2L4NA

Solution structure of the chemokine ccl21
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of CCL21 and identification of a putative CCR7 binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords C-C motif chemokine 21
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l4nA00
3UI2A 2HCIA 1DOMA 1F2LA 2NWGA 4IUQA 5EJWA 1PLFA 5T1GA 4ZLTF 1ICWA 2KEDA 2L11A 2RA4A 3DM1A 1KNAA 1PFNA 3FDTA 1O7ZA 2EE1A 4XT3B 1KNEA 5E4WC 4CJ2C 1G6ZA 3QO2A 1CA6A 1NR2A 1RTOA 2B2UC 4ZKBB 1IKLA 1C8CA 1QG7A 1SDFA 2X6GA 3TZDA 1U4MA 5EPLA 4IUVA 5CBAE 4X3SA 3R93A 1WTWA 3TN2A 1HRJA 2X69A 1BBXC 3IL8A 1NCVA 2DY7A 3N52A 4XDXA 1F9RA 1AZQA 1WTVA 1HUNA 1WTOA 3Q6SA 2B2VC 2L9HA 2K01A 2KEEA 1TVXA 2J7ZA 5D14A 3I91A 4HCSA 1HUMA 1XYIA 2D9UA 2RSOA 3ONAB 2K04A 1ZXTA 1J9OA 2NYZD 1MSHA 2X6LA 5AFWA 4QUFA 2H1EA 2N55A 2DY8A 2FJ2A 3FPUB 4O42A 1S4ZA 1Q3LA 4MN3A 3SVMA 1O80A 5DNFA 1HFGA 2RSNA 1X3PA 5D65A 1B2TA 2K1BA 4CJ1B 4NW2A 5E4XA 1M8AA 2MP1A 3IFDA 1LV9A 1RJTA 2B2TA 1DONA 5EPKA 2HUGA 1DZ1A 1BO0A 1GUWA 2B2VA 2L4NA 1MGSA 1JE4A 4ZKCB 1AP0A 1G2SA 3MWYW 4IUPA 1SSOA 4OIJA 1HA6A 1U4LA 3KBXA 1B3AA 4QUCA 1B53A 3D6WA 1VMPA 1B50A 1PFMA 4LMQD 5EKIA 1AZPA 3KUPA 2RVLA 4RAUC 1XX8A 1VMCA 2N88A 1G91A 4X3TA 1EOTA 4ZAIA 4ZK9B 1F9QA 2HDMA 2JYOA 1IL8A 2KECA 2K28A 1WVLA 2B2WA 1X3QA 4RA8A 1NR4A 1IKMA 1U4PA 4OIKA 1U4RA 1CA5A 1WD1A 1G2TA 2Q8TA 5EPJA 3DEOA 2FHTA 1EIHA 5CBEE 2Q8RE 3I3CA 3H91A 4HEDA 4X3KA 1J8IA 1BF4A 2B2TC 1MSGA 3MTSA 1JICA 2HCCA 1MI2A 4IUTA 2CVRA 4XT1B 1F9SA 2B2YA 3DEPA 5JJZA 2JP1A 2NZ1D 4CJ0B 1A15A 1QNKA 2K03A 2EPBA 1HHVA 1RODA 2XIWA 2MJ8A 1DOLA 2L1BA 3GV6A 4R9WA 2K05A 2MPMA 5COYA 5CORA 2EOTA 1E0BA 2HDLA 1EQTA 2MGSA 3G7LA 2BDNA 1ILQA 4IURA 2B2UA 1SAPA 3LWEA 4IUUA 1QE6A 4RWSC 2KUMA 1WTRA 2M2LA 2R3ZA 1BNZA 1NAPA 1ESRA 1EIGA 1RTNA 2KVMA 1EL0A 1WTQA 2FINB 2L12A 1O7YA 4R8IA 2B2WC 1WTXA 1DOKA 3HP3A 4X3UA 2B2YC 1F9PA 5EQ0A 2KOLA 2IL8A 2SDFA 1PFBA 3I90A 1RHPA 3F2UA 5CMDA 4MHEA 1WD0A 1HFNA 3I8ZA 1ILPA 4DN4M 1WTPA 1PDQA 2FFKB 1X32A 4HSVA 3P7JA 3GV3A 4UAIA 5T1IA 4U68A 1B4OA 4HAEA 2VXWA 2FMMA 1CM9A 1ML0D
chains in the Genus database with same CATH superfamily
3NHHA 4ZCKA 1XMOQ 1K8MA 4PZ8A 5EJWA 4X65L 1WTVA 2E75C 3OTOQ 4FXKC 1R4PB 1TQOA 4EQOA 4XYQA 4DV3L 4DR4L 4X62L 3I4NG 1H9JA 1BCPB 1HZBA 1EUJA 1IXRA 4I7AA 3MXNB 4AQYL 1LACA 5EAYA 4F87A 2N78A 1YHQA 4JYAL 1GJXA 4JI1Q 3NBHA 1J9OA 1O7IA 1X9NA 5GROA 1Q3LA 3SVMA 5DNFA 2M00A 4A93B 2Q2HA 5IWAQ 2UUCQ 4MTKA 1S5FD 5K36H 5E4XA 1J5EQ 2KQ3A 5EBDA 2CH4A 5C5MA 4FNFA 3TP5A 3GTKH 3OMGA 1LO5D 1JWMD 5E7NA 1I6HH 4C3IG 4DV1L 1HA6A 5FLXE 1IBML 3ZYYX 3PO2G 1VMPA 1RIPA 1TXYA 1B50A 1V1PA 1VF5C 1AZPA 4P74A 4K0KL 3TREA 4QF4A 2L0CA 4DV1Q 1K3RA 4LF5Q 3RZOH 3SK6A 5IT9c 1TU2B 4OWXB 2K5DA 3AFQA 2CCZA 5JEAG 5C0XH 3S1MB 1V8QA 3DEOA 1DYQA 3B6YA 3J81c 4HJAA 2K50A 3R2TA 2F0TA 4IFDH 1GXDC 2PNRC 1STHA 3FKIB 1CKNB 1N8RC 2UXCL 2Z9HA 1CT1D 4YCVA 3T13A 1EWIA 3BS1A 3HGBA 2WAQG 1RTNA 1Y1VB 2EYMA 2JE6I 1F2ZA 4KHZA 1DOKA 3OTOL 4ZRZA 5GAGC 3F2DA 3BDOA 4A3KH 3I8ZA 3U4ZA 5IP7H 2K75A 3UDXA 2FFKB 2A68D 4H13C 1IBKL 3GV3A 3PUYA 1YHAA 1KD1C 1R9TB 4IJLA 4LF8Q 3GTKB 4JI4L 2EYPA 4DAYB 4N9PA 2UXDL 1E3PA 1LYLA 3K0YA 1NJIC 1QG7A 4ILWA 2K32A 1YHBA 4EQNA 1EYCA 2LKVA 2UUCL 2UXDQ 3DM3A 4RG1A 3PO3B 4HCSA 2IX0A 2O2LD 2YYZA 4DU9A 2Z4HA 1SYGA 5J1ZA 5FKAC 2JA7H 4A3DB 2A6ED 1A8VA 4DV2Q 1KLUD 1EYAA 1X3PA 1I50H 1S40A 4LF6Q 1FL0A 2IHFA 1RF2D 2Z6BA 4OL7A 2QDBA 4RCNA 1PTOB 4L5SA 2N49A 1GHKA 2OCEA 3HFZB 4DV2L 2ASBA 2NB0A 2G9DA 2TMPA 3NE5B 4QUCA 4C1NK 3BVMA 2DN8A 1D5XC 4LUOA 1PH4A 1L1OC 1JOOA 2JA7B 3NXWA 1JWUD 2EYOA 3BDLA 3PSIA 2PW5A 4B08A 3ULJA 4A3BH 5I4DA 2ES2A 4JI0L 2K28A 2WIIB 4NP5A 4A3FB 4OGQC 4ABNA 3A8IE 1WD1A 2B63B 1STAA 1IYVA 2FHTA 2Q8RE 1NTGA 2RDGA 4BY1G 3TZUA 1W6KA 3HOUH 3OWFA 5GADC 5LMUQ 4R4QA 3SDZA 2EPBA 1CFMA 3N6RA 4KJNA 3GV6A 2ZTCA 1HNZL 2WKDA 5EKKA 4JOIA 2ID0A 1VQHA 3BZKA 3NBHB 1GUTA 4Y7NB 2D0PA 2A5HA 3HKZE 2XWBB 4APVA 3M4OH 1SJED 3A7AB 4KHVA 2LXJA 2PMZE 4HCEA 2EJMA 5JPMC 4DV7L 1R4QB 1ENFA 1YIJA 2Z0SA 3LNNA 1SNPA 1T5EA 2JA8G 4C3JG 2OEOA 2EJGC 3VA5A 2ZT9C 3AQQA 1Q8KA 4C2MB 3CW2C 1KNEA 2Q2TA 3QO2A 1HR0L 5C4XG 4YWKA 1SDFA 5JEAJ 5FO9B 4JI6Q 2E2HB 4GKJL 1NCVA 3OHXC 4DKAC 2UXCQ 3Q6SA 4A3EG 1QVGA 4K0KQ 3M3YH 2LFNA 2OQKA 2JA8B 1F2YA 3ONAB 3CC4A 3FPUB 1QWYA 2ICEC 5C4JH 5EGTA 1XWEA 1SN8A 3T1YL 2MP1A 2B2TA 2A69C 2B63G 3I4OA 4BBRG 1SFOH 4RGOS 1G2SA 2NZOA 1W3SA 4NXNL 1LUZA 2Y0SE 1II3A 5FLXL 1LLRD 5KYLA 2C9OA 4ULLA 1VMCA 5I9OA 4FF1A 3HOWB 2KCNA 1VQEA 3CCUA 4B3RQ 2RKSA 1IL2A 1AFPA 5C0XG 2OXPA 3HKZG 2CFMA 1FNWA 3HKZB 3NEMA 2BE5D 2VQEQ 4OIKA 2YU9B 2YTXA 1VQMA 1G2TA 1EY8A 3RN2A 3HOZG 3NENA 3MTSA 4X65Q 2D62A 2A73B 3TEHB 1STGA 3NPPA 2EVBA 3TSSA 4HSPA 4C2MH 5IOCA 3VA7A 2OQ0A 1H9RA 4KMUC 2XIWA 2PZTA 1IBMQ 4JV5Q 1Q1BA 4GOPA 4Y52H 4GLAC 2J4XA 3S24A 3UDGA 3L0OA 5A2QL 4A3KG 4K2KA 2JJQA 5IYDH 5IP9G 3CRLC 4X64L 3S9WA 2FMCA 1WD0A 1HNWQ 4GKJQ 4HSVA 4IALA 1STYA 1IHZA 1WYDA 2KJXA 3H0GH 2NVYB 5M9OA 2E5LL 1DOMA 4RHSA 1IBLQ 2O5JC 1ZYRC 5C0XI 4CDCC 2I5HA 2J0TD 1GUGA 4IZ8A 2F0HA 4P71A 3AFPA 3UDIA 4G7ZC 4RKBA 1HRJA 1G51A 4GNXB 4G7HC 4XDXA 1JC7A 1F9RA 3IRBA 3CMEA 4DV6L 1N36Q 5D14A 1TVXA 4A75A 3SEBA 2HIXA 1U9RA 3J80c 1SE3A 5LHY1 3TP8A 2FXQA 1HPCA 1MSHA 1HZAA 1I3QH 1STEA 3CAMA 1PH7A 4MN3A 5C44H 1XMOL 1K0SA 5ELEA 3SXHA 1PH8A 3KFUA 1A2UA 2F0PA 3M3YB 4A3GH 1TWHH 2R93H 3U9OA 4OELB 4AH6A 5FLMG 4LW1A 2IPKD 1YNJC 4K8JA 2YU9H 3MXPA 2WAQB 3KDFA 2QGQA 1Y1WH 1C9OA 4LUZA 4HJ5A 1VQ8A 4LF9L 1L1OB 1QOHA 3M7GA 4KN7C 1HNXL 4A3BG 1SROA 4UP8A 1XX8A 5C44B 1LTLA 4X3TA 1I4RA 4YHHQ 3PO3H 2KECA 4NXML 2F0SA 2CHBD 4Q0FA 4BY1H 3QG1A 4A3FG 1L2FA 1U4RA 5HURA 1SYFA 5KNBA 1TWFH 5KIXA 1LT6D 4IUTA 5I9PA 2HCCA 3DEPA 4C1NI 1SYEA 4OX9Q 3I73A 3UDFA 5IGCA 1KAAA 3BVGA 5IYBH 3X3NA 3GDEA 2UUAL 3SR1A 1IBLL 1ILQA 1EYGA 1HR0Q 1HZCA 3LWEA 3STBC 3CQZH 5G3LF 1L0XB 4IPHA 4PZ7A 3BVZA 1WTQA 1TWCH 4NXNQ 4YCWA 3JAMc 4OWTB 2IL8A 4DUYL 4B3MQ 1PMRA 2TSSA 4PMCA 1UE6A 2KCCA 2RQXA 3TDQA 3C46A 1CSPA 1I6VC 1HQMC 1X32A 4GS3A 4BA2I 4FP5D 4A3DH 1CM9A 3A0JA 3UI2A 3FKIH 1HNWL 2AQ2B 5C3EG 4H44C 3K80C 1RL2A 2A6HC 2RA4A 5ISRA 5E4WC 1I6HB 2RBMA 5A35A 2AHOB 4K5WA 4KHPL 1I4GA 4DAPA 4LF7Q 4LUVA 1JB7A 5M3FH 2NN6I 2CW0D 2F03A 2K14A 5EPLA 5BN3A 1SYCA 3H0GG 3IL8A 3NWSA 2Q2UA 4UP9A 3HOVG 2JK8A 1E1TA 4JBMA 1H95A 2K5VA 1PFSA 3M4PA 2B2VC 4NB3A 3TMEA 4A3LG 2KEEA 2K04A 4X6AH 1A6XA 2RDFA 4R8NA 3PF5A 3PF4A 1NY4A 4UHVA 4WRDA 4X66L 3LGJA 3EROA 4TKOB 5I6WA 4IFDJ 4MNOA 3IFDA 4JYAQ 5DM73 3GTGH 1EYDA 2HUGA 3G6EA 1DZ1A 4A76A 1AN8A 3U50C 1U4LA 1JJCB 1V1QA 4L8JA 4UDUC 1XMQQ 3K5NA 1SYBA 3A54A 1PFMA 4LMQD 3U9SA 1E7ZA 2PO4A 4RAUC 3K7UC 2F3WA 4KD3A 2N88A 1G91A 2HIVA 1I3QB 3VR5A 1PZJD 2NN6G 3RD4A 3HKSA 3PIOA 4JI2L 5GQOA 2LMCB 3I3CA 4J6HA 3H91A 1VQBA 2I5LX 3E6ZX 3CCSA 4TSSA 4IO9A 4A3GG 4H7BA 4OO1G 5JVH3 1DOLA 1QB5D 3ULLA 2MGSA 1K83H 3RUZA 1Y1WG 4V190 1XPUA 1QE6A 1WTHA 2KUMA 2VUMG 3PIPA 4KJOA 2IY5B 3ITPA 3NP8A 1CI3M 4K6DA 4DV7Q 2Z8LA 2D5DA 4P72A 2K33A 1RD9D 3W2DA 1QZGA 1GHJA 3FHWA 1PH3A 4BBSB 2G5DA 3I90A 1Z7TA 4OXPA 3G71A 4X62Q 3G6JB 4KV6A 4WJWA 2KENA 2PCFB 1KDBA 1SMXA 5IE8A 1ML0D 3FVQA 2R92B 1BR9A 1A3UA 1F2LA 2HCIA 1ET6A 4IUQA 4ZLTF 5T1GA 1VQNA 1ICWA 1EU3A 1EY4A 2NUCA 1X55A 4I65A 5ELNA 3OWEB 1OTCA 1HJPA 4ZKBB 1C8CA 1K73C 3KLWA 5BR8L 4IUNA 3S2DH 4EGVA 1D6EC 3MFGA 4QIWB 2RHQB 3PUXA 1W2BA 1ZEQX 4M1UB 1Y1VG 5E3FA 1EWCA 4OO1I 2RSOA 4JI5L 5AFWA 1JMCA 3S14H 5IT9L 3C3LA 1LT3D 1QZHA 3IAYA 2DJFC 1JCKB 3HOWH 2WP8J 4HJ8A 1TS2A 3H3VI 2VUMH 1YZ6A 3S1NB 1DONA 4DAYA 5KYIA 2O4XA 3S17B 1PZKD 1UEBA 1VQGA 5IY0A 3KBXA 2EJFC 1B53A 5FLMH 4XQJA 5IGDA 1KDCA 3K5OA 4LK1C 3KJPA 2R93G 1P16A 4QIWE 4HJ7A 4JI8Q 4LF4Q 1H9KA 4Y7NH 1PRTD 5J22A 2KHJA 5IP9H 4B9WA 5H1SE 4BBSH 2VUMB 4L63B 3NQTA 4O2DA 1S3OA 4IFDI 4DV0Q 1SE2A 3BYTB 1CA5A 3VYSA 3D4WA 3BDCA 1E24A 5CBEE 2L5TA 4YY3L 1JICA 2NVYH 2XRSD 2R61A 1LT5D 5JJZA 1PTOH 1XJVA 2K03A 3GTPB 1CTMA 4QGUA 2B8FA 1GUWA 1E0BA 5JEAH 3K6OA 2SEBD 3WWVA 4DK0A 4JW0A 1TWFB 1MHWC 1G291 1WTRA 5DLQE 2HD3A 5KEEA 2IW3A 2KVMA 4PMBA 1PYSB 1A3VA 4A3MH 1Y14B 2R7ZG 2YTVA 1EQVA 2LS01 4DK1A 1N32Q 2UXBQ 3KJOA 4DR5Q 1AE2A 3JAME 1HR0W 3SK8A 5C3EH 1ILPA 3NQIA 3U4VA 1WTPA 1EY5A 4HIOA 3FKIG 3T1HQ 4DF7A 3FRPB 4JI5Q 2IT1A 4DV4Q 4A93H 2UXBL 2B29A 1PLFA 1MJEA 1CA6A 2B2UC 1D1KA 2MFIA 5ELOA 4NKLA 3MA2B 1RCVD 3VDYA 1BDOA 2RHSB 4X3SA 3T4AC 3PIP3 1WTWA 1PH2A 3GTOB 1BBXC 4JC0A 4IOAA 4P75A 4YHHL 5AJ3Q 3J7A5 5C6AA 1QUQB 1Q81C 1S5DD 4N8X1 3R2IA 2F0GA 3ND8A 4JBKA 5JJLA 3P75A 1FNUA 2D9UA 2SNSA 1KRTA 1X3EA 5CV5A 5LMNW 2E2IH 3I4NH 3ND9A 2DJGC 1PH9A 1HFGA 4OONA 4GN4B 1GOZA 2F3VA 4LFAL 1B2TA 1XNQQ 3HRZC 4DR1L 1TIID 1LTGD 4POGA 1E2WA 1OXXK 3K5MA 1IYJB 5TSSA 1Q90A 3HOYB 4WJ4A 4GNXA 1VQFA 1VQAA 2L4NA 2EXDA 3OIQA 4OWWB 4JVZA 4ZKCB 1SEBD 1B3AA 1WJJA 1WOCA 3MXNA 3GTQB 3VR2A 4G57A 3AMUA 3I4NB 1UE5A 3M4QA 2E2IB 3URYA 1MJCA 3HS0C 1ZKOA 4JI3Q 3ER0A 3RZDH 2QEXA 4CHTB 1VS0A 3VYTA 4DUZQ 1IZ6A 1BCPC 4PV1C 2ZXPA 4A3DG 1TWAH 2VB2X 4DR7Q 2NVTH 4IN3A 4DR6Q 3EA6A 3J81E 5IYCG 4R9WA 4HIMA 3VYUA 1XMQL 2E2DC 4XYOA 1V9PA 4IUUA 1CZGA 4R4IA 3EVQA 2EQSA 3K58A 2KCMA 4A3IH 3RZOB 1X56A 2CQOA 4EQPA 5KNDA 3HOXG 4RGMA 5ELCA 4LFCQ 5C44G 5F2DA 2NVTB 5CC4A 4BY1B 3E0JA 5CMDA 3S2DB 4CBVA 3AU7A 4LNQA 1WFQA 1BUVT 1PH6A 4JBJA 3I4LA 2XRQD 1BCPD 2L11A 3NTIA 2Z1CA 1IYUA 4GOPB 2D0OA 2V1CC 3S1RH 1VQ6A 5FLXc 1NMGA 1CKNA 1XPOA 3R8BA 1NMFA 2N8NA 3I91A 4C56C 1UWVA 5KGUA 1D7QA 2NVQB 3RZDB 3A55A 2VS1A 1N32L 2A1AA 3BYYB 2EZVA 2BOSA 2RSNA 4A93G 1EFID 1LTAD 1TS4A 2VW9A 3T1HL 2QILA 4M8AA 1KABA 2Z6KC 4BY7H 4XQNA 4ME3A 1KC8C 1NBWA 4BS9A 3WOFA 3FP9A 5JJIA 1VQIA 1ICFB 2Q8IB 5JVG3 1PHJA 2PI2E 3CD6A 5JJKA 2IJ0A 2GVBA 1BKBA 1UAPA 2BCOA 4BBRH 1IL8A 1V1PB 4TVAB 1G8ZD 2K6AA 3R3OA 1OXSC 2AQ3B 2I0QA 1EY9A 1PXUA 3GTGB 1I50B 3DXJC 2EDGA 4X64Q 5ELFA 3E0EA 2JP1A 1DM0B 2F0UA 3NWTA 3QB3A 5FK9C 4PMWA 4BY7B 3W5OA 1HHVA 4A3CG 2L1BA 1KIXA 2MO0A 5LL6X 5CV7A 2XVSA 4POFA 3CMAA 3HOVB 3H0GB 3MVVA 4LWCA 3J80i 4JPBW 4B3ML 1C4QA 4BXXH 3SE0A 4ZUIA 4DXGA 1NAPA 3EQLC 1IW7C 3F1ZA 2FINB 2L12A 2A8VA 3PMFA 1EEID 4AYBE 1BOSA 5CV6A 2B2YC 1IBKQ 2VL6A 4A3MG 2UUBQ 3UE1A 2E74C 2QDLA 3J80L 4DN4M 4JCVE 5IGGA 3TQYA 1I4HA 2EXZA 1B4OA 3J81j 2JA5B 3E9IA 5JAVA 2A19A 1ONLA 4KD4A 3DHQA 1L0YB 5A2QE 1PFNA 5M3MG 3EBEA 4C3HG 1RKNA 1UE1A 4JOIC 1M1KC 2X6GA 3TZDA 5CBAE 3H6MA 4BWGB 3TS0A 2R7DA 3TN2A 4DR6L 4C3IB 3P1HA 3PUWA 3S2HB 3S17H 1DJRD 5NUCA 3OOCA 3HOXH 2RCNA 3KDFB 1JJGA 5LMUL 4C3HH 3NSWA 2B63H 2K5QA 1PRTC 4CJ1B 4B3SL 3RLOA 4NXMQ 2F1MA 2EIFA 1GUSA 2DNEA 1ASYA 4Z9CB 2IX3A 5LMNL 1VCIA 3MEFA 2F0VA 2F0MA 1PH5A 4IPCA 3PUZA 2F0WA 4HIDA 2K4KA 3MAQA 2PQAA 4JV5L 4K5VA 4QCLA 3QJYA 3M85A 4HTHA 5FOBB 4FO2A 3TP6A 1K9MC 2ENBA 3SK5A 3I4MB 2HDMA 1SNQA 1PVOA 4A3EB 1VQ4A 2B2WA 1LABA 3WOEA 1D5MC 4DV4L 3HOZH 1K28A 2DUDA 1VDZA 2QF7A 5EPJA 2NVXB 4HEDA 5FJ8G 3CPWA 2B2TC 1MSGA 5M5WB 1CKMA 1F9SA 4CJ0B 3PO2B 2IWHA 2SOBA 3HOYH 1YNND 4L5QA 1FYCA 1RODA 4AIMA 1LTID 3OPOA 3I72A 3CHBD 4E6IA 3CCQA 4L6TB 1NSNS 1VQOA 2R3ZA 1SR3A 2AMCB 2XN9C 4U673 3J7ZC 4OHJA 3M7NA 4JI3L 3OW2A 3F2UA 2F4IA 3GTMB 1SNDA 3DWPA 1E1OA 3AYHB 3IFTA 3JAMi 3G4SA 3GTJB 4YIJA 4BXXG 1UE7A 1X3FA 1PTOF 4HAEA 3P20A 2K5WA 3EIVA 3I56A 4A3CH 4A3JH 3G48A 2RCFA 4GLVB 3PQIA 1GM5A 4KI0A 4GOPC 4A3GB 1LTSD 4DNTB 4PQXA 5K5PA 3PUVA 3U58A 3K57A 1J5EL 5HGQA 3C2PA 4XTCS 3D4DA 4LJZC 1R9TH 5IIFA 2WACA 2L9HA 1TY0A 3D0FA 3M9BA 1TKWB 2NYZD 1XNRL 1D5ZC 3GTMH 3BZDB 1FD7D 1I4XA 3H3VH 2R92H 2K1BA 3D31A 1FGBD 3A8KE 1QCBD 2PMZB 4C3JB 1A62A 3KLSX 3FMCA 1GUNA 4KY6A 2XWJB 3NTHA 2CH4W 4GKKL 1KHIA 5D3DA 2B39A 2ICIA 5I2XA 3PO3G 4LFCL 3CKIB 4I7ZC 2MHVA 2NZHA 3SHLA 3S1RB 1SLJA 2R7ZB 2JA7G 4A3IG 2RVLA 4LF7L 1VQKA 4A3MB 1VQLA 4DPGA 1Y69U 1I94L 2JSOA 3WDNA 2JEBI 1EFWA 4ME5A 1U4PA 2JA6B 5K36G 2JXMB 1FJGL 4R4TA 2XGTA 1TT2A 4XQQA 2P5ZX 3VR4A 2NZ1D 3K8AA 3F2CA 4DNIA 4F88A 1YI2A 1XXGA 2MJ8A 3RNUA 2ZTDA 3S15B 4QQBX 2BDNA 2ZXOA 4ZUJA 2YTYA 3VYRA 2M2LA 5M5WH 1VQ5A 1X65A 4QMGA 4K5XA 5C4XB 3DWAA 2K7VA 3JC66 3NK9A 1WTXA 1O7LA 3HOZB 2QW7A 3S16B 1TR5A 4CGYB 5I2YA 4JI1L 1JOKA 4ID6A 2F0KA 5C3WA 3D8GA 3J80E 3CCEA 1PRTF 3TBIB 1FVIA 3QR8A 3CU7A 3A5ZB 2KEDA 4L5RC 1F2MA 1MKHA 2E8GA 1GO3E 4J8QA 5M3MB 4DR3Q 1M4VA 1NR2A 3MXUA 4AYBG 4BY7G 5LMNQ 3I2ZA 4GLXA 4JK1C 4K2LA 3GTLH 3HOVH 3QOLA 4A3IB 3A8JE 5ELDA 1PTOC 1LTTD 2VB3X 4B9XA 3CCVA 1TWCB 2F3IA 3I4MG 3O13A 1HUNA 3W3AA 4H0LC 4A3JB 2J7ZA 1DGSA 3KLRA 4YWLA 3T1YQ 3KLSA 3VR6A 1BCPF 3KF6B 2VY3A 1E22A 1QVFA 4NPSA 3STBD 1UUPA 2QCPX 1XTDA 2H1EA 5EBCA 4LFBL 5JPNC 4UP7A 1CK1A 1QILA 2PYKA 4QY7A 3S1MH 1KDAA 5J3BA 1V1OA 2IHEA 2HQLA 2F0DA 1BBWA 3BG3A 1N36L 4DV5Q 2PZWA 3MFYA 2ZJPA 2MUYA 5JOBA 1O78A 2E76C 3AB9A 3KOJA 5GAHC 4F8MA 5CYUA 5IYDG 5M5XH 1PA6A 5IT9E 4DXFA 5C4JB 1CZWA 4R4CA 2NN6H 3Q23A 1EOTA 4ZAIA 4ZK9B 2JYOA 2CKZB 3GD7A 2JEAI 1OXTA 4XXEA 3E3XA 3ERQA 1NR4A 4A3KB 1IW7D 1OXUA 2EYLA 2F0IA 4X3KA 1LTBD 1YNNC 2R92G 1T5XD 2JA5H 1A3TA 3A56A 2CVRA 4K6LA 1Q1EA 1Z9FA 1QNKA 4N8FA 1YJ9A 4FVMA 3I55A 3KF8B 3KF8A 2LSSA 4HR7B 2N3SA 3GTJH 1Q8IA 4V0BA 1WCMH 3OW7A 4RWSC 4K8IA 1B9MA 4FF4A 2A6EC 1EIGA 1TWGH 2I07B 4NMZA 4A3LH 2M9VA 5LL6S 1VQ7A 5DAUA 1T9HA 1I94Q 1VQPA 4JI0Q 4K14A 1E2VA 2JN4A 2QEJC 2PI2A 4GZYC 2QA4A 1EU4A 2FMMA 3CQZB 1LTRD 3DWQA 3KF6A 4G7OC 1EQRA 1EZ6A 1Y8NB 1HQRD 2A74C 2EE1A 2WB1E 1K83B 2QKIC 1X54A 3A7LA 3MEHA 1IKLA 4H02A 1L0WA 3FEWX 4CKBA 4FF2A 5CV9A 3Q22A 5IGBA 1SMYD 1YEZA 4HIKA 4GNXC 4G4KA 1Z47A 4O0AA 4DK3C 1LM0A 3HEJA 2X6LA 3L7ZC 4A3BB 3BZCA 2N55A 4KKSA 1J6QA 1VQCA 3OYYA 4NDXA 3TP7A 5M3FB 3ZJYC 1HTPA 4NW2A 4FXDA 3C1FA 4UY8C 1M8AA 2BH8A 2VQFQ 5FJ8H 1RJTA 5EPKA 2AUJD 1BO0A 3J7AV 1TS5A 4WORA 1ENAA 1SMYC 1JE4A 1HZ9A 2ZTEA 1B1ZA 1JE5A 4R1JA 4PNYA 2HT1A 2H4OA 3GP7A 1EEFD 4RGNA 2R6GA 3MZ5A 3CC7A 4FF3A 3A74A 1CHQD 3RR5A 1GUOA 5KRUA 1Q7YC 1X3QA 5C5LA 1HNXQ 3MHBA 3QWNA 1SE4A 2GVAA 3I70A 4YCUA 4JI7Q 1S72A 4LFBQ 4LF8L 1MI2A 1SE8A 1I5FA 4L5TA 5FO8B 2F0NA 4TRDA 5BR8Q 1QNUA 1M90C 5M5YB 2HHHQ 2EOTA 4IURA 1U5KA 4DUYQ 2K5NA 3ICEA 1H9SB 5EKLA 5C0XJ 4UPAA 2A69D 1XNRQ 1BNZA 4MIUA 5J39A 1AH9A 1EWHA 2JA6G 2EYHA 2HHHL 1QUQA 4RH6A 2PQEA 4RMFA 1PFBA 2L15A 4CDFC 3J81L 1PDQA 1HA5A 4YY3Q 4QB4A 1YVCA 2NTTA 2UU9Q 2VQEL 1S5CD 2CW0C 2AKWB 2B3GA 4XT3B 4QJFA 4CJ2C 2XSCA 3T53B 4OEMB 5IODA 1B3QA 2MQHA 1H9SA 1P8LA 1B7YB 1KL9A 1TWHB 3L9AX 5C4XH 3I4MH 3CRKC 3H94A 3F2BA 1FJGQ 2BA1A 4B3SQ 4A3EH 4LF9Q 2MO1A 3D3RA 1H9MA 3QOJA 2FJ2A 4O42A 4QL5A 4AQYQ 5D65A 3M4YA 3UE0A 1Q46A 3PIO3 4IJHA 2D2CC 3T51B 1KXLA 4EQ5A 4KN4C 1HTLD 5IP7G 4BA1I 3L3OC 1S5ED 2JA6H 1AP0A 2ZJRA 3MWYW 4IUPA 3D6CA 4XIGS 5G3LD 2ATWA 1YITA 3LWUA 4RFBA 3RN5A 3ERSX 1W6JA 2XTIA 1CKOA 3S15H 1ET9A 1K0RA 3HG9A 4DNRB 2H5XA 1SBBB 2AUKA 1I4PA 1D8LA 3EN2A 5IGEA 5M5XB 5IYCH 4CDDC 4KY5A 1MIUA 2UUBL 4P2CB 4XT1B 2B2YA 2E2JH 1L1OA 1HNZQ 2KHIA 1N33L 4LF4L 1D1IA 1EY7A 3M4OB 1JOQA 4A3FH 4CKCA 1DXMA 2BA0A 5DEHA 3G7LA 3HOWG 2OF1A 4HMJA 3NTKA 4IPGA 2PNHA 1Q86C 3GTOH 4A3JG 1VQ9A 1ESRA 3OIPA 1BXTA 4KHPQ 1Y8PB 2CQAA 2KBNA 2PQAB 5CV4A 2KOLA 5EQ0A 4WJ3M 2VZAA 4DFAA 1BQQT 4DGZA 1ASZA 4DR2Q 2F0JA 4KY7A 1Y8OB 2KA7A 5T1IA 1DCZA 1EZ8A 1Y1VH 3DMUA 2E2JB 5IYBG 3DM1A 1WVLA 3MC0B 1O7ZA 1TY2A 2NTSA 5HY6A 3CCJA 4RKLA 4JI7L 1G6ZA 1YNJD 2LY7A 4IQZA 1N34L 1SXTA 4LAAA 4IFDG 3T16A 1MD2D 2G9HD 2F4VQ 4FYDA 2C35B 4OX9L 2X69A 1HXYD 4YWMA 3J7AF 4DAVA 4KK7A 2K01A 1PV4A 1C7YA 3TRZA 1JR0D 4N9TA 3OMCA 1XYIA 3IKJA 2HQEA 4QUFA 1JWSD 2WB1G 1PYBA 1FR3A 2DY8A 5DM63 1S4ZA 4O1NA 4KKTA 3ULPA 2E5LQ 2R7ZH 1N9WA 5BN4A 3Q8DA 4JI6L 2EY6A 1A0IA 1U0LA 3EFXD 2B8GA 4B3TL 4OIJA 1SSOA 2F0EA 3GTLB 3D6WA 2NBFA 1EY6A 3KUPA 4S3SA 4LFAQ 2ALYB 4HMIA 1AW7A 2WAQE 4KTAA 3J7YW 1GVPA 2NVQH 3K5LA 1MBYA 4HJ9A 1QJOA 5D3IB 3GO5A 5CR3A 3EJIA 3H3VC 1DD2A 3BJUA 2A68C 2A6HD 3QIAA 2Q8TA 1EIHA 5E1FA 2Z6KA 3VR3A 4IPDA 3JAML 2UU9L 3W1BA 1K8OA 1G6PA 2K05A 2MPMA 5COYA 4DV6Q 5I6YA 1X3GA 1SYDA 2GN5A 1KQSA 4B3RL 5ELBA 4JI4Q 4KLKA 2L55A 3D4RA 4KKUA 5C3XA 1FNVA 1YJWA 2C5CA 5CV8A 3HP3A 1EQQA 2AQ1B 2RDHA 2SDFA 4JBWA 1LT4D 5KNCA 2PW7A 1GD7A 1C48A 1AE3A 3SGIA 2NWGA 3LX0A 4C3HB 3K7AH 1RTOA 1NNXA 3RLFA 2DNCA 3CP0A 1XTCD 1XPRA 2JA9A 4IUVA 4IOCA 2ZM6Q 4GN3B 1N33Q 1Z6HA 1SRUA 2AWOA 3S1NH 3N52A 2BH2A 1AZQA 2BDOA 1WTOA 4CDEC 1STNA 1KTKA 3T56B 4C3JH 1SFOB 1D2BA 3NELA 2CWAA 1HUMA 1EIFA 4DA2A 4F7XA 1K8GA 2F0QA 3CCLA 2Y0SG 2Y0SB 1C0AA 4JI8L 2K52A 1SJHD 2WKCA 1HH2P 1KLGD 2EY1A 2I5MX 4JI2Q 3TS2A 2WINB 3DUZA 2BE5C 3MXGA 1LV9A 1UEAB 2JA8H 1TS3A 4LF6L 3V2TA 1F77A 4C3IH 4RCOA 2MNAA 4R4OA 4DK6C 4DUZL 3F8TA 1B9NA 4B3TQ 2RF4A 2PPBC 2YV5A 3NUCA 3RMHA 4Q5VA 3W1GA 1UNSA 4DV5L 1F9QA 4DR7L 1RDPD 3K0XA 3PCOB 4MZ9A 4ZQ3A 1PRTB 4RA8A 1JJ2A 3V05A 1AEXA 1B8AA 2VQFL 2OTLA 4GN5A 4J15A 2Q2IA 1STBA 5C4ZA 4OO1H 2LXKA 1J8IA 1SNOA 1VF7A 4ALPA 4RHRA 4EVOA 4DR5L 3S1QB 5GAEC 1A15A 1K8AC 3K7AB 4DV3Q 4DR4Q 5CORA 1SNCA 4BBRB 1KRSA 3Q0AA 1SAPA 2XNAC 3HZXA 4GKKQ 2F4VL 5CGKA 2E2HH 1HCZA 1ESFA 1Q12A 2I46A 3FPPA 1E2ZA 4DR3L 2B2WC 3HOXB 2VNUD 1EOVA 1QVCA 3S1QH 5M3MH 4X66Q 1CQFA 2F0OA 1HFNA 2NVXH 3K59A 3H09A 4MHEA 4J1MA 3Q24A 3NBIA 4FXGC 1A2TA 1K3BC 3CPFA 3P7JA 1NE3A 2V4DA 4TQUS 4UAIA 2UUAQ 4U68A 3HOUB 1I4QA 1BVSA 4DV0L 3KBGA 5IGFA 5M5YH 1VQJA 3FDTA 1KNAA 3E9HA 3S16H 1OXVA 1ENCA 3GTPH 3DLLA 4AYBB 1PZID 2R93B 1U4MA 1Q82C 1X6OA 1PH1A 2IX1A 3R93A 1S5BD 2F52A 2CWPA 2WV6D 3V96A 4ZYSA 2DY7A 4CKEA 1CHPD 4HN7A 1PYWD 4RGTA 2ZM6L 5BN5A 2K5HA 3A5UA 1JT8A 5IWAL 1WI5A 1CSQA 4FDBA 3KYHC 1ZXTA 4MTNA 1YBYA 1EY0A 2DGYA 3CCRA 5HGTA 1O80A 3SK4A 3H15A 1OO9B 2F0LA 4PG3A 1VQDA 1TWAB 4PZ6A 1CQVA 1GKHA 2WFWA 3HOYG 3S2HH 3GQBA 3CXCA 3OSOA 1JQYD 2B2VA 1XNQL 1N34Q 1MGSA 3BU2A 3AEVA 1BBUA 1FGUA 1NUCA 2EY5A 2SNMA 2R7FA 1JB3A 2OTJA 3PGZA 4WFN3 3CC2A 1B70B 5EKIA 2KHSA 2KCTA 4DAMA 4DR2L 4A4IA 5AJ3L 3S14B 4P73A 1YNXA 1EIYB 2EYFA 5FO7B 1IKMA 3X3MA 4EX5A 2WB1B 1TWGB 2Z4IA 5C3EB 1BF4A 4BBSG 2AWNA 5M3FG 2F0FA 3I7FA 3PV0A 1JORA 1B44D 3CCMA 3L2PA 2OT2A 2O5IC 2EY2A 3HOUG 1A63A 2HDLA 3RLNA 1EQTA 1V43A 2B2UA 3K81C 1Y1WB 4LF5L 3CF5A 1ZYRD 4ODGA 5C4HA 3GTQH 2ZXRA 1EL0A 4R8IA 1O7YA 1KAWA 2PZUA 2GA4B 4X3UA 5L37A 1F9PA 1PTOD 2JQOA 3C1EA 3PO2H 1RHPA 4JG2A 2ZJQA 3J81i 2OWOA 3KK7A 1CUKA 1WCMG 1WCMB 1SNMA 2VXWA 2JA5G 3E5SA 4DR1Q 1YJNA 2EYJA
chains in the Genus database with same CATH topology
3NHHA 1K8MA 5EJWA 1WTVA 2E75C 4FXKC 1R4PB 1TQOA 4EQOA 4XYQA 1H9JA 1BCPB 1LACA 4F87A 1GJXA 3NBHA 1J9OA 1Q3LA 3SVMA 5DNFA 2M00A 4A93B 1S5FD 5K36H 5E4XA 2KQ3A 5EBDA 5C5MA 4FNFA 3TP5A 3OMGA 1LO5D 1JWMD 4C3IG 1HA6A 5FLXE 3ZYYX 1VMPA 1B50A 1V1PA 1VF5C 1AZPA 4QF4A 2L0CA 3SK6A 1TU2B 2K5DA 5JEAG 5C0XH 3S1MB 1V8QA 3DEOA 1DYQA 3R2TA 2F0TA 4IFDH 1GXDC 2PNRC 1STHA 3FKIB 1CT1D 3T13A 3BS1A 3HGBA 1RTNA 1Y1VB 2EYMA 2JE6I 1F2ZA 4KHZA 1DOKA 4ZRZA 3BDOA 3I8ZA 2FFKB 2A68D 4H13C 3GV3A 3PUYA 1R9TB 3GTKB 2EYPA 4N9PA 3K0YA 1QG7A 4ILWA 2K32A 4EQNA 1EYCA 2LKVA 3PO3B 4HCSA 2IX0A 2O2LD 2YYZA 4DU9A 2Z4HA 1SYGA 5J1ZA 5FKAC 4A3DB 2A6ED 1KLUD 1EYAA 1X3PA 1RF2D 4OL7A 2QDBA 4RCNA 1PTOB 1GHKA 2NB0A 2G9DA 2TMPA 3NE5B 4QUCA 4C1NK 3BVMA 2DN8A 1D5XC 1JOOA 2JA7B 3NXWA 1JWUD 2EYOA 3BDLA 2PW5A 4B08A 5I4DA 2K28A 2WIIB 4NP5A 4A3FB 4OGQC 4ABNA 3A8IE 1WD1A 2B63B 1STAA 1IYVA 2FHTA 2Q8RE 2RDGA 3TZUA 1W6KA 3OWFA 3SDZA 2EPBA 1CFMA 3N6RA 4KJNA 3GV6A 2WKDA 5EKKA 2ID0A 1GUTA 4Y7NB 2A5HA 2XWBB 1SJED 3A7AB 4KHVA 4HCEA 2EJMA 5JPMC 1R4QB 1ENFA 3LNNA 1SNPA 1T5EA 4C3JG 2OEOA 2EJGC 3VA5A 2ZT9C 4C2MB 1KNEA 3QO2A 1SDFA 5JEAJ 5FO9B 2E2HB 1NCVA 3OHXC 3Q6SA 2LFNA 2JA8B 1F2YA 3ONAB 3FPUB 1QWYA 2ICEC 5EGTA 1XWEA 2MP1A 2B2TA 2A69C 4RGOS 1G2SA 5FLXL 1II3A 1LLRD 5KYLA 2C9OA 4ULLA 1VMCA 5I9OA 4FF1A 3HOWB 2KCNA 1AFPA 2RKSA 5C0XG 2OXPA 1FNWA 3HKZB 2BE5D 4OIKA 2YU9B 1G2TA 1EY8A 3MTSA 2D62A 2A73B 1STGA 3NPPA 2EVBA 3TSSA 4HSPA 5IOCA 3VA7A 1H9RA 4KMUC 2XIWA 2PZTA 1Q1BA 2J4XA 5A2QL 4K2KA 3CRLC 3S9WA 2FMCA 1WD0A 4HSVA 4IALA 1STYA 1IHZA 2KJXA 2NVYB 5M9OA 1DOMA 4RHSA 2O5JC 1ZYRC 5C0XI 2J0TD 1GUGA 4IZ8A 2F0HA 4G7ZC 4RKBA 1HRJA 4G7HC 4XDXA 1JC7A 1F9RA 5D14A 1TVXA 3SEBA 1U9RA 1SE3A 5LHY1 3TP8A 1HPCA 1MSHA 1STEA 4MN3A 5ELEA 3SXHA 1A2UA 2F0PA 3M3YB 3U9OA 2IPKD 1YNJC 4K8JA 3MXPA 2WAQB 3M7GA 1QOHA 4KN7C 5C44B 1XX8A 4X3TA 1I4RA 2KECA 2F0SA 2CHBD 4Q0FA 3QG1A 1U4RA 5HURA 1SYFA 5KNBA 5KIXA 1LT6D 4IUTA 5I9PA 2HCCA 3DEPA 4C1NI 1SYEA 3I73A 5IGCA 1KAAA 3BVGA 3X3NA 3SR1A 1ILQA 3LWEA 5G3LF 1L0XB 3BVZA 1WTQA 2IL8A 1PMRA 2TSSA 4PMCA 2KCCA 2RQXA 3TDQA 3C46A 1I6VC 1HQMC 1X32A 4BA2I 4FP5D 1CM9A 3UI2A 2AQ2B 4H44C 2A6HC 2RA4A 5ISRA 5E4WC 1I6HB 2RBMA 5A35A 4K5WA 1I4GA 4DAPA 2NN6I 2CW0D 2F03A 5EPLA 5BN3A 1SYCA 3IL8A 3NWSA 3TMEA 2B2VC 2KEEA 2K04A 1A6XA 2RDFA 4R8NA 4WRDA 3EROA 4TKOB 5I6WA 4IFDJ 3IFDA 5DM73 1EYDA 2HUGA 1DZ1A 1AN8A 1U4LA 4UDUC 4L8JA 3K5NA 1SYBA 3A54A 1PFMA 4LMQD 3U9SA 2PO4A 4RAUC 2F3WA 4KD3A 2N88A 1G91A 1I3QB 3VR5A 1PZJD 2NN6G 3RD4A 2LMCB 3I3CA 4J6HA 3H91A 3E6ZX 4TSSA 4H7BA 4OO1G 5JVH3 1DOLA 1QB5D 2MGSA 3RUZA 4V190 1QE6A 2KUMA 4KJOA 3ITPA 3NP8A 1CI3M 4K6DA 2Z8LA 2D5DA 2K33A 1RD9D 3W2DA 1GHJA 4BBSB 3I90A 1Z7TA 3G6JB 4KV6A 4WJWA 2PCFB 1KDBA 1ML0D 3FVQA 2R92B 1BR9A 1A3UA 1F2LA 2HCIA 1ET6A 4IUQA 4ZLTF 5T1GA 1ICWA 1EU3A 1EY4A 2NUCA 4I65A 3OWEB 4ZKBB 1C8CA 4IUNA 4EGVA 1D6EC 3MFGA 4QIWB 3PUXA 1ZEQX 4M1UB 5E3FA 1EWCA 4OO1I 2RSOA 5AFWA 5IT9L 3C3LA 1LT3D 3IAYA 1JCKB 2WP8J 1TS2A 1DONA 3S1NB 4DAYA 5KYIA 2O4XA 3S17B 1PZKD 3KBXA 2EJFC 1B53A 4XQJA 5IGDA 1KDCA 3K5OA 4LK1C 1H9KA 1PRTD 5J22A 4B9WA 2VUMB 4L63B 3NQTA 4IFDI 1SE2A 3BYTB 1CA5A 3VYSA 3D4WA 3BDCA 5CBEE 2L5TA 1JICA 2XRSD 2R61A 1LT5D 5JJZA 1PTOH 2K03A 3GTPB 1CTMA 2B8FA 1GUWA 1E0BA 5JEAH 3K6OA 2SEBD 4DK0A 1TWFB 1G291 1WTRA 5KEEA 2IW3A 2KVMA 4PMBA 1A3VA 1EQVA 2LS01 4DK1A 3JAME 3SK8A 1ILPA 3NQIA 1WTPA 1EY5A 4DF7A 3FRPB 2IT1A 1PLFA 1CA6A 2B2UC 1D1KA 4NKLA 3MA2B 1RCVD 1BDOA 4X3SA 3T4AC 3PIP3 1WTWA 3GTOB 1BBXC 5C6AA 1S5DD 3R2IA 2F0GA 3ND8A 3P75A 1FNUA 2D9UA 2SNSA 5CV5A 3ND9A 1HFGA 1GOZA 2F3VA 1B2TA 3HRZC 1TIID 1LTGD 1E2WA 1OXXK 3K5MA 5TSSA 1Q90A 3HOYB 2L4NA 3OIQA 4ZKCB 1SEBD 1B3AA 3MXNA 3GTQB 3VR2A 4G57A 3AMUA 3I4NB 2E2IB 3URYA 3HS0C 1ZKOA 4CHTB 3VYTA 1BCPC 4PV1C 2ZXPA 2VB2X 4IN3A 3EA6A 3J81E 4R9WA 3VYUA 2E2DC 4XYOA 4IUUA 1CZGA 3EVQA 3K58A 3RZOB 4EQPA 5KNDA 4RGMA 5ELCA 5F2DA 2NVTB 5CC4A 4BY1B 3E0JA 5CMDA 3S2DB 4CBVA 3AU7A 1BUVT 3I4LA 2XRQD 1BCPD 2L11A 3NTIA 2Z1CA 1IYUA 3R8BA 3I91A 4C56C 5KGUA 2NVQB 3RZDB 3A55A 3BYYB 2EZVA 2BOSA 2RSNA 1EFID 1LTAD 1TS4A 2QILA 4M8AA 1KABA 4XQNA 4BS9A 3WOFA 5JVG3 2Q8IB 2IJ0A 1UAPA 2BCOA 1IL8A 1V1PB 1G8ZD 2K6AA 3R3OA 1OXSC 2AQ3B 1EY9A 1PXUA 3GTGB 1I50B 3DXJC 2EDGA 5ELFA 2JP1A 1DM0B 2F0UA 3NWTA 3QB3A 5FK9C 4PMWA 4BY7B 1HHVA 2L1BA 5LL6X 5CV7A 2XVSA 3HOVB 3H0GB 3MVVA 1C4QA 3SE0A 4ZUIA 4DXGA 1NAPA 3EQLC 1IW7C 2FINB 2L12A 3PMFA 1EEID 1BOSA 5CV6A 2B2YC 2E74C 3J80L 4DN4M 5IGGA 1I4HA 2EXZA 1B4OA 2JA5B 5JAVA 1ONLA 4KD4A 3DHQA 1L0YB 5A2QE 1PFNA 4C3HG 1RKNA 2X6GA 3TZDA 5CBAE 3H6MA 4BWGB 3TN2A 4C3IB 3P1HA 3PUWA 3S2HB 1DJRD 5NUCA 3OOCA 3NSWA 2K5QA 1PRTC 4CJ1B 2F1MA 1GUSA 2DNEA 4Z9CB 2IX3A 1VCIA 2F0VA 2F0MA 3PUZA 2F0WA 3MAQA 4K5VA 4QCLA 3QJYA 3M85A 4HTHA 5FOBB 4FO2A 3TP6A 2ENBA 3SK5A 3I4MB 2HDMA 1SNQA 4A3EB 2B2WA 1LABA 3WOEA 1D5MC 1VDZA 2QF7A 5EPJA 2NVXB 4HEDA 2B2TC 1MSGA 5M5WB 1F9SA 4CJ0B 3PO2B 2IWHA 2SOBA 1YNND 1FYCA 1RODA 1LTID 3OPOA 3I72A 3CHBD 4E6IA 4L6TB 1NSNS 2R3ZA 2XN9C 4U673 4OHJA 3M7NA 3F2UA 2F4IA 3GTMB 1SNDA 3DWPA 3GTJB 3IFTA 4YIJA 1PTOF 4HAEA 3P20A 2K5WA 4KI0A 4A3GB 1LTSD 4DNTB 4PQXA 5K5PA 3PUVA 3K57A 3C2PA 4XTCS 3D4DA 4LJZC 5IIFA 2WACA 2L9HA 1TY0A 1TKWB 2NYZD 1D5ZC 3BZDB 1FD7D 1I4XA 2K1BA 3D31A 1FGBD 3A8KE 1QCBD 2PMZB 4C3JB 3KLSX 3FMCA 1GUNA 4KY6A 2XWJB 3NTHA 5D3DA 2B39A 2ICIA 5I2XA 3CKIB 4I7ZC 2MHVA 3SHLA 3S1RB 2R7ZB 2RVLA 4A3MB 1Y69U 2JSOA 3WDNA 2JEBI 4ME5A 1U4PA 2JA6B 5K36G 2JXMB 1TT2A 4XQQA 3VR4A 2NZ1D 4F88A 1XXGA 2MJ8A 3S15B 2BDNA 2ZXOA 4ZUJA 3VYRA 2M2LA 4QMGA 4K5XA 5C4XB 3DWAA 2K7VA 3NK9A 1WTXA 1O7LA 3HOZB 3S16B 1TR5A 4CGYB 5I2YA 1JOKA 4ID6A 2F0KA 5C3WA 3D8GA 3J80E 1PRTF 3TBIB 3CU7A 2KEDA 1F2MA 4J8QA 5M3MB 1M4VA 1NR2A 3MXUA 4JK1C 4K2LA 3QOLA 4A3IB 3A8JE 5ELDA 1PTOC 1LTTD 2VB3X 4B9XA 1TWCB 3O13A 1HUNA 3W3AA 4H0LC 4A3JB 2J7ZA 3KLRA 3KLSA 3VR6A 1BCPF 1UUPA 2QCPX 5EBCA 2H1EA 5JPNC 1CK1A 1QILA 2PYKA 1KDAA 1V1OA 2F0DA 3BG3A 2PZWA 3MFYA 2MUYA 5JOBA 1O78A 2E76C 3AB9A 4F8MA 5CYUA 5IT9E 4DXFA 5C4JB 1CZWA 2NN6H 3Q23A 1EOTA 4ZAIA 4ZK9B 2JYOA 3GD7A 2JEAI 1OXTA 4XXEA 3ERQA 1NR4A 4A3KB 1IW7D 1OXUA 2EYLA 2F0IA 4X3KA 1LTBD 1YNNC 1T5XD 1A3TA 3A56A 2CVRA 4K6LA 1Q1EA 1QNKA 4FVMA 3KF8A 4HR7B 1Q8IA 4V0BA 3OW7A 4RWSC 4K8IA 1B9MA 4FF4A 2A6EC 1EIGA 2I07B 4NMZA 2M9VA 5LL6S 5DAUA 4K14A 1E2VA 2QEJC 4GZYC 1EU4A 2FMMA 3CQZB 1LTRD 3DWQA 4G7OC 1EZ6A 1Y8NB 1HQRD 2A74C 2EE1A 1K83B 2QKIC 3A7LA 3MEHA 1IKLA 3FEWX 4CKBA 4FF2A 5CV9A 3Q22A 5IGBA 1SMYD 4G4KA 1Z47A 3HEJA 2X6LA 3L7ZC 4A3BB 2N55A 4KKSA 5M3FB 4NDXA 3TP7A 1HTPA 4NW2A 4FXDA 3C1FA 1M8AA 1RJTA 5EPKA 2AUJD 1BO0A 3J7AV 1TS5A 4WORA 1ENAA 1SMYC 1JE4A 1B1ZA 4PNYA 2H4OA 3GP7A 1EEFD 4RGNA 2R6GA 3MZ5A 4FF3A 1CHQD 5KRUA 1GUOA 1X3QA 5C5LA 3MHBA 3QWNA 1SE4A 3I70A 1MI2A 5FO8B 2F0NA 4TRDA 1QNUA 5M5YB 2EOTA 4IURA 1H9SB 5EKLA 5C0XJ 2A69D 1BNZA 4MIUA 5J39A 1EWHA 2EYHA 4RH6A 2PQEA 1PFBA 3J81L 1HA5A 1PDQA 4QB4A 2NTTA 1S5CD 2CW0C 4XT3B 4CJ2C 2XSCA 3T53B 5IODA 1H9SA 1TWHB 3L9AX 3CRKC 3H94A 2BA1A 3D3RA 1H9MA 3QOJA 2FJ2A 4O42A 5D65A 3M4YA 3PIO3 2D2CC 3T51B 4KN4C 1HTLD 4BA1I 3L3OC 1S5ED 1AP0A 3MWYW 4IUPA 3D6CA 4XIGS 5G3LD 3LWUA 4RFBA 1W6JA 1ET9A 3HG9A 4DNRB 1SBBB 2AUKA 1I4PA 5M5XB 5IGEA 4KY5A 4P2CB 4XT1B 2B2YA 1D1IA 1EY7A 3M4OB 1JOQA 4CKCA 1DXMA 2BA0A 5DEHA 3G7LA 2OF1A 4HMJA 3NTKA 1ESRA 3OIPA 1BXTA 1Y8PB 2CQAA 5CV4A 5EQ0A 2KOLA 4DFAA 1BQQT 4DGZA 2F0JA 4KY7A 1Y8OB 2KA7A 5T1IA 1DCZA 1EZ8A 3DMUA 2E2JB 3DM1A 1WVLA 3MC0B 1O7ZA 1TY2A 2NTSA 1G6ZA 4RKLA 1YNJD 2LY7A 4IQZA 4IFDG 1SXTA 4LAAA 3T16A 1MD2D 2G9HD 4FYDA 2X69A 1HXYD 3J7AF 4DAVA 4KK7A 2K01A 1JR0D 4N9TA 3OMCA 1XYIA 3IKJA 2HQEA 4QUFA 1JWSD 1FR3A 2DY8A 5DM63 1S4ZA 4O1NA 4KKTA 5BN4A 2EY6A 3EFXD 2B8GA 4OIJA 1SSOA 2F0EA 3GTLB 3D6WA 2NBFA 1EY6A 3KUPA 4S3SA 4HMIA 4KTAA 1AW7A 3J7YW 3K5LA 1MBYA 1QJOA 5D3IB 3GO5A 5CR3A 3EJIA 3H3VC 1DD2A 2A68C 2A6HD 3QIAA 2Q8TA 1EIHA 5E1FA 3VR3A 3JAML 1K8OA 2K05A 2MPMA 5COYA 5I6YA 1SYDA 5ELBA 2L55A 3D4RA 4KKUA 5C3XA 1FNVA 2C5CA 5CV8A 3HP3A 2AQ1B 2RDHA 2SDFA 4JBWA 1LT4D 5KNCA 2PW7A 1C48A 2NWGA 3LX0A 4C3HB 1RTOA 3RLFA 2DNCA 1XTCD 4IUVA 1Z6HA 2AWOA 3N52A 1AZQA 2BDOA 1WTOA 1STNA 1KTKA 3T56B 1SFOB 1D2BA 4F7XA 1HUMA 4DA2A 2F0QA 2Y0SB 1SJHD 1KLGD 2WKCA 2EY1A 2WINB 3DUZA 2BE5C 3MXGA 1LV9A 1UEAB 1TS3A 3V2TA 1F77A 4RCOA 1B9NA 2PPBC 3NUCA 3RMHA 4Q5VA 1UNSA 1F9QA 1RDPD 4ZQ3A 1PRTB 4RA8A 3V05A 1AEXA 5C4ZA 4OO1H 1STBA 1J8IA 1SNOA 1VF7A 4RHRA 4EVOA 3S1QB 1A15A 3K7AB 5CORA 1SNCA 4BBRB 3Q0AA 1SAPA 2XNAC 3HZXA 5CGKA 1HCZA 1ESFA 1Q12A 2I46A 3FPPA 1E2ZA 2B2WC 3HOXB 2VNUD 1CQFA 2F0OA 1HFNA 3K59A 3H09A 4MHEA 4J1MA 3Q24A 3NBIA 4FXGC 1A2TA 2V4DA 3P7JA 4TQUS 4UAIA 4U68A 3HOUB 1I4QA 3KBGA 5IGFA 3FDTA 1KNAA 1OXVA 1ENCA 4AYBB 1PZID 2R93B 1U4MA 2IX1A 3R93A 1S5BD 2WV6D 4ZYSA 3V96A 2DY7A 4CKEA 1CHPD 4HN7A 1PYWD 4RGTA 5BN5A 1ZXTA 1EY0A 5HGTA 1O80A 3SK4A 1OO9B 2F0LA 1TWAB 1CQVA 3GQBA 3OSOA 1JQYD 2B2VA 1MGSA 1NUCA 2EY5A 2SNMA 1JB3A 4WFN3 5EKIA 2KHSA 3S14B 2EYFA 5FO7B 1IKMA 3X3MA 2WB1B 1TWGB 2Z4IA 5C3EB 1BF4A 2AWNA 2F0FA 3PV0A 1JORA 1B44D 2OT2A 2O5IC 2EY2A 2HDLA 1EQTA 1V43A 2B2UA 1Y1WB 1ZYRD 4ODGA 5C4HA 2ZXRA 1EL0A 4R8IA 1O7YA 2PZUA 2GA4B 4X3UA 1F9PA 1PTOD 3C1EA 1RHPA 3KK7A 1WCMB 1SNMA 2VXWA 3E5SA 2EYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI2 A;  2HCI A;  1DOM A;  1F2L A;  2NWG A;  4IUQ A;  5EJW A;  1PLF A;  5T1G A;  4ZLT F;  1ICW A;  2KED A;  2L11 A;  2RA4 A;  3DM1 A;  1KNA A;  1PFN A;  3FDT A;  1O7Z A;  2EE1 A;  4XT3 B;  1KNE A;  5E4W C;  4CJ2 C;  1G6Z A;  3QO2 A;  1CA6 A;  1NR2 A;  1RTO A;  2B2U C;  4ZKB B;  1IKL A;  1C8C A;  1QG7 A;  1SDF A;  2X6G A;  3TZD A;  1U4M A;  5EPL A;  4IUV A;  5CBA E;  4X3S A;  3R93 A;  1WTW A;  3TN2 A;  1HRJ A;  2X69 A;  1BBX C;  3IL8 A;  1NCV A;  2DY7 A;  3N52 A;  4XDX A;  1F9R A;  1AZQ A;  1WTV A;  1HUN A;  1WTO A;  3Q6S A;  2B2V C;  2L9H A;  2K01 A;  2KEE A;  1TVX A;  2J7Z A;  5D14 A;  3I91 A;  4HCS A;  1HUM A;  1XYI A;  2D9U A;  2RSO A;  3ONA B;  2K04 A;  1ZXT A;  1J9O A;  2NYZ D;  1MSH A;  2X6L A;  5AFW A;  4QUF A;  2H1E A;  2N55 A;  2DY8 A;  2FJ2 A;  3FPU B;  4O42 A;  1S4Z A;  1Q3L A;  4MN3 A;  3SVM A;  1O80 A;  5DNF A;  1HFG A;  2RSN A;  1X3P A;  5D65 A;  1B2T A;  2K1B A;  4CJ1 B;  4NW2 A;  5E4X A;  1M8A A;  2MP1 A;  3IFD A;  1LV9 A;  1RJT A;  2B2T A;  1DON A;  5EPK A;  2HUG A;  1DZ1 A;  1BO0 A;  1GUW A;  2B2V A;  2L4N A;  1MGS A;  1JE4 A;  4ZKC B;  1AP0 A;  1G2S A;  3MWY W;  4IUP A;  1SSO A;  4OIJ A;  1HA6 A;  1U4L A;  3KBX A;  1B3A A;  4QUC A;  1B53 A;  3D6W A;  1VMP A;  1B50 A;  1PFM A;  4LMQ D;  5EKI A;  1AZP A;  3KUP A;  2RVL A;  4RAU C;  1XX8 A;  1VMC A;  2N88 A;  1G91 A;  4X3T A;  1EOT A;  4ZAI A;  4ZK9 B;  1F9Q A;  2HDM A;  2JYO A;  1IL8 A;  2KEC A;  2K28 A;  1WVL A;  2B2W A;  1X3Q A;  4RA8 A;  1NR4 A;  1IKM A;  1U4P A;  4OIK A;  1U4R A;  1CA5 A;  1WD1 A;  1G2T A;  2Q8T A;  5EPJ A;  3DEO A;  2FHT A;  1EIH A;  5CBE E;  2Q8R E;  3I3C A;  3H91 A;  4HED A;  4X3K A;  1J8I A;  1BF4 A;  2B2T C;  1MSG A;  3MTS A;  1JIC A;  2HCC A;  1MI2 A;  4IUT A;  2CVR A;  4XT1 B;  1F9S A;  2B2Y A;  3DEP A;  5JJZ A;  2JP1 A;  2NZ1 D;  4CJ0 B;  1A15 A;  1QNK A;  2K03 A;  2EPB A;  1HHV A;  1ROD A;  2XIW A;  2MJ8 A;  1DOL A;  2L1B A;  3GV6 A;  4R9W A;  2K05 A;  2MPM A;  5COY A;  5COR A;  2EOT A;  1E0B A;  2HDL A;  1EQT A;  2MGS A;  3G7L A;  2BDN A;  1ILQ A;  4IUR A;  2B2U A;  1SAP A;  3LWE A;  4IUU A;  1QE6 A;  4RWS C;  2KUM A;  1WTR A;  2M2L A;  2R3Z A;  1BNZ A;  1NAP A;  1ESR A;  1EIG A;  1RTN A;  2KVM A;  1EL0 A;  1WTQ A;  2FIN B;  2L12 A;  1O7Y A;  4R8I A;  2B2W C;  1WTX A;  1DOK A;  3HP3 A;  4X3U A;  2B2Y C;  1F9P A;  5EQ0 A;  2KOL A;  2IL8 A;  2SDF A;  1PFB A;  3I90 A;  1RHP A;  3F2U A;  5CMD A;  4MHE A;  1WD0 A;  1HFN A;  3I8Z A;  1ILP A;  4DN4 M;  1WTP A;  1PDQ A;  2FFK B;  1X32 A;  4HSV A;  3P7J A;  3GV3 A;  4UAI A;  5T1I A;  4U68 A;  1B4O A;  4HAE A;  2VXW A;  2FMM A;  1CM9 A;  1ML0 D; 
#chains in the Genus database with same CATH topology
 3NHH A;  4ZCK A;  1XMO Q;  1K8M A;  4PZ8 A;  5EJW A;  4X65 L;  1WTV A;  2E75 C;  3OTO Q;  4FXK C;  1R4P B;  1TQO A;  4EQO A;  4XYQ A;  4DV3 L;  4DR4 L;  4X62 L;  3I4N G;  1H9J A;  1BCP B;  1HZB A;  1EUJ A;  1IXR A;  4I7A A;  3MXN B;  4AQY L;  1LAC A;  5EAY A;  4F87 A;  2N78 A;  1YHQ A;  4JYA L;  1GJX A;  4JI1 Q;  3NBH A;  1J9O A;  1O7I A;  1X9N A;  5GRO A;  1Q3L A;  3SVM A;  5DNF A;  2M00 A;  4A93 B;  2Q2H A;  5IWA Q;  2UUC Q;  4MTK A;  1S5F D;  5K36 H;  5E4X A;  1J5E Q;  2KQ3 A;  5EBD A;  2CH4 A;  5C5M A;  4FNF A;  3TP5 A;  3GTK H;  3OMG A;  1LO5 D;  1JWM D;  5E7N A;  1I6H H;  4C3I G;  4DV1 L;  1HA6 A;  5FLX E;  1IBM L;  3ZYY X;  3PO2 G;  1VMP A;  1RIP A;  1TXY A;  1B50 A;  1V1P A;  1VF5 C;  1AZP A;  4P74 A;  4K0K L;  3TRE A;  4QF4 A;  2L0C A;  4DV1 Q;  1K3R A;  4LF5 Q;  3RZO H;  3SK6 A;  5IT9 c;  1TU2 B;  4OWX B;  2K5D A;  3AFQ A;  2CCZ A;  5JEA G;  5C0X H;  3S1M B;  1V8Q A;  3DEO A;  1DYQ A;  3B6Y A;  3J81 c;  4HJA A;  2K50 A;  3R2T A;  2F0T A;  4IFD H;  1GXD C;  2PNR C;  1STH A;  3FKI B;  1CKN B;  1N8R C;  2UXC L;  2Z9H A;  1CT1 D;  4YCV A;  3T13 A;  1EWI A;  3BS1 A;  3HGB A;  2WAQ G;  1RTN A;  1Y1V B;  2EYM A;  2JE6 I;  1F2Z A;  4KHZ A;  1DOK A;  3OTO L;  4ZRZ A;  5GAG C;  3F2D A;  3BDO A;  4A3K H;  3I8Z A;  3U4Z A;  5IP7 H;  2K75 A;  3UDX A;  2FFK B;  2A68 D;  4H13 C;  1IBK L;  3GV3 A;  3PUY A;  1YHA A;  1KD1 C;  1R9T B;  4IJL A;  4LF8 Q;  3GTK B;  4JI4 L;  2EYP A;  4DAY B;  4N9P A;  2UXD L;  1E3P A;  1LYL A;  3K0Y A;  1NJI C;  1QG7 A;  4ILW A;  2K32 A;  1YHB A;  4EQN A;  1EYC A;  2LKV A;  2UUC L;  2UXD Q;  3DM3 A;  4RG1 A;  3PO3 B;  4HCS A;  2IX0 A;  2O2L D;  2YYZ A;  4DU9 A;  2Z4H A;  1SYG A;  5J1Z A;  5FKA C;  2JA7 H;  4A3D B;  2A6E D;  1A8V A;  4DV2 Q;  1KLU D;  1EYA A;  1X3P A;  1I50 H;  1S40 A;  4LF6 Q;  1FL0 A;  2IHF A;  1RF2 D;  2Z6B A;  4OL7 A;  2QDB A;  4RCN A;  1PTO B;  4L5S A;  2N49 A;  1GHK A;  2OCE A;  3HFZ B;  4DV2 L;  2ASB A;  2NB0 A;  2G9D A;  2TMP A;  3NE5 B;  4QUC A;  4C1N K;  3BVM A;  2DN8 A;  1D5X C;  4LUO A;  1PH4 A;  1L1O C;  1JOO A;  2JA7 B;  3NXW A;  1JWU D;  2EYO A;  3BDL A;  3PSI A;  2PW5 A;  4B08 A;  3ULJ A;  4A3B H;  5I4D A;  2ES2 A;  4JI0 L;  2K28 A;  2WII B;  4NP5 A;  4A3F B;  4OGQ C;  4ABN A;  3A8I E;  1WD1 A;  2B63 B;  1STA A;  1IYV A;  2FHT A;  2Q8R E;  1NTG A;  2RDG A;  4BY1 G;  3TZU A;  1W6K A;  3HOU H;  3OWF A;  5GAD C;  5LMU Q;  4R4Q A;  3SDZ A;  2EPB A;  1CFM A;  3N6R A;  4KJN A;  3GV6 A;  2ZTC A;  1HNZ L;  2WKD A;  5EKK A;  4JOI A;  2ID0 A;  1VQH A;  3BZK A;  3NBH B;  1GUT A;  4Y7N B;  2D0P A;  2A5H A;  3HKZ E;  2XWB B;  4APV A;  3M4O H;  1SJE D;  3A7A B;  4KHV A;  2LXJ A;  2PMZ E;  4HCE A;  2EJM A;  5JPM C;  4DV7 L;  1R4Q B;  1ENF A;  1YIJ A;  2Z0S A;  3LNN A;  1SNP A;  1T5E A;  2JA8 G;  4C3J G;  2OEO A;  2EJG C;  3VA5 A;  2ZT9 C;  3AQQ A;  1Q8K A;  4C2M B;  3CW2 C;  1KNE A;  2Q2T A;  3QO2 A;  1HR0 L;  5C4X G;  4YWK A;  1SDF A;  5JEA J;  5FO9 B;  4JI6 Q;  2E2H B;  4GKJ L;  1NCV A;  3OHX C;  4DKA C;  2UXC Q;  3Q6S A;  4A3E G;  1QVG A;  4K0K Q;  3M3Y H;  2LFN A;  2OQK A;  2JA8 B;  1F2Y A;  3ONA B;  3CC4 A;  3FPU B;  1QWY A;  2ICE C;  5C4J H;  5EGT A;  1XWE A;  1SN8 A;  3T1Y L;  2MP1 A;  2B2T A;  2A69 C;  2B63 G;  3I4O A;  4BBR G;  1SFO H;  4RGO S;  1G2S A;  2NZO A;  1W3S A;  4NXN L;  1LUZ A;  2Y0S E;  1II3 A;  5FLX L;  1LLR D;  5KYL A;  2C9O A;  4ULL A;  1VMC A;  5I9O A;  4FF1 A;  3HOW B;  2KCN A;  1VQE A;  3CCU A;  4B3R Q;  2RKS A;  1IL2 A;  1AFP A;  5C0X G;  2OXP A;  3HKZ G;  2CFM A;  1FNW A;  3HKZ B;  3NEM A;  2BE5 D;  2VQE Q;  4OIK A;  2YU9 B;  2YTX A;  1VQM A;  1G2T A;  1EY8 A;  3RN2 A;  3HOZ G;  3NEN A;  3MTS A;  4X65 Q;  2D62 A;  2A73 B;  3TEH B;  1STG A;  3NPP A;  2EVB A;  3TSS A;  4HSP A;  4C2M H;  5IOC A;  3VA7 A;  2OQ0 A;  1H9R A;  4KMU C;  2XIW A;  2PZT A;  1IBM Q;  4JV5 Q;  1Q1B A;  4GOP A;  4Y52 H;  4GLA C;  2J4X A;  3S24 A;  3UDG A;  3L0O A;  5A2Q L;  4A3K G;  4K2K A;  2JJQ A;  5IYD H;  5IP9 G;  3CRL C;  4X64 L;  3S9W A;  2FMC A;  1WD0 A;  1HNW Q;  4GKJ Q;  4HSV A;  4IAL A;  1STY A;  1IHZ A;  1WYD A;  2KJX A;  3H0G H;  2NVY B;  5M9O A;  2E5L L;  1DOM A;  4RHS A;  1IBL Q;  2O5J C;  1ZYR C;  5C0X I;  4CDC C;  2I5H A;  2J0T D;  1GUG A;  4IZ8 A;  2F0H A;  4P71 A;  3AFP A;  3UDI A;  4G7Z C;  4RKB A;  1HRJ A;  1G51 A;  4GNX B;  4G7H C;  4XDX A;  1JC7 A;  1F9R A;  3IRB A;  3CME A;  4DV6 L;  1N36 Q;  5D14 A;  1TVX A;  4A75 A;  3SEB A;  2HIX A;  1U9R A;  3J80 c;  1SE3 A;  5LHY 1;  3TP8 A;  2FXQ A;  1HPC A;  1MSH A;  1HZA A;  1I3Q H;  1STE A;  3CAM A;  1PH7 A;  4MN3 A;  5C44 H;  1XMO L;  1K0S A;  5ELE A;  3SXH A;  1PH8 A;  3KFU A;  1A2U A;  2F0P A;  3M3Y B;  4A3G H;  1TWH H;  2R93 H;  3U9O A;  4OEL B;  4AH6 A;  5FLM G;  4LW1 A;  2IPK D;  1YNJ C;  4K8J A;  2YU9 H;  3MXP A;  2WAQ B;  3KDF A;  2QGQ A;  1Y1W H;  1C9O A;  4LUZ A;  4HJ5 A;  1VQ8 A;  4LF9 L;  1L1O B;  1QOH A;  3M7G A;  4KN7 C;  1HNX L;  4A3B G;  1SRO A;  4UP8 A;  1XX8 A;  5C44 B;  1LTL A;  4X3T A;  1I4R A;  4YHH Q;  3PO3 H;  2KEC A;  4NXM L;  2F0S A;  2CHB D;  4Q0F A;  4BY1 H;  3QG1 A;  4A3F G;  1L2F A;  1U4R A;  5HUR A;  1SYF A;  5KNB A;  1TWF H;  5KIX A;  1LT6 D;  4IUT A;  5I9P A;  2HCC A;  3DEP A;  4C1N I;  1SYE A;  4OX9 Q;  3I73 A;  3UDF A;  5IGC A;  1KAA A;  3BVG A;  5IYB H;  3X3N A;  3GDE A;  2UUA L;  3SR1 A;  1IBL L;  1ILQ A;  1EYG A;  1HR0 Q;  1HZC A;  3LWE A;  3STB C;  3CQZ H;  5G3L F;  1L0X B;  4IPH A;  4PZ7 A;  3BVZ A;  1WTQ A;  1TWC H;  4NXN Q;  4YCW A;  3JAM c;  4OWT B;  2IL8 A;  4DUY L;  4B3M Q;  1PMR A;  2TSS A;  4PMC A;  1UE6 A;  2KCC A;  2RQX A;  3TDQ A;  3C46 A;  1CSP A;  1I6V C;  1HQM C;  1X32 A;  4GS3 A;  4BA2 I;  4FP5 D;  4A3D H;  1CM9 A;  3A0J A;  3UI2 A;  3FKI H;  1HNW L;  2AQ2 B;  5C3E G;  4H44 C;  3K80 C;  1RL2 A;  2A6H C;  2RA4 A;  5ISR A;  5E4W C;  1I6H B;  2RBM A;  5A35 A;  2AHO B;  4K5W A;  4KHP L;  1I4G A;  4DAP A;  4LF7 Q;  4LUV A;  1JB7 A;  5M3F H;  2NN6 I;  2CW0 D;  2F03 A;  2K14 A;  5EPL A;  5BN3 A;  1SYC A;  3H0G G;  3IL8 A;  3NWS A;  2Q2U A;  4UP9 A;  3HOV G;  2JK8 A;  1E1T A;  4JBM A;  1H95 A;  2K5V A;  1PFS A;  3M4P A;  2B2V C;  4NB3 A;  3TME A;  4A3L G;  2KEE A;  2K04 A;  4X6A H;  1A6X A;  2RDF A;  4R8N A;  3PF5 A;  3PF4 A;  1NY4 A;  4UHV A;  4WRD A;  4X66 L;  3LGJ A;  3ERO A;  4TKO B;  5I6W A;  4IFD J;  4MNO A;  3IFD A;  4JYA Q;  5DM7 3;  3GTG H;  1EYD A;  2HUG A;  3G6E A;  1DZ1 A;  4A76 A;  1AN8 A;  3U50 C;  1U4L A;  1JJC B;  1V1Q A;  4L8J A;  4UDU C;  1XMQ Q;  3K5N A;  1SYB A;  3A54 A;  1PFM A;  4LMQ D;  3U9S A;  1E7Z A;  2PO4 A;  4RAU C;  3K7U C;  2F3W A;  4KD3 A;  2N88 A;  1G91 A;  2HIV A;  1I3Q B;  3VR5 A;  1PZJ D;  2NN6 G;  3RD4 A;  3HKS A;  3PIO A;  4JI2 L;  5GQO A;  2LMC B;  3I3C A;  4J6H A;  3H91 A;  1VQB A;  2I5L X;  3E6Z X;  3CCS A;  4TSS A;  4IO9 A;  4A3G G;  4H7B A;  4OO1 G;  5JVH 3;  1DOL A;  1QB5 D;  3ULL A;  2MGS A;  1K83 H;  3RUZ A;  1Y1W G;  4V19 0;  1XPU A;  1QE6 A;  1WTH A;  2KUM A;  2VUM G;  3PIP A;  4KJO A;  2IY5 B;  3ITP A;  3NP8 A;  1CI3 M;  4K6D A;  4DV7 Q;  2Z8L A;  2D5D A;  4P72 A;  2K33 A;  1RD9 D;  3W2D A;  1QZG A;  1GHJ A;  3FHW A;  1PH3 A;  4BBS B;  2G5D A;  3I90 A;  1Z7T A;  4OXP A;  3G71 A;  4X62 Q;  3G6J B;  4KV6 A;  4WJW A;  2KEN A;  2PCF B;  1KDB A;  1SMX A;  5IE8 A;  1ML0 D;  3FVQ A;  2R92 B;  1BR9 A;  1A3U A;  1F2L A;  2HCI A;  1ET6 A;  4IUQ A;  4ZLT F;  5T1G A;  1VQN A;  1ICW A;  1EU3 A;  1EY4 A;  2NUC A;  1X55 A;  4I65 A;  5ELN A;  3OWE B;  1OTC A;  1HJP A;  4ZKB B;  1C8C A;  1K73 C;  3KLW A;  5BR8 L;  4IUN A;  3S2D H;  4EGV A;  1D6E C;  3MFG A;  4QIW B;  2RHQ B;  3PUX A;  1W2B A;  1ZEQ X;  4M1U B;  1Y1V G;  5E3F A;  1EWC A;  4OO1 I;  2RSO A;  4JI5 L;  5AFW A;  1JMC A;  3S14 H;  5IT9 L;  3C3L A;  1LT3 D;  1QZH A;  3IAY A;  2DJF C;  1JCK B;  3HOW H;  2WP8 J;  4HJ8 A;  1TS2 A;  3H3V I;  2VUM H;  1YZ6 A;  3S1N B;  1DON A;  4DAY A;  5KYI A;  2O4X A;  3S17 B;  1PZK D;  1UEB A;  1VQG A;  5IY0 A;  3KBX A;  2EJF C;  1B53 A;  5FLM H;  4XQJ A;  5IGD A;  1KDC A;  3K5O A;  4LK1 C;  3KJP A;  2R93 G;  1P16 A;  4QIW E;  4HJ7 A;  4JI8 Q;  4LF4 Q;  1H9K A;  4Y7N H;  1PRT D;  5J22 A;  2KHJ A;  5IP9 H;  4B9W A;  5H1S E;  4BBS H;  2VUM B;  4L63 B;  3NQT A;  4O2D A;  1S3O A;  4IFD I;  4DV0 Q;  1SE2 A;  3BYT B;  1CA5 A;  3VYS A;  3D4W A;  3BDC A;  1E24 A;  5CBE E;  2L5T A;  4YY3 L;  1JIC A;  2NVY H;  2XRS D;  2R61 A;  1LT5 D;  5JJZ A;  1PTO H;  1XJV A;  2K03 A;  3GTP B;  1CTM A;  4QGU A;  2B8F A;  1GUW A;  1E0B A;  5JEA H;  3K6O A;  2SEB D;  3WWV A;  4DK0 A;  4JW0 A;  1TWF B;  1MHW C;  1G29 1;  1WTR A;  5DLQ E;  2HD3 A;  5KEE A;  2IW3 A;  2KVM A;  4PMB A;  1PYS B;  1A3V A;  4A3M H;  1Y14 B;  2R7Z G;  2YTV A;  1EQV A;  2LS0 1;  4DK1 A;  1N32 Q;  2UXB Q;  3KJO A;  4DR5 Q;  1AE2 A;  3JAM E;  1HR0 W;  3SK8 A;  5C3E H;  1ILP A;  3NQI A;  3U4V A;  1WTP A;  1EY5 A;  4HIO A;  3FKI G;  3T1H Q;  4DF7 A;  3FRP B;  4JI5 Q;  2IT1 A;  4DV4 Q;  4A93 H;  2UXB L;  2B29 A;  1PLF A;  1MJE A;  1CA6 A;  2B2U C;  1D1K A;  2MFI A;  5ELO A;  4NKL A;  3MA2 B;  1RCV D;  3VDY A;  1BDO A;  2RHS B;  4X3S A;  3T4A C;  3PIP 3;  1WTW A;  1PH2 A;  3GTO B;  1BBX C;  4JC0 A;  4IOA A;  4P75 A;  4YHH L;  5AJ3 Q;  3J7A 5;  5C6A A;  1QUQ B;  1Q81 C;  1S5D D;  4N8X 1;  3R2I A;  2F0G A;  3ND8 A;  4JBK A;  5JJL A;  3P75 A;  1FNU A;  2D9U A;  2SNS A;  1KRT A;  1X3E A;  5CV5 A;  5LMN W;  2E2I H;  3I4N H;  3ND9 A;  2DJG C;  1PH9 A;  1HFG A;  4OON A;  4GN4 B;  1GOZ A;  2F3V A;  4LFA L;  1B2T A;  1XNQ Q;  3HRZ C;  4DR1 L;  1TII D;  1LTG D;  4POG A;  1E2W A;  1OXX K;  3K5M A;  1IYJ B;  5TSS A;  1Q90 A;  3HOY B;  4WJ4 A;  4GNX A;  1VQF A;  1VQA A;  2L4N A;  2EXD A;  3OIQ A;  4OWW B;  4JVZ A;  4ZKC B;  1SEB D;  1B3A A;  1WJJ A;  1WOC A;  3MXN A;  3GTQ B;  3VR2 A;  4G57 A;  3AMU A;  3I4N B;  1UE5 A;  3M4Q A;  2E2I B;  3URY A;  1MJC A;  3HS0 C;  1ZKO A;  4JI3 Q;  3ER0 A;  3RZD H;  2QEX A;  4CHT B;  1VS0 A;  3VYT A;  4DUZ Q;  1IZ6 A;  1BCP C;  4PV1 C;  2ZXP A;  4A3D G;  1TWA H;  2VB2 X;  4DR7 Q;  2NVT H;  4IN3 A;  4DR6 Q;  3EA6 A;  3J81 E;  5IYC G;  4R9W A;  4HIM A;  3VYU A;  1XMQ L;  2E2D C;  4XYO A;  1V9P A;  4IUU A;  1CZG A;  4R4I A;  3EVQ A;  2EQS A;  3K58 A;  2KCM A;  4A3I H;  3RZO B;  1X56 A;  2CQO A;  4EQP A;  5KND A;  3HOX G;  4RGM A;  5ELC A;  4LFC Q;  5C44 G;  5F2D A;  2NVT B;  5CC4 A;  4BY1 B;  3E0J A;  5CMD A;  3S2D B;  4CBV A;  3AU7 A;  4LNQ A;  1WFQ A;  1BUV T;  1PH6 A;  4JBJ A;  3I4L A;  2XRQ D;  1BCP D;  2L11 A;  3NTI A;  2Z1C A;  1IYU A;  4GOP B;  2D0O A;  2V1C C;  3S1R H;  1VQ6 A;  5FLX c;  1NMG A;  1CKN A;  1XPO A;  3R8B A;  1NMF A;  2N8N A;  3I91 A;  4C56 C;  1UWV A;  5KGU A;  1D7Q A;  2NVQ B;  3RZD B;  3A55 A;  2VS1 A;  1N32 L;  2A1A A;  3BYY B;  2EZV A;  2BOS A;  2RSN A;  4A93 G;  1EFI D;  1LTA D;  1TS4 A;  2VW9 A;  3T1H L;  2QIL A;  4M8A A;  1KAB A;  2Z6K C;  4BY7 H;  4XQN A;  4ME3 A;  1KC8 C;  1NBW A;  4BS9 A;  3WOF A;  3FP9 A;  5JJI A;  1VQI A;  1ICF B;  2Q8I B;  5JVG 3;  1PHJ A;  2PI2 E;  3CD6 A;  5JJK A;  2IJ0 A;  2GVB A;  1BKB A;  1UAP A;  2BCO A;  4BBR H;  1IL8 A;  1V1P B;  4TVA B;  1G8Z D;  2K6A A;  3R3O A;  1OXS C;  2AQ3 B;  2I0Q A;  1EY9 A;  1PXU A;  3GTG B;  1I50 B;  3DXJ C;  2EDG A;  4X64 Q;  5ELF A;  3E0E A;  2JP1 A;  1DM0 B;  2F0U A;  3NWT A;  3QB3 A;  5FK9 C;  4PMW A;  4BY7 B;  3W5O A;  1HHV A;  4A3C G;  2L1B A;  1KIX A;  2MO0 A;  5LL6 X;  5CV7 A;  2XVS A;  4POF A;  3CMA A;  3HOV B;  3H0G B;  3MVV A;  4LWC A;  3J80 i;  4JPB W;  4B3M L;  1C4Q A;  4BXX H;  3SE0 A;  4ZUI A;  4DXG A;  1NAP A;  3EQL C;  1IW7 C;  3F1Z A;  2FIN B;  2L12 A;  2A8V A;  3PMF A;  1EEI D;  4AYB E;  1BOS A;  5CV6 A;  2B2Y C;  1IBK Q;  2VL6 A;  4A3M G;  2UUB Q;  3UE1 A;  2E74 C;  2QDL A;  3J80 L;  4DN4 M;  4JCV E;  5IGG A;  3TQY A;  1I4H A;  2EXZ A;  1B4O A;  3J81 j;  2JA5 B;  3E9I A;  5JAV A;  2A19 A;  1ONL A;  4KD4 A;  3DHQ A;  1L0Y B;  5A2Q E;  1PFN A;  5M3M G;  3EBE A;  4C3H G;  1RKN A;  1UE1 A;  4JOI C;  1M1K C;  2X6G A;  3TZD A;  5CBA E;  3H6M A;  4BWG B;  3TS0 A;  2R7D A;  3TN2 A;  4DR6 L;  4C3I B;  3P1H A;  3PUW A;  3S2H B;  3S17 H;  1DJR D;  5NUC A;  3OOC A;  3HOX H;  2RCN A;  3KDF B;  1JJG A;  5LMU L;  4C3H H;  3NSW A;  2B63 H;  2K5Q A;  1PRT C;  4CJ1 B;  4B3S L;  3RLO A;  4NXM Q;  2F1M A;  2EIF A;  1GUS A;  2DNE A;  1ASY A;  4Z9C B;  2IX3 A;  5LMN L;  1VCI A;  3MEF A;  2F0V A;  2F0M A;  1PH5 A;  4IPC A;  3PUZ A;  2F0W A;  4HID A;  2K4K A;  3MAQ A;  2PQA A;  4JV5 L;  4K5V A;  4QCL A;  3QJY A;  3M85 A;  4HTH A;  5FOB B;  4FO2 A;  3TP6 A;  1K9M C;  2ENB A;  3SK5 A;  3I4M B;  2HDM A;  1SNQ A;  1PVO A;  4A3E B;  1VQ4 A;  2B2W A;  1LAB A;  3WOE A;  1D5M C;  4DV4 L;  3HOZ H;  1K28 A;  2DUD A;  1VDZ A;  2QF7 A;  5EPJ A;  2NVX B;  4HED A;  5FJ8 G;  3CPW A;  2B2T C;  1MSG A;  5M5W B;  1CKM A;  1F9S A;  4CJ0 B;  3PO2 B;  2IWH A;  2SOB A;  3HOY H;  1YNN D;  4L5Q A;  1FYC A;  1ROD A;  4AIM A;  1LTI D;  3OPO A;  3I72 A;  3CHB D;  4E6I A;  3CCQ A;  4L6T B;  1NSN S;  1VQO A;  2R3Z A;  1SR3 A;  2AMC B;  2XN9 C;  4U67 3;  3J7Z C;  4OHJ A;  3M7N A;  4JI3 L;  3OW2 A;  3F2U A;  2F4I A;  3GTM B;  1SND A;  3DWP A;  1E1O A;  3AYH B;  3IFT A;  3JAM i;  3G4S A;  3GTJ B;  4YIJ A;  4BXX G;  1UE7 A;  1X3F A;  1PTO F;  4HAE A;  3P20 A;  2K5W A;  3EIV A;  3I56 A;  4A3C H;  4A3J H;  3G48 A;  2RCF A;  4GLV B;  3PQI A;  1GM5 A;  4KI0 A;  4GOP C;  4A3G B;  1LTS D;  4DNT B;  4PQX A;  5K5P A;  3PUV A;  3U58 A;  3K57 A;  1J5E L;  5HGQ A;  3C2P A;  4XTC S;  3D4D A;  4LJZ C;  1R9T H;  5IIF A;  2WAC A;  2L9H A;  1TY0 A;  3D0F A;  3M9B A;  1TKW B;  2NYZ D;  1XNR L;  1D5Z C;  3GTM H;  3BZD B;  1FD7 D;  1I4X A;  3H3V H;  2R92 H;  2K1B A;  3D31 A;  1FGB D;  3A8K E;  1QCB D;  2PMZ B;  4C3J B;  1A62 A;  3KLS X;  3FMC A;  1GUN A;  4KY6 A;  2XWJ B;  3NTH A;  2CH4 W;  4GKK L;  1KHI A;  5D3D A;  2B39 A;  2ICI A;  5I2X A;  3PO3 G;  4LFC L;  3CKI B;  4I7Z C;  2MHV A;  2NZH A;  3SHL A;  3S1R B;  1SLJ A;  2R7Z B;  2JA7 G;  4A3I G;  2RVL A;  4LF7 L;  1VQK A;  4A3M B;  1VQL A;  4DPG A;  1Y69 U;  1I94 L;  2JSO A;  3WDN A;  2JEB I;  1EFW A;  4ME5 A;  1U4P A;  2JA6 B;  5K36 G;  2JXM B;  1FJG L;  4R4T A;  2XGT A;  1TT2 A;  4XQQ A;  2P5Z X;  3VR4 A;  2NZ1 D;  3K8A A;  3F2C A;  4DNI A;  4F88 A;  1YI2 A;  1XXG A;  2MJ8 A;  3RNU A;  2ZTD A;  3S15 B;  4QQB X;  2BDN A;  2ZXO A;  4ZUJ A;  2YTY A;  3VYR A;  2M2L A;  5M5W H;  1VQ5 A;  1X65 A;  4QMG A;  4K5X A;  5C4X B;  3DWA A;  2K7V A;  3JC6 6;  3NK9 A;  1WTX A;  1O7L A;  3HOZ B;  2QW7 A;  3S16 B;  1TR5 A;  4CGY B;  5I2Y A;  4JI1 L;  1JOK A;  4ID6 A;  2F0K A;  5C3W A;  3D8G A;  3J80 E;  3CCE A;  1PRT F;  3TBI B;  1FVI A;  3QR8 A;  3CU7 A;  3A5Z B;  2KED A;  4L5R C;  1F2M A;  1MKH A;  2E8G A;  1GO3 E;  4J8Q A;  5M3M B;  4DR3 Q;  1M4V A;  1NR2 A;  3MXU A;  4AYB G;  4BY7 G;  5LMN Q;  3I2Z A;  4GLX A;  4JK1 C;  4K2L A;  3GTL H;  3HOV H;  3QOL A;  4A3I B;  3A8J E;  5ELD A;  1PTO C;  1LTT D;  2VB3 X;  4B9X A;  3CCV A;  1TWC B;  2F3I A;  3I4M G;  3O13 A;  1HUN A;  3W3A A;  4H0L C;  4A3J B;  2J7Z A;  1DGS A;  3KLR A;  4YWL A;  3T1Y Q;  3KLS A;  3VR6 A;  1BCP F;  3KF6 B;  2VY3 A;  1E22 A;  1QVF A;  4NPS A;  3STB D;  1UUP A;  2QCP X;  1XTD A;  2H1E A;  5EBC A;  4LFB L;  5JPN C;  4UP7 A;  1CK1 A;  1QIL A;  2PYK A;  4QY7 A;  3S1M H;  1KDA A;  5J3B A;  1V1O A;  2IHE A;  2HQL A;  2F0D A;  1BBW A;  3BG3 A;  1N36 L;  4DV5 Q;  2PZW A;  3MFY A;  2ZJP A;  2MUY A;  5JOB A;  1O78 A;  2E76 C;  3AB9 A;  3KOJ A;  5GAH C;  4F8M A;  5CYU A;  5IYD G;  5M5X H;  1PA6 A;  5IT9 E;  4DXF A;  5C4J B;  1CZW A;  4R4C A;  2NN6 H;  3Q23 A;  1EOT A;  4ZAI A;  4ZK9 B;  2JYO A;  2CKZ B;  3GD7 A;  2JEA I;  1OXT A;  4XXE A;  3E3X A;  3ERQ A;  1NR4 A;  4A3K B;  1IW7 D;  1OXU A;  2EYL A;  2F0I A;  4X3K A;  1LTB D;  1YNN C;  2R92 G;  1T5X D;  2JA5 H;  1A3T A;  3A56 A;  2CVR A;  4K6L A;  1Q1E A;  1Z9F A;  1QNK A;  4N8F A;  1YJ9 A;  4FVM A;  3I55 A;  3KF8 B;  3KF8 A;  2LSS A;  4HR7 B;  2N3S A;  3GTJ H;  1Q8I A;  4V0B A;  1WCM H;  3OW7 A;  4RWS C;  4K8I A;  1B9M A;  4FF4 A;  2A6E C;  1EIG A;  1TWG H;  2I07 B;  4NMZ A;  4A3L H;  2M9V A;  5LL6 S;  1VQ7 A;  5DAU A;  1T9H A;  1I94 Q;  1VQP A;  4JI0 Q;  4K14 A;  1E2V A;  2JN4 A;  2QEJ C;  2PI2 A;  4GZY C;  2QA4 A;  1EU4 A;  2FMM A;  3CQZ B;  1LTR D;  3DWQ A;  3KF6 A;  4G7O C;  1EQR A;  1EZ6 A;  1Y8N B;  1HQR D;  2A74 C;  2EE1 A;  2WB1 E;  1K83 B;  2QKI C;  1X54 A;  3A7L A;  3MEH A;  1IKL A;  4H02 A;  1L0W A;  3FEW X;  4CKB A;  4FF2 A;  5CV9 A;  3Q22 A;  5IGB A;  1SMY D;  1YEZ A;  4HIK A;  4GNX C;  4G4K A;  1Z47 A;  4O0A A;  4DK3 C;  1LM0 A;  3HEJ A;  2X6L A;  3L7Z C;  4A3B B;  3BZC A;  2N55 A;  4KKS A;  1J6Q A;  1VQC A;  3OYY A;  4NDX A;  3TP7 A;  5M3F B;  3ZJY C;  1HTP A;  4NW2 A;  4FXD A;  3C1F A;  4UY8 C;  1M8A A;  2BH8 A;  2VQF Q;  5FJ8 H;  1RJT A;  5EPK A;  2AUJ D;  1BO0 A;  3J7A V;  1TS5 A;  4WOR A;  1ENA A;  1SMY C;  1JE4 A;  1HZ9 A;  2ZTE A;  1B1Z A;  1JE5 A;  4R1J A;  4PNY A;  2HT1 A;  2H4O A;  3GP7 A;  1EEF D;  4RGN A;  2R6G A;  3MZ5 A;  3CC7 A;  4FF3 A;  3A74 A;  1CHQ D;  3RR5 A;  1GUO A;  5KRU A;  1Q7Y C;  1X3Q A;  5C5L A;  1HNX Q;  3MHB A;  3QWN A;  1SE4 A;  2GVA A;  3I70 A;  4YCU A;  4JI7 Q;  1S72 A;  4LFB Q;  4LF8 L;  1MI2 A;  1SE8 A;  1I5F A;  4L5T A;  5FO8 B;  2F0N A;  4TRD A;  5BR8 Q;  1QNU A;  1M90 C;  5M5Y B;  2HHH Q;  2EOT A;  4IUR A;  1U5K A;  4DUY Q;  2K5N A;  3ICE A;  1H9S B;  5EKL A;  5C0X J;  4UPA A;  2A69 D;  1XNR Q;  1BNZ A;  4MIU A;  5J39 A;  1AH9 A;  1EWH A;  2JA6 G;  2EYH A;  2HHH L;  1QUQ A;  4RH6 A;  2PQE A;  4RMF A;  1PFB A;  2L15 A;  4CDF C;  3J81 L;  1PDQ A;  1HA5 A;  4YY3 Q;  4QB4 A;  1YVC A;  2NTT A;  2UU9 Q;  2VQE L;  1S5C D;  2CW0 C;  2AKW B;  2B3G A;  4XT3 B;  4QJF A;  4CJ2 C;  2XSC A;  3T53 B;  4OEM B;  5IOD A;  1B3Q A;  2MQH A;  1H9S A;  1P8L A;  1B7Y B;  1KL9 A;  1TWH B;  3L9A X;  5C4X H;  3I4M H;  3CRK C;  3H94 A;  3F2B A;  1FJG Q;  2BA1 A;  4B3S Q;  4A3E H;  4LF9 Q;  2MO1 A;  3D3R A;  1H9M A;  3QOJ A;  2FJ2 A;  4O42 A;  4QL5 A;  4AQY Q;  5D65 A;  3M4Y A;  3UE0 A;  1Q46 A;  3PIO 3;  4IJH A;  2D2C C;  3T51 B;  1KXL A;  4EQ5 A;  4KN4 C;  1HTL D;  5IP7 G;  4BA1 I;  3L3O C;  1S5E D;  2JA6 H;  1AP0 A;  2ZJR A;  3MWY W;  4IUP A;  3D6C A;  4XIG S;  5G3L D;  2ATW A;  1YIT A;  3LWU A;  4RFB A;  3RN5 A;  3ERS X;  1W6J A;  2XTI A;  1CKO A;  3S15 H;  1ET9 A;  1K0R A;  3HG9 A;  4DNR B;  2H5X A;  1SBB B;  2AUK A;  1I4P A;  1D8L A;  3EN2 A;  5IGE A;  5M5X B;  5IYC H;  4CDD C;  4KY5 A;  1MIU A;  2UUB L;  4P2C B;  4XT1 B;  2B2Y A;  2E2J H;  1L1O A;  1HNZ Q;  2KHI A;  1N33 L;  4LF4 L;  1D1I A;  1EY7 A;  3M4O B;  1JOQ A;  4A3F H;  4CKC A;  1DXM A;  2BA0 A;  5DEH A;  3G7L A;  3HOW G;  2OF1 A;  4HMJ A;  3NTK A;  4IPG A;  2PNH A;  1Q86 C;  3GTO H;  4A3J G;  1VQ9 A;  1ESR A;  3OIP A;  1BXT A;  4KHP Q;  1Y8P B;  2CQA A;  2KBN A;  2PQA B;  5CV4 A;  2KOL A;  5EQ0 A;  4WJ3 M;  2VZA A;  4DFA A;  1BQQ T;  4DGZ A;  1ASZ A;  4DR2 Q;  2F0J A;  4KY7 A;  1Y8O B;  2KA7 A;  5T1I A;  1DCZ A;  1EZ8 A;  1Y1V H;  3DMU A;  2E2J B;  5IYB G;  3DM1 A;  1WVL A;  3MC0 B;  1O7Z A;  1TY2 A;  2NTS A;  5HY6 A;  3CCJ A;  4RKL A;  4JI7 L;  1G6Z A;  1YNJ D;  2LY7 A;  4IQZ A;  1N34 L;  1SXT A;  4LAA A;  4IFD G;  3T16 A;  1MD2 D;  2G9H D;  2F4V Q;  4FYD A;  2C35 B;  4OX9 L;  2X69 A;  1HXY D;  4YWM A;  3J7A F;  4DAV A;  4KK7 A;  2K01 A;  1PV4 A;  1C7Y A;  3TRZ A;  1JR0 D;  4N9T A;  3OMC A;  1XYI A;  3IKJ A;  2HQE A;  4QUF A;  1JWS D;  2WB1 G;  1PYB A;  1FR3 A;  2DY8 A;  5DM6 3;  1S4Z A;  4O1N A;  4KKT A;  3ULP A;  2E5L Q;  2R7Z H;  1N9W A;  5BN4 A;  3Q8D A;  4JI6 L;  2EY6 A;  1A0I A;  1U0L A;  3EFX D;  2B8G A;  4B3T L;  4OIJ A;  1SSO A;  2F0E A;  3GTL B;  3D6W A;  2NBF A;  1EY6 A;  3KUP A;  4S3S A;  4LFA Q;  2ALY B;  4HMI A;  1AW7 A;  2WAQ E;  4KTA A;  3J7Y W;  1GVP A;  2NVQ H;  3K5L A;  1MBY A;  4HJ9 A;  1QJO A;  5D3I B;  3GO5 A;  5CR3 A;  3EJI A;  3H3V C;  1DD2 A;  3BJU A;  2A68 C;  2A6H D;  3QIA A;  2Q8T A;  1EIH A;  5E1F A;  2Z6K A;  3VR3 A;  4IPD A;  3JAM L;  2UU9 L;  3W1B A;  1K8O A;  1G6P A;  2K05 A;  2MPM A;  5COY A;  4DV6 Q;  5I6Y A;  1X3G A;  1SYD A;  2GN5 A;  1KQS A;  4B3R L;  5ELB A;  4JI4 Q;  4KLK A;  2L55 A;  3D4R A;  4KKU A;  5C3X A;  1FNV A;  1YJW A;  2C5C A;  5CV8 A;  3HP3 A;  1EQQ A;  2AQ1 B;  2RDH A;  2SDF A;  4JBW A;  1LT4 D;  5KNC A;  2PW7 A;  1GD7 A;  1C48 A;  1AE3 A;  3SGI A;  2NWG A;  3LX0 A;  4C3H B;  3K7A H;  1RTO A;  1NNX A;  3RLF A;  2DNC A;  3CP0 A;  1XTC D;  1XPR A;  2JA9 A;  4IUV A;  4IOC A;  2ZM6 Q;  4GN3 B;  1N33 Q;  1Z6H A;  1SRU A;  2AWO A;  3S1N H;  3N52 A;  2BH2 A;  1AZQ A;  2BDO A;  1WTO A;  4CDE C;  1STN A;  1KTK A;  3T56 B;  4C3J H;  1SFO B;  1D2B A;  3NEL A;  2CWA A;  1HUM A;  1EIF A;  4DA2 A;  4F7X A;  1K8G A;  2F0Q A;  3CCL A;  2Y0S G;  2Y0S B;  1C0A A;  4JI8 L;  2K52 A;  1SJH D;  2WKC A;  1HH2 P;  1KLG D;  2EY1 A;  2I5M X;  4JI2 Q;  3TS2 A;  2WIN B;  3DUZ A;  2BE5 C;  3MXG A;  1LV9 A;  1UEA B;  2JA8 H;  1TS3 A;  4LF6 L;  3V2T A;  1F77 A;  4C3I H;  4RCO A;  2MNA A;  4R4O A;  4DK6 C;  4DUZ L;  3F8T A;  1B9N A;  4B3T Q;  2RF4 A;  2PPB C;  2YV5 A;  3NUC A;  3RMH A;  4Q5V A;  3W1G A;  1UNS A;  4DV5 L;  1F9Q A;  4DR7 L;  1RDP D;  3K0X A;  3PCO B;  4MZ9 A;  4ZQ3 A;  1PRT B;  4RA8 A;  1JJ2 A;  3V05 A;  1AEX A;  1B8A A;  2VQF L;  2OTL A;  4GN5 A;  4J15 A;  2Q2I A;  1STB A;  5C4Z A;  4OO1 H;  2LXK A;  1J8I A;  1SNO A;  1VF7 A;  4ALP A;  4RHR A;  4EVO A;  4DR5 L;  3S1Q B;  5GAE C;  1A15 A;  1K8A C;  3K7A B;  4DV3 Q;  4DR4 Q;  5COR A;  1SNC A;  4BBR B;  1KRS A;  3Q0A A;  1SAP A;  2XNA C;  3HZX A;  4GKK Q;  2F4V L;  5CGK A;  2E2H H;  1HCZ A;  1ESF A;  1Q12 A;  2I46 A;  3FPP A;  1E2Z A;  4DR3 L;  2B2W C;  3HOX B;  2VNU D;  1EOV A;  1QVC A;  3S1Q H;  5M3M H;  4X66 Q;  1CQF A;  2F0O A;  1HFN A;  2NVX H;  3K59 A;  3H09 A;  4MHE A;  4J1M A;  3Q24 A;  3NBI A;  4FXG C;  1A2T A;  1K3B C;  3CPF A;  3P7J A;  1NE3 A;  2V4D A;  4TQU S;  4UAI A;  2UUA Q;  4U68 A;  3HOU B;  1I4Q A;  1BVS A;  4DV0 L;  3KBG A;  5IGF A;  5M5Y H;  1VQJ A;  3FDT A;  1KNA A;  3E9H A;  3S16 H;  1OXV A;  1ENC A;  3GTP H;  3DLL A;  4AYB B;  1PZI D;  2R93 B;  1U4M A;  1Q82 C;  1X6O A;  1PH1 A;  2IX1 A;  3R93 A;  1S5B D;  2F52 A;  2CWP A;  2WV6 D;  3V96 A;  4ZYS A;  2DY7 A;  4CKE A;  1CHP D;  4HN7 A;  1PYW D;  4RGT A;  2ZM6 L;  5BN5 A;  2K5H A;  3A5U A;  1JT8 A;  5IWA L;  1WI5 A;  1CSQ A;  4FDB A;  3KYH C;  1ZXT A;  4MTN A;  1YBY A;  1EY0 A;  2DGY A;  3CCR A;  5HGT A;  1O80 A;  3SK4 A;  3H15 A;  1OO9 B;  2F0L A;  4PG3 A;  1VQD A;  1TWA B;  4PZ6 A;  1CQV A;  1GKH A;  2WFW A;  3HOY G;  3S2H H;  3GQB A;  3CXC A;  3OSO A;  1JQY D;  2B2V A;  1XNQ L;  1N34 Q;  1MGS A;  3BU2 A;  3AEV A;  1BBU A;  1FGU A;  1NUC A;  2EY5 A;  2SNM A;  2R7F A;  1JB3 A;  2OTJ A;  3PGZ A;  4WFN 3;  3CC2 A;  1B70 B;  5EKI A;  2KHS A;  2KCT A;  4DAM A;  4DR2 L;  4A4I A;  5AJ3 L;  3S14 B;  4P73 A;  1YNX A;  1EIY B;  2EYF A;  5FO7 B;  1IKM A;  3X3M A;  4EX5 A;  2WB1 B;  1TWG B;  2Z4I A;  5C3E B;  1BF4 A;  4BBS G;  2AWN A;  5M3F G;  2F0F A;  3I7F A;  3PV0 A;  1JOR A;  1B44 D;  3CCM A;  3L2P A;  2OT2 A;  2O5I C;  2EY2 A;  3HOU G;  1A63 A;  2HDL A;  3RLN A;  1EQT A;  1V43 A;  2B2U A;  3K81 C;  1Y1W B;  4LF5 L;  3CF5 A;  1ZYR D;  4ODG A;  5C4H A;  3GTQ H;  2ZXR A;  1EL0 A;  4R8I A;  1O7Y A;  1KAW A;  2PZU A;  2GA4 B;  4X3U A;  5L37 A;  1F9P A;  1PTO D;  2JQO A;  3C1E A;  3PO2 H;  1RHP A;  4JG2 A;  2ZJQ A;  3J81 i;  2OWO A;  3KK7 A;  1CUK A;  1WCM G;  1WCM B;  1SNM A;  2VXW A;  2JA5 G;  3E5S A;  4DR1 Q;  1YJN A;  2EYJ A; 
#chains in the Genus database with same CATH homology
 3NHH A;  1K8M A;  5EJW A;  1WTV A;  2E75 C;  4FXK C;  1R4P B;  1TQO A;  4EQO A;  4XYQ A;  1H9J A;  1BCP B;  1LAC A;  4F87 A;  1GJX A;  3NBH A;  1J9O A;  1Q3L A;  3SVM A;  5DNF A;  2M00 A;  4A93 B;  1S5F D;  5K36 H;  5E4X A;  2KQ3 A;  5EBD A;  5C5M A;  4FNF A;  3TP5 A;  3OMG A;  1LO5 D;  1JWM D;  4C3I G;  1HA6 A;  5FLX E;  3ZYY X;  1VMP A;  1B50 A;  1V1P A;  1VF5 C;  1AZP A;  4QF4 A;  2L0C A;  3SK6 A;  1TU2 B;  2K5D A;  5JEA G;  5C0X H;  3S1M B;  1V8Q A;  3DEO A;  1DYQ A;  3R2T A;  2F0T A;  4IFD H;  1GXD C;  2PNR C;  1STH A;  3FKI B;  1CT1 D;  3T13 A;  3BS1 A;  3HGB A;  1RTN A;  1Y1V B;  2EYM A;  2JE6 I;  1F2Z A;  4KHZ A;  1DOK A;  4ZRZ A;  3BDO A;  3I8Z A;  2FFK B;  2A68 D;  4H13 C;  3GV3 A;  3PUY A;  1R9T B;  3GTK B;  2EYP A;  4N9P A;  3K0Y A;  1QG7 A;  4ILW A;  2K32 A;  4EQN A;  1EYC A;  2LKV A;  3PO3 B;  4HCS A;  2IX0 A;  2O2L D;  2YYZ A;  4DU9 A;  2Z4H A;  1SYG A;  5J1Z A;  5FKA C;  4A3D B;  2A6E D;  1KLU D;  1EYA A;  1X3P A;  1RF2 D;  4OL7 A;  2QDB A;  4RCN A;  1PTO B;  1GHK A;  2NB0 A;  2G9D A;  2TMP A;  3NE5 B;  4QUC A;  4C1N K;  3BVM A;  2DN8 A;  1D5X C;  1JOO A;  2JA7 B;  3NXW A;  1JWU D;  2EYO A;  3BDL A;  2PW5 A;  4B08 A;  5I4D A;  2K28 A;  2WII B;  4NP5 A;  4A3F B;  4OGQ C;  4ABN A;  3A8I E;  1WD1 A;  2B63 B;  1STA A;  1IYV A;  2FHT A;  2Q8R E;  2RDG A;  3TZU A;  1W6K A;  3OWF A;  3SDZ A;  2EPB A;  1CFM A;  3N6R A;  4KJN A;  3GV6 A;  2WKD A;  5EKK A;  2ID0 A;  1GUT A;  4Y7N B;  2A5H A;  2XWB B;  1SJE D;  3A7A B;  4KHV A;  4HCE A;  2EJM A;  5JPM C;  1R4Q B;  1ENF A;  3LNN A;  1SNP A;  1T5E A;  4C3J G;  2OEO A;  2EJG C;  3VA5 A;  2ZT9 C;  4C2M B;  1KNE A;  3QO2 A;  1SDF A;  5JEA J;  5FO9 B;  2E2H B;  1NCV A;  3OHX C;  3Q6S A;  2LFN A;  2JA8 B;  1F2Y A;  3ONA B;  3FPU B;  1QWY A;  2ICE C;  5EGT A;  1XWE A;  2MP1 A;  2B2T A;  2A69 C;  4RGO S;  1G2S A;  5FLX L;  1II3 A;  1LLR D;  5KYL A;  2C9O A;  4ULL A;  1VMC A;  5I9O A;  4FF1 A;  3HOW B;  2KCN A;  1AFP A;  2RKS A;  5C0X G;  2OXP A;  1FNW A;  3HKZ B;  2BE5 D;  4OIK A;  2YU9 B;  1G2T A;  1EY8 A;  3MTS A;  2D62 A;  2A73 B;  1STG A;  3NPP A;  2EVB A;  3TSS A;  4HSP A;  5IOC A;  3VA7 A;  1H9R A;  4KMU C;  2XIW A;  2PZT A;  1Q1B A;  2J4X A;  5A2Q L;  4K2K A;  3CRL C;  3S9W A;  2FMC A;  1WD0 A;  4HSV A;  4IAL A;  1STY A;  1IHZ A;  2KJX A;  2NVY B;  5M9O A;  1DOM A;  4RHS A;  2O5J C;  1ZYR C;  5C0X I;  2J0T D;  1GUG A;  4IZ8 A;  2F0H A;  4G7Z C;  4RKB A;  1HRJ A;  4G7H C;  4XDX A;  1JC7 A;  1F9R A;  5D14 A;  1TVX A;  3SEB A;  1U9R A;  1SE3 A;  5LHY 1;  3TP8 A;  1HPC A;  1MSH A;  1STE A;  4MN3 A;  5ELE A;  3SXH A;  1A2U A;  2F0P A;  3M3Y B;  3U9O A;  2IPK D;  1YNJ C;  4K8J A;  3MXP A;  2WAQ B;  3M7G A;  1QOH A;  4KN7 C;  5C44 B;  1XX8 A;  4X3T A;  1I4R A;  2KEC A;  2F0S A;  2CHB D;  4Q0F A;  3QG1 A;  1U4R A;  5HUR A;  1SYF A;  5KNB A;  5KIX A;  1LT6 D;  4IUT A;  5I9P A;  2HCC A;  3DEP A;  4C1N I;  1SYE A;  3I73 A;  5IGC A;  1KAA A;  3BVG A;  3X3N A;  3SR1 A;  1ILQ A;  3LWE A;  5G3L F;  1L0X B;  3BVZ A;  1WTQ A;  2IL8 A;  1PMR A;  2TSS A;  4PMC A;  2KCC A;  2RQX A;  3TDQ A;  3C46 A;  1I6V C;  1HQM C;  1X32 A;  4BA2 I;  4FP5 D;  1CM9 A;  3UI2 A;  2AQ2 B;  4H44 C;  2A6H C;  2RA4 A;  5ISR A;  5E4W C;  1I6H B;  2RBM A;  5A35 A;  4K5W A;  1I4G A;  4DAP A;  2NN6 I;  2CW0 D;  2F03 A;  5EPL A;  5BN3 A;  1SYC A;  3IL8 A;  3NWS A;  3TME A;  2B2V C;  2KEE A;  2K04 A;  1A6X A;  2RDF A;  4R8N A;  4WRD A;  3ERO A;  4TKO B;  5I6W A;  4IFD J;  3IFD A;  5DM7 3;  1EYD A;  2HUG A;  1DZ1 A;  1AN8 A;  1U4L A;  4UDU C;  4L8J A;  3K5N A;  1SYB A;  3A54 A;  1PFM A;  4LMQ D;  3U9S A;  2PO4 A;  4RAU C;  2F3W A;  4KD3 A;  2N88 A;  1G91 A;  1I3Q B;  3VR5 A;  1PZJ D;  2NN6 G;  3RD4 A;  2LMC B;  3I3C A;  4J6H A;  3H91 A;  3E6Z X;  4TSS A;  4H7B A;  4OO1 G;  5JVH 3;  1DOL A;  1QB5 D;  2MGS A;  3RUZ A;  4V19 0;  1QE6 A;  2KUM A;  4KJO A;  3ITP A;  3NP8 A;  1CI3 M;  4K6D A;  2Z8L A;  2D5D A;  2K33 A;  1RD9 D;  3W2D A;  1GHJ A;  4BBS B;  3I90 A;  1Z7T A;  3G6J B;  4KV6 A;  4WJW A;  2PCF B;  1KDB A;  1ML0 D;  3FVQ A;  2R92 B;  1BR9 A;  1A3U A;  1F2L A;  2HCI A;  1ET6 A;  4IUQ A;  4ZLT F;  5T1G A;  1ICW A;  1EU3 A;  1EY4 A;  2NUC A;  4I65 A;  3OWE B;  4ZKB B;  1C8C A;  4IUN A;  4EGV A;  1D6E C;  3MFG A;  4QIW B;  3PUX A;  1ZEQ X;  4M1U B;  5E3F A;  1EWC A;  4OO1 I;  2RSO A;  5AFW A;  5IT9 L;  3C3L A;  1LT3 D;  3IAY A;  1JCK B;  2WP8 J;  1TS2 A;  1DON A;  3S1N B;  4DAY A;  5KYI A;  2O4X A;  3S17 B;  1PZK D;  3KBX A;  2EJF C;  1B53 A;  4XQJ A;  5IGD A;  1KDC A;  3K5O A;  4LK1 C;  1H9K A;  1PRT D;  5J22 A;  4B9W A;  2VUM B;  4L63 B;  3NQT A;  4IFD I;  1SE2 A;  3BYT B;  1CA5 A;  3VYS A;  3D4W A;  3BDC A;  5CBE E;  2L5T A;  1JIC A;  2XRS D;  2R61 A;  1LT5 D;  5JJZ A;  1PTO H;  2K03 A;  3GTP B;  1CTM A;  2B8F A;  1GUW A;  1E0B A;  5JEA H;  3K6O A;  2SEB D;  4DK0 A;  1TWF B;  1G29 1;  1WTR A;  5KEE A;  2IW3 A;  2KVM A;  4PMB A;  1A3V A;  1EQV A;  2LS0 1;  4DK1 A;  3JAM E;  3SK8 A;  1ILP A;  3NQI A;  1WTP A;  1EY5 A;  4DF7 A;  3FRP B;  2IT1 A;  1PLF A;  1CA6 A;  2B2U C;  1D1K A;  4NKL A;  3MA2 B;  1RCV D;  1BDO A;  4X3S A;  3T4A C;  3PIP 3;  1WTW A;  3GTO B;  1BBX C;  5C6A A;  1S5D D;  3R2I A;  2F0G A;  3ND8 A;  3P75 A;  1FNU A;  2D9U A;  2SNS A;  5CV5 A;  3ND9 A;  1HFG A;  1GOZ A;  2F3V A;  1B2T A;  3HRZ C;  1TII D;  1LTG D;  1E2W A;  1OXX K;  3K5M A;  5TSS A;  1Q90 A;  3HOY B;  2L4N A;  3OIQ A;  4ZKC B;  1SEB D;  1B3A A;  3MXN A;  3GTQ B;  3VR2 A;  4G57 A;  3AMU A;  3I4N B;  2E2I B;  3URY A;  3HS0 C;  1ZKO A;  4CHT B;  3VYT A;  1BCP C;  4PV1 C;  2ZXP A;  2VB2 X;  4IN3 A;  3EA6 A;  3J81 E;  4R9W A;  3VYU A;  2E2D C;  4XYO A;  4IUU A;  1CZG A;  3EVQ A;  3K58 A;  3RZO B;  4EQP A;  5KND A;  4RGM A;  5ELC A;  5F2D A;  2NVT B;  5CC4 A;  4BY1 B;  3E0J A;  5CMD A;  3S2D B;  4CBV A;  3AU7 A;  1BUV T;  3I4L A;  2XRQ D;  1BCP D;  2L11 A;  3NTI A;  2Z1C A;  1IYU A;  3R8B A;  3I91 A;  4C56 C;  5KGU A;  2NVQ B;  3RZD B;  3A55 A;  3BYY B;  2EZV A;  2BOS A;  2RSN A;  1EFI D;  1LTA D;  1TS4 A;  2QIL A;  4M8A A;  1KAB A;  4XQN A;  4BS9 A;  3WOF A;  5JVG 3;  2Q8I B;  2IJ0 A;  1UAP A;  2BCO A;  1IL8 A;  1V1P B;  1G8Z D;  2K6A A;  3R3O A;  1OXS C;  2AQ3 B;  1EY9 A;  1PXU A;  3GTG B;  1I50 B;  3DXJ C;  2EDG A;  5ELF A;  2JP1 A;  1DM0 B;  2F0U A;  3NWT A;  3QB3 A;  5FK9 C;  4PMW A;  4BY7 B;  1HHV A;  2L1B A;  5LL6 X;  5CV7 A;  2XVS A;  3HOV B;  3H0G B;  3MVV A;  1C4Q A;  3SE0 A;  4ZUI A;  4DXG A;  1NAP A;  3EQL C;  1IW7 C;  2FIN B;  2L12 A;  3PMF A;  1EEI D;  1BOS A;  5CV6 A;  2B2Y C;  2E74 C;  3J80 L;  4DN4 M;  5IGG A;  1I4H A;  2EXZ A;  1B4O A;  2JA5 B;  5JAV A;  1ONL A;  4KD4 A;  3DHQ A;  1L0Y B;  5A2Q E;  1PFN A;  4C3H G;  1RKN A;  2X6G A;  3TZD A;  5CBA E;  3H6M A;  4BWG B;  3TN2 A;  4C3I B;  3P1H A;  3PUW A;  3S2H B;  1DJR D;  5NUC A;  3OOC A;  3NSW A;  2K5Q A;  1PRT C;  4CJ1 B;  2F1M A;  1GUS A;  2DNE A;  4Z9C B;  2IX3 A;  1VCI A;  2F0V A;  2F0M A;  3PUZ A;  2F0W A;  3MAQ A;  4K5V A;  4QCL A;  3QJY A;  3M85 A;  4HTH A;  5FOB B;  4FO2 A;  3TP6 A;  2ENB A;  3SK5 A;  3I4M B;  2HDM A;  1SNQ A;  4A3E B;  2B2W A;  1LAB A;  3WOE A;  1D5M C;  1VDZ A;  2QF7 A;  5EPJ A;  2NVX B;  4HED A;  2B2T C;  1MSG A;  5M5W B;  1F9S A;  4CJ0 B;  3PO2 B;  2IWH A;  2SOB A;  1YNN D;  1FYC A;  1ROD A;  1LTI D;  3OPO A;  3I72 A;  3CHB D;  4E6I A;  4L6T B;  1NSN S;  2R3Z A;  2XN9 C;  4U67 3;  4OHJ A;  3M7N A;  3F2U A;  2F4I A;  3GTM B;  1SND A;  3DWP A;  3GTJ B;  3IFT A;  4YIJ A;  1PTO F;  4HAE A;  3P20 A;  2K5W A;  4KI0 A;  4A3G B;  1LTS D;  4DNT B;  4PQX A;  5K5P A;  3PUV A;  3K57 A;  3C2P A;  4XTC S;  3D4D A;  4LJZ C;  5IIF A;  2WAC A;  2L9H A;  1TY0 A;  1TKW B;  2NYZ D;  1D5Z C;  3BZD B;  1FD7 D;  1I4X A;  2K1B A;  3D31 A;  1FGB D;  3A8K E;  1QCB D;  2PMZ B;  4C3J B;  3KLS X;  3FMC A;  1GUN A;  4KY6 A;  2XWJ B;  3NTH A;  5D3D A;  2B39 A;  2ICI A;  5I2X A;  3CKI B;  4I7Z C;  2MHV A;  3SHL A;  3S1R B;  2R7Z B;  2RVL A;  4A3M B;  1Y69 U;  2JSO A;  3WDN A;  2JEB I;  4ME5 A;  1U4P A;  2JA6 B;  5K36 G;  2JXM B;  1TT2 A;  4XQQ A;  3VR4 A;  2NZ1 D;  4F88 A;  1XXG A;  2MJ8 A;  3S15 B;  2BDN A;  2ZXO A;  4ZUJ A;  3VYR A;  2M2L A;  4QMG A;  4K5X A;  5C4X B;  3DWA A;  2K7V A;  3NK9 A;  1WTX A;  1O7L A;  3HOZ B;  3S16 B;  1TR5 A;  4CGY B;  5I2Y A;  1JOK A;  4ID6 A;  2F0K A;  5C3W A;  3D8G A;  3J80 E;  1PRT F;  3TBI B;  3CU7 A;  2KED A;  1F2M A;  4J8Q A;  5M3M B;  1M4V A;  1NR2 A;  3MXU A;  4JK1 C;  4K2L A;  3QOL A;  4A3I B;  3A8J E;  5ELD A;  1PTO C;  1LTT D;  2VB3 X;  4B9X A;  1TWC B;  3O13 A;  1HUN A;  3W3A A;  4H0L C;  4A3J B;  2J7Z A;  3KLR A;  3KLS A;  3VR6 A;  1BCP F;  1UUP A;  2QCP X;  5EBC A;  2H1E A;  5JPN C;  1CK1 A;  1QIL A;  2PYK A;  1KDA A;  1V1O A;  2F0D A;  3BG3 A;  2PZW A;  3MFY A;  2MUY A;  5JOB A;  1O78 A;  2E76 C;  3AB9 A;  4F8M A;  5CYU A;  5IT9 E;  4DXF A;  5C4J B;  1CZW A;  2NN6 H;  3Q23 A;  1EOT A;  4ZAI A;  4ZK9 B;  2JYO A;  3GD7 A;  2JEA I;  1OXT A;  4XXE A;  3ERQ A;  1NR4 A;  4A3K B;  1IW7 D;  1OXU A;  2EYL A;  2F0I A;  4X3K A;  1LTB D;  1YNN C;  1T5X D;  1A3T A;  3A56 A;  2CVR A;  4K6L A;  1Q1E A;  1QNK A;  4FVM A;  3KF8 A;  4HR7 B;  1Q8I A;  4V0B A;  3OW7 A;  4RWS C;  4K8I A;  1B9M A;  4FF4 A;  2A6E C;  1EIG A;  2I07 B;  4NMZ A;  2M9V A;  5LL6 S;  5DAU A;  4K14 A;  1E2V A;  2QEJ C;  4GZY C;  1EU4 A;  2FMM A;  3CQZ B;  1LTR D;  3DWQ A;  4G7O C;  1EZ6 A;  1Y8N B;  1HQR D;  2A74 C;  2EE1 A;  1K83 B;  2QKI C;  3A7L A;  3MEH A;  1IKL A;  3FEW X;  4CKB A;  4FF2 A;  5CV9 A;  3Q22 A;  5IGB A;  1SMY D;  4G4K A;  1Z47 A;  3HEJ A;  2X6L A;  3L7Z C;  4A3B B;  2N55 A;  4KKS A;  5M3F B;  4NDX A;  3TP7 A;  1HTP A;  4NW2 A;  4FXD A;  3C1F A;  1M8A A;  1RJT A;  5EPK A;  2AUJ D;  1BO0 A;  3J7A V;  1TS5 A;  4WOR A;  1ENA A;  1SMY C;  1JE4 A;  1B1Z A;  4PNY A;  2H4O A;  3GP7 A;  1EEF D;  4RGN A;  2R6G A;  3MZ5 A;  4FF3 A;  1CHQ D;  5KRU A;  1GUO A;  1X3Q A;  5C5L A;  3MHB A;  3QWN A;  1SE4 A;  3I70 A;  1MI2 A;  5FO8 B;  2F0N A;  4TRD A;  1QNU A;  5M5Y B;  2EOT A;  4IUR A;  1H9S B;  5EKL A;  5C0X J;  2A69 D;  1BNZ A;  4MIU A;  5J39 A;  1EWH A;  2EYH A;  4RH6 A;  2PQE A;  1PFB A;  3J81 L;  1HA5 A;  1PDQ A;  4QB4 A;  2NTT A;  1S5C D;  2CW0 C;  4XT3 B;  4CJ2 C;  2XSC A;  3T53 B;  5IOD A;  1H9S A;  1TWH B;  3L9A X;  3CRK C;  3H94 A;  2BA1 A;  3D3R A;  1H9M A;  3QOJ A;  2FJ2 A;  4O42 A;  5D65 A;  3M4Y A;  3PIO 3;  2D2C C;  3T51 B;  4KN4 C;  1HTL D;  4BA1 I;  3L3O C;  1S5E D;  1AP0 A;  3MWY W;  4IUP A;  3D6C A;  4XIG S;  5G3L D;  3LWU A;  4RFB A;  1W6J A;  1ET9 A;  3HG9 A;  4DNR B;  1SBB B;  2AUK A;  1I4P A;  5M5X B;  5IGE A;  4KY5 A;  4P2C B;  4XT1 B;  2B2Y A;  1D1I A;  1EY7 A;  3M4O B;  1JOQ A;  4CKC A;  1DXM A;  2BA0 A;  5DEH A;  3G7L A;  2OF1 A;  4HMJ A;  3NTK A;  1ESR A;  3OIP A;  1BXT A;  1Y8P B;  2CQA A;  5CV4 A;  5EQ0 A;  2KOL A;  4DFA A;  1BQQ T;  4DGZ A;  2F0J A;  4KY7 A;  1Y8O B;  2KA7 A;  5T1I A;  1DCZ A;  1EZ8 A;  3DMU A;  2E2J B;  3DM1 A;  1WVL A;  3MC0 B;  1O7Z A;  1TY2 A;  2NTS A;  1G6Z A;  4RKL A;  1YNJ D;  2LY7 A;  4IQZ A;  4IFD G;  1SXT A;  4LAA A;  3T16 A;  1MD2 D;  2G9H D;  4FYD A;  2X69 A;  1HXY D;  3J7A F;  4DAV A;  4KK7 A;  2K01 A;  1JR0 D;  4N9T A;  3OMC A;  1XYI A;  3IKJ A;  2HQE A;  4QUF A;  1JWS D;  1FR3 A;  2DY8 A;  5DM6 3;  1S4Z A;  4O1N A;  4KKT A;  5BN4 A;  2EY6 A;  3EFX D;  2B8G A;  4OIJ A;  1SSO A;  2F0E A;  3GTL B;  3D6W A;  2NBF A;  1EY6 A;  3KUP A;  4S3S A;  4HMI A;  4KTA A;  1AW7 A;  3J7Y W;  3K5L A;  1MBY A;  1QJO A;  5D3I B;  3GO5 A;  5CR3 A;  3EJI A;  3H3V C;  1DD2 A;  2A68 C;  2A6H D;  3QIA A;  2Q8T A;  1EIH A;  5E1F A;  3VR3 A;  3JAM L;  1K8O A;  2K05 A;  2MPM A;  5COY A;  5I6Y A;  1SYD A;  5ELB A;  2L55 A;  3D4R A;  4KKU A;  5C3X A;  1FNV A;  2C5C A;  5CV8 A;  3HP3 A;  2AQ1 B;  2RDH A;  2SDF A;  4JBW A;  1LT4 D;  5KNC A;  2PW7 A;  1C48 A;  2NWG A;  3LX0 A;  4C3H B;  1RTO A;  3RLF A;  2DNC A;  1XTC D;  4IUV A;  1Z6H A;  2AWO A;  3N52 A;  1AZQ A;  2BDO A;  1WTO A;  1STN A;  1KTK A;  3T56 B;  1SFO B;  1D2B A;  4F7X A;  1HUM A;  4DA2 A;  2F0Q A;  2Y0S B;  1SJH D;  1KLG D;  2WKC A;  2EY1 A;  2WIN B;  3DUZ A;  2BE5 C;  3MXG A;  1LV9 A;  1UEA B;  1TS3 A;  3V2T A;  1F77 A;  4RCO A;  1B9N A;  2PPB C;  3NUC A;  3RMH A;  4Q5V A;  1UNS A;  1F9Q A;  1RDP D;  4ZQ3 A;  1PRT B;  4RA8 A;  3V05 A;  1AEX A;  5C4Z A;  4OO1 H;  1STB A;  1J8I A;  1SNO A;  1VF7 A;  4RHR A;  4EVO A;  3S1Q B;  1A15 A;  3K7A B;  5COR A;  1SNC A;  4BBR B;  3Q0A A;  1SAP A;  2XNA C;  3HZX A;  5CGK A;  1HCZ A;  1ESF A;  1Q12 A;  2I46 A;  3FPP A;  1E2Z A;  2B2W C;  3HOX B;  2VNU D;  1CQF A;  2F0O A;  1HFN A;  3K59 A;  3H09 A;  4MHE A;  4J1M A;  3Q24 A;  3NBI A;  4FXG C;  1A2T A;  2V4D A;  3P7J A;  4TQU S;  4UAI A;  4U68 A;  3HOU B;  1I4Q A;  3KBG A;  5IGF A;  3FDT A;  1KNA A;  1OXV A;  1ENC A;  4AYB B;  1PZI D;  2R93 B;  1U4M A;  2IX1 A;  3R93 A;  1S5B D;  2WV6 D;  4ZYS A;  3V96 A;  2DY7 A;  4CKE A;  1CHP D;  4HN7 A;  1PYW D;  4RGT A;  5BN5 A;  1ZXT A;  1EY0 A;  5HGT A;  1O80 A;  3SK4 A;  1OO9 B;  2F0L A;  1TWA B;  1CQV A;  3GQB A;  3OSO A;  1JQY D;  2B2V A;  1MGS A;  1NUC A;  2EY5 A;  2SNM A;  1JB3 A;  4WFN 3;  5EKI A;  2KHS A;  3S14 B;  2EYF A;  5FO7 B;  1IKM A;  3X3M A;  2WB1 B;  1TWG B;  2Z4I A;  5C3E B;  1BF4 A;  2AWN A;  2F0F A;  3PV0 A;  1JOR A;  1B44 D;  2OT2 A;  2O5I C;  2EY2 A;  2HDL A;  1EQT A;  1V43 A;  2B2U A;  1Y1W B;  1ZYR D;  4ODG A;  5C4H A;  2ZXR A;  1EL0 A;  4R8I A;  1O7Y A;  2PZU A;  2GA4 B;  4X3U A;  1F9P A;  1PTO D;  3C1E A;  1RHP A;  3KK7 A;  1WCM B;  1SNM A;  2VXW A;  3E5S A;  2EYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...