A;  2VXW A;  4LMQ D;  2RVL A;  3ONA B;  2MGS A;  3IL8 A;  1ML0 D;  1NAP A;  1Q3L A;  4IUR A;  1S4Z A;  2B2T A;  1DOM A;  5T1G A;  5E4X A;  1B53 A;  1PDQ A;  3DEO A;  1ILP A;  2JP1 A;  1KNA A;  2KVM A;  2L1B A;  4RA8 A;  1AZQ A;  1PFB A;  2KOL A;  4IUP A;  1F9R A;  4OIJ A;  4R9W A;  2HCI A; 
#chains in the Genus database with same CATH topology
 5C5L A;  4JI3 Q;  3SK5 A;  4X3T A;  4X66 L;  4IPH A;  2R61 A;  4HR7 B;  5C4J B;  3AB9 A;  4DV1 Q;  2B2T C;  3BU2 A;  3Q8D A;  2NZH A;  1SAP A;  3I4M H;  1K83 H;  3KJP A;  2HD3 A;  5I9O A;  3DLL A;  4JBK A;  4LF6 L;  1FGU A;  4RGT A;  4DR6 L;  1EY7 A;  3VR3 A;  3J81 j;  3VR5 A;  4R1J A;  1D5X C;  4DAP A;  4ILW A;  2FMC A;  4NMZ A;  5A2Q E;  3E5S A;  2FJ2 A;  3C1E A;  3KF6 B;  1BO0 A;  1CZW A;  1XJV A;  1QJO A;  2UUC Q;  2SDF A;  5C3E B;  1KTK A;  1NCV A;  1MSG A;  4B3M Q;  1C0A A;  4C3I B;  2I5M X;  1EY9 A;  1N9W A;  3S14 H;  3M3Y H;  4A3B H;  2KCN A;  2CH4 W;  1GOZ A;  4FXK C;  1DYQ A;  1JWM D;  3KOJ A;  1A8V A;  1D5Z C;  1IYU A;  4LWC A;  2L0C A;  3S1M B;  1AE2 A;  2KHJ A;  1SYF A;  5JJK A;  1RJT A;  1YJW A;  2F0I A;  2ICE C;  3TRE A;  3S24 A;  3C3L A;  2UUA Q;  4KHP Q;  1A2T A;  4GN4 B;  2AHO B;  2N88 A;  1FVI A;  3HOU H;  3S2D H;  1Z47 A;  2QIL A;  4HMJ A;  2KJX A;  4ZRZ A;  3S16 B;  4DPG A;  1N36 Q;  1ESR A;  1VQM A;  2RDH A;  1UE6 A;  5EKK A;  4BBR H;  1XNR Q;  2KED A;  1WD0 A;  4JOI C;  3S1R B;  2LKV A;  4RHS A;  3HOW G;  4F8M A;  1EQT A;  3SDZ A;  4UP7 A;  2AUJ D;  2D0P A;  2DNE A;  4J1M A;  4KKS A;  4KHZ A;  1K83 B;  3IAY A;  5M3F G;  1CHQ D;  3DUZ A;  4R4C A;  2R93 H;  3OOC A;  1O7L A;  1GKH A;  5D3I B;  5F2D A;  4LF5 L;  2J4X A;  3CPF A;  4DV4 Q;  4IPG A;  1MD2 D;  1K8M A;  1STB A;  1OXU A;  3PGZ A;  5KNB A;  3MVV A;  2OWO A;  1U9R A;  2F4I A;  3CCJ A;  1MIU A;  1X32 A;  2ATW A;  3BVG A;  1H9M A;  5EGT A;  2Q2U A;  1X6O A;  2HUG A;  3DWQ A;  3CU7 A;  5JEA G;  1VQD A;  4V19 0;  1HQM C;  2FFK B;  1EFI D;  3PQI A;  2KCM A;  4CHT B;  4L6T B;  1HA6 A;  1WCM G;  4ZYS A;  4DV7 L;  4ODG A;  1PRT F;  4A3L H;  2B2Y A;  2UXB Q;  3D4W A;  1VCI A;  1VMP A;  5C4X B;  1CFM A;  3T13 A;  4A93 H;  2J7Z A;  5JOB A;  4L63 B;  5FLX c;  2Z4H A;  3A56 A;  2TMP A;  2IJ0 A;  5EPL A;  4ZQ3 A;  1SNQ A;  1IL2 A;  2F0M A;  4OO1 I;  3HOY H;  1HNW Q;  2EJF C;  1TS2 A;  4Y7N H;  1DON A;  3HOX B;  2M00 A;  1XPR A;  2QKI C;  5T1I A;  5CMD A;  3NTK A;  1F2L A;  4DR5 L;  3K7U C;  3EVQ A;  2PNR C;  1IL8 A;  4J6H A;  3MEF A;  5DLQ E;  3PO2 B;  2EQS A;  5CV7 A;  3M4O H;  4NW2 A;  2E76 C;  4HN7 A;  3HOZ H;  2WAQ E;  1UAP A;  1ZEQ X;  2IPK D;  2IX0 A;  2R92 B;  3FKI B;  3DWA A;  1Q8K A;  1CHP D;  1HJP A;  4A3E G;  2R93 B;  2EYH A;  1EIH A;  2EY6 A;  3AYH B;  4JI8 L;  2AQ1 B;  4PZ7 A;  1NR4 A;  5AJ3 Q;  1PLF A;  4PZ6 A;  1J5E Q;  1RL2 A;  4PMC A;  4UPA A;  1V9P A;  3HRZ C;  1O7I A;  1G6Z A;  1G2T A;  1VQ5 A;  2B2W C;  3EBE A;  1VS0 A;  3F2C A;  3HOW H;  3CCM A;  3OTO Q;  3J81 L;  1JJ2 A;  4JI5 Q;  1XMQ L;  2NN6 G;  4Q5V A;  1S4Z A;  4K0K Q;  4TKO B;  1PDQ A;  2NVT H;  5M3M H;  4X65 L;  1KNA A;  1LTG D;  5FOB B;  2JA5 H;  4LF7 L;  1CKN B;  3KLS A;  2QCP X;  2WB1 E;  4DV2 L;  1Z7T A;  1N32 L;  2K6A A;  1VDZ A;  2K5H A;  1E1O A;  1E22 A;  5KYL A;  5IGF A;  4G7Z C;  4P75 A;  2Q8I B;  4H44 C;  4JI4 L;  2FMM A;  5HGT A;  1H9K A;  4XIG S;  2XIW A;  1TWG B;  1L0W A;  4GNX B;  1GD7 A;  4IFD H;  3GTK H;  2VS1 A;  4NXM L;  2K5W A;  5FKA C;  4CDC C;  3F2U A;  4JBW A;  3PSI A;  2CH4 A;  1W6J A;  1WYD A;  3BDO A;  3EFX D;  5CYU A;  3TP7 A;  2EYM A;  1N33 Q;  4A3D H;  4IOC A;  4A3J G;  1SBB B;  2B8G A;  5LMN W;  1VQK A;  3P20 A;  2Q2I A;  4B9W A;  2NUC A;  2Z0S A;  1IBL Q;  1MJC A;  4NXN Q;  3Q6S A;  1V1P B;  1EY5 A;  1IW7 D;  3JAM L;  5ELD A;  4R4O A;  3J80 L;  2AWO A;  2MJ8 A;  4ZUI A;  1JOR A;  4DNI A;  4IUT A;  4KHV A;  2ENB A;  4JI7 Q;  2I5L X;  2K5D A;  4G7H C;  5ELC A;  5GQO A;  3S1Q B;  4NB3 A;  4DR3 Q;  4JI2 L;  4CDD C;  3VA7 A;  1JB7 A;  1PTO D;  1HZB A;  1GVP A;  1NTG A;  2RSO A;  3MAQ A;  1U4P A;  1K8G A;  3BG3 A;  2H1E A;  3VR6 A;  3HOV B;  1XMO L;  2PMZ B;  2UUB L;  5C6A A;  3ITP A;  1TWC B;  3A55 A;  3HKZ G;  1S5E D;  4IAL A;  3R2I A;  1UEA B;  2ZTD A;  5M3M B;  1CQV A;  1PVO A;  2PQE A;  2EIF A;  2YV5 A;  1C8C A;  3FVQ A;  4P2C B;  3G7L A;  3K81 C;  1V1O A;  1IBK Q;  2XN9 C;  2K52 A;  5K36 G;  1Y1V G;  1HNZ Q;  2BE5 D;  4A3K G;  4A75 A;  2JQO A;  4RKL A;  5NUC A;  1PTO C;  3EA6 A;  1X9N A;  2JA8 B;  1F9Q A;  1VQ9 A;  3WWV A;  1TU2 B;  2CQO A;  3H6M A;  2ZM6 L;  1X65 A;  3I73 A;  4KD4 A;  3IL8 A;  5I2Y A;  2CQA A;  3CP0 A;  2B2T A;  4DFA A;  4XQJ A;  4HTH A;  1SFO H;  2HQE A;  3RN2 A;  1RDP D;  4A3I H;  2B2U C;  3D6W A;  4E6I A;  4R8N A;  5C44 G;  3NP8 A;  1W2B A;  1N34 Q;  3HGB A;  4RWS C;  4FF1 A;  1PH1 A;  4HIK A;  1ASY A;  4A76 A;  4DV5 L;  2BE5 C;  1KL9 A;  4C3J G;  4L8J A;  3SGI A;  5ELE A;  2CKZ B;  1CSP A;  2GA4 B;  3VYU A;  1LM0 A;  2JJQ A;  3SEB A;  1SMX A;  1A15 A;  1YNX A;  3I7F A;  1LTB D;  3L2P A;  4JPB W;  2H4O A;  2ZXO A;  3QJY A;  2EYP A;  3SR1 A;  3SXH A;  3UDF A;  3C1F A;  4I7A A;  3NWS A;  4B3S Q;  3H0G H;  4DXG A;  4Q0F A;  3PUW A;  2K04 A;  4YHH L;  3PIO A;  2EYF A;  1PRT C;  1MGS A;  2UU9 Q;  4F87 A;  5JJI A;  2F3W A;  3G6E A;  4C1N I;  5LMU Q;  4J8Q A;  3C2P A;  1LTI D;  5C0X G;  2O5J C;  2VUM H;  2CW0 D;  2ALY B;  3HZX A;  5FO7 B;  2K01 A;  1EYC A;  4C3H G;  4CKB A;  3NEN A;  1V8Q A;  2Y0S G;  3PIP A;  1HR0 Q;  1FNV A;  1F9P A;  1JIC A;  4IPD A;  1B50 A;  1W6K A;  5DM7 3;  3E6Z X;  1WTR A;  4JOI A;  5CV5 A;  4BS9 A;  1E1T A;  2NVX H;  3FPP A;  1SRU A;  3U58 A;  1AFP A;  4QCL A;  3WOF A;  5IIF A;  1EQR A;  1L0X B;  1LT6 D;  4A3C H;  3CRL C;  1SFO B;  2KEN A;  2Z6K C;  3CW2 C;  1N8R C;  3TN2 A;  3C46 A;  4A3I B;  1DJR D;  5KNC A;  5KEE A;  4K2L A;  4H0L C;  1YIT A;  3S2H H;  3MFG A;  3CMA A;  1RTN A;  4A3F H;  3M4Y A;  2RDG A;  2F0G A;  1CI3 M;  2L5T A;  3KLW A;  2VXW A;  1IBM L;  4DR7 Q;  3CME A;  3I4N H;  3OMG A;  4PQX A;  1O78 A;  3KBG A;  1QWY A;  3M4Q A;  4RA8 A;  1FJG Q;  1F9R A;  4CDF C;  4IFD J;  1XNQ L;  2F0D A;  2KHS A;  1IYJ B;  4C3I G;  3H0G B;  1WD1 A;  4XT3 B;  1BUV T;  2MP1 A;  5HGQ A;  1PMR A;  1A0I A;  3EJI A;  3N6R A;  4QB4 A;  1EWI A;  3J81 E;  1ONL A;  2EY5 A;  3TME A;  1GHK A;  3J7A V;  2J0T D;  4OO1 H;  2JA7 H;  1VF7 A;  4ZK9 B;  1Q82 C;  4AQY L;  1VQC A;  5M5X B;  2VUM B;  2O4X A;  3D6C A;  3GTL H;  3KDF B;  2F0L A;  3ZYY X;  1TS3 A;  4JC0 A;  2K03 A;  3BYY B;  4DK0 A;  2HHH Q;  3K7A H;  3GTO B;  1EQQ A;  2HIX A;  1SMY C;  2PQA A;  4EQO A;  4AYB B;  1S72 A;  1WI5 A;  1I4P A;  1VQ7 A;  4QF4 A;  1YBY A;  4WJW A;  4RCN A;  3CHB D;  3P7J A;  1XX8 A;  1YNN D;  3ERO A;  3ND8 A;  3SK4 A;  1D2B A;  1VQO A;  2AMC B;  2A8V A;  3F8T A;  1X55 A;  4RHR A;  4LFA L;  4RCO A;  4RGN A;  4V0B A;  1LAC A;  2XVS A;  2Q8R E;  1BOS A;  2F0P A;  2BDN A;  1A3U A;  3CD6 A;  1JMC A;  1MJE A;  4A3F B;  2VQF Q;  2A19 A;  4X3S A;  3L9A X;  2UXD Q;  2OXP A;  1AH9 A;  1LT4 D;  4C3H H;  3PO3 G;  4AYB E;  1DOL A;  3JAM E;  3AU7 A;  1B3Q A;  4HID A;  3J80 E;  3I4N B;  3J81 i;  3ICE A;  3A7L A;  3CCV A;  2B2W A;  1EEI D;  2O5I C;  5IYD G;  4LF8 Q;  3G4S A;  4BBS H;  1MSH A;  4DV0 L;  1ET6 A;  3G48 A;  1PH9 A;  2B29 A;  3T1H Q;  1SLJ A;  1E2W A;  1DD2 A;  2B63 H;  2ZTE A;  4JCV E;  2JSO A;  2NTT A;  4RKB A;  1KDA A;  3PUX A;  4LFC Q;  4QQB X;  4LFB Q;  2JA7 B;  2MGS A;  4BA2 I;  2RBM A;  3BJU A;  2EYL A;  1TWA B;  4FVM A;  5C4X G;  5BN5 A;  1B53 A;  1ILP A;  1QB5 D;  4JYA L;  1YVC A;  3NBI A;  4MNO A;  1HCZ A;  1PH8 A;  3BDC A;  2JK8 A;  3K7A B;  4GS3 A;  2XSC A;  3M4P A;  5TSS A;  2V4D A;  1BR9 A;  4R4I A;  1EZ6 A;  4JI6 Q;  5J22 A;  2R7Z B;  2F0N A;  2EOT A;  3QB3 A;  4YY3 Q;  2I07 B;  1CA5 A;  5CV4 A;  3A8J E;  2EY1 A;  2JA6 G;  5D65 A;  2HIV A;  3KBX A;  1B9M A;  2RKS A;  3T56 B;  3KYH C;  2LSS A;  3PO2 G;  2D5D A;  4KMU C;  5IP7 G;  5C3X A;  3UDG A;  1I94 L;  3OWE B;  1JT8 A;  1KIX A;  1KNE A;  5CBA E;  3FP9 A;  3DXJ C;  5IOC A;  1XTD A;  5EBD A;  1LV9 A;  2K33 A;  4FF3 A;  3LNN A;  4QGU A;  2RDF A;  3N52 A;  4YCV A;  4G57 A;  4R4Q A;  1STE A;  1AW7 A;  4DK1 A;  4X66 Q;  4FXD A;  5CV8 A;  2XRS D;  2CWP A;  3CPW A;  3NBH A;  1G51 A;  3VR4 A;  1L2F A;  5IP9 H;  3D0F A;  4JI3 L;  5IGD A;  4BBS B;  1HTL D;  1SJH D;  4IPC A;  3W1B A;  4DV1 L;  2ZJQ A;  2NN6 I;  2WFW A;  3AEV A;  3RMH A;  1PXU A;  2IT1 A;  1HHV A;  2B63 B;  2KEE A;  2FHT A;  4UY8 C;  2K05 A;  1STG A;  2EXZ A;  3PF4 A;  3H91 A;  4L5S A;  2Y0S E;  1WJJ A;  4QUF A;  1B9N A;  1KLU D;  1FNW A;  3EQL C;  3UI2 A;  1HUM A;  1BCP B;  2QEX A;  4BA1 I;  2UUC L;  4K6D A;  1STY A;  3E3X A;  3TP5 A;  2BCO A;  2M9V A;  4B3M L;  5COR A;  4IN3 A;  1WTO A;  4XYO A;  5IYD H;  1CSQ A;  1LT5 D;  4B08 A;  1EL0 A;  5C5M A;  2B2U A;  4R8I A;  1I3Q B;  3MXP A;  4N9T A;  2JEB I;  4DNT B;  4S3S A;  1K8A C;  2A6H D;  3GO5 A;  3BVM A;  4IUR A;  1L1O A;  2F0U A;  4JI1 Q;  3E0E A;  1QVC A;  1QIL A;  1T9H A;  2O2L D;  3M7G A;  4R9W A;  2UXC Q;  1VF5 C;  1K0S A;  4P71 A;  1KHI A;  1T5E A;  4OIK A;  1JCK B;  2X6L A;  3GTP H;  3H15 A;  2YYZ A;  5FJ8 H;  4U67 3;  2L55 A;  1KQS A;  1B4O A;  1N36 L;  3Q0A A;  3I91 A;  4JW0 A;  2MUY A;  1XNR L;  1RD9 D;  3I4M B;  5I9P A;  2K7V A;  4DUZ Q;  4C2M H;  1TWH H;  1X56 A;  1K0R A;  4BY1 H;  2A6H C;  5IGC A;  3MZ5 A;  2JA6 H;  1YJ9 A;  3HOV G;  2YTY A;  3W1G A;  4BY7 G;  1VQL A;  1ZYR C;  4X64 Q;  1WVL A;  4OHJ A;  2HDL A;  1Y8P B;  1MI2 A;  2QW7 A;  2XWB B;  2C9O A;  3ERS X;  5IT9 L;  3R3O A;  4YWM A;  1VQH A;  2EY2 A;  3ZJY C;  4RG1 A;  5JJL A;  2RF4 A;  1FGB D;  3S14 B;  1K8O A;  1S5F D;  3OWF A;  3CF5 A;  5ELB A;  3M3Y B;  4A3B B;  4ZKC B;  4DV4 L;  4YIJ A;  4IZ8 A;  5DM6 3;  4HIM A;  3K0Y A;  1QG7 A;  1B2T A;  1VQF A;  3A54 A;  2JA8 G;  4DA2 A;  2Z6K A;  2Q2T A;  4K5V A;  4DV7 Q;  2QA4 A;  1ZKO A;  1Y1W G;  2WAQ B;  5KRU A;  5FO8 B;  4JV5 Q;  5LHY 1;  3HOU B;  1AEX A;  2EE1 A;  3S2D B;  4DAY A;  2UXB L;  2D2C C;  2NVY H;  3L7Z C;  3S15 H;  1PTO H;  4ZLT F;  1M1K C;  4HMI A;  2XTI A;  4K8I A;  4BBR B;  3T1Y Q;  4ZAI A;  1YNJ D;  3ND9 A;  2AKW B;  2R7F A;  1D1K A;  5DEH A;  1IKL A;  3BZD B;  3HP3 A;  3VYT A;  4O1N A;  4YCW A;  1E3P A;  1HNW L;  4NPS A;  1NY4 A;  1PZJ D;  4ZUJ A;  3D3R A;  2F3I A;  2LXK A;  1PV4 A;  2IY5 B;  5DAU A;  3DEO A;  5K5P A;  2F4V Q;  2KVM A;  4ID6 A;  4KKT A;  4IUP A;  4EQP A;  3DMU A;  2WB1 B;  1NMF A;  1PFS A;  3CRK C;  2MO1 A;  3HFZ B;  1EIF A;  5FLM G;  1RHP A;  1CUK A;  5C0X I;  1B44 D;  4C56 C;  1YNJ C;  3MA2 B;  1UNS A;  1YJN A;  1A63 A;  3GTM H;  3MC0 B;  5KIX A;  1WTH A;  4M8A A;  4FXG C;  3GTJ H;  2OTJ A;  2H5X A;  4HSV A;  2KCT A;  3CCQ A;  5AJ3 L;  4LF9 L;  2V1C C;  3KF8 A;  2PZU A;  1YHA A;  1TY0 A;  3HEJ A;  1XMQ Q;  2E2H H;  5G3L F;  4JI0 Q;  2A6E C;  3TP8 A;  2K14 A;  4GN5 A;  5M3F H;  4JVZ A;  1EZ8 A;  4X3U A;  3OTO L;  3UE0 A;  1UE7 A;  4JI5 L;  4A93 B;  1AE3 A;  3I55 A;  1I4X A;  4K0K L;  5EKI A;  4I65 A;  1IKM A;  1NR2 A;  4BY7 H;  3I70 A;  1K3R A;  1UE5 A;  1EYA A;  1SN8 A;  3GDE A;  3GTG H;  3K5O A;  5I4D A;  1ET9 A;  3HOY B;  2ASB A;  3S15 B;  1PTO B;  5EAY A;  4Y7N B;  1HR0 W;  1PFN A;  4A3M G;  1TKW B;  1STH A;  5JEA H;  2LFN A;  3BS1 A;  4XQN A;  3FPU B;  4EQ5 A;  1WCM H;  2VNU D;  4EQN A;  4LW1 A;  1WTX A;  3DM3 A;  3M4O B;  5IGB A;  4XT1 B;  5M5Y H;  3U9O A;  3HOZ B;  3CC2 A;  1N33 L;  1H9J A;  1Q81 C;  3K58 A;  1L1O B;  1TII D;  3TQY A;  2VL6 A;  2QDL A;  1G29 1;  5ISR A;  1XWE A;  1CT1 D;  4QL5 A;  1IBL L;  3UE1 A;  3HS0 C;  4B3R Q;  4NXN L;  4WOR A;  1YI2 A;  4GKJ L;  1K73 C;  4MTK A;  3STB D;  3IFT A;  3T53 B;  1VQ8 A;  2A74 C;  3HOW B;  2SOB A;  1NNX A;  3J7A F;  3NQT A;  4LF4 Q;  4XTC S;  1E24 A;  1NAP A;  4DR3 L;  1LTL A;  1XMO Q;  1SRO A;  2NVT B;  1JWS D;  2JP1 A;  3M85 A;  2JA5 B;  2DJF C;  2I5H A;  3KLR A;  5BR8 Q;  1GUG A;  4CKE A;  5M3F B;  4A3E H;  1SNP A;  1STN A;  2N49 A;  4OON A;  2JYO A;  2KA7 A;  3T16 A;  5JPM C;  5IYB G;  1QUQ A;  2RCN A;  4ULL A;  3STB C;  3J7Z C;  3B6Y A;  4HJ7 A;  3GTK B;  2YU9 H;  3TSS A;  1PHJ A;  5IYC G;  1IBK L;  5BN4 A;  4PV1 C;  2ZM6 Q;  1EFW A;  1HNZ L;  4M1U B;  4TQU S;  1F2Z A;  2PO4 A;  4A3D B;  3KLS X;  3PF5 A;  1Y14 B;  2NN6 H;  4AH6 A;  4HCS A;  4APV A;  4GNX C;  3Q23 A;  1EYG A;  2MQH A;  3ULL A;  3OMC A;  4O42 A;  1PRT D;  2Z6B A;  3SE0 A;  5M5Y B;  1PZI D;  3RN5 A;  1E2Z A;  1PH6 A;  1SDF A;  1UEB A;  5I6Y A;  2EDG A;  1BBW A;  2E2I H;  4YWL A;  4DAY B;  3TS0 A;  1VQ4 A;  4QIW E;  1A3V A;  2RCF A;  4A3G G;  1HRJ A;  5GRO A;  2F0W A;  3CCU A;  1N34 L;  4HJ8 A;  4RGM A;  2F0T A;  5E4W C;  4POF A;  2K28 A;  3QIA A;  3X3M A;  1JE4 A;  4A3M H;  5FLX L;  4IO9 A;  2A68 D;  1LT3 D;  3CQZ H;  2WKD A;  5IT9 E;  1YHB A;  1O7Z A;  2I46 A;  4GLV B;  1RCV D;  4BXX G;  4KJN A;  4A3J H;  5C4H A;  4NDX A;  1B8A A;  3CKI B;  3MXN A;  1K28 A;  5D14 A;  1MKH A;  1EY8 A;  1CM9 A;  1FL0 A;  2OQ0 A;  1LTA D;  4GOP C;  2E74 C;  2R7Z G;  4AIM A;  2OQK A;  2K5N A;  3PUY A;  1LTT D;  1QCB D;  1SXT A;  4GLA C;  3M9B A;  5J3B A;  2UU9 L;  1GJX A;  4UP8 A;  5JJZ A;  1M90 C;  3URY A;  2WAC A;  3MXG A;  2AQ2 B;  1F9S A;  3EIV A;  1NUC A;  2A68 C;  3GV3 A;  2KEC A;  1FR3 A;  2E5L Q;  2B39 A;  4I7Z C;  2LMC B;  4WRD A;  2E2J H;  1TXY A;  1STA A;  2K50 A;  3D4D A;  3K59 A;  4DR4 Q;  4WJ4 A;  3AQQ A;  2K75 A;  1HR0 L;  4L5R C;  5GAE C;  1XXG A;  3Q24 A;  2BH2 A;  2WIN B;  3AFQ A;  2L9H A;  5ELO A;  3S1N H;  5IWA L;  1DOK A;  2F0E A;  1D7Q A;  4HAE A;  5DNF A;  3RR5 A;  2G9H D;  1JJC B;  2PI2 A;  3NTH A;  1EU4 A;  3RLO A;  3W5O A;  4OX9 Q;  4B9X A;  4J15 A;  3RZO H;  3OW7 A;  4P73 A;  3U9S A;  5K36 H;  5LMN Q;  1Y1V H;  1QZG A;  4ABN A;  3IFD A;  1IHZ A;  4A3K H;  4KLK A;  3TBI B;  4FYD A;  4HED A;  3T51 B;  5H1S E;  4OWT B;  5C3E G;  5IYC H;  2LY7 A;  3VYR A;  3CQZ B;  5D3D A;  1SMY D;  3TS2 A;  1T5X D;  3KF6 A;  4DR7 L;  1VQN A;  1RF2 D;  5JEA J;  1AZQ A;  2FIN B;  1JJG A;  1VQJ A;  1B3A A;  1P8L A;  1SYE A;  2HCC A;  5C44 H;  1I6H H;  4DV6 L;  2EYO A;  4CBV A;  4OWX B;  2SNM A;  4O2D A;  4C3J H;  1E7Z A;  1ENF A;  4DKA C;  2HT1 A;  2DGY A;  3RD4 A;  1EIG A;  4DV3 L;  1MHW C;  1F77 A;  1VMC A;  4LUZ A;  4DUY Q;  4GKK Q;  2QGQ A;  2XGT A;  3R93 A;  2DNC A;  3LX0 A;  3W2D A;  2P5Z X;  3K57 A;  4N9P A;  2NVX B;  3J7Y W;  4B3T L;  1LYL A;  2E2J B;  1H9S A;  1CA6 A;  4CDE C;  2ZJR A;  1TWF H;  1C4Q A;  2R7D A;  4PNY A;  1KRT A;  2A69 D;  3V2T A;  3CC7 A;  1U4M A;  3SK8 A;  1EOT A;  4DR1 Q;  1BCP F;  2ZJP A;  3S1N B;  5GAG C;  5CGK A;  4POG A;  3RLN A;  3H94 A;  4X62 Q;  5C0X H;  1QNK A;  4IUN A;  4PG3 A;  4LFA Q;  1GXD C;  3S2H B;  2BA1 A;  1PYB A;  3I4M G;  1Q1B A;  3K5N A;  1SYC A;  1GUS A;  4IOA A;  3W3A A;  1SE4 A;  4LUV A;  1Y1V B;  3K6O A;  4A3K B;  3ONA B;  3WOE A;  1SEB D;  4OL7 A;  1D5M C;  2KOL A;  2VQF L;  1GUT A;  2DJG C;  1HXY D;  4OEM B;  3HKZ E;  2A69 C;  2MNA A;  1ENC A;  5IE8 A;  1YIJ A;  1ZXT A;  1G91 A;  1QVG A;  4IJL A;  4DR2 Q;  1WFQ A;  5C4J H;  3I56 A;  5C4Z A;  4A3B G;  1W3S A;  4DGZ A;  1TT2 A;  1IXR A;  1PFM A;  2VQE L;  1JC7 A;  5IY0 A;  4HJ5 A;  2OT2 A;  1YZ6 A;  1EWH A;  1HNX L;  1BKB A;  3BDL A;  2D9U A;  3A7A B;  5LL6 S;  3GTL B;  1I4H A;  4JBM A;  3T1H L;  1ENA A;  2XNA C;  3TEH B;  4K5X A;  1SYB A;  3HOU G;  1X3Q A;  4LFC L;  2M2L A;  1GUN A;  2K4K A;  4LFB L;  1LAB A;  1QE6 A;  4RAU C;  5M9O A;  3MTS A;  4K5W A;  1DCZ A;  3HOX G;  1NMG A;  4C3I H;  3RZD H;  4BBR G;  1HZA A;  4ME5 A;  2NTS A;  1EU3 A;  2RHQ B;  2F0V A;  1S5D D;  3MXN B;  1GUO A;  3NEM A;  4KY6 A;  4UDU C;  2MPM A;  1FD7 D;  5CBE E;  4JI6 L;  5COY A;  4YY3 L;  2IL8 A;  3S1M H;  3HG9 A;  1MBY A;  2RA4 A;  2R92 G;  3FKI G;  2F03 A;  2C35 B;  1BNZ A;  1RKN A;  4GN3 B;  1WTW A;  1O80 A;  4UP9 A;  5EQ0 A;  4C3H B;  3K5L A;  2R93 G;  1OXV A;  4UHV A;  2Y0S B;  4HSP A;  2BH8 A;  4C1N K;  2IX1 A;  1SNO A;  4CJ1 B;  1EWC A;  4L5T A;  3J81 c;  3S16 H;  4HJ9 A;  2KBN A;  1JOK A;  2L4N A;  3U4V A;  5JVH 3;  5FLX E;  3S1R H;  2AUK A;  4LF6 Q;  1VQG A;  1M4V A;  4DR6 Q;  2E2D C;  5FK9 C;  1A3T A;  1R9T H;  1EIY B;  2GVB A;  5JPN C;  1JWU D;  1S5B D;  5AFW A;  4Y52 H;  3VYS A;  2BDO A;  2Z1C A;  4A3L G;  2A1A A;  3G71 A;  3PUZ A;  1ML0 D;  3QOJ A;  3A5U A;  1JOO A;  2ES2 A;  5JAV A;  2D62 A;  2CHB D;  3PO3 H;  1PFB A;  1CKN A;  4A93 G;  2HCI A;  4MN3 A;  5J1Z A;  1Q7Y C;  2PNH A;  2SEB D;  4HJA A;  1B7Y B;  2R3Z A;  2CWA A;  4MZ9 A;  2KQ3 A;  3HOY G;  5A35 A;  2PI2 E;  3RZD B;  3BYT B;  4GNX A;  1TS4 A;  3IRB A;  4ZKB B;  2EJG C;  4KD3 A;  3MXU A;  4JG2 A;  4UAI A;  1KDB A;  3JAM c;  2PPB C;  5EPK A;  1S3O A;  2ID0 A;  3P75 A;  1SE8 A;  1ICW A;  3J80 c;  4P74 A;  2WKC A;  1CZG A;  1ZYR D;  5IGG A;  2UUA L;  3HOZ G;  4KHP L;  1U5K A;  5C4X H;  4KK7 A;  1PH7 A;  3DHQ A;  3QWN A;  3OPO A;  1Y8O B;  4JI1 L;  2PQA B;  1PH4 A;  1V1P A;  2CCZ A;  1OXS C;  1X3F A;  1SSO A;  3L0O A;  3H3V C;  1GUW A;  2B2V C;  2UXC L;  3ERQ A;  1H9S B;  4F7X A;  4JBJ A;  3VR2 A;  1HFN A;  3MHB A;  3HOX H;  1PTO F;  2N8N A;  5L37 A;  3CCR A;  1VQB A;  4NKL A;  1K9M C;  2A73 B;  3QOL A;  1Z9F A;  1BCP D;  1KRS A;  3NXW A;  5C3W A;  5LL6 X;  1CQF A;  2F0H A;  1R9T B;  3PO2 H;  4TSS A;  1SYG A;  5IP7 H;  4GOP A;  4LF5 Q;  5M3M G;  2DUD A;  4DUZ L;  1G2S A;  2JA5 G;  1I50 H;  5C0X J;  4HIO A;  1KC8 C;  1KDC A;  1KAA A;  3FKI H;  2R92 H;  3V05 A;  1B1Z A;  4L5Q A;  1PA6 A;  1J9O A;  3PO3 B;  4K6L A;  1PH5 A;  4X64 L;  3BZC A;  1H9R A;  4K2K A;  2B3G A;  1A2U A;  3KUP A;  4IFD G;  2C5C A;  3AFP A;  2X6G A;  1WTQ A;  3VA5 A;  1IZ6 A;  2F0J A;  1BCP C;  3UDX A;  3E9H A;  3BZK A;  2OF1 A;  1IYV A;  4A3D G;  3V96 A;  4X6A H;  3WDN A;  1F2M A;  1Q3L A;  1Q46 A;  1CK1 A;  4K14 A;  2L1B A;  5HY6 A;  4LNQ A;  3CAM A;  1I6V C;  1L0Y B;  5CV6 A;  5M5W H;  3GTP B;  4JV5 L;  3KFU A;  1BVS A;  2KCC A;  1RTO A;  2JA9 A;  2X69 A;  5BN3 A;  1VQ6 A;  2OEO A;  4DR5 Q;  2K32 A;  4K8J A;  1EYD A;  2N3S A;  4FP5 D;  3QR8 A;  4LUO A;  1TWG H;  2F0Q A;  2N78 A;  3T1Y L;  4QUC A;  1SE2 A;  3A74 A;  1TWH B;  4C2M B;  1U4R A;  1NBW A;  4BY1 B;  4MIU A;  3MWY W;  2A6E D;  2WII B;  3K5M A;  2JA6 B;  2NBF A;  5KND A;  1AZP A;  3S9W A;  1BBX C;  1QZH A;  2RHS B;  4JI8 Q;  2VB2 X;  3ULJ A;  4DXF A;  4RFB A;  1I50 B;  2F4V L;  3MEH A;  3RLF A;  3F1Z A;  3D31 A;  4IJH A;  3NBH B;  4F88 A;  1CKM A;  3I3C A;  4FDB A;  1X3G A;  1J5E L;  2ZXR A;  5EJW A;  3RNU A;  3I4O A;  1C9O A;  1Q86 C;  3H09 A;  3BVZ A;  1F2Y A;  3H3V I;  3S1Q H;  4YWK A;  5IGE A;  4LF9 Q;  1ILQ A;  1XPO A;  3AMU A;  4FO2 A;  4X65 Q;  1OO9 B;  4LF7 Q;  4GLX A;  5GAH C;  4LK1 C;  3K80 C;  3TZD A;  4H02 A;  4ZCK A;  4PZ8 A;  4DV2 Q;  3O13 A;  3LWU A;  1S40 A;  1N32 Q;  4IUV A;  4IQZ A;  5KGU A;  2NVQ H;  1UWV A;  3HOV H;  2BOS A;  1PYW D;  2WP8 J;  4OWW B;  4A3I G;  2A5H A;  1TWC H;  2RSN A;  1D6E C;  1Q1E A;  2RQX A;  4JI0 L;  4JI4 Q;  2NVY B;  1UUP A;  2EYJ A;  1WTP A;  1A6X A;  1OXX K;  4NXM Q;  3E0J A;  2MO0 A;  3PV0 A;  2XWJ B;  3LWE A;  3TP6 A;  2ZT9 C;  3IKJ A;  5M5W B;  4KN4 C;  3PIO 3;  3ER0 A;  3FHW A;  1DGS A;  1EY0 A;  2QEJ C;  4XYQ A;  4X3K A;  2JA8 H;  5I6W A;  4N8F A;  2NZO A;  1LLR D;  4LMQ D;  3U4Z A;  1DXM A;  4KN7 C;  1ESF A;  1JE5 A;  1OXT A;  2F0S A;  5T1G A;  1Y1W H;  2VZA A;  3H0G G;  4FF2 A;  3PIP 3;  2WV6 D;  1V1Q A;  1A62 A;  1TS5 A;  3SVM A;  2D0O A;  4LAA A;  1EOV A;  2VB3 X;  3PUV A;  3GV6 A;  1S5C D;  3GTM B;  3X3N A;  4BWG B;  2MFI A;  4JI2 Q;  4GKJ Q;  2IHE A;  2VUM G;  2YTX A;  3GTJ B;  2F52 A;  3NSW A;  1ROD A;  4JI7 L;  5EBC A;  3Q22 A;  4B3R L;  5CC4 A;  1CTM A;  4XDX A;  1VQI A;  1BF4 A;  1PRT B;  3KDF A;  2UUB Q;  4DK3 C;  1LO5 D;  3NPP A;  2R6G A;  3LGJ A;  2NB0 A;  2E2H B;  2ZXP A;  2Z8L A;  3NE5 B;  4RGO S;  3HKS A;  4PMW A;  4AYB G;  5KYI A;  1U0L A;  4IUQ A;  4GOP B;  4DF7 A;  4LF4 L;  3OSO A;  4A3C G;  2NVQ B;  2JXM B;  3DWP A;  3QO2 A;  5FLM H;  3R8B A;  4BY7 B;  1K3B C;  2QDB A;  5CR3 A;  3GTG B;  5BR8 L;  4QIW B;  1IW7 C;  5E3F A;  4DAM A;  2EJM A;  4KY5 A;  1HH2 P;  1HTP A;  1HPC A;  1I4R A;  1HQR D;  5ELN A;  4A3F G;  3JC6 6;  4A4I A;  1FYC A;  2Q8T A;  1SYD A;  2PYK A;  4DNR B;  2LS0 1;  1WCM B;  1V43 A;  2Z4I A;  2VW9 A;  1SND A;  3T4A C;  3I4N G;  4N8X 1;  1X3P A;  4TVA B;  1DM0 B;  1KAW A;  2VY3 A;  1O7Y A;  2CVR A;  1GM5 A;  2PMZ E;  5CV9 A;  2NYZ D;  4KJO A;  1J8I A;  2HDM A;  5IOD A;  2IHF A;  4IUU A;  4DV5 Q;  1Y1W B;  1KLG D;  1SR3 A;  3ULP A;  5HUR A;  1SNC A;  1NSN S;  3CCS A;  1EUJ A;  1BXT A;  1I5F A;  2XRQ D;  1Z6H A;  3FDT A;  4WFN 3;  4NP5 A;  4XXE A;  1Q12 A;  4OO1 G;  2JA7 G;  4QJF A;  1L1O C;  3GP7 A;  4H7B A;  2E75 C;  4OXP A;  3K0X A;  2L12 A;  2E8G A;  3NQI A;  1CKO A;  1QNU A;  2HQL A;  4MTN A;  4YHH Q;  1D8L A;  1DOM A;  5E7N A;  4B3S L;  1X54 A;  4OIJ A;  1RIP A;  1JB3 A;  4A3E B;  3I72 A;  2DY8 A;  4LJZ C;  1P16 A;  1LTR D;  5A2Q L;  3S17 H;  1C7Y A;  5LMU L;  1E2V A;  1I4Q A;  1H95 A;  4XQQ A;  1HUN A;  3FRP B;  2YU9 B;  1Y8N B;  2F0F A;  4G4K A;  2EZV A;  1G6P A;  5M5X H;  3P1H A;  3KF8 B;  4HCE A;  4OEL B;  1AN8 A;  1LUZ A;  2B2V A;  3G6J B;  4G7O C;  2EVB A;  2MHV A;  3I90 A;  2LXJ A;  3U50 C;  3CXC A;  1X3E A;  2E5L L;  2JE6 I;  1BBU A;  3I4L A;  3GTO H;  5EPJ A;  5G3L D;  2NWG A;  1VQA A;  5IWA Q;  2N55 A;  4FF4 A;  3NEL A;  1GHJ A;  4DR4 L;  1SNM A;  1DZ1 A;  1U4L A;  4BBS G;  3NUC A;  4DU9 A;  2E2I B;  3A5Z B;  1KAB A;  1Q90 A;  2B2Y C;  1TVX A;  5IYB H;  5EKL A;  4PMB A;  1IBM Q;  2B63 G;  3TDQ A;  2ZTC A;  1BQQ T;  1R4P B;  1UE1 A;  2CW0 C;  2DN8 A;  4OX9 L;  4A3M B;  2JEA I;  1JQY D;  3M7N A;  2JN4 A;  5LMN L;  3GTQ H;  2IW3 A;  1XNQ Q;  4DK6 C;  4KY7 A;  1OTC A;  2CFM A;  2L11 A;  4A3J B;  5GAD C;  1XTC D;  1FJG L;  3SK6 A;  4GZY C;  3CC4 A;  1PH3 A;  3OYY A;  3I8Z A;  3A8K E;  1KXL A;  4DV6 Q;  1QVF A;  3TRZ A;  1TY2 A;  3A0J A;  3OW2 A;  4KTA A;  2DY7 A;  2I0Q A;  2EXD A;  4AQY Q;  5I2X A;  4A3G H;  1J6Q A;  3FMC A;  1QOH A;  1WOC A;  3S17 B;  2Q2H A;  3KJO A;  3I2Z A;  4DV3 Q;  3E9I A;  1LTS D;  2RVL A;  3GQB A;  3NHH A;  1EQV A;  1TWA H;  1PZK D;  2G9D A;  4BXX H;  2HHH L;  4B3T Q;  4DUY L;  4GKK L;  1HZC A;  1VQP A;  3HKZ B;  1HA5 A;  3D4R A;  4CGY B;  2K1B A;  2PW5 A;  2EPB A;  3NWT A;  1M8A A;  5IP9 G;  2IWH A;  4R4T A;  3D8G A;  2KUM A;  2IX3 A;  1Y69 U;  2R7Z H;  4CJ2 C;  1QUQ B;  1SE3 A;  3VDY A;  4EGV A;  1R4Q B;  3OIP A;  4FNF A;  3RZO B;  3L3O C;  4KI0 A;  3CCL A;  4DR1 L;  5IT9 c;  3SHL A;  1E0B A;  3K8A A;  3NK9 A;  2PCF B;  4X62 L;  2PW7 A;  4CKC A;  3MFY A;  1EY4 A;  3H3V H;  2SNS A;  3OHX C;  2UXD L;  5E1F A;  3PCO B;  2KHI A;  3KK7 A;  1XYI A;  1AP0 A;  3RUZ A;  2K5Q A;  1NE3 A;  2OTL A;  2BA0 A;  3GTQ B;  2F0O A;  4ME3 A;  3NTI A;  4EX5 A;  4DAV A;  1EY6 A;  4DN4 M;  1KD1 C;  1PYS B;  4DV0 Q;  2YTV A;  1JOQ A;  5C44 B;  4IFD I;  4LF8 L;  1I6H B;  1BDO A;  2FXQ A;  3FEW X;  4H13 C;  2B8F A;  3F2B A;  4MHE A;  1NJI C;  4KKU A;  3EN2 A;  4OGQ C;  1C48 A;  4RH6 A;  2AQ3 B;  4C3J B;  2VQE Q;  1YNN C;  3GD7 A;  4DR2 L;  3TZU A;  4KV6 A;  2ICI A;  4TRD A;  1HNX Q;  4JK1 C;  2AWN A;  3DEP A;  2WAQ G;  4A3G B;  1G8Z D;  1VQE A;  5FO9 B;  1YHQ A;  3OIQ A;  4JYA Q;  4P72 A;  4QMG A;  4YCU A;  5JVG 3;  4ALP A;  3CCE A;  4Z9C B;  4U68 A;  2QF7 A;  2GN5 A;  1Q8I A;  1B70 B;  5C3E H;  1XPU A;  3UDI A;  3R2T A;  1JR0 D;  1II3 A;  4QY7 A;  3PMF A;  4RMF A;  4CJ0 B;  1TWF B;  2OCE A;  2L15 A;  1ICF B;  1HFG A;  1EEF D;  2G5D A;  1SJE D;  5FJ8 G;  1TQO A;  4EVO A;  2NZ1 D;  1YEZ A;  3A8I E;  5J39 A;  1WTV A;  2TSS A;  2PZW A;  5ELF A;  1PH2 A;  1TR5 A;  1I94 Q;  3DM1 A;  3F2D A;  3J7A 5;  1GO3 E;  2K5V A;  1FNU A;  4BY1 G;  1I3Q H;  2F0K A;  2PZT A;  2F1M A;  3JAM i;  3QG1 A;  2GVA A;  2WB1 G;  2Z9H A;  1HZ9 A;  3J80 i;  4WJ3 M;  2F3V A;  5E4X A;  1ASZ A;  4O0A A;  1I4G A;  1D1I A; 
#chains in the Genus database with same CATH homology
 5C5L A;  3SK5 A;  4X3T A;  2R61 A;  4HR7 B;  5C4J B;  3AB9 A;  2B2T C;  1SAP A;  5I9O A;  4RGT A;  1EY7 A;  3VR3 A;  3VR5 A;  1D5X C;  4DAP A;  4ILW A;  2FMC A;  4NMZ A;  5A2Q E;  3E5S A;  2FJ2 A;  3C1E A;  1BO0 A;  1CZW A;  1QJO A;  2SDF A;  5C3E B;  1KTK A;  1NCV A;  1MSG A;  4C3I B;  1EY9 A;  2KCN A;  1GOZ A;  4FXK C;  1DYQ A;  1JWM D;  1D5Z C;  1IYU A;  2L0C A;  3S1M B;  1SYF A;  1RJT A;  2F0I A;  2ICE C;  3C3L A;  1A2T A;  2N88 A;  1Z47 A;  2QIL A;  4HMJ A;  2KJX A;  4ZRZ A;  3S16 B;  1ESR A;  2RDH A;  5EKK A;  2KED A;  1WD0 A;  3S1R B;  2LKV A;  4RHS A;  4F8M A;  1EQT A;  3SDZ A;  2AUJ D;  2DNE A;  4J1M A;  4KKS A;  4KHZ A;  1K83 B;  3IAY A;  1CHQ D;  3DUZ A;  3OOC A;  1O7L A;  5D3I B;  5F2D A;  2J4X A;  1MD2 D;  1K8M A;  1STB A;  1OXU A;  5KNB A;  3MVV A;  1U9R A;  2F4I A;  1X32 A;  3BVG A;  1H9M A;  5EGT A;  2HUG A;  3DWQ A;  3CU7 A;  5JEA G;  4V19 0;  1HQM C;  2FFK B;  1EFI D;  4CHT B;  4L6T B;  1HA6 A;  4ZYS A;  4ODG A;  1PRT F;  2B2Y A;  3D4W A;  1VCI A;  1VMP A;  5C4X B;  1CFM A;  3T13 A;  2J7Z A;  5JOB A;  4L63 B;  2Z4H A;  3A56 A;  2TMP A;  2IJ0 A;  5EPL A;  4ZQ3 A;  1SNQ A;  2F0M A;  4OO1 I;  2EJF C;  1TS2 A;  1DON A;  3HOX B;  2M00 A;  2QKI C;  5T1I A;  5CMD A;  3NTK A;  1F2L A;  3EVQ A;  2PNR C;  1IL8 A;  4J6H A;  3PO2 B;  5CV7 A;  4NW2 A;  2E76 C;  4HN7 A;  1UAP A;  1ZEQ X;  2IPK D;  2IX0 A;  2R92 B;  3FKI B;  3DWA A;  1CHP D;  2R93 B;  2EYH A;  1EIH A;  2EY6 A;  2AQ1 B;  1NR4 A;  1PLF A;  4PMC A;  3HRZ C;  1G6Z A;  1G2T A;  2B2W C;  3J81 L;  2NN6 G;  4Q5V A;  1S4Z A;  4TKO B;  1PDQ A;  1KNA A;  1LTG D;  5FOB B;  3KLS A;  2QCP X;  1Z7T A;  2K6A A;  1VDZ A;  5KYL A;  5IGF A;  4G7Z C;  2Q8I B;  4H44 C;  2FMM A;  5HGT A;  1H9K A;  4XIG S;  2XIW A;  1TWG B;  4IFD H;  2K5W A;  5FKA C;  3F2U A;  4JBW A;  1W6J A;  3TP7 A;  3BDO A;  3EFX D;  5CYU A;  2EYM A;  1SBB B;  2B8G A;  3P20 A;  4B9W A;  2NUC A;  3Q6S A;  1V1P B;  1EY5 A;  1IW7 D;  3JAM L;  5ELD A;  3J80 L;  2AWO A;  2MJ8 A;  4ZUI A;  1JOR A;  4IUT A;  4KHV A;  2ENB A;  2K5D A;  4G7H C;  5ELC A;  3S1Q B;  3VA7 A;  1PTO D;  2RSO A;  3MAQ A;  1U4P A;  3BG3 A;  2H1E A;  3VR6 A;  3HOV B;  2PMZ B;  5C6A A;  3ITP A;  1TWC B;  3A55 A;  1S5E D;  4IAL A;  1UEA B;  3R2I A;  5M3M B;  1CQV A;  2PQE A;  1C8C A;  3FVQ A;  4P2C B;  3G7L A;  1V1O A;  2XN9 C;  5K36 G;  2BE5 D;  4RKL A;  5NUC A;  1PTO C;  3EA6 A;  2JA8 B;  1F9Q A;  1TU2 B;  3H6M A;  4KD4 A;  3I73 A;  3IL8 A;  5I2Y A;  2CQA A;  4DFA A;  2B2T A;  4XQJ A;  4HTH A;  2HQE A;  1RDP D;  2B2U C;  3D6W A;  4E6I A;  4R8N A;  3NP8 A;  4FF1 A;  3HGB A;  4RWS C;  2BE5 C;  4C3J G;  4L8J A;  5ELE A;  2GA4 B;  3VYU A;  3SEB A;  1A15 A;  1LTB D;  2H4O A;  2ZXO A;  3QJY A;  2EYP A;  3SR1 A;  3SXH A;  3C1F A;  3NWS A;  4DXG A;  4Q0F A;  3PUW A;  2K04 A;  2EYF A;  1PRT C;  1MGS A;  4F87 A;  2F3W A;  4C1N I;  4J8Q A;  3C2P A;  1LTI D;  5C0X G;  2O5J C;  2CW0 D;  3HZX A;  5FO7 B;  2K01 A;  1EYC A;  4C3H G;  4CKB A;  1V8Q A;  1FNV A;  1F9P A;  1JIC A;  1B50 A;  1W6K A;  5DM7 3;  3E6Z X;  1WTR A;  5CV5 A;  4BS9 A;  3FPP A;  1AFP A;  4QCL A;  3WOF A;  5IIF A;  1L0X B;  1LT6 D;  3CRL C;  1SFO B;  3TN2 A;  3C46 A;  4A3I B;  1DJR D;  5KNC A;  5KEE A;  4K2L A;  4H0L C;  3MFG A;  1RTN A;  3M4Y A;  2RDG A;  2F0G A;  1CI3 M;  2L5T A;  2VXW A;  3OMG A;  4PQX A;  1O78 A;  3KBG A;  1QWY A;  4RA8 A;  1F9R A;  4IFD J;  2F0D A;  2KHS A;  4C3I G;  3H0G B;  1WD1 A;  4XT3 B;  1BUV T;  2MP1 A;  1PMR A;  3EJI A;  3N6R A;  4QB4 A;  3J81 E;  1ONL A;  2EY5 A;  3TME A;  1GHK A;  3J7A V;  2J0T D;  4OO1 H;  1VF7 A;  4ZK9 B;  5M5X B;  2VUM B;  2O4X A;  3D6C A;  2F0L A;  3ZYY X;  1TS3 A;  2K03 A;  3BYY B;  4DK0 A;  3GTO B;  1SMY C;  4EQO A;  4AYB B;  1I4P A;  4QF4 A;  4WJW A;  4RCN A;  3CHB D;  3P7J A;  1XX8 A;  1YNN D;  3ERO A;  3ND8 A;  3SK4 A;  1D2B A;  4RHR A;  4RCO A;  4RGN A;  4V0B A;  1LAC A;  2XVS A;  2Q8R E;  1BOS A;  2F0P A;  2BDN A;  1A3U A;  4A3F B;  4X3S A;  3L9A X;  2OXP A;  1LT4 D;  3JAM E;  1DOL A;  3AU7 A;  3J80 E;  3I4N B;  3A7L A;  2B2W A;  1EEI D;  2O5I C;  1MSH A;  1ET6 A;  1E2W A;  1DD2 A;  2JSO A;  2NTT A;  4RKB A;  1KDA A;  3PUX A;  2JA7 B;  2MGS A;  4BA2 I;  2RBM A;  2EYL A;  1TWA B;  4FVM A;  5BN5 A;  1B53 A;  1ILP A;  1QB5 D;  3NBI A;  1HCZ A;  3BDC A;  3K7A B;  2XSC A;  5TSS A;  2V4D A;  1BR9 A;  1EZ6 A;  5J22 A;  2R7Z B;  2F0N A;  2EOT A;  3QB3 A;  2I07 B;  1CA5 A;  5CV4 A;  3A8J E;  2EY1 A;  5D65 A;  3KBX A;  1B9M A;  2RKS A;  3T56 B;  2D5D A;  4KMU C;  5C3X A;  3OWE B;  1KNE A;  5CBA E;  3DXJ C;  5IOC A;  5EBD A;  1LV9 A;  2K33 A;  4FF3 A;  3LNN A;  2RDF A;  3N52 A;  4G57 A;  1STE A;  1AW7 A;  4DK1 A;  4FXD A;  5CV8 A;  2XRS D;  3NBH A;  3VR4 A;  5IGD A;  4BBS B;  1HTL D;  1SJH D;  2NN6 I;  3RMH A;  1PXU A;  2IT1 A;  1HHV A;  2B63 B;  2KEE A;  2FHT A;  2K05 A;  1STG A;  2EXZ A;  3H91 A;  4QUF A;  1B9N A;  1KLU D;  1FNW A;  3EQL C;  3UI2 A;  1HUM A;  1BCP B;  4BA1 I;  4K6D A;  1STY A;  3TP5 A;  2BCO A;  2M9V A;  5COR A;  4IN3 A;  1WTO A;  4XYO A;  1LT5 D;  4B08 A;  1EL0 A;  5C5M A;  2B2U A;  4R8I A;  1I3Q B;  3MXP A;  4N9T A;  2JEB I;  4DNT B;  4S3S A;  2A6H D;  3GO5 A;  3BVM A;  4IUR A;  2F0U A;  1QIL A;  2O2L D;  3M7G A;  4R9W A;  1VF5 C;  1T5E A;  4OIK A;  1JCK B;  2X6L A;  2YYZ A;  4U67 3;  2L55 A;  1B4O A;  3Q0A A;  3I91 A;  2MUY A;  1RD9 D;  3I4M B;  5I9P A;  2K7V A;  2A6H C;  5IGC A;  3MZ5 A;  1ZYR C;  1WVL A;  4OHJ A;  2HDL A;  1Y8P B;  1MI2 A;  2XWB B;  2C9O A;  5IT9 L;  3R3O A;  2EY2 A;  1FGB D;  3S14 B;  1K8O A;  1S5F D;  3OWF A;  5ELB A;  3M3Y B;  4A3B B;  4ZKC B;  4YIJ A;  4IZ8 A;  5DM6 3;  3K0Y A;  1QG7 A;  1B2T A;  3A54 A;  4DA2 A;  4K5V A;  1ZKO A;  2WAQ B;  5KRU A;  5FO8 B;  5LHY 1;  3HOU B;  1AEX A;  2EE1 A;  3S2D B;  4DAY A;  2D2C C;  3L7Z C;  1PTO H;  4ZLT F;  4HMI A;  4K8I A;  4BBR B;  4ZAI A;  1YNJ D;  3ND9 A;  1D1K A;  5DEH A;  1IKL A;  3BZD B;  3HP3 A;  3VYT A;  4O1N A;  1PZJ D;  4ZUJ A;  3D3R A;  5DAU A;  3DEO A;  5K5P A;  2KVM A;  4ID6 A;  4KKT A;  4IUP A;  4EQP A;  3DMU A;  2WB1 B;  3CRK C;  1RHP A;  5C0X I;  1B44 D;  4C56 C;  1YNJ C;  3MA2 B;  1UNS A;  3MC0 B;  5KIX A;  4M8A A;  4FXG C;  4HSV A;  3KF8 A;  2PZU A;  1TY0 A;  3HEJ A;  5G3L F;  2A6E C;  3TP8 A;  1EZ8 A;  4X3U A;  4A93 B;  1I4X A;  5EKI A;  4I65 A;  1IKM A;  1NR2 A;  3I70 A;  1EYA A;  3K5O A;  5I4D A;  1ET9 A;  3HOY B;  3S15 B;  1PTO B;  4Y7N B;  1PFN A;  1TKW B;  1STH A;  5JEA H;  2LFN A;  3BS1 A;  4XQN A;  3FPU B;  2VNU D;  4EQN A;  1WTX A;  3M4O B;  5IGB A;  4XT1 B;  3U9O A;  3HOZ B;  1H9J A;  3K58 A;  1TII D;  1G29 1;  5ISR A;  1XWE A;  1CT1 D;  3HS0 C;  4WOR A;  3IFT A;  3T53 B;  2A74 C;  3HOW B;  2SOB A;  3J7A F;  3NQT A;  4XTC S;  1NAP A;  2NVT B;  1JWS D;  2JP1 A;  3M85 A;  2JA5 B;  3KLR A;  1GUG A;  4CKE A;  5M3F B;  1SNP A;  1STN A;  2JYO A;  2KA7 A;  3T16 A;  5JPM C;  4ULL A;  3GTK B;  3TSS A;  5BN4 A;  4PV1 C;  4M1U B;  4TQU S;  1F2Z A;  2PO4 A;  4A3D B;  3KLS X;  2NN6 H;  4HCS A;  3Q23 A;  3OMC A;  4O42 A;  1PRT D;  3SE0 A;  5M5Y B;  1PZI D;  1E2Z A;  1SDF A;  5I6Y A;  2EDG A;  1A3V A;  1HRJ A;  2F0W A;  4RGM A;  2F0T A;  5E4W C;  2K28 A;  3QIA A;  3X3M A;  1JE4 A;  5FLX L;  2A68 D;  1LT3 D;  2WKD A;  5IT9 E;  1O7Z A;  2I46 A;  1RCV D;  4KJN A;  5C4H A;  4NDX A;  3CKI B;  3MXN A;  5D14 A;  1EY8 A;  1CM9 A;  1LTA D;  2E74 C;  3PUY A;  1LTT D;  1QCB D;  1SXT A;  1GJX A;  5JJZ A;  3URY A;  2WAC A;  3MXG A;  2AQ2 B;  1F9S A;  1NUC A;  2A68 C;  3GV3 A;  2KEC A;  1FR3 A;  2B39 A;  4I7Z C;  2LMC B;  4WRD A;  1STA A;  3D4D A;  3K59 A;  1XXG A;  3Q24 A;  2WIN B;  2L9H A;  1DOK A;  2F0E A;  4HAE A;  5DNF A;  2G9H D;  3NTH A;  1EU4 A;  4B9X A;  3OW7 A;  3U9S A;  5K36 H;  4ABN A;  3IFD A;  1IHZ A;  3TBI B;  4FYD A;  4HED A;  3T51 B;  2LY7 A;  3VYR A;  3CQZ B;  5D3D A;  1SMY D;  1T5X D;  1RF2 D;  5JEA J;  1AZQ A;  2FIN B;  1B3A A;  1SYE A;  2HCC A;  2EYO A;  4CBV A;  2SNM A;  1ENF A;  3RD4 A;  1EIG A;  1F77 A;  1VMC A;  3R93 A;  2DNC A;  3LX0 A;  3W2D A;  3K57 A;  4N9P A;  2NVX B;  3J7Y W;  2E2J B;  1H9S A;  1CA6 A;  4PNY A;  1C4Q A;  2A69 D;  3V2T A;  1U4M A;  3SK8 A;  1EOT A;  1BCP F;  3S1N B;  5CGK A;  3H94 A;  5C0X H;  1QNK A;  4IUN A;  3S2H B;  1GXD C;  2BA1 A;  1Q1B A;  3K5N A;  1SYC A;  1GUS A;  3W3A A;  1SE4 A;  1Y1V B;  3K6O A;  4A3K B;  3ONA B;  3WOE A;  1SEB D;  4OL7 A;  1D5M C;  2KOL A;  1GUT A;  1HXY D;  2A69 C;  1ENC A;  1ZXT A;  1G91 A;  5C4Z A;  4DGZ A;  1TT2 A;  1PFM A;  1JC7 A;  2OT2 A;  1EWH A;  3BDL A;  2D9U A;  3A7A B;  5LL6 S;  3GTL B;  1I4H A;  1ENA A;  2XNA C;  4K5X A;  1SYB A;  1X3Q A;  2M2L A;  1GUN A;  1LAB A;  1QE6 A;  4RAU C;  5M9O A;  3MTS A;  4K5W A;  1DCZ A;  4ME5 A;  2NTS A;  1EU3 A;  2F0V A;  1S5D D;  1GUO A;  4KY6 A;  4UDU C;  2MPM A;  1FD7 D;  5CBE E;  5COY A;  2IL8 A;  3HG9 A;  1MBY A;  2RA4 A;  2F03 A;  1BNZ A;  1RKN A;  1WTW A;  1O80 A;  5EQ0 A;  4C3H B;  3K5L A;  1OXV A;  2Y0S B;  4HSP A;  4C1N K;  2IX1 A;  1SNO A;  4CJ1 B;  1EWC A;  1JOK A;  2L4N A;  5JVH 3;  5FLX E;  2AUK A;  1M4V A;  2E2D C;  5FK9 C;  1A3T A;  5JPN C;  1JWU D;  1S5B D;  5AFW A;  3VYS A;  2BDO A;  2Z1C A;  3PUZ A;  1ML0 D;  3QOJ A;  1JOO A;  5JAV A;  2D62 A;  2CHB D;  1PFB A;  2HCI A;  4MN3 A;  5J1Z A;  2SEB D;  2R3Z A;  2KQ3 A;  5A35 A;  3RZD B;  3BYT B;  1TS4 A;  4ZKB B;  2EJG C;  4KD3 A;  3MXU A;  4UAI A;  1KDB A;  2PPB C;  5EPK A;  2ID0 A;  3P75 A;  1ICW A;  2WKC A;  1CZG A;  1ZYR D;  5IGG A;  4KK7 A;  3DHQ A;  3QWN A;  3OPO A;  1Y8O B;  1V1P A;  1OXS C;  1SSO A;  3H3V C;  1GUW A;  2B2V C;  3ERQ A;  1H9S B;  4F7X A;  3VR2 A;  1HFN A;  3MHB A;  1PTO F;  4NKL A;  2A73 B;  3QOL A;  1BCP D;  3NXW A;  5C3W A;  5LL6 X;  1CQF A;  2F0H A;  1R9T B;  4TSS A;  1SYG A;  1G2S A;  5C0X J;  1KDC A;  1KAA A;  3V05 A;  1B1Z A;  1J9O A;  3PO3 B;  4K6L A;  1H9R A;  4K2K A;  1A2U A;  3KUP A;  4IFD G;  2C5C A;  2X6G A;  1WTQ A;  3VA5 A;  2F0J A;  1BCP C;  2OF1 A;  1IYV A;  3V96 A;  3WDN A;  1F2M A;  1Q3L A;  1CK1 A;  4K14 A;  2L1B A;  1I6V C;  1L0Y B;  5CV6 A;  3GTP B;  2KCC A;  5BN3 A;  1RTO A;  2X69 A;  2OEO A;  2K32 A;  4K8J A;  1EYD A;  4FP5 D;  2F0Q A;  4QUC A;  1SE2 A;  4C2M B;  1TWH B;  1U4R A;  4BY1 B;  4MIU A;  3MWY W;  2A6E D;  2WII B;  3K5M A;  2JA6 B;  2NBF A;  5KND A;  1AZP A;  3S9W A;  1BBX C;  2VB2 X;  4DXF A;  4RFB A;  1I50 B;  3MEH A;  3RLF A;  3D31 A;  4F88 A;  3I3C A;  2ZXR A;  5EJW A;  3H09 A;  3BVZ A;  1F2Y A;  5IGE A;  1ILQ A;  3AMU A;  4FO2 A;  1OO9 B;  4LK1 C;  3TZD A;  3O13 A;  3LWU A;  4IUV A;  4IQZ A;  5KGU A;  2BOS A;  1PYW D;  2WP8 J;  2A5H A;  2RSN A;  1D6E C;  1Q1E A;  2RQX A;  2NVY B;  1UUP A;  2EYJ A;  1WTP A;  1A6X A;  1OXX K;  3E0J A;  3PV0 A;  2XWJ B;  3LWE A;  3TP6 A;  2ZT9 C;  3IKJ A;  5M5W B;  4KN4 C;  3PIO 3;  1EY0 A;  2QEJ C;  4XYQ A;  4X3K A;  5I6W A;  1LLR D;  4LMQ D;  1DXM A;  4KN7 C;  1ESF A;  1OXT A;  2F0S A;  5T1G A;  4FF2 A;  3PIP 3;  2WV6 D;  1TS5 A;  3SVM A;  4LAA A;  2VB3 X;  3PUV A;  3GV6 A;  1S5C D;  3GTM B;  3X3N A;  4BWG B;  3GTJ B;  3NSW A;  1ROD A;  5EBC A;  3Q22 A;  5CC4 A;  1CTM A;  4XDX A;  1BF4 A;  1PRT B;  1LO5 D;  3NPP A;  2R6G A;  2NB0 A;  2E2H B;  2ZXP A;  2Z8L A;  3NE5 B;  4RGO S;  4PMW A;  5KYI A;  4IUQ A;  4DF7 A;  3OSO A;  2NVQ B;  2JXM B;  3DWP A;  3QO2 A;  3R8B A;  4BY7 B;  2QDB A;  5CR3 A;  3GTG B;  4QIW B;  1IW7 C;  5E3F A;  2EJM A;  4KY5 A;  1HTP A;  1HPC A;  1I4R A;  1HQR D;  1FYC A;  2Q8T A;  1SYD A;  2PYK A;  4DNR B;  2LS0 1;  1WCM B;  1V43 A;  2Z4I A;  1SND A;  3T4A C;  1X3P A;  1DM0 B;  1O7Y A;  2CVR A;  5CV9 A;  2NYZ D;  4KJO A;  1J8I A;  2HDM A;  5IOD A;  4IUU A;  1Y1W B;  1KLG D;  5HUR A;  1SNC A;  1NSN S;  1BXT A;  2XRQ D;  1Z6H A;  3FDT A;  4WFN 3;  4NP5 A;  4XXE A;  1Q12 A;  4OO1 G;  3GP7 A;  4H7B A;  2E75 C;  2L12 A;  3NQI A;  1QNU A;  1DOM A;  4OIJ A;  1JB3 A;  4A3E B;  3I72 A;  2DY8 A;  4LJZ C;  1LTR D;  5A2Q L;  1E2V A;  1I4Q A;  4XQQ A;  1HUN A;  3FRP B;  2YU9 B;  1Y8N B;  2F0F A;  4G4K A;  2EZV A;  3P1H A;  4HCE A;  1AN8 A;  2B2V A;  3G6J B;  4G7O C;  2EVB A;  2MHV A;  3I90 A;  2JE6 I;  3I4L A;  5EPJ A;  5G3L D;  2NWG A;  2N55 A;  4FF4 A;  1GHJ A;  1SNM A;  1DZ1 A;  1U4L A;  3NUC A;  4DU9 A;  2E2I B;  1KAB A;  1Q90 A;  2B2Y C;  1TVX A;  5EKL A;  4PMB A;  3TDQ A;  1BQQ T;  1R4P B;  2CW0 C;  2DN8 A;  2JEA I;  4A3M B;  1JQY D;  3M7N A;  2IW3 A;  4KY7 A;  2L11 A;  4A3J B;  1XTC D;  3SK6 A;  4GZY C;  3I8Z A;  3A8K E;  1TY2 A;  4KTA A;  2DY7 A;  5I2X A;  3FMC A;  1QOH A;  3S17 B;  1LTS D;  2RVL A;  3GQB A;  3NHH A;  1EQV A;  2G9D A;  1PZK D;  3HKZ B;  1HA5 A;  3D4R A;  4CGY B;  2K1B A;  2PW5 A;  2EPB A;  3NWT A;  1M8A A;  2IWH A;  1Y69 U;  3D8G A;  2KUM A;  2IX3 A;  4CJ2 C;  1SE3 A;  4EGV A;  1R4Q B;  3OIP A;  4FNF A;  3RZO B;  3L3O C;  4KI0 A;  3SHL A;  1E0B A;  3NK9 A;  2PCF B;  2PW7 A;  4CKC A;  3MFY A;  1EY4 A;  2SNS A;  3OHX C;  5E1F A;  3KK7 A;  1XYI A;  1AP0 A;  3RUZ A;  2K5Q A;  2BA0 A;  3GTQ B;  2F0O A;  3NTI A;  4DAV A;  1EY6 A;  4DN4 M;  1JOQ A;  5C44 B;  4IFD I;  1I6H B;  1BDO A;  3FEW X;  4H13 C;  2B8F A;  4MHE A;  4KKU A;  4OGQ C;  1C48 A;  4RH6 A;  2AQ3 B;  4C3J B;  1YNN C;  3GD7 A;  3TZU A;  4KV6 A;  2ICI A;  4TRD A;  4JK1 C;  2AWN A;  3DEP A;  4A3G B;  1G8Z D;  5FO9 B;  3OIQ A;  4QMG A;  5JVG 3;  4Z9C B;  4U68 A;  2QF7 A;  1Q8I A;  3R2T A;  1JR0 D;  1II3 A;  3PMF A;  4CJ0 B;  1TWF B;  1HFG A;  1EEF D;  1SJE D;  1TQO A;  4EVO A;  2NZ1 D;  3A8I E;  5J39 A;  1WTV A;  2TSS A;  2PZW A;  5ELF A;  1TR5 A;  3DM1 A;  1FNU A;  2F0K A;  2PZT A;  2F1M A;  3QG1 A;  2F3V A;  5E4X A;  1I4G A;  1D1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...