2L4NA

Solution structure of the chemokine ccl21
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of CCL21 and identification of a putative CCR7 binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords C-C motif chemokine 21
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l4nA00
1HFNA 2R3ZA 1F9PA 1M8AA 4QUFA 2DY7A 3I91A 1LV9A 1DOMA 2L4NA 4HAEA 5JJZA 1WVLA 2B2WC 4QUCA 1F2LA 2KEEA 3HP3A 3FPUB 1ESRA 1MI2A 1HRJA 5T1IA 1C8CA 5CBAE 1AP0A 1EOTA 3DEOA 4X3KA 2RA4A 2KUMA 2CVRA 4IURA 4U68A 2J7ZA 1JE4A 2L11A 2XIWA 1TVXA 5D65A 1CA6A 2RSOA 4XT3B 1F9RA 2FHTA 2K01A 2VXWA 4HCSA 1HUMA 4IUPA 5DNFA 4CJ1B 1EIHA 1B4OA 4XT1B 1HUNA 1VMCA 3DM1A 1BNZA 1U4RA 1J9OA 2H1EA 2N88A 4ZAIA 1B2TA 1HHVA 2M2LA 1WTOA 1U4PA 3MTSA 3P7JA 1WTWA 4IUUA 1ILPA 1Q3LA 2BDNA 2K1BA 5EKIA 1F9QA 2K04A 2NWGA 2K05A 5EJWA 4X3SA 2FINB 1PFBA 2B2WA 2RVLA 1HA6A 1KNEA 1MSHA 3I3CA 4RA8A 5D14A 5EPJA 1WTPA 2EE1A 1DOKA 1U4MA 1SSOA 1S4ZA 2KECA 1XX8A 3GV6A 4ZK9B 1BF4A 2HDMA 2B2VA 2FMMA 1QE6A 1U4LA 1KNAA 1WD1A 1B50A 2SDFA 2Q8RE 2NZ1D 1PDQA 1DOLA 1CA5A 1NR2A 2KVMA 2JP1A 1X32A 5AFWA 4RWSC 4NW2A 1BBXC 1AZPA 1VMPA 1RHPA 5EQ0A 5CBEE 4X3TA 2HCCA 1EIGA 2L1BA 3N52A 1XYIA 4HSVA 3Q6SA 4ZLTF 1CM9A 1IL8A 1X3PA 3D6WA 1SAPA 2EOTA 3KUPA 1IKLA 1G2TA 3QO2A 3R93A 1DZ1A 3IL8A 1O7ZA 4IUQA 4OIKA 1PFMA 1PLFA 1NAPA 4R9WA 4CJ2C 3GV3A 1JICA 2B2TC 2IL8A 3LWEA 3ONAB 4DN4M 1B3AA 2B2VC 1AZQA 1HFGA 1A15A 5COYA 4X3UA 5EPKA 3TN2A 2EPBA 5EPLA 5T1GA 4IUVA 3MWYW 4MHEA 2HUGA 4O42A 2HDLA 2X6LA 1GUWA 4XDXA 3F2UA 2MGSA 1NR4A 1EL0A 1F9SA 5E4XA 3UI2A 3IFDA 3TZDA 2N55A 3KBXA 1QNKA 3SVMA 1J8IA 1RTNA 2X69A 4UAIA 1G91A 1QG7A 3I8ZA 2K03A 2FJ2A 1RJTA 2KOLA 2B2YC 1DONA 2L9HA 4ZKCB 1X3QA 1WTQA 2MPMA 1ILQA 4OIJA 2X6GA 2DY8A 2FFKB 1RTOA 1WTRA 1NCVA 4IUTA 2MP1A 3G7LA 1ICWA 2NYZD 1B53A 1WTVA 2RSNA 3FDTA 5CMDA 2KEDA 4R8IA 4HEDA 5E4WC 2B2UA 1ML0D 1ZXTA 2Q8TA 4RAUC 1O80A 1BO0A 1PFNA 2HCIA 2L12A 3H91A 5CORA 1WD0A 1MSGA 1MGSA 2K28A 2B2UC 2MJ8A 1E0BA 4ZKBB 1EQTA 2B2YA 1O7YA 4CJ0B 3I90A 1G2SA 4MN3A 1G6ZA 4LMQD 2D9UA 1SDFA 1IKMA 3DEPA 2JYOA 1WTXA 2B2TA 1RODA
chains in the Genus database with same CATH superfamily
4B3MQ 3RZDB 1AE3A 4R4TA 5FJ8H 1Q1BA 3V2TA 3HP3A 3A5UA 4X62L 3PIP3 3A8JE 1VF5C 1YHBA 2PQAB 3U58A 1Q86C 4OX9Q 3S24A 4PMBA 2VXWA 2E75C 3W1GA 1W6KA 4CJ1B 3S1QH 4CHTB 1VQLA 2G5DA 3OIQA 3DM1A 4LF8Q 4YHHL 3TREA 4DV0Q 2VQEL 4AQYL 2C35B 1KABA 3F2CA 3GTPB 3OW7A 3E0JA 4XQNA 1LT5D 5FLMG 4A3JH 3PCOB 2SNMA 4P75A 1QNUA 4YWMA 3J7AV 1L0XB 2F3VA 3OIPA 2JQOA 1YIJA 1DOLA 5C44H 2JA5G 2KVMA 4DUYL 1VS0A 4GOPC 1EEFD 2F4IA 4IN3A 1YZ6A 3KK7A 2BE5C 3BDOA 4A3MH 1IKLA 2PMZB 1I50H 1G2TA 1R4QB 1S5CD 2EXDA 3KDFB 4ME5A 1PFMA 5KYLA 2ZJRA 4GNXA 2IL8A 2XRSD 4DXFA 5COYA 3W5OA 1GHKA 1FYCA 5C3EB 1Y1VB 1YI2A 4APVA 3GP7A 1OTCA 2XGTA 2PQEA 1QVFA 4G57A 1X65A 3I4MB 2JA8G 3FVQA 5IOCA 2MGSA 1BOSA 4F7XA 2IX0A 2K14A 4OGQC 5TSSA 3K7UC 3IFDA 4JI2Q 3SVMA 4B3TL 1G91A 1KLUD 1IBKL 2A6HD 1D1IA 1E2VA 4X6AH 1PA6A 4C3JB 4C3IG 3A8KE 2DUDA 3KF6A 1B53A 1KDBA 1A2UA 4KMUC 4G7ZC 3HRZC 4FF1A 4LNQA 2ZTCA 2JEBI 4A3KG 1BO0A 1PH8A 4JV5Q 4AIMA 2JA8B 4JI4Q 3K57A 2EYPA 3VA7A 3GTMH 1I4XA 2PW7A 1Z9FA 4L5RC 1LTID 3J7A5 4DR6L 4L8JA 1HJPA 2F0VA 2SEBD 3AFPA 2KEEA 2DN8A 4L5QA 4DR1L 2CH4A 3I70A 2WINB 3JC66 5GAHC 1JOOA 1VQAA 5M3FG 3GTKH 2IHEA 4LUZA 5D65A 1FVIA 1PV4A 5FLXE 1EFID 4A3EH 3SHLA 2EY6A 3DWAA 1Y1WH 2KHJA 5F2DA 1GM5A 3NK9A 5BN5A 2F0TA 3TEHB 3MXNB 5ELDA 1SE3A 4KN7C 2MNAA 3K58A 2K1BA 2JA8H 3U4VA 3J7YW 2ZXRA 2IJ0A 3J7ZC 1BF4A 3L3OC 1I4RA 2L5TA 3T1YQ 1QE6A 1N36Q 3RZOH 1EUJA 3EIVA 3PV0A 3H0GH 4DAYA 4WJ3M 1F2ZA 4C3IH 3E0EA 1RD9D 5A35A 2JP1A 5IY0A 5IGCA 3S16H 3U4ZA 4BBRG 1I4QA 3CMAA 2A6ED 4KI0A 1LM0A 1JWUD 4HSVA 4WJ4A 4JPBW 1N9WA 3K8AA 3NHHA 2EY2A 4KJOA 4OIKA 2UUAL 4ZUIA 4BS9A 4FF3A 3ONAB 1Z6HA 1AZQA 1XMOQ 1A15A 2R7ZG 5J1ZA 2UUBL 2I46A 1PFSA 2NBFA 1GUWA 2HDLA 1NY4A 3G71A 3VR4A 5BN3A 3R3OA 4DV3Q 3E3XA 4DK3C 4HIDA 4QJFA 2X69A 5IP7H 1PTOC 4R4IA 3S14H 5LMUQ 2E74C 4C1NK 3Q0AA 2F0MA 3TZUA 1X3QA 1FJGL 5KIXA 4NB3A 1RTOA 3G7LA 1IBLQ 2RKSA 2EJFC 4DA2A 1B70B 2E76C 2EDGA 4DPGA 2BA0A 3J80L 3G6EA 3IFTA 1LT6D 4A3JG 3S1RB 3FEWX 4HJ7A 4A3IG 1HA6A 4CDCC 2D9UA 1HTLD 1NE3A 3LX0A 3QB3A 1A3UA 1XNRQ 1CFMA 1MJCA 5C3WA 4LF9Q 2O5JC 3HKZG 3OYYA 4KK7A 1ESRA 1Y1WG 5T1IA 1A3VA 3SE0A 4IURA 2PPBC 4K5WA 1K83H 4JYAQ 2XIWA 1LTLA 2NN6I 2UU9Q 4B9WA 3U9OA 1STHA 1XJVA 1VCIA 3TP5A 1LTGD 2ZTDA 2NN6G 3P7JA 2NTSA 1ILPA 1C9OA 1GUNA 2A6EC 4K2KA 5EKIA 1K8MA 3J7AF 2K05A 4JI3L 1LT3D 4R4OA 1QZGA 3P1HA 5FOBB 1LT4D 2OWOA 1E22A 1X55A 2QDBA 3P75A 2HIXA 1ZKOA 1STYA 4HJ8A 4DV1L 1NR2A 3GO5A 4C3JH 2N78A 2LS01 3KLSX 1KLGD 1D5MC 1PYWD 2BA1A 2PMZE 5KGUA 1YBYA 4PMWA 4A93B 3D3RA 3BZDB 1E1TA 2EOTA 2R6GA 2MQHA 4LWCA 4LF6Q 3QO2A 5EGTA 1ASZA 2EYLA 3I4NG 1BCPF 1EWHA 1A3TA 2Z4IA 5GAGC 1IBML 1CKNA 4H0LC 1S5ED 1BBWA 3CC7A 4A3FB 2YTVA 5DLQE 2V1CC 3DMUA 4A3CG 3PGZA 3LGJA 2G9HD 3EJIA 2I5HA 3NXWA 1BR9A 1TY0A 5CR3A 1KC8C 3PMFA 1EYAA 4X62Q 1YNXA 4QY7A 4GKJL 2B63B 4LF7Q 1N36L 2GA4B 4K5XA 2JA6G 3HOUG 1WTQA 2K75A 4RCOA 1VQKA 1IYVA 2Z6KC 1CQFA 2YTXA 1NCVA 3H0GB 3J81L 2F3IA 1EY0A 1I3QB 2NUCA 3CF5A 3PO3H 1PVOA 1KQSA 4UP9A 4HEDA 3TMEA 4DUZL 3GTLB 3CKIB 3OMGA 3PIOA 4LFAL 4DK1A 2K28A 3BDLA 2B2UC 1YJNA 2ZM6L 4BXXH 2UXCL 2WB1E 1NTGA 1SDFA 3DEPA 2CCZA 4KHZA 2KJXA 3VR3A 2GN5A 1D8LA 4BY1G 1HNZL 1GXDC 1VQIA 3K0YA 3J80i 3TP6A 3LNNA 3PUXA 3K59A 5C4XG 2WP8J 4HTHA 1I4PA 1II3A 1K28A 3CCQA 3GTOB 1XXGA 1EOTA 3DEOA 4IUNA 1GKHA 1JE4A 3OOCA 1PMRA 2AUKA 1PTOH 1FJGQ 3RLOA 1VQCA 3PO3G 1YJWA 3STBD 1J9OA 1FGUA 3QG1A 3E5SA 4A3IH 4G7HC 2ICIA 1R9TB 1L1OA 4IUUA 5IP9G 1D5ZC 4FF4A 1IW7C 2JA9A 3I3CA 2EVBA 4JVZA 3GTLH 3FHWA 2KECA 3SGIA 2HDMA 1H9KA 1E3PA 3CCRA 5I2YA 1FD7D 5C0XJ 1XPRA 4B08A 3C2PA 2Q8RE 3K6OA 3NBHA 4P74A 4DV2Q 3NEMA 2LFNA 4LFBL 3TP7A 4HCEA 5CC4A 3S2DH 2DJGC 4O0AA 4A3DH 2CWPA 1SNQA 1PZJD 2QCPX 2Z1CA 4X65Q 2F0PA 1CSPA 5JEAH 3CXCA 4A3LH 1V1QA 4GLVB 4FP5D 1EY4A 2F4VL 1J5EQ 1JJCB 5C3EH 3AEVA 5FO7B 5IYBG 1E2WA 3A54A 4BBSH 3D8GA 4BWGB 3ICEA 1XNRL 4LAAA 1SBBB 1KHIA 4DR6Q 4IJLA 1SNOA 3WOFA 3CCSA 3BVZA 1SLJA 3X3NA 2R7ZB 1TWHB 3QOJA 4HJAA 4YCWA 1IL2A 3KBXA 3CHBD 4JG2A 3I73A 3K5LA 3GTQB 5K36G 1PRTB 5C4JB 2B2YC 4JI5Q 4A3DB 2VB3X 4ZKCB 2CHBD 3NSWA 4C2MH 3HEJA 5J3BA 4K6LA 3IKJA 4LF5Q 2L0CA 2OCEA 3M3YB 1A63A 1KRTA 3MFGA 2BH8A 4ZCKA 2F0NA 1EYCA 2E2DC 4Q5VA 5C4ZA 3I2ZA 4A3EG 2F4VQ 1O7YA 3I90A 3VYUA 4OELB 2CQOA 2QW7A 5EPLA 3IAYA 4JI6Q 1KDCA 3IRBA 1F9PA 2OEOA 4A3DG 2E2HB 1EU3A 5M5YH 1MI2A 3CRLC 4TVAB 4HR7B 4JC0A 4DV4L 4I65A 3JAMc 2E2JH 2L11A 3HKZB 3OTOL 1TS2A 2RDFA 5IGFA 5M3MG 3Q24A 1F2MA 3HOWB 2A74C 2EYHA 2ENBA 4ZRZA 1G291 1TWFB 2A69C 2N88A 2F0WA 1U4PA 4DNTB 3K5MA 2RQXA 1HZBA 1K8OA 3J81E 5IT9c 1DM0B 1CT1D 2KCNA 2B2WA 5JJKA 2F1MA 3KF8B 1SFOH 2MUYA 1SSOA 5I6YA 1BKBA 5GADC 2F03A 2JA6H 1I3QH 5K36H 4CDFC 2JXMB 4YHHQ 5M5XH 1S3OA 5AFWA 4H44C 1HCZA 1B8AA 5CBEE 3N52A 4GN5A 1VQPA 3HS0C 3TS0A 4YWKA 1X3PA 3TSSA 1L0YB 1BVSA 3DUZA 2F0KA 1QUQB 3Q8DA 1OXVA 3H6MA 3CCEA 2VQFQ 1AE2A 2D5DA 5E3FA 2PZUA 4IFDI 3I4NB 2F0IA 3J80c 1CKMA 4GNXC 2H4OA 3MWYW 2F52A 3VR2A 1XMQQ 1B44D 4U673 4YIJA 2EIFA 1UUPA 4JI7L 2EXZA 2QKIC 1JC7A 1BDOA 1I4GA 1SYFA 2K5QA 4DK6C 1I6VC 1SMYD 5E7NA 4YY3Q 2E5LQ 2ZXOA 4UPAA 2L9HA 2NVYB 2B63G 1ILQA 2KBNA 4DR3Q 1HA5A 3BDCA 1TWAB 2UXBL 1WTVA 5KRUA 2R93H 1SE4A 3A7AB 4GKKL 5J22A 1VQGA 4DR4L 2BH2A 3KJPA 2B3GA 3W3AA 1WD0A 1LACA 4OHJA 3GTPH 2KCMA 1Q82C 2YYZA 3GDEA 2OF1A 1N8RC 4UP8A 4PMCA 4FXGC 5ELCA 1QB5D 4DAPA 1JOQA 2F0QA 1RODA 2WFWA 1WVLA 1PTOB 5EKLA 1HR0Q 4PQXA 4LF4L 2OTLA 2H5XA 1QZHA 2DNCA 3AMUA 4J8QA 3U50C 3W1BA 1TT2A 2Q2IA 3CQZB 4XT1B 1HR0L 1X56A 1TU2B 1HHVA 3WOEA 3Q23A 2SNSA 4QGUA 1PH3A 5EJWA 4A3GB 3VDYA 2RVLA 4KJNA 3KLSA 4QIWE 4F8MA 5FLXc 4JBMA 3NBIA 1TY2A 1PH7A 5M3FH 3T1HQ 2K33A 4K0KL 3MC0B 3MFYA 4OONA 2VB2X 4FO2A 1WCMH 1CA5A 3V05A 5IYCH 3GTJB 1QUQA 3V96A 4GZYC 4JOIA 3S14B 4DR3L 1V9PA 2Z8LA 3S17H 4DR2L 4ZLTF 4YCUA 4XXEA 5C0XH 4L5TA 3I4MH 1ZEQX 2Z4HA 3K80C 3I4NH 1MHWC 4DN4M 4GN4B 1Q46A 2B2VC 3CP0A 3EQLC 3CCMA 2I0QA 2NZHA 4RH6A 4B3ML 4OO1I 2O4XA 3U9SA 4F88A 2E2IB 1M90C 3H0GG 5FO8B 3BVGA 4O42A 3UDIA 4TRDA 1IZ6A 3D4DA 3W2DA 3KF8A 1HQMC 5IT9E 1J5EL 1ET6A 2RDGA 5ELEA 4K0KQ 5IP9H 2PW5A 4HSPA 4KD4A 4JI0Q 3NWTA 1NJIC 1K8GA 2VUMB 4K8JA 3FRPB 4KTAA 4YCVA 3I7FA 3URYA 4BY1B 3RD4A 4UY8C 1FGBD 5A2QL 1ZXTA 3UDFA 3T13A 5CORA 3H91A 4X66Q 5K5PA 5IODA 4RKLA 1PH9A 1MGSA 2MJ8A 3EA6A 1F77A 4DU9A 3GTGH 3D4RA 1ENFA 2JYOA 4DV7Q 1WTXA 5L37A 1W6JA 1SEBD 4A3EB 1B7YB 1Q81C 1EIFA 1CHQD 1K83B 1C8CA 5CBAE 3VR6A 1KD1C 1EY6A 5GROA 4FYDA 2RSOA 4IPCA 4JK1C 2A6HC 2M9VA 4HCSA 1Y8OB 4PNYA 1D1KA 1H9SA 2XTIA 4RHRA 3KOJA 2NVQH 3A74A 3RZDH 3RN2A 2JN4A 2JJQA 4HIOA 4RKBA 3FKIB 1U4RA 4DFAA 1PTOD 2H1EA 3GTGB 3QJYA 1YNNC 3R2TA 1JQYD 2UXDQ 1CKOA 2QILA 3HOWG 2RBMA 1A8VA 2F0GA 4A3GG 4RCNA 2KCTA 1KDAA 3EFXD 1LTBD 2JA5B 3GV6A 1IXRA 1QILA 4DR2Q 2TMPA 1W2BA 1MKHA 2C9OA 2B2VA 5DAUA 3J80E 5IWAL 1GVPA 3S1MB 1I5FA 2NZ1D 1LTTD 4YY3L 3DHQA 2A1AA 4KY7A 2JA7H 2NVYH 1TXYA 2PNHA 1HPCA 4NW2A 4OWWB 2ALYB 4N9TA 5LMNW 1WYDA 3D31A 4X3TA 2L1BA 4A75A 4DR5Q 5JJLA 2B29A 2ZJPA 2NVTB 1YEZA 1K73C 4A3BH 4K14A 1Z47A 3IL8A 3DM3A 4QCLA 2MO1A 1PLFA 4LF7L 1DD2A 1H9JA 2QGQA 4O2DA 2UXCQ 3CPWA 4V0BA 1KXLA 2RDHA 4JBWA 1YNND 3CD6A 4JI8Q 4MTNA 4BBRH 4ODGA 2P5ZX 3F8TA 1VQ6A 3S17B 4LF5L 2JE6I 2ZT9C 1I94Q 2FJ2A 3T1HL 1S40A 2EZVA 4WJWA 3CMEA 3S9WA 1N34Q 3S2DB 2JA7B 1I6HB 2R7FA 2EY1A 4XIGS 2AMCB 4FXKC 5C44B 1KTKA 3G6JB 2EYOA 2VUMG 2MP1A 4H02A 4IOAA 4KHPQ 3GQBA 4R8IA 4B3RQ 2B2UA 2Z6KA 1JB7A 1TWGH 1EFWA 2JA5H 4RAUC 3HOYH 4A3GH 4ALPA 2CW0D 2R92B 5C5LA 1GJXA 2AQ2B 3UDGA 1GOZA 2D0PA 1O7LA 5M3MB 1IKMA 1IBMQ 1K9MC 1EWCA 3TZDA 3CU7A 2JA7G 1B9NA 3FPUB 1SR3A 4X65L 3CAMA 3SDZA 5JPNC 5C6AA 1I94L 3J81c 5DNFA 3J81j 2E2HH 5KEEA 1IW7D 1B4OA 1PYBA 3M4OH 1V1OA 1N33L 5I9OA 1B2TA 4EQNA 5M3MH 1F2YA 2VL6A 5M9OA 5G3LF 1Q3LA 2EYFA 2K50A 3I55A 2WACA 1X6OA 2NWGA 3KBGA 4JCVE 4HMJA 3JAME 4RA8A 3PUWA 5A2QE 1U4MA 1Y8NB 4ZK9B 1VQDA 2UUCL 2AUJD 4Y52H 1EQVA 2IX3A 1SJHD 1N32Q 1JORA 3OWEB 1TQOA 3I4LA 5FJ8G 5I4DA 1OO9B 3N6RA 1AFPA 4ME3A 1HFNA 1DGSA 3ULPA 4CDDC 3A5ZB 5HURA 4OEMB 5IGBA 1GO3E 4LW1A 2DGYA 2XWJB 1PRTC 3EVQA 2HHHL 1NSNS 2K6AA 2PNRC 1EQRA 1H9MA 1ONLA 4UP7A 2E2IH 2VZAA 1QWYA 4BBSB 1JWSD 3A8IE 2ZM6Q 2HIVA 5HGQA 2F0FA 1DJRD 5EPKA 4J6HA 3OPOA 4IUVA 2UXDL 3MZ5A 4RG1A 3RUZA 1VQ8A 1I50B 3F2UA 3L7ZC 2ICEC 4KKUA 3PO2G 1V1PA 3MVVA 3F1ZA 1QNKA 2PO4A 2UUAQ 3JAMi 4POGA 1IBLL 3MAQA 3O13A 2BCOA 2F0OA 1RJTA 2HQLA 4QF4A 1I4HA 2F0EA 1YVCA 1BXTA 2NB0A 2FFKB 4DK0A 1UEBA 3OHXC 4DKAC 1RIPA 3CPFA 2HCIA 4P71A 4NXMQ 1ASYA 1Y14B 4DR1Q 2EY5A 4K5VA 3PO2B 1S5DD 3OSOA 4OO1H 3D6CA 3A55A 4JOIC 2I07B 1DCZA 4C3HG 3H09A 1EOVA 3I91A 4BY7H 2K5DA 3A56A 1EZ8A 3HKZE 2E2JB 2WKCA 3OW2A 2J7ZA 1EY8A 1RL2A 1F9RA 3RNUA 2FHTA 4H13C 3FMCA 2RCNA 1NNXA 4Y7NB 3VA5A 2HHHQ 4PZ6A 4PV1C 1NUCA 3MTSA 4MIUA 5LHY1 3GTMB 2ZTEA 1VQHA 2XWBB 1L0WA 2PQAA 4N8FA 2FINB 3NQTA 3FKIG 3OTOQ 1XTCD 2WB1B 3B6YA 3STBC 4A3KH 1WTPA 1EY5A 1C0AA 1YHQA 1QCBD 4JI4L 5KNDA 1HNWL 3PO3B 2KHSA 1ZYRD 1PDQA 4A3BG 2VUMH 3KJOA 4X64Q 2NZOA 1X32A 4ZQ3A 2ZJQA 2QA4A 3BG3A 2F0LA 2R61A 4DV1Q 1JE5A 1K0RA 2TSSA 2PI2A 4A3FG 3RR5A 1CI3M 1YNJC 1DZ1A 3GD7A 1MBYA 5EAYA 1SYCA 2ZXPA 1PH1A 1KRSA 4NXNQ 1JJ2A 4RGOS 1A0IA 1B9MA 4A3BB 1N34L 4LUOA 4IQZA 1HNWQ 5E4XA 2UUCQ 1GD7A 2N3SA 2NN6H 2F0HA 1RTNA 5KNBA 2XN9C 5CGKA 4JYAL 2L15A 1FL0A 2OQ0A 2KHIA 1VQJA 4P2CB 4NMZA 1QJOA 1ICWA 3F2DA 3T4AC 3AQQA 4TQUS 2RSNA 5M3FB 3KFUA 4B3TQ 3NP8A 1AH9A 4JI1L 4A3JB 1X9NA 1CHPD 1LO5D 3HOVB 3DWPA 1Q8IA 1LABA 1VQ4A 5NUCA 4KD3A 3MXUA 1VQEA 4RFBA 5JEAJ 2UU9L 1S5FD 3BS1A 2R92G 1LV9A 2L4NA 1CSQA 5DM73 1UAPA 4OL7A 3M85A 3GTKB 4Z9CB 1STNA 3L2PA 3P20A 2AWOA 4QL5A 2BDOA 3NUCA 4GOPB 3RLFA 2K7VA 2D2CC 1HUMA 2OQKA 1EIHA 1Q12A 3M7GA 1SMYC 1G51A 4M1UB 2OXPA 2Q2HA 3DXJC 5D3IB 1XMOL 1UE7A 3HOUH 3PO2H 2E8GA 5C5MA 4ULLA 4QQBX 2OTJA 1LLRD 5D14A 2WB1G 2A68C 4EQOA 2CWAA 2IW3A 4FNFA 5EKKA 4LF8L 4OWXB 5HGTA 1XTDA 2WKDA 1EIYB 4JW0A 1HNZQ 4IFDH 2K32A 2RCFA 3KDFA 3TQYA 3C1FA 2HCCA 4EQ5A 4A93G 1VF7A 3T51B 1JB3A 1TWHH 1SAPA 2B39A 4CKBA 5H1SE 2OT2A 4IPDA 1GHJA 4S3SA 1SROA 1PRTD 3NBHB 1RDPD 5M5WH 1D2BA 5LL6X 3SK4A 5T1GA 1GUOA 4O1NA 3AFQA 5JVH3 2HUGA 3VYSA 5CV6A 2Y0SE 4WORA 3PIO3 4JI0L 3NE5B 3QWNA 2DNEA 3UI2A 4XYQA 3HOXB 1J8IA 3MA2B 2K5HA 3RMHA 1C48A 1PHJA 2O2LD 4H7BA 2IHFA 3PUZA 4JI8L 3I72A 1IYUA 3A0JA 4MZ9A 4C3JG 4DV6L 3NTHA 4N8X1 2NYZD 3RLNA 2PI2E 4JI2L 3FPPA 4JI6L 4RHSA 1ML0D 2ID0A 2F0DA 3PF5A 1TKWB 4I7ZC 4BY7G 4A3KB 5KNCA 5JEAG 4ID6A 5BR8Q 1PYSB 4MN3A 3HOXG 3NTIA 3QR8A 4GN3B 4HJ5A 3HOWH 2Y0SG 3M4OB 1LTRD 1SMXA 4RGNA 2QEXA 2DY7A 5CYUA 3VR5A 1E24A 2F0JA 4KY6A 4E6IA 4B9XA 2BOSA 3PUYA 1YHAA 2KUMA 4U68A 3GTOH 1S72A 1VQMA 1TVXA 2A73B 4KKTA 1GUSA 2K01A 4BY7B 3MXNA 2LXKA 2LXJA 1VMCA 4KHPL 1BNZA 3ZYYX 4MNOA 1JT8A 4IZ8A 5IE8A 1NMFA 5ELBA 3RN5A 3C3LA 1S5BD 4X3SA 1M1KC 4GKKQ 1HQRD 1MSHA 1HTPA 1G6PA 3EROA 3Q22A 4IOCA 3M3YH 5G3LD 1X54A 1TWAH 5LMUL 1WD1A 3E9IA 3KLRA 5CV5A 4JI5L 1OXSC 3K81C 3E6ZX 1AZPA 2RF4A 1HNXQ 1SNPA 1RHPA 5EQ0A 1XYIA 3M4QA 4R4QA 2WAQB 3T1YL 1B3QA 2MHVA 5C0XG 3QOLA 1CZWA 1IL8A 2Q2TA 2IY5B 3HOZG 4IUQA 3ERQA 2V4DA 4P72A 1U0LA 1Y1VH 2B2TC 3LWEA 1PH5A 1EYGA 1VQ9A 5GQOA 1PH6A 2YU9B 1RKNA 1ENAA 4L5SA 1EEID 1AN8A 3H94A 1NR4A 1LTSD 4A3MB 4IFDG 2D0OA 2YTYA 2PCFB 3I4MG 3J81i 2CW0C 4BA1I 1D5XC 4NP5A 1RCVD 1DONA 2UUBQ 2XRQD 1GUTA 4DV2L 5J39A 2VY3A 3S1MH 1WTHA 4ILWA 4AQYQ 5FKAC 2Q8TA 1AW7A 2LY7A 1OXUA 4WRDA 4QMGA 3CCUA 4DR7Q 1UE1A 1EQTA 4A3IB 1CTMA 2I5MX 3R8BA 2B8FA 2VNUD 2NVQB 1DOMA 1F2LA 1K0SA 1Y8PB 1JJGA 1FR3A 4IPGA 3SK5A 4C56C 2CVRA 1SNDA 4QIWB 2XSCA 3T16A 5JOBA 5CV4A 1R4PB 3I56A 5ELNA 1HZ9A 1HUNA 2J4XA 1WJJA 1K3RA 2M2LA 4A76A 1SN8A 2BDNA 3M4PA 3S15H 1FNWA 1TWCH 4NKLA 3H3VH 3S1RH 3S1NB 4RGTA 2EE1A 2R93B 1XWEA 2FMMA 4BY1H 3H3VC 2QDLA 4C2MB 5LMNL 1Y1VG 1E1OA 1VMPA 4TKOB 1BCPB 3HG9A 2B63H 3A7LA 3TS2A 2WAQG 3K5NA 1PH4A 4BBRB 4DR4Q 4R9WA 3GV3A 4N9PA 2R93G 2M00A 4DAYB 1N33Q 4A3FH 3SK8A 4X3UA 3K5OA 2EPBA 4F87A 5JAVA 4MHEA 2PZTA 1CQVA 1E7ZA 4AYBG 1EL0A 4KY5A 2N55A 4MTKA 1JCKB 2KOLA 2EJGC 4JI1Q 1JR0D 1MJEA 3S16B 2MPMA 1EZ6A 1XMQL 1QOHA 2DY8A 1B1ZA 4DGZA 2XVSA 1A62A 3RZOB 4KHVA 3G4SA 4DV0L 4R8NA 3CCVA 4M8AA 3MXPA 1OXXK 1SFOB 5I2XA 3S1NH 1MSGA 1E0BA 1R9TH 2B2YA 2J0TD 2GVAA 4K2LA 2Z0SA 1CKNB 1L2FA 3CQZH 4NXNL 4UHVA 5I6WA 4LFBQ 3SEBA 2Z9HA 1CK1A 2LMCB 5LMNQ 5C0XI 1VQFA 2Y0SB 1DXMA 3TP8A 4LUVA 5KYIA 5M5YB 3NPPA 5FO9B 3QIAA 3ND9A 3CCLA 4ZAIA 1SYBA 4G7OC 1PXUA 4LFAQ 1C4QA 1CUKA 4KKSA 1X3FA 3HOVH 1PTOF 1XX8A 4V190 4JI7Q 1Z7TA 3EN2A 4K8IA 2IPKD 5IIFA 1LUZA 5IYDH 2Q8IB 4DXGA 2R7DA 3HGBA 2O5IC 4GNXB 4RWSC 4DNIA 5C4JH 4DV6Q 3BZKA 3MHBA 4B3SQ 1EIGA 3AB9A 3D4WA 3ER0A 3HOXH 3H15A 4PZ8A 3AYHB 3D6WA 3M7NA 1VQNA 1WCMG 1O7ZA 4ZYSA 1C7YA 4EQPA 1FNVA 4L6TB 2NTTA 4IALA 4UDUC 5AJ3Q 2MO0A 1SYGA 5HY6A 3M4YA 3TN2A 3HOZB 2F0UA 1A2TA 2QEJC 1TS5A 1HZCA 5AJ3L 1PRTF 2Z6BA 4UAIA 4A3CH 2JEAI 4DV5Q 3OWFA 4A3MG 1VQBA 3CC2A 5M5XB 1WCMB 4IPHA 4IUTA 1STGA 1PH2A 2KENA 2JA6B 2IX1A 3D0FA 3BYTB 1PFNA 4YWLA 1EQQA 3TBIB 5CV8A 2A69D 1K3BC 2BE5D 1EU4A 3R2IA 4FDBA 4AH6A 5IYDG 1N32L 2AQ1B 1EY7A 1M8AA 5JJZA 4HAEA 3S1QB 1T5EA 1BQQT 1HNXL 1V43A 1O78A 1WI5A 2LKVA 1Y69U 3PUVA 4GLAC 4LFCL 1RF2D 1G8ZD 3S2HH 5C4XB 1ICFB 1IBKQ 1STEA 3ERSX 3NELA 1WFQA 1XPUA 4HIMA 1HZAA 4B3RL 4DV4Q 4OO1G 1NMGA 5IT9L 2PYKA 3BU2A 1WTOA 1OXTA 4HIKA 2K04A 1EWIA 3DWQA 5D3DA 1PFBA 1JOKA 3UDXA 1QVCA 1TWGB 3BJUA 4WFN3 2L55A 4FVMA 1T9HA 1UE5A 5JJIA 4CBVA 2HD3A 1T5XD 2MFIA 3CRKC 1SYDA 4A3LG 1H9RA 1I6HH 2Q2UA 2RHSB 1BBXC 5E1FA 1Q90A 2CFMA 5EBCA 2VS1A 5GAEC 4CKEA 1W3SA 3HZXA 1AEXA 4CJ2C 1NAPA 2EYJA 5BR8L 2SOBA 3HOZH 3F2BA 4PZ7A 2XNAC 2K5WA 3ULJA 1STBA 1TIID 5CV9A 3WWVA 4R4CA 1H9SB 2X6LA 2EQSA 3ULLA 4GOPA 1ENCA 4DAVA 5IWAQ 1VDZA 4GLXA 2K03A 4AYBB 4LFCQ 4NXML 2EYMA 2CKZB 3KF6B 4G4KA 2K5NA 4OXPA 4DUYQ 3HKSA 1HR0W 1UEAB 2X6GA 4IO9A 1SXTA 1A6XA 4KN4C 1L1OC 5CMDA 2KEDA 1UWVA 1EY9A 5DM63 1O80A 3CC4A 2VQEQ 4NDXA 1IYJB 3BZCA 4LF6L 2PZWA 2I5LX 1LYLA 2QF7A 3S15B 4K6DA 2B8GA 1H95A 2RHQB 4CJ0B 3PIPA 1G2SA 4LMQD 4C1NI 4L63B 2HT1A 4BXXG 4QB4A 2GVBA 3KYHC 2CQAA 3PQIA 4Y7NH 2R3ZA 4QUFA 1HH2P 3T53B 3SXHA 4GKJQ 2N8NA 2EJMA 2JSOA 3H3VI 5C4XH 3S2HB 2K52A 1AP0A 5JVG3 3C46A 2A68D 1CA6A 4DR5L 4JI3Q 3MXGA 2IWHA 5DEHA 2AKWB 2WIIB 5C4HA 4CDEC 4I7AA 2VQFL 4GS3A 1WTWA 4R1JA 3ITPA 2R92H 5IGGA 5FLXL 4DF7A 3HOYG 1KNEA 4J15A 4EVOA 3ND8A 4DV3L 4CGYB 1L1OB 1HXYD 1SYEA 2ES2A 1KNAA 1B50A 4NPSA 2FMCA 4DV5L 1E2ZA 2DJFC 4LF9L 3LWUA 1SNCA 2FXQA 4C3HH 3DLLA 5ELFA 4RGMA 4AYBE 1YITA 1NBWA 3Q6SA 3L0OA 1DYQA 3SK6A 1KAWA 3ZJYC 3KUPA 4BA2I 2G9DA 3R93A 1KIXA 5C44G 1XNQL 5EBDA 2YV5A 1UNSA 2N49A 5M5WB 1B3AA 1FNUA 4DAMA 3T56B 1YNJD 4A4IA 3VYTA 2JK8A 4XDXA 1VQOA 3UE0A 4A93H 5IYCG 2K5VA 5FK9C 3E9HA 3OMCA 1YJ9A 1MIUA 4Q0FA 4X66L 1CZGA 5JPMC 4OIJA 1VQ7A 1KL9A 4X64L 3I4OA 1Q1EA 4CKCA 3HOVG 4JV5L 3PF4A 1D6EC 1P16A 4EGVA 3FDTA 1SRUA 2NVXH 1UE6A 2L12A 4LK1C 3CCJA 3EBEA 2WV6D 4HN7A 4RMFA 3L9AX 3G48A 4ZKBB 1U5KA 4XQJA 1BUVT 2ASBA 1TWFH 4LF4Q 3FKIH 2CH4W 1BBUA 4XTCS 4OX9L 3VYRA 2B2WC 1MD2D 4QUCA 1HRJA 2A19A 3M9BA 1IHZA 2KQ3A 4X3KA 2RA4A 2AHOB 1V1PB 3NTKA 5ELOA 1EYDA 1TR5A 4XT3B 2AWNA 4IUPA 3AU7A 4JBKA 1VQ5A 4PG3A 5IP7G 1TS4A 2UXBQ 3NENA 1J6QA 4DNRB 1BCPC 4OWTB 2VW9A 1F9QA 1V8QA 1O7IA 1JMCA 2LSSA 1SNMA 2C5CA 5EPJA 3HOYB 1DOKA 2NVXB 1S4ZA 4HJ9A 1P8LA 2A5HA 4DV7L 1QVGA 1U4LA 3MEHA 4B3SL 1LTAD 2SDFA 1GUGA 3BVMA 3NWSA 5BN4A 1JWMD 3X3MA 1BCPD 3TRZA 4KV6A 4ZUJA 4XQQA 3GTQH 2K4KA 1STAA 4P73A 4IFDJ 1D7QA 1CM9A 1PZID 2R7ZH 4IJHA 4FXDA 4HMIA 1K8AC 4ABNA 2KA7A 1SE8A 3WDNA 1JICA 2KCCA 3K7AB 1ZYRC 2IT1A 2YU9H 1HFGA 5C3EG 4DR7L 2E5LL 3CW2C 5IGDA 3K7AH 5IYBH 4FF2A 1ESFA 4LJZC 1M4VA 1XNQQ 5CV7A 1TS3A 1U9RA 2F0SA 2NVTH 1WOCA 1F9SA 1KAAA 3FP9A 3PSIA 1XPOA 4TSSA 5FLMH 5IGEA 4DUZQ 1QG7A 3I8ZA 1PZKD 3HFZB 1SJED 3K0XA 5LL6S 3SR1A 3TDQA 5I9PA 4C3HB 1SE2A 2WAQE 3GTJH 3JAML 3MEFA 4C3IB 1Q8KA 3KLWA 2F3WA 2AQ3B 1WTRA 2A8VA 4KLKA 4JBJA 3C1EA 1Q7YC 4BBSG 1ET9A 5E4WC 3BYYB 5C3XA 4EX5A 3UE1A 4J1MA 4XYOA 1TWCB 4POFA 3HOUB 2D62A 1G6ZA 3NQIA 2HQEA 2ATWA 1X3EA 1X3GA 1Y1WB 5ISRA 2B2TA
chains in the Genus database with same CATH topology
3RZDB 1Q1BA 3V2TA 3HP3A 3PIP3 3A8JE 1VF5C 4PMBA 2VXWA 2E75C 4CJ1B 1W6KA 4CHTB 3OIQA 3DM1A 3GTPB 1KABA 3OW7A 3E0JA 4XQNA 1LT5D 2SNMA 1QNUA 3J7AV 1L0XB 2F3VA 3OIPA 1DOLA 2KVMA 1EEFD 2F4IA 4IN3A 3KK7A 2BE5C 3BDOA 1IKLA 2PMZB 1G2TA 1R4QB 1S5CD 4ME5A 1PFMA 5KYLA 2IL8A 2XRSD 4DXFA 5COYA 1GHKA 1FYCA 5C3EB 1Y1VB 3GP7A 2PQEA 4G57A 3I4MB 3FVQA 5IOCA 2MGSA 1BOSA 4F7XA 2IX0A 4OGQC 5TSSA 3IFDA 3SVMA 1G91A 1KLUD 2A6HD 1E2VA 1D1IA 4C3JB 4C3IG 3A8KE 1B53A 1KDBA 1A2UA 4KMUC 4G7ZC 3HRZC 4FF1A 2JEBI 1BO0A 2JA8B 3K57A 2EYPA 3VA7A 1I4XA 2PW7A 1LTID 4L8JA 2F0VA 2SEBD 2KEEA 2DN8A 3I70A 2WINB 1JOOA 5D65A 5FLXE 1EFID 3SHLA 2EY6A 3DWAA 5F2DA 3NK9A 5BN5A 2F0TA 5ELDA 1SE3A 4KN7C 3K58A 2K1BA 3J7YW 2ZXRA 2IJ0A 1BF4A 3L3OC 1I4RA 2L5TA 1QE6A 3PV0A 4DAYA 1F2ZA 1RD9D 5A35A 2JP1A 5IGCA 1I4QA 2A6ED 4KI0A 1JWUD 4HSVA 3NHHA 2EY2A 4KJOA 4OIKA 4ZUIA 4BS9A 4FF3A 3ONAB 1Z6HA 1AZQA 1A15A 5J1ZA 2I46A 2NBFA 1GUWA 2HDLA 3VR4A 5BN3A 3R3OA 2X69A 1PTOC 2E74C 4C1NK 3Q0AA 2F0MA 3TZUA 1X3QA 5KIXA 1RTOA 3G7LA 2RKSA 2EJFC 4DA2A 2E76C 2EDGA 2BA0A 3J80L 3IFTA 1LT6D 3S1RB 3FEWX 1HA6A 2D9UA 1HTLD 3LX0A 3QB3A 1A3UA 1CFMA 5C3WA 2O5JC 4KK7A 1ESRA 5T1IA 1A3VA 3SE0A 4IURA 2PPBC 4K5WA 2XIWA 2NN6I 4B9WA 3U9OA 1STHA 1VCIA 3TP5A 1LTGD 2NN6G 3P7JA 2NTSA 1ILPA 1GUNA 2A6EC 4K2KA 5EKIA 1K8MA 3J7AF 2K05A 1LT3D 3P1HA 5FOBB 1LT4D 2QDBA 3P75A 1ZKOA 1STYA 1NR2A 3GO5A 2LS01 3KLSX 1KLGD 1D5MC 1PYWD 2BA1A 5KGUA 4PMWA 4A93B 3D3RA 3BZDB 2EOTA 2R6GA 3QO2A 5EGTA 2EYLA 1BCPF 1EWHA 1A3TA 2Z4IA 4H0LC 1S5ED 4A3FB 3DMUA 2G9HD 3EJIA 3NXWA 1BR9A 1TY0A 5CR3A 3PMFA 1EYAA 2B63B 2GA4B 4K5XA 1WTQA 4RCOA 1IYVA 1CQFA 1NCVA 3H0GB 3J81L 2NUCA 1EY0A 1I3QB 4HEDA 3TMEA 3GTLB 3CKIB 3OMGA 4DK1A 2K28A 3BDLA 2B2UC 1SDFA 3DEPA 4KHZA 2KJXA 3VR3A 1GXDC 3K0YA 3TP6A 3LNNA 3PUXA 3K59A 2WP8J 1I4PA 1II3A 4HTHA 3GTOB 1XXGA 1EOTA 3DEOA 4IUNA 1JE4A 3OOCA 1PMRA 2AUKA 1PTOH 1J9OA 3QG1A 3E5SA 4G7HC 2ICIA 1R9TB 4IUUA 1D5ZC 4FF4A 1IW7C 3I3CA 2EVBA 2KECA 2HDMA 1H9KA 5I2YA 1FD7D 5C0XJ 4B08A 3C2PA 2Q8RE 3K6OA 3NBHA 2LFNA 3TP7A 4HCEA 5CC4A 1SNQA 1PZJD 2QCPX 2Z1CA 2F0PA 5JEAH 4FP5D 1EY4A 5FO7B 1E2WA 3A54A 3D8GA 4BWGB 4LAAA 1SBBB 1SNOA 3WOFA 3BVZA 3X3NA 2R7ZB 1TWHB 3QOJA 3KBXA 3CHBD 3I73A 3K5LA 3GTQB 5K36G 1PRTB 5C4JB 2B2YC 4A3DB 2VB3X 4ZKCB 2CHBD 3NSWA 3HEJA 4K6LA 3IKJA 2L0CA 3M3YB 3MFGA 2F0NA 1EYCA 2E2DC 4Q5VA 5C4ZA 1O7YA 3I90A 3VYUA 5EPLA 3IAYA 1KDCA 1F9PA 2OEOA 2E2HB 1EU3A 1MI2A 3CRLC 4HR7B 4I65A 2L11A 3HKZB 1TS2A 2RDFA 5IGFA 3Q24A 1F2MA 3HOWB 2A74C 2EYHA 2ENBA 4ZRZA 1G291 1TWFB 2A69C 2N88A 2F0WA 1U4PA 4DNTB 3K5MA 2RQXA 1K8OA 3J81E 1DM0B 1CT1D 2KCNA 2B2WA 2F1MA 2MUYA 1SSOA 5I6YA 2F03A 5K36H 2JXMB 5AFWA 4H44C 1HCZA 5CBEE 3N52A 3HS0C 1X3PA 3TSSA 1L0YB 3DUZA 2F0KA 1OXVA 3H6MA 2D5DA 5E3FA 2PZUA 4IFDI 3I4NB 2F0IA 2H4OA 3MWYW 3VR2A 1B44D 4U673 4YIJA 1UUPA 2EXZA 2QKIC 1JC7A 1BDOA 1I4GA 1SYFA 2K5QA 1I6VC 1SMYD 2ZXOA 2L9HA 2NVYB 1ILQA 1HA5A 3BDCA 1TWAB 1WTVA 5KRUA 1SE4A 3A7AB 5J22A 3W3AA 1WD0A 1LACA 4OHJA 2YYZA 2OF1A 4PMCA 4FXGC 5ELCA 1QB5D 4DAPA 1JOQA 2F0QA 1RODA 1WVLA 1PTOB 5EKLA 4PQXA 2DNCA 3AMUA 4J8QA 1TT2A 3CQZB 4XT1B 1TU2B 1HHVA 3WOEA 3Q23A 2SNSA 5EJWA 4A3GB 2RVLA 4KJNA 3KLSA 4F8MA 3NBIA 1TY2A 2K33A 3MC0B 3MFYA 2VB2X 4FO2A 1CA5A 3V05A 3GTJB 3V96A 4GZYC 3S14B 2Z8LA 4ZLTF 4XXEA 5C0XH 1ZEQX 2Z4HA 4DN4M 2B2VC 3EQLC 4RH6A 4OO1I 2O4XA 3U9SA 4F88A 2E2IB 5FO8B 3BVGA 4O42A 4TRDA 3D4DA 3W2DA 3KF8A 1HQMC 5IT9E 1ET6A 2RDGA 5ELEA 2PW5A 4HSPA 4KD4A 3NWTA 2VUMB 4K8JA 3FRPB 4KTAA 3URYA 4BY1B 3RD4A 1FGBD 5A2QL 1ZXTA 3T13A 5CORA 3H91A 5K5PA 5IODA 4RKLA 1MGSA 2MJ8A 3EA6A 1F77A 4DU9A 3D4RA 1ENFA 2JYOA 1WTXA 1W6JA 1SEBD 4A3EB 1CHQD 1K83B 1C8CA 5CBAE 3VR6A 1EY6A 4FYDA 2RSOA 4JK1C 2A6HC 2M9VA 4HCSA 1Y8OB 4PNYA 1D1KA 1H9SA 4RHRA 4RKBA 3FKIB 1U4RA 4DFAA 1PTOD 2H1EA 3GTGB 3QJYA 1YNNC 3R2TA 1JQYD 2QILA 2RBMA 2F0GA 4RCNA 1KDAA 3EFXD 1LTBD 2JA5B 3GV6A 1QILA 2TMPA 2C9OA 2B2VA 5DAUA 3J80E 3S1MB 2NZ1D 1LTTD 3DHQA 4KY7A 1HPCA 4NW2A 4N9TA 3D31A 4X3TA 2L1BA 2NVTB 4K14A 1Z47A 3IL8A 4QCLA 1PLFA 1DD2A 1H9JA 4V0BA 2RDHA 4JBWA 1YNND 4ODGA 3S17B 2JE6I 2ZT9C 2FJ2A 2EZVA 4WJWA 3S9WA 3S2DB 2JA7B 1I6HB 2EY1A 4XIGS 5C44B 4FXKC 1KTKA 3G6JB 2EYOA 2MP1A 3GQBA 4R8IA 2B2UA 4RAUC 2CW0D 2R92B 5C5LA 1GJXA 2AQ2B 1GOZA 5M3MB 1O7LA 1IKMA 1EWCA 3TZDA 3CU7A 1B9NA 3FPUB 3SDZA 5JPNC 5C6AA 5DNFA 5KEEA 1IW7D 1B4OA 1V1OA 5I9OA 1B2TA 4EQNA 1F2YA 5M9OA 5G3LF 1Q3LA 2EYFA 2WACA 2NWGA 3KBGA 4HMJA 3JAME 4RA8A 3PUWA 5A2QE 1U4MA 1Y8NB 4ZK9B 2AUJD 1EQVA 2IX3A 1SJHD 1JORA 3OWEB 1TQOA 3I4LA 5I4DA 1OO9B 3N6RA 1AFPA 1HFNA 5HURA 5IGBA 2XWJB 1PRTC 3EVQA 1NSNS 2K6AA 2PNRC 1H9MA 1ONLA 1QWYA 4BBSB 1JWSD 3A8IE 2F0FA 1DJRD 5EPKA 4J6HA 3OPOA 4IUVA 3MZ5A 3RUZA 1I50B 3F2UA 3L7ZC 2ICEC 4KKUA 1V1PA 3MVVA 1QNKA 2PO4A 3MAQA 3O13A 2BCOA 2F0OA 1RJTA 4QF4A 1I4HA 2F0EA 1BXTA 2NB0A 2FFKB 4DK0A 3OHXC 2HCIA 2EY5A 4K5VA 3PO2B 1S5DD 3OSOA 4OO1H 3D6CA 3A55A 2I07B 1DCZA 4C3HG 3H09A 3I91A 2K5DA 3A56A 1EZ8A 2E2JB 2WKCA 2J7ZA 1EY8A 1F9RA 2FHTA 4H13C 3FMCA 4Y7NB 3VA5A 4PV1C 1NUCA 3MTSA 4MIUA 5LHY1 3GTMB 2XWBB 2FINB 3NQTA 1XTCD 2WB1B 1WTPA 1EY5A 1QCBD 5KNDA 3PO3B 2KHSA 1ZYRD 1PDQA 1X32A 4ZQ3A 3BG3A 2F0LA 2R61A 2TSSA 1CI3M 1YNJC 1DZ1A 3GD7A 1MBYA 1SYCA 2ZXPA 4RGOS 1B9MA 4A3BB 4IQZA 5E4XA 2NN6H 2F0HA 1RTNA 5KNBA 2XN9C 5CGKA 4P2CB 4NMZA 1QJOA 1ICWA 5M3FB 3T4AC 4TQUS 2RSNA 3NP8A 4A3JB 1CHPD 1LO5D 3HOVB 3DWPA 1Q8IA 1LABA 5NUCA 4KD3A 3MXUA 4RFBA 5JEAJ 1S5FD 3BS1A 1LV9A 2L4NA 5DM73 1UAPA 4OL7A 3M85A 3GTKB 4Z9CB 1STNA 3P20A 2AWOA 2BDOA 3NUCA 3RLFA 2K7VA 2D2CC 1HUMA 1EIHA 1Q12A 3M7GA 1SMYC 4M1UB 2OXPA 5D3IB 3DXJC 5C5MA 4ULLA 1LLRD 5D14A 2A68C 4EQOA 2IW3A 4FNFA 5EKKA 5HGTA 2WKDA 4IFDH 2K32A 3C1FA 2HCCA 1VF7A 3T51B 1JB3A 1SAPA 2B39A 4CKBA 2OT2A 1GHJA 4S3SA 1PRTD 1RDPD 1D2BA 5LL6X 3SK4A 5T1GA 1GUOA 4O1NA 5JVH3 2HUGA 3VYSA 5CV6A 4WORA 3PIO3 3NE5B 3QWNA 2DNEA 3UI2A 4XYQA 3HOXB 1J8IA 3MA2B 3RMHA 1C48A 2O2LD 4H7BA 3PUZA 3I72A 1IYUA 4C3JG 3NTHA 2NYZD 3FPPA 4RHSA 1ML0D 2ID0A 2F0DA 1TKWB 4I7ZC 4A3KB 5KNCA 5JEAG 4ID6A 4MN3A 3NTIA 3M4OB 1LTRD 4RGNA 2DY7A 5CYUA 3VR5A 2F0JA 4KY6A 4E6IA 4B9XA 2BOSA 3PUYA 2KUMA 4U68A 1TVXA 2A73B 4KKTA 1GUSA 2K01A 4BY7B 3MXNA 1VMCA 1BNZA 3ZYYX 4IZ8A 5ELBA 3C3LA 1S5BD 4X3SA 1HQRD 1MSHA 1HTPA 3EROA 3Q22A 5G3LD 1WD1A 3KLRA 5CV5A 1OXSC 3E6ZX 1AZPA 1SNPA 1RHPA 5EQ0A 1XYIA 2WAQB 2MHVA 5C0XG 1IL8A 1CZWA 3QOLA 4IUQA 3ERQA 2V4DA 2B2TC 3LWEA 2YU9B 1RKNA 1ENAA 1EEID 1AN8A 3H94A 1NR4A 1LTSD 4A3MB 4IFDG 2PCFB 2CW0C 4BA1I 1D5XC 4NP5A 1RCVD 1DONA 2XRQD 1GUTA 5J39A 4ILWA 5FKAC 2Q8TA 1AW7A 2LY7A 1OXUA 4WRDA 4QMGA 1EQTA 4A3IB 1CTMA 3R8BA 2B8FA 2VNUD 2NVQB 1DOMA 1F2LA 1Y8PB 1FR3A 3SK5A 4C56C 2CVRA 1SNDA 4QIWB 2XSCA 3T16A 5JOBA 5CV4A 1R4PB 1HUNA 2J4XA 2M2LA 2BDNA 1FNWA 4NKLA 3S1NB 4RGTA 2EE1A 2R93B 1XWEA 2FMMA 3H3VC 4C2MB 1VMPA 4TKOB 1BCPB 3HG9A 3A7LA 3K5NA 4BBRB 4R9WA 3GV3A 4N9PA 2M00A 3SK8A 4X3UA 3K5OA 2EPBA 4F87A 5JAVA 4MHEA 2PZTA 1CQVA 1EL0A 4KY5A 2N55A 1JCKB 2KOLA 2EJGC 3S16B 1JR0D 2MPMA 1EZ6A 1QOHA 2DY8A 1B1ZA 4DGZA 2XVSA 3RZOB 4KHVA 4R8NA 4M8AA 3MXPA 1OXXK 1SFOB 5I2XA 1MSGA 1E0BA 2B2YA 2J0TD 4K2LA 5I6WA 3SEBA 1CK1A 2LMCB 5C0XI 2Y0SB 1DXMA 3TP8A 5KYIA 5M5YB 3NPPA 5FO9B 3QIAA 3ND9A 4ZAIA 1SYBA 4G7OC 1PXUA 1C4QA 4KKSA 1PTOF 1XX8A 4V190 1Z7TA 4K8IA 2IPKD 5IIFA 2Q8IB 4DXGA 3HGBA 2O5IC 4RWSC 3MHBA 1EIGA 3AB9A 3D4WA 3D6WA 3M7NA 1O7ZA 4ZYSA 4EQPA 1FNVA 4L6TB 2NTTA 4IALA 4UDUC 1SYGA 3M4YA 3TN2A 3HOZB 2F0UA 1A2TA 2QEJC 1TS5A 1PRTF 4UAIA 2JEAI 3OWFA 5M5XB 1WCMB 4IUTA 1STGA 2JA6B 2IX1A 3BYTB 1PFNA 3TBIB 5CV8A 2A69D 2BE5D 1EU4A 3R2IA 2AQ1B 1EY7A 1M8AA 5JJZA 4HAEA 3S1QB 1T5EA 1BQQT 1V43A 1O78A 2LKVA 1Y69U 3PUVA 1RF2D 1G8ZD 5C4XB 1STEA 4OO1G 5IT9L 2PYKA 1WTOA 1OXTA 2K04A 3DWQA 5D3DA 1PFBA 1JOKA 4WFN3 1TWGB 2L55A 4FVMA 4CBVA 1T5XD 3CRKC 1SYDA 1H9RA 1BBXC 5E1FA 1Q90A 5EBCA 4CKEA 3HZXA 1AEXA 4CJ2C 1NAPA 2EYJA 2SOBA 2XNAC 2K5WA 1STBA 1TIID 5CV9A 1H9SB 2X6LA 1ENCA 4DAVA 1VDZA 2K03A 4AYBB 2EYMA 4G4KA 1UEAB 2X6GA 1A6XA 1SXTA 4KN4C 5CMDA 2KEDA 5DM63 1EY9A 1O80A 4NDXA 2PZWA 2QF7A 3S15B 4K6DA 2B8GA 4CJ0B 1G2SA 4LMQD 4C1NI 4L63B 4QB4A 2CQAA 2R3ZA 4QUFA 3T53B 3SXHA 2EJMA 2JSOA 3S2HB 1AP0A 5JVG3 3C46A 2A68D 1CA6A 3MXGA 2IWHA 5DEHA 2WIIB 5C4HA 1WTWA 3ITPA 5IGGA 5FLXL 4DF7A 1KNEA 4EVOA 3ND8A 4CGYB 1HXYD 1SYEA 1KNAA 1B50A 2FMCA 1E2ZA 3LWUA 1SNCA 5ELFA 4RGMA 3Q6SA 1DYQA 3SK6A 3KUPA 4BA2I 2G9DA 3R93A 5EBDA 1UNSA 5M5WB 1B3AA 1FNUA 3T56B 1YNJD 3VYTA 4XDXA 5FK9C 3OMCA 4Q0FA 1CZGA 5JPMC 4OIJA 1Q1EA 4CKCA 1D6EC 4EGVA 3FDTA 2L12A 4LK1C 2WV6D 4HN7A 3L9AX 4ZKBB 4XQJA 1BUVT 4XTCS 3VYRA 2B2WC 1MD2D 4QUCA 1HRJA 1IHZA 2KQ3A 4X3KA 2RA4A 1V1PB 3NTKA 1EYDA 1TR5A 4XT3B 2AWNA 4IUPA 3AU7A 1TS4A 4DNRB 1BCPC 1F9QA 1V8QA 1SNMA 2C5CA 5EPJA 3HOYB 1DOKA 2NVXB 1S4ZA 2A5HA 1U4LA 3MEHA 1LTAD 2SDFA 1GUGA 3BVMA 3NWSA 5BN4A 1JWMD 3X3MA 1BCPD 4KV6A 4ZUJA 4XQQA 1STAA 4IFDJ 1CM9A 1PZID 4FXDA 4HMIA 4ABNA 2KA7A 3WDNA 1JICA 2KCCA 3K7AB 1ZYRC 2IT1A 1HFGA 5IGDA 4FF2A 1ESFA 4LJZC 1M4VA 5CV7A 1TS3A 1U9RA 2F0SA 1F9SA 1KAAA 4TSSA 5IGEA 1QG7A 3I8ZA 1PZKD 5LL6S 1SJED 3SR1A 3TDQA 5I9PA 4C3HB 1SE2A 3JAML 4C3IB 1WTRA 2F3WA 2AQ3B 3C1EA 1ET9A 5E4WC 3BYYB 5C3XA 4J1MA 4XYOA 1TWCB 3HOUB 2D62A 1G6ZA 3NQIA 2HQEA 1Y1WB 5ISRA 2B2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFN A;  2R3Z A;  1F9P A;  1M8A A;  4QUF A;  2DY7 A;  3I91 A;  1LV9 A;  1DOM A;  2L4N A;  4HAE A;  5JJZ A;  1WVL A;  2B2W C;  4QUC A;  1F2L A;  2KEE A;  3HP3 A;  3FPU B;  1ESR A;  1MI2 A;  1HRJ A;  5T1I A;  1C8C A;  5CBA E;  1AP0 A;  1EOT A;  3DEO A;  4X3K A;  2RA4 A;  2KUM A;  2CVR A;  4IUR A;  4U68 A;  2J7Z A;  1JE4 A;  2L11 A;  2XIW A;  1TVX A;  5D65 A;  1CA6 A;  2RSO A;  4XT3 B;  1F9R A;  2FHT A;  2K01 A;  2VXW A;  4HCS A;  1HUM A;  4IUP A;  5DNF A;  4CJ1 B;  1EIH A;  1B4O A;  4XT1 B;  1HUN A;  1VMC A;  3DM1 A;  1BNZ A;  1U4R A;  1J9O A;  2H1E A;  2N88 A;  4ZAI A;  1B2T A;  1HHV A;  2M2L A;  1WTO A;  1U4P A;  3MTS A;  3P7J A;  1WTW A;  4IUU A;  1ILP A;  1Q3L A;  2BDN A;  2K1B A;  5EKI A;  1F9Q A;  2K04 A;  2NWG A;  2K05 A;  5EJW A;  4X3S A;  2FIN B;  1PFB A;  2B2W A;  2RVL A;  1HA6 A;  1KNE A;  1MSH A;  3I3C A;  4RA8 A;  5D14 A;  5EPJ A;  1WTP A;  2EE1 A;  1DOK A;  1U4M A;  1SSO A;  1S4Z A;  2KEC A;  1XX8 A;  3GV6 A;  4ZK9 B;  1BF4 A;  2HDM A;  2B2V A;  2FMM A;  1QE6 A;  1U4L A;  1KNA A;  1WD1 A;  1B50 A;  2SDF A;  2Q8R E;  2NZ1 D;  1PDQ A;  1DOL A;  1CA5 A;  1NR2 A;  2KVM A;  2JP1 A;  1X32 A;  5AFW A;  4RWS C;  4NW2 A;  1BBX C;  1AZP A;  1VMP A;  1RHP A;  5EQ0 A;  5CBE E;  4X3T A;  2HCC A;  1EIG A;  2L1B A;  3N52 A;  1XYI A;  4HSV A;  3Q6S A;  4ZLT F;  1CM9 A;  1IL8 A;  1X3P A;  3D6W A;  1SAP A;  2EOT A;  3KUP A;  1IKL A;  1G2T A;  3QO2 A;  3R93 A;  1DZ1 A;  3IL8 A;  1O7Z A;  4IUQ A;  4OIK A;  1PFM A;  1PLF A;  1NAP A;  4R9W A;  4CJ2 C;  3GV3 A;  1JIC A;  2B2T C;  2IL8 A;  3LWE A;  3ONA B;  4DN4 M;  1B3A A;  2B2V C;  1AZQ A;  1HFG A;  1A15 A;  5COY A;  4X3U A;  5EPK A;  3TN2 A;  2EPB A;  5EPL A;  5T1G A;  4IUV A;  3MWY W;  4MHE A;  2HUG A;  4O42 A;  2HDL A;  2X6L A;  1GUW A;  4XDX A;  3F2U A;  2MGS A;  1NR4 A;  1EL0 A;  1F9S A;  5E4X A;  3UI2 A;  3IFD A;  3TZD A;  2N55 A;  3KBX A;  1QNK A;  3SVM A;  1J8I A;  1RTN A;  2X69 A;  4UAI A;  1G91 A;  1QG7 A;  3I8Z A;  2K03 A;  2FJ2 A;  1RJT A;  2KOL A;  2B2Y C;  1DON A;  2L9H A;  4ZKC B;  1X3Q A;  1WTQ A;  2MPM A;  1ILQ A;  4OIJ A;  2X6G A;  2DY8 A;  2FFK B;  1RTO A;  1WTR A;  1NCV A;  4IUT A;  2MP1 A;  3G7L A;  1ICW A;  2NYZ D;  1B53 A;  1WTV A;  2RSN A;  3FDT A;  5CMD A;  2KED A;  4R8I A;  4HED A;  5E4W C;  2B2U A;  1ML0 D;  1ZXT A;  2Q8T A;  4RAU C;  1O80 A;  1BO0 A;  1PFN A;  2HCI A;  2L12 A;  3H91 A;  5COR A;  1WD0 A;  1MSG A;  1MGS A;  2K28 A;  2B2U C;  2MJ8 A;  1E0B A;  4ZKB B;  1EQT A;  2B2Y A;  1O7Y A;  4CJ0 B;  3I90 A;  1G2S A;  4MN3 A;  1G6Z A;  4LMQ D;  2D9U A;  1SDF A;  1IKM A;  3DEP A;  2JYO A;  1WTX A;  2B2T A;  1ROD A; 
#chains in the Genus database with same CATH topology
 4B3M Q;  3RZD B;  1AE3 A;  4R4T A;  5FJ8 H;  1Q1B A;  3V2T A;  3HP3 A;  3A5U A;  4X62 L;  3PIP 3;  3A8J E;  1VF5 C;  1YHB A;  2PQA B;  3U58 A;  1Q86 C;  4OX9 Q;  3S24 A;  4PMB A;  2VXW A;  2E75 C;  3W1G A;  1W6K A;  4CJ1 B;  3S1Q H;  4CHT B;  1VQL A;  2G5D A;  3OIQ A;  3DM1 A;  4LF8 Q;  4YHH L;  3TRE A;  4DV0 Q;  2VQE L;  4AQY L;  2C35 B;  1KAB A;  3F2C A;  3GTP B;  3OW7 A;  3E0J A;  4XQN A;  1LT5 D;  5FLM G;  4A3J H;  3PCO B;  2SNM A;  4P75 A;  1QNU A;  4YWM A;  3J7A V;  1L0X B;  2F3V A;  3OIP A;  2JQO A;  1YIJ A;  1DOL A;  5C44 H;  2JA5 G;  2KVM A;  4DUY L;  1VS0 A;  4GOP C;  1EEF D;  2F4I A;  4IN3 A;  1YZ6 A;  3KK7 A;  2BE5 C;  3BDO A;  4A3M H;  1IKL A;  2PMZ B;  1I50 H;  1G2T A;  1R4Q B;  1S5C D;  2EXD A;  3KDF B;  4ME5 A;  1PFM A;  5KYL A;  2ZJR A;  4GNX A;  2IL8 A;  2XRS D;  4DXF A;  5COY A;  3W5O A;  1GHK A;  1FYC A;  5C3E B;  1Y1V B;  1YI2 A;  4APV A;  3GP7 A;  1OTC A;  2XGT A;  2PQE A;  1QVF A;  4G57 A;  1X65 A;  3I4M B;  2JA8 G;  3FVQ A;  5IOC A;  2MGS A;  1BOS A;  4F7X A;  2IX0 A;  2K14 A;  4OGQ C;  5TSS A;  3K7U C;  3IFD A;  4JI2 Q;  3SVM A;  4B3T L;  1G91 A;  1KLU D;  1IBK L;  2A6H D;  1D1I A;  1E2V A;  4X6A H;  1PA6 A;  4C3J B;  4C3I G;  3A8K E;  2DUD A;  3KF6 A;  1B53 A;  1KDB A;  1A2U A;  4KMU C;  4G7Z C;  3HRZ C;  4FF1 A;  4LNQ A;  2ZTC A;  2JEB I;  4A3K G;  1BO0 A;  1PH8 A;  4JV5 Q;  4AIM A;  2JA8 B;  4JI4 Q;  3K57 A;  2EYP A;  3VA7 A;  3GTM H;  1I4X A;  2PW7 A;  1Z9F A;  4L5R C;  1LTI D;  3J7A 5;  4DR6 L;  4L8J A;  1HJP A;  2F0V A;  2SEB D;  3AFP A;  2KEE A;  2DN8 A;  4L5Q A;  4DR1 L;  2CH4 A;  3I70 A;  2WIN B;  3JC6 6;  5GAH C;  1JOO A;  1VQA A;  5M3F G;  3GTK H;  2IHE A;  4LUZ A;  5D65 A;  1FVI A;  1PV4 A;  5FLX E;  1EFI D;  4A3E H;  3SHL A;  2EY6 A;  3DWA A;  1Y1W H;  2KHJ A;  5F2D A;  1GM5 A;  3NK9 A;  5BN5 A;  2F0T A;  3TEH B;  3MXN B;  5ELD A;  1SE3 A;  4KN7 C;  2MNA A;  3K58 A;  2K1B A;  2JA8 H;  3U4V A;  3J7Y W;  2ZXR A;  2IJ0 A;  3J7Z C;  1BF4 A;  3L3O C;  1I4R A;  2L5T A;  3T1Y Q;  1QE6 A;  1N36 Q;  3RZO H;  1EUJ A;  3EIV A;  3PV0 A;  3H0G H;  4DAY A;  4WJ3 M;  1F2Z A;  4C3I H;  3E0E A;  1RD9 D;  5A35 A;  2JP1 A;  5IY0 A;  5IGC A;  3S16 H;  3U4Z A;  4BBR G;  1I4Q A;  3CMA A;  2A6E D;  4KI0 A;  1LM0 A;  1JWU D;  4HSV A;  4WJ4 A;  4JPB W;  1N9W A;  3K8A A;  3NHH A;  2EY2 A;  4KJO A;  4OIK A;  2UUA L;  4ZUI A;  4BS9 A;  4FF3 A;  3ONA B;  1Z6H A;  1AZQ A;  1XMO Q;  1A15 A;  2R7Z G;  5J1Z A;  2UUB L;  2I46 A;  1PFS A;  2NBF A;  1GUW A;  2HDL A;  1NY4 A;  3G71 A;  3VR4 A;  5BN3 A;  3R3O A;  4DV3 Q;  3E3X A;  4DK3 C;  4HID A;  4QJF A;  2X69 A;  5IP7 H;  1PTO C;  4R4I A;  3S14 H;  5LMU Q;  2E74 C;  4C1N K;  3Q0A A;  2F0M A;  3TZU A;  1X3Q A;  1FJG L;  5KIX A;  4NB3 A;  1RTO A;  3G7L A;  1IBL Q;  2RKS A;  2EJF C;  4DA2 A;  1B70 B;  2E76 C;  2EDG A;  4DPG A;  2BA0 A;  3J80 L;  3G6E A;  3IFT A;  1LT6 D;  4A3J G;  3S1R B;  3FEW X;  4HJ7 A;  4A3I G;  1HA6 A;  4CDC C;  2D9U A;  1HTL D;  1NE3 A;  3LX0 A;  3QB3 A;  1A3U A;  1XNR Q;  1CFM A;  1MJC A;  5C3W A;  4LF9 Q;  2O5J C;  3HKZ G;  3OYY A;  4KK7 A;  1ESR A;  1Y1W G;  5T1I A;  1A3V A;  3SE0 A;  4IUR A;  2PPB C;  4K5W A;  1K83 H;  4JYA Q;  2XIW A;  1LTL A;  2NN6 I;  2UU9 Q;  4B9W A;  3U9O A;  1STH A;  1XJV A;  1VCI A;  3TP5 A;  1LTG D;  2ZTD A;  2NN6 G;  3P7J A;  2NTS A;  1ILP A;  1C9O A;  1GUN A;  2A6E C;  4K2K A;  5EKI A;  1K8M A;  3J7A F;  2K05 A;  4JI3 L;  1LT3 D;  4R4O A;  1QZG A;  3P1H A;  5FOB B;  1LT4 D;  2OWO A;  1E22 A;  1X55 A;  2QDB A;  3P75 A;  2HIX A;  1ZKO A;  1STY A;  4HJ8 A;  4DV1 L;  1NR2 A;  3GO5 A;  4C3J H;  2N78 A;  2LS0 1;  3KLS X;  1KLG D;  1D5M C;  1PYW D;  2BA1 A;  2PMZ E;  5KGU A;  1YBY A;  4PMW A;  4A93 B;  3D3R A;  3BZD B;  1E1T A;  2EOT A;  2R6G A;  2MQH A;  4LWC A;  4LF6 Q;  3QO2 A;  5EGT A;  1ASZ A;  2EYL A;  3I4N G;  1BCP F;  1EWH A;  1A3T A;  2Z4I A;  5GAG C;  1IBM L;  1CKN A;  4H0L C;  1S5E D;  1BBW A;  3CC7 A;  4A3F B;  2YTV A;  5DLQ E;  2V1C C;  3DMU A;  4A3C G;  3PGZ A;  3LGJ A;  2G9H D;  3EJI A;  2I5H A;  3NXW A;  1BR9 A;  1TY0 A;  5CR3 A;  1KC8 C;  3PMF A;  1EYA A;  4X62 Q;  1YNX A;  4QY7 A;  4GKJ L;  2B63 B;  4LF7 Q;  1N36 L;  2GA4 B;  4K5X A;  2JA6 G;  3HOU G;  1WTQ A;  2K75 A;  4RCO A;  1VQK A;  1IYV A;  2Z6K C;  1CQF A;  2YTX A;  1NCV A;  3H0G B;  3J81 L;  2F3I A;  1EY0 A;  1I3Q B;  2NUC A;  3CF5 A;  3PO3 H;  1PVO A;  1KQS A;  4UP9 A;  4HED A;  3TME A;  4DUZ L;  3GTL B;  3CKI B;  3OMG A;  3PIO A;  4LFA L;  4DK1 A;  2K28 A;  3BDL A;  2B2U C;  1YJN A;  2ZM6 L;  4BXX H;  2UXC L;  2WB1 E;  1NTG A;  1SDF A;  3DEP A;  2CCZ A;  4KHZ A;  2KJX A;  3VR3 A;  2GN5 A;  1D8L A;  4BY1 G;  1HNZ L;  1GXD C;  1VQI A;  3K0Y A;  3J80 i;  3TP6 A;  3LNN A;  3PUX A;  3K59 A;  5C4X G;  2WP8 J;  4HTH A;  1I4P A;  1II3 A;  1K28 A;  3CCQ A;  3GTO B;  1XXG A;  1EOT A;  3DEO A;  4IUN A;  1GKH A;  1JE4 A;  3OOC A;  1PMR A;  2AUK A;  1PTO H;  1FJG Q;  3RLO A;  1VQC A;  3PO3 G;  1YJW A;  3STB D;  1J9O A;  1FGU A;  3QG1 A;  3E5S A;  4A3I H;  4G7H C;  2ICI A;  1R9T B;  1L1O A;  4IUU A;  5IP9 G;  1D5Z C;  4FF4 A;  1IW7 C;  2JA9 A;  3I3C A;  2EVB A;  4JVZ A;  3GTL H;  3FHW A;  2KEC A;  3SGI A;  2HDM A;  1H9K A;  1E3P A;  3CCR A;  5I2Y A;  1FD7 D;  5C0X J;  1XPR A;  4B08 A;  3C2P A;  2Q8R E;  3K6O A;  3NBH A;  4P74 A;  4DV2 Q;  3NEM A;  2LFN A;  4LFB L;  3TP7 A;  4HCE A;  5CC4 A;  3S2D H;  2DJG C;  4O0A A;  4A3D H;  2CWP A;  1SNQ A;  1PZJ D;  2QCP X;  2Z1C A;  4X65 Q;  2F0P A;  1CSP A;  5JEA H;  3CXC A;  4A3L H;  1V1Q A;  4GLV B;  4FP5 D;  1EY4 A;  2F4V L;  1J5E Q;  1JJC B;  5C3E H;  3AEV A;  5FO7 B;  5IYB G;  1E2W A;  3A54 A;  4BBS H;  3D8G A;  4BWG B;  3ICE A;  1XNR L;  4LAA A;  1SBB B;  1KHI A;  4DR6 Q;  4IJL A;  1SNO A;  3WOF A;  3CCS A;  3BVZ A;  1SLJ A;  3X3N A;  2R7Z B;  1TWH B;  3QOJ A;  4HJA A;  4YCW A;  1IL2 A;  3KBX A;  3CHB D;  4JG2 A;  3I73 A;  3K5L A;  3GTQ B;  5K36 G;  1PRT B;  5C4J B;  2B2Y C;  4JI5 Q;  4A3D B;  2VB3 X;  4ZKC B;  2CHB D;  3NSW A;  4C2M H;  3HEJ A;  5J3B A;  4K6L A;  3IKJ A;  4LF5 Q;  2L0C A;  2OCE A;  3M3Y B;  1A63 A;  1KRT A;  3MFG A;  2BH8 A;  4ZCK A;  2F0N A;  1EYC A;  2E2D C;  4Q5V A;  5C4Z A;  3I2Z A;  4A3E G;  2F4V Q;  1O7Y A;  3I90 A;  3VYU A;  4OEL B;  2CQO A;  2QW7 A;  5EPL A;  3IAY A;  4JI6 Q;  1KDC A;  3IRB A;  1F9P A;  2OEO A;  4A3D G;  2E2H B;  1EU3 A;  5M5Y H;  1MI2 A;  3CRL C;  4TVA B;  4HR7 B;  4JC0 A;  4DV4 L;  4I65 A;  3JAM c;  2E2J H;  2L11 A;  3HKZ B;  3OTO L;  1TS2 A;  2RDF A;  5IGF A;  5M3M G;  3Q24 A;  1F2M A;  3HOW B;  2A74 C;  2EYH A;  2ENB A;  4ZRZ A;  1G29 1;  1TWF B;  2A69 C;  2N88 A;  2F0W A;  1U4P A;  4DNT B;  3K5M A;  2RQX A;  1HZB A;  1K8O A;  3J81 E;  5IT9 c;  1DM0 B;  1CT1 D;  2KCN A;  2B2W A;  5JJK A;  2F1M A;  3KF8 B;  1SFO H;  2MUY A;  1SSO A;  5I6Y A;  1BKB A;  5GAD C;  2F03 A;  2JA6 H;  1I3Q H;  5K36 H;  4CDF C;  2JXM B;  4YHH Q;  5M5X H;  1S3O A;  5AFW A;  4H44 C;  1HCZ A;  1B8A A;  5CBE E;  3N52 A;  4GN5 A;  1VQP A;  3HS0 C;  3TS0 A;  4YWK A;  1X3P A;  3TSS A;  1L0Y B;  1BVS A;  3DUZ A;  2F0K A;  1QUQ B;  3Q8D A;  1OXV A;  3H6M A;  3CCE A;  2VQF Q;  1AE2 A;  2D5D A;  5E3F A;  2PZU A;  4IFD I;  3I4N B;  2F0I A;  3J80 c;  1CKM A;  4GNX C;  2H4O A;  3MWY W;  2F52 A;  3VR2 A;  1XMQ Q;  1B44 D;  4U67 3;  4YIJ A;  2EIF A;  1UUP A;  4JI7 L;  2EXZ A;  2QKI C;  1JC7 A;  1BDO A;  1I4G A;  1SYF A;  2K5Q A;  4DK6 C;  1I6V C;  1SMY D;  5E7N A;  4YY3 Q;  2E5L Q;  2ZXO A;  4UPA A;  2L9H A;  2NVY B;  2B63 G;  1ILQ A;  2KBN A;  4DR3 Q;  1HA5 A;  3BDC A;  1TWA B;  2UXB L;  1WTV A;  5KRU A;  2R93 H;  1SE4 A;  3A7A B;  4GKK L;  5J22 A;  1VQG A;  4DR4 L;  2BH2 A;  3KJP A;  2B3G A;  3W3A A;  1WD0 A;  1LAC A;  4OHJ A;  3GTP H;  2KCM A;  1Q82 C;  2YYZ A;  3GDE A;  2OF1 A;  1N8R C;  4UP8 A;  4PMC A;  4FXG C;  5ELC A;  1QB5 D;  4DAP A;  1JOQ A;  2F0Q A;  1ROD A;  2WFW A;  1WVL A;  1PTO B;  5EKL A;  1HR0 Q;  4PQX A;  4LF4 L;  2OTL A;  2H5X A;  1QZH A;  2DNC A;  3AMU A;  4J8Q A;  3U50 C;  3W1B A;  1TT2 A;  2Q2I A;  3CQZ B;  4XT1 B;  1HR0 L;  1X56 A;  1TU2 B;  1HHV A;  3WOE A;  3Q23 A;  2SNS A;  4QGU A;  1PH3 A;  5EJW A;  4A3G B;  3VDY A;  2RVL A;  4KJN A;  3KLS A;  4QIW E;  4F8M A;  5FLX c;  4JBM A;  3NBI A;  1TY2 A;  1PH7 A;  5M3F H;  3T1H Q;  2K33 A;  4K0K L;  3MC0 B;  3MFY A;  4OON A;  2VB2 X;  4FO2 A;  1WCM H;  1CA5 A;  3V05 A;  5IYC H;  3GTJ B;  1QUQ A;  3V96 A;  4GZY C;  4JOI A;  3S14 B;  4DR3 L;  1V9P A;  2Z8L A;  3S17 H;  4DR2 L;  4ZLT F;  4YCU A;  4XXE A;  5C0X H;  4L5T A;  3I4M H;  1ZEQ X;  2Z4H A;  3K80 C;  3I4N H;  1MHW C;  4DN4 M;  4GN4 B;  1Q46 A;  2B2V C;  3CP0 A;  3EQL C;  3CCM A;  2I0Q A;  2NZH A;  4RH6 A;  4B3M L;  4OO1 I;  2O4X A;  3U9S A;  4F88 A;  2E2I B;  1M90 C;  3H0G G;  5FO8 B;  3BVG A;  4O42 A;  3UDI A;  4TRD A;  1IZ6 A;  3D4D A;  3W2D A;  3KF8 A;  1HQM C;  5IT9 E;  1J5E L;  1ET6 A;  2RDG A;  5ELE A;  4K0K Q;  5IP9 H;  2PW5 A;  4HSP A;  4KD4 A;  4JI0 Q;  3NWT A;  1NJI C;  1K8G A;  2VUM B;  4K8J A;  3FRP B;  4KTA A;  4YCV A;  3I7F A;  3URY A;  4BY1 B;  3RD4 A;  4UY8 C;  1FGB D;  5A2Q L;  1ZXT A;  3UDF A;  3T13 A;  5COR A;  3H91 A;  4X66 Q;  5K5P A;  5IOD A;  4RKL A;  1PH9 A;  1MGS A;  2MJ8 A;  3EA6 A;  1F77 A;  4DU9 A;  3GTG H;  3D4R A;  1ENF A;  2JYO A;  4DV7 Q;  1WTX A;  5L37 A;  1W6J A;  1SEB D;  4A3E B;  1B7Y B;  1Q81 C;  1EIF A;  1CHQ D;  1K83 B;  1C8C A;  5CBA E;  3VR6 A;  1KD1 C;  1EY6 A;  5GRO A;  4FYD A;  2RSO A;  4IPC A;  4JK1 C;  2A6H C;  2M9V A;  4HCS A;  1Y8O B;  4PNY A;  1D1K A;  1H9S A;  2XTI A;  4RHR A;  3KOJ A;  2NVQ H;  3A74 A;  3RZD H;  3RN2 A;  2JN4 A;  2JJQ A;  4HIO A;  4RKB A;  3FKI B;  1U4R A;  4DFA A;  1PTO D;  2H1E A;  3GTG B;  3QJY A;  1YNN C;  3R2T A;  1JQY D;  2UXD Q;  1CKO A;  2QIL A;  3HOW G;  2RBM A;  1A8V A;  2F0G A;  4A3G G;  4RCN A;  2KCT A;  1KDA A;  3EFX D;  1LTB D;  2JA5 B;  3GV6 A;  1IXR A;  1QIL A;  4DR2 Q;  2TMP A;  1W2B A;  1MKH A;  2C9O A;  2B2V A;  5DAU A;  3J80 E;  5IWA L;  1GVP A;  3S1M B;  1I5F A;  2NZ1 D;  1LTT D;  4YY3 L;  3DHQ A;  2A1A A;  4KY7 A;  2JA7 H;  2NVY H;  1TXY A;  2PNH A;  1HPC A;  4NW2 A;  4OWW B;  2ALY B;  4N9T A;  5LMN W;  1WYD A;  3D31 A;  4X3T A;  2L1B A;  4A75 A;  4DR5 Q;  5JJL A;  2B29 A;  2ZJP A;  2NVT B;  1YEZ A;  1K73 C;  4A3B H;  4K14 A;  1Z47 A;  3IL8 A;  3DM3 A;  4QCL A;  2MO1 A;  1PLF A;  4LF7 L;  1DD2 A;  1H9J A;  2QGQ A;  4O2D A;  2UXC Q;  3CPW A;  4V0B A;  1KXL A;  2RDH A;  4JBW A;  1YNN D;  3CD6 A;  4JI8 Q;  4MTN A;  4BBR H;  4ODG A;  2P5Z X;  3F8T A;  1VQ6 A;  3S17 B;  4LF5 L;  2JE6 I;  2ZT9 C;  1I94 Q;  2FJ2 A;  3T1H L;  1S40 A;  2EZV A;  4WJW A;  3CME A;  3S9W A;  1N34 Q;  3S2D B;  2JA7 B;  1I6H B;  2R7F A;  2EY1 A;  4XIG S;  2AMC B;  4FXK C;  5C44 B;  1KTK A;  3G6J B;  2EYO A;  2VUM G;  2MP1 A;  4H02 A;  4IOA A;  4KHP Q;  3GQB A;  4R8I A;  4B3R Q;  2B2U A;  2Z6K A;  1JB7 A;  1TWG H;  1EFW A;  2JA5 H;  4RAU C;  3HOY H;  4A3G H;  4ALP A;  2CW0 D;  2R92 B;  5C5L A;  1GJX A;  2AQ2 B;  3UDG A;  1GOZ A;  2D0P A;  1O7L A;  5M3M B;  1IKM A;  1IBM Q;  1K9M C;  1EWC A;  3TZD A;  3CU7 A;  2JA7 G;  1B9N A;  3FPU B;  1SR3 A;  4X65 L;  3CAM A;  3SDZ A;  5JPN C;  5C6A A;  1I94 L;  3J81 c;  5DNF A;  3J81 j;  2E2H H;  5KEE A;  1IW7 D;  1B4O A;  1PYB A;  3M4O H;  1V1O A;  1N33 L;  5I9O A;  1B2T A;  4EQN A;  5M3M H;  1F2Y A;  2VL6 A;  5M9O A;  5G3L F;  1Q3L A;  2EYF A;  2K50 A;  3I55 A;  2WAC A;  1X6O A;  2NWG A;  3KBG A;  4JCV E;  4HMJ A;  3JAM E;  4RA8 A;  3PUW A;  5A2Q E;  1U4M A;  1Y8N B;  4ZK9 B;  1VQD A;  2UUC L;  2AUJ D;  4Y52 H;  1EQV A;  2IX3 A;  1SJH D;  1N32 Q;  1JOR A;  3OWE B;  1TQO A;  3I4L A;  5FJ8 G;  5I4D A;  1OO9 B;  3N6R A;  1AFP A;  4ME3 A;  1HFN A;  1DGS A;  3ULP A;  4CDD C;  3A5Z B;  5HUR A;  4OEM B;  5IGB A;  1GO3 E;  4LW1 A;  2DGY A;  2XWJ B;  1PRT C;  3EVQ A;  2HHH L;  1NSN S;  2K6A A;  2PNR C;  1EQR A;  1H9M A;  1ONL A;  4UP7 A;  2E2I H;  2VZA A;  1QWY A;  4BBS B;  1JWS D;  3A8I E;  2ZM6 Q;  2HIV A;  5HGQ A;  2F0F A;  1DJR D;  5EPK A;  4J6H A;  3OPO A;  4IUV A;  2UXD L;  3MZ5 A;  4RG1 A;  3RUZ A;  1VQ8 A;  1I50 B;  3F2U A;  3L7Z C;  2ICE C;  4KKU A;  3PO2 G;  1V1P A;  3MVV A;  3F1Z A;  1QNK A;  2PO4 A;  2UUA Q;  3JAM i;  4POG A;  1IBL L;  3MAQ A;  3O13 A;  2BCO A;  2F0O A;  1RJT A;  2HQL A;  4QF4 A;  1I4H A;  2F0E A;  1YVC A;  1BXT A;  2NB0 A;  2FFK B;  4DK0 A;  1UEB A;  3OHX C;  4DKA C;  1RIP A;  3CPF A;  2HCI A;  4P71 A;  4NXM Q;  1ASY A;  1Y14 B;  4DR1 Q;  2EY5 A;  4K5V A;  3PO2 B;  1S5D D;  3OSO A;  4OO1 H;  3D6C A;  3A55 A;  4JOI C;  2I07 B;  1DCZ A;  4C3H G;  3H09 A;  1EOV A;  3I91 A;  4BY7 H;  2K5D A;  3A56 A;  1EZ8 A;  3HKZ E;  2E2J B;  2WKC A;  3OW2 A;  2J7Z A;  1EY8 A;  1RL2 A;  1F9R A;  3RNU A;  2FHT A;  4H13 C;  3FMC A;  2RCN A;  1NNX A;  4Y7N B;  3VA5 A;  2HHH Q;  4PZ6 A;  4PV1 C;  1NUC A;  3MTS A;  4MIU A;  5LHY 1;  3GTM B;  2ZTE A;  1VQH A;  2XWB B;  1L0W A;  2PQA A;  4N8F A;  2FIN B;  3NQT A;  3FKI G;  3OTO Q;  1XTC D;  2WB1 B;  3B6Y A;  3STB C;  4A3K H;  1WTP A;  1EY5 A;  1C0A A;  1YHQ A;  1QCB D;  4JI4 L;  5KND A;  1HNW L;  3PO3 B;  2KHS A;  1ZYR D;  1PDQ A;  4A3B G;  2VUM H;  3KJO A;  4X64 Q;  2NZO A;  1X32 A;  4ZQ3 A;  2ZJQ A;  2QA4 A;  3BG3 A;  2F0L A;  2R61 A;  4DV1 Q;  1JE5 A;  1K0R A;  2TSS A;  2PI2 A;  4A3F G;  3RR5 A;  1CI3 M;  1YNJ C;  1DZ1 A;  3GD7 A;  1MBY A;  5EAY A;  1SYC A;  2ZXP A;  1PH1 A;  1KRS A;  4NXN Q;  1JJ2 A;  4RGO S;  1A0I A;  1B9M A;  4A3B B;  1N34 L;  4LUO A;  4IQZ A;  1HNW Q;  5E4X A;  2UUC Q;  1GD7 A;  2N3S A;  2NN6 H;  2F0H A;  1RTN A;  5KNB A;  2XN9 C;  5CGK A;  4JYA L;  2L15 A;  1FL0 A;  2OQ0 A;  2KHI A;  1VQJ A;  4P2C B;  4NMZ A;  1QJO A;  1ICW A;  3F2D A;  3T4A C;  3AQQ A;  4TQU S;  2RSN A;  5M3F B;  3KFU A;  4B3T Q;  3NP8 A;  1AH9 A;  4JI1 L;  4A3J B;  1X9N A;  1CHP D;  1LO5 D;  3HOV B;  3DWP A;  1Q8I A;  1LAB A;  1VQ4 A;  5NUC A;  4KD3 A;  3MXU A;  1VQE A;  4RFB A;  5JEA J;  2UU9 L;  1S5F D;  3BS1 A;  2R92 G;  1LV9 A;  2L4N A;  1CSQ A;  5DM7 3;  1UAP A;  4OL7 A;  3M85 A;  3GTK B;  4Z9C B;  1STN A;  3L2P A;  3P20 A;  2AWO A;  4QL5 A;  2BDO A;  3NUC A;  4GOP B;  3RLF A;  2K7V A;  2D2C C;  1HUM A;  2OQK A;  1EIH A;  1Q12 A;  3M7G A;  1SMY C;  1G51 A;  4M1U B;  2OXP A;  2Q2H A;  3DXJ C;  5D3I B;  1XMO L;  1UE7 A;  3HOU H;  3PO2 H;  2E8G A;  5C5M A;  4ULL A;  4QQB X;  2OTJ A;  1LLR D;  5D14 A;  2WB1 G;  2A68 C;  4EQO A;  2CWA A;  2IW3 A;  4FNF A;  5EKK A;  4LF8 L;  4OWX B;  5HGT A;  1XTD A;  2WKD A;  1EIY B;  4JW0 A;  1HNZ Q;  4IFD H;  2K32 A;  2RCF A;  3KDF A;  3TQY A;  3C1F A;  2HCC A;  4EQ5 A;  4A93 G;  1VF7 A;  3T51 B;  1JB3 A;  1TWH H;  1SAP A;  2B39 A;  4CKB A;  5H1S E;  2OT2 A;  4IPD A;  1GHJ A;  4S3S A;  1SRO A;  1PRT D;  3NBH B;  1RDP D;  5M5W H;  1D2B A;  5LL6 X;  3SK4 A;  5T1G A;  1GUO A;  4O1N A;  3AFQ A;  5JVH 3;  2HUG A;  3VYS A;  5CV6 A;  2Y0S E;  4WOR A;  3PIO 3;  4JI0 L;  3NE5 B;  3QWN A;  2DNE A;  3UI2 A;  4XYQ A;  3HOX B;  1J8I A;  3MA2 B;  2K5H A;  3RMH A;  1C48 A;  1PHJ A;  2O2L D;  4H7B A;  2IHF A;  3PUZ A;  4JI8 L;  3I72 A;  1IYU A;  3A0J A;  4MZ9 A;  4C3J G;  4DV6 L;  3NTH A;  4N8X 1;  2NYZ D;  3RLN A;  2PI2 E;  4JI2 L;  3FPP A;  4JI6 L;  4RHS A;  1ML0 D;  2ID0 A;  2F0D A;  3PF5 A;  1TKW B;  4I7Z C;  4BY7 G;  4A3K B;  5KNC A;  5JEA G;  4ID6 A;  5BR8 Q;  1PYS B;  4MN3 A;  3HOX G;  3NTI A;  3QR8 A;  4GN3 B;  4HJ5 A;  3HOW H;  2Y0S G;  3M4O B;  1LTR D;  1SMX A;  4RGN A;  2QEX A;  2DY7 A;  5CYU A;  3VR5 A;  1E24 A;  2F0J A;  4KY6 A;  4E6I A;  4B9X A;  2BOS A;  3PUY A;  1YHA A;  2KUM A;  4U68 A;  3GTO H;  1S72 A;  1VQM A;  1TVX A;  2A73 B;  4KKT A;  1GUS A;  2K01 A;  4BY7 B;  3MXN A;  2LXK A;  2LXJ A;  1VMC A;  4KHP L;  1BNZ A;  3ZYY X;  4MNO A;  1JT8 A;  4IZ8 A;  5IE8 A;  1NMF A;  5ELB A;  3RN5 A;  3C3L A;  1S5B D;  4X3S A;  1M1K C;  4GKK Q;  1HQR D;  1MSH A;  1HTP A;  1G6P A;  3ERO A;  3Q22 A;  4IOC A;  3M3Y H;  5G3L D;  1X54 A;  1TWA H;  5LMU L;  1WD1 A;  3E9I A;  3KLR A;  5CV5 A;  4JI5 L;  1OXS C;  3K81 C;  3E6Z X;  1AZP A;  2RF4 A;  1HNX Q;  1SNP A;  1RHP A;  5EQ0 A;  1XYI A;  3M4Q A;  4R4Q A;  2WAQ B;  3T1Y L;  1B3Q A;  2MHV A;  5C0X G;  3QOL A;  1CZW A;  1IL8 A;  2Q2T A;  2IY5 B;  3HOZ G;  4IUQ A;  3ERQ A;  2V4D A;  4P72 A;  1U0L A;  1Y1V H;  2B2T C;  3LWE A;  1PH5 A;  1EYG A;  1VQ9 A;  5GQO A;  1PH6 A;  2YU9 B;  1RKN A;  1ENA A;  4L5S A;  1EEI D;  1AN8 A;  3H94 A;  1NR4 A;  1LTS D;  4A3M B;  4IFD G;  2D0O A;  2YTY A;  2PCF B;  3I4M G;  3J81 i;  2CW0 C;  4BA1 I;  1D5X C;  4NP5 A;  1RCV D;  1DON A;  2UUB Q;  2XRQ D;  1GUT A;  4DV2 L;  5J39 A;  2VY3 A;  3S1M H;  1WTH A;  4ILW A;  4AQY Q;  5FKA C;  2Q8T A;  1AW7 A;  2LY7 A;  1OXU A;  4WRD A;  4QMG A;  3CCU A;  4DR7 Q;  1UE1 A;  1EQT A;  4A3I B;  1CTM A;  2I5M X;  3R8B A;  2B8F A;  2VNU D;  2NVQ B;  1DOM A;  1F2L A;  1K0S A;  1Y8P B;  1JJG A;  1FR3 A;  4IPG A;  3SK5 A;  4C56 C;  2CVR A;  1SND A;  4QIW B;  2XSC A;  3T16 A;  5JOB A;  5CV4 A;  1R4P B;  3I56 A;  5ELN A;  1HZ9 A;  1HUN A;  2J4X A;  1WJJ A;  1K3R A;  2M2L A;  4A76 A;  1SN8 A;  2BDN A;  3M4P A;  3S15 H;  1FNW A;  1TWC H;  4NKL A;  3H3V H;  3S1R H;  3S1N B;  4RGT A;  2EE1 A;  2R93 B;  1XWE A;  2FMM A;  4BY1 H;  3H3V C;  2QDL A;  4C2M B;  5LMN L;  1Y1V G;  1E1O A;  1VMP A;  4TKO B;  1BCP B;  3HG9 A;  2B63 H;  3A7L A;  3TS2 A;  2WAQ G;  3K5N A;  1PH4 A;  4BBR B;  4DR4 Q;  4R9W A;  3GV3 A;  4N9P A;  2R93 G;  2M00 A;  4DAY B;  1N33 Q;  4A3F H;  3SK8 A;  4X3U A;  3K5O A;  2EPB A;  4F87 A;  5JAV A;  4MHE A;  2PZT A;  1CQV A;  1E7Z A;  4AYB G;  1EL0 A;  4KY5 A;  2N55 A;  4MTK A;  1JCK B;  2KOL A;  2EJG C;  4JI1 Q;  1JR0 D;  1MJE A;  3S16 B;  2MPM A;  1EZ6 A;  1XMQ L;  1QOH A;  2DY8 A;  1B1Z A;  4DGZ A;  2XVS A;  1A62 A;  3RZO B;  4KHV A;  3G4S A;  4DV0 L;  4R8N A;  3CCV A;  4M8A A;  3MXP A;  1OXX K;  1SFO B;  5I2X A;  3S1N H;  1MSG A;  1E0B A;  1R9T H;  2B2Y A;  2J0T D;  2GVA A;  4K2L A;  2Z0S A;  1CKN B;  1L2F A;  3CQZ H;  4NXN L;  4UHV A;  5I6W A;  4LFB Q;  3SEB A;  2Z9H A;  1CK1 A;  2LMC B;  5LMN Q;  5C0X I;  1VQF A;  2Y0S B;  1DXM A;  3TP8 A;  4LUV A;  5KYI A;  5M5Y B;  3NPP A;  5FO9 B;  3QIA A;  3ND9 A;  3CCL A;  4ZAI A;  1SYB A;  4G7O C;  1PXU A;  4LFA Q;  1C4Q A;  1CUK A;  4KKS A;  1X3F A;  3HOV H;  1PTO F;  1XX8 A;  4V19 0;  4JI7 Q;  1Z7T A;  3EN2 A;  4K8I A;  2IPK D;  5IIF A;  1LUZ A;  5IYD H;  2Q8I B;  4DXG A;  2R7D A;  3HGB A;  2O5I C;  4GNX B;  4RWS C;  4DNI A;  5C4J H;  4DV6 Q;  3BZK A;  3MHB A;  4B3S Q;  1EIG A;  3AB9 A;  3D4W A;  3ER0 A;  3HOX H;  3H15 A;  4PZ8 A;  3AYH B;  3D6W A;  3M7N A;  1VQN A;  1WCM G;  1O7Z A;  4ZYS A;  1C7Y A;  4EQP A;  1FNV A;  4L6T B;  2NTT A;  4IAL A;  4UDU C;  5AJ3 Q;  2MO0 A;  1SYG A;  5HY6 A;  3M4Y A;  3TN2 A;  3HOZ B;  2F0U A;  1A2T A;  2QEJ C;  1TS5 A;  1HZC A;  5AJ3 L;  1PRT F;  2Z6B A;  4UAI A;  4A3C H;  2JEA I;  4DV5 Q;  3OWF A;  4A3M G;  1VQB A;  3CC2 A;  5M5X B;  1WCM B;  4IPH A;  4IUT A;  1STG A;  1PH2 A;  2KEN A;  2JA6 B;  2IX1 A;  3D0F A;  3BYT B;  1PFN A;  4YWL A;  1EQQ A;  3TBI B;  5CV8 A;  2A69 D;  1K3B C;  2BE5 D;  1EU4 A;  3R2I A;  4FDB A;  4AH6 A;  5IYD G;  1N32 L;  2AQ1 B;  1EY7 A;  1M8A A;  5JJZ A;  4HAE A;  3S1Q B;  1T5E A;  1BQQ T;  1HNX L;  1V43 A;  1O78 A;  1WI5 A;  2LKV A;  1Y69 U;  3PUV A;  4GLA C;  4LFC L;  1RF2 D;  1G8Z D;  3S2H H;  5C4X B;  1ICF B;  1IBK Q;  1STE A;  3ERS X;  3NEL A;  1WFQ A;  1XPU A;  4HIM A;  1HZA A;  4B3R L;  4DV4 Q;  4OO1 G;  1NMG A;  5IT9 L;  2PYK A;  3BU2 A;  1WTO A;  1OXT A;  4HIK A;  2K04 A;  1EWI A;  3DWQ A;  5D3D A;  1PFB A;  1JOK A;  3UDX A;  1QVC A;  1TWG B;  3BJU A;  4WFN 3;  2L55 A;  4FVM A;  1T9H A;  1UE5 A;  5JJI A;  4CBV A;  2HD3 A;  1T5X D;  2MFI A;  3CRK C;  1SYD A;  4A3L G;  1H9R A;  1I6H H;  2Q2U A;  2RHS B;  1BBX C;  5E1F A;  1Q90 A;  2CFM A;  5EBC A;  2VS1 A;  5GAE C;  4CKE A;  1W3S A;  3HZX A;  1AEX A;  4CJ2 C;  1NAP A;  2EYJ A;  5BR8 L;  2SOB A;  3HOZ H;  3F2B A;  4PZ7 A;  2XNA C;  2K5W A;  3ULJ A;  1STB A;  1TII D;  5CV9 A;  3WWV A;  4R4C A;  1H9S B;  2X6L A;  2EQS A;  3ULL A;  4GOP A;  1ENC A;  4DAV A;  5IWA Q;  1VDZ A;  4GLX A;  2K03 A;  4AYB B;  4LFC Q;  4NXM L;  2EYM A;  2CKZ B;  3KF6 B;  4G4K A;  2K5N A;  4OXP A;  4DUY Q;  3HKS A;  1HR0 W;  1UEA B;  2X6G A;  4IO9 A;  1SXT A;  1A6X A;  4KN4 C;  1L1O C;  5CMD A;  2KED A;  1UWV A;  1EY9 A;  5DM6 3;  1O80 A;  3CC4 A;  2VQE Q;  4NDX A;  1IYJ B;  3BZC A;  4LF6 L;  2PZW A;  2I5L X;  1LYL A;  2QF7 A;  3S15 B;  4K6D A;  2B8G A;  1H95 A;  2RHQ B;  4CJ0 B;  3PIP A;  1G2S A;  4LMQ D;  4C1N I;  4L63 B;  2HT1 A;  4BXX G;  4QB4 A;  2GVB A;  3KYH C;  2CQA A;  3PQI A;  4Y7N H;  2R3Z A;  4QUF A;  1HH2 P;  3T53 B;  3SXH A;  4GKJ Q;  2N8N A;  2EJM A;  2JSO A;  3H3V I;  5C4X H;  3S2H B;  2K52 A;  1AP0 A;  5JVG 3;  3C46 A;  2A68 D;  1CA6 A;  4DR5 L;  4JI3 Q;  3MXG A;  2IWH A;  5DEH A;  2AKW B;  2WII B;  5C4H A;  4CDE C;  4I7A A;  2VQF L;  4GS3 A;  1WTW A;  4R1J A;  3ITP A;  2R92 H;  5IGG A;  5FLX L;  4DF7 A;  3HOY G;  1KNE A;  4J15 A;  4EVO A;  3ND8 A;  4DV3 L;  4CGY B;  1L1O B;  1HXY D;  1SYE A;  2ES2 A;  1KNA A;  1B50 A;  4NPS A;  2FMC A;  4DV5 L;  1E2Z A;  2DJF C;  4LF9 L;  3LWU A;  1SNC A;  2FXQ A;  4C3H H;  3DLL A;  5ELF A;  4RGM A;  4AYB E;  1YIT A;  1NBW A;  3Q6S A;  3L0O A;  1DYQ A;  3SK6 A;  1KAW A;  3ZJY C;  3KUP A;  4BA2 I;  2G9D A;  3R93 A;  1KIX A;  5C44 G;  1XNQ L;  5EBD A;  2YV5 A;  1UNS A;  2N49 A;  5M5W B;  1B3A A;  1FNU A;  4DAM A;  3T56 B;  1YNJ D;  4A4I A;  3VYT A;  2JK8 A;  4XDX A;  1VQO A;  3UE0 A;  4A93 H;  5IYC G;  2K5V A;  5FK9 C;  3E9H A;  3OMC A;  1YJ9 A;  1MIU A;  4Q0F A;  4X66 L;  1CZG A;  5JPM C;  4OIJ A;  1VQ7 A;  1KL9 A;  4X64 L;  3I4O A;  1Q1E A;  4CKC A;  3HOV G;  4JV5 L;  3PF4 A;  1D6E C;  1P16 A;  4EGV A;  3FDT A;  1SRU A;  2NVX H;  1UE6 A;  2L12 A;  4LK1 C;  3CCJ A;  3EBE A;  2WV6 D;  4HN7 A;  4RMF A;  3L9A X;  3G48 A;  4ZKB B;  1U5K A;  4XQJ A;  1BUV T;  2ASB A;  1TWF H;  4LF4 Q;  3FKI H;  2CH4 W;  1BBU A;  4XTC S;  4OX9 L;  3VYR A;  2B2W C;  1MD2 D;  4QUC A;  1HRJ A;  2A19 A;  3M9B A;  1IHZ A;  2KQ3 A;  4X3K A;  2RA4 A;  2AHO B;  1V1P B;  3NTK A;  5ELO A;  1EYD A;  1TR5 A;  4XT3 B;  2AWN A;  4IUP A;  3AU7 A;  4JBK A;  1VQ5 A;  4PG3 A;  5IP7 G;  1TS4 A;  2UXB Q;  3NEN A;  1J6Q A;  4DNR B;  1BCP C;  4OWT B;  2VW9 A;  1F9Q A;  1V8Q A;  1O7I A;  1JMC A;  2LSS A;  1SNM A;  2C5C A;  5EPJ A;  3HOY B;  1DOK A;  2NVX B;  1S4Z A;  4HJ9 A;  1P8L A;  2A5H A;  4DV7 L;  1QVG A;  1U4L A;  3MEH A;  4B3S L;  1LTA D;  2SDF A;  1GUG A;  3BVM A;  3NWS A;  5BN4 A;  1JWM D;  3X3M A;  1BCP D;  3TRZ A;  4KV6 A;  4ZUJ A;  4XQQ A;  3GTQ H;  2K4K A;  1STA A;  4P73 A;  4IFD J;  1D7Q A;  1CM9 A;  1PZI D;  2R7Z H;  4IJH A;  4FXD A;  4HMI A;  1K8A C;  4ABN A;  2KA7 A;  1SE8 A;  3WDN A;  1JIC A;  2KCC A;  3K7A B;  1ZYR C;  2IT1 A;  2YU9 H;  1HFG A;  5C3E G;  4DR7 L;  2E5L L;  3CW2 C;  5IGD A;  3K7A H;  5IYB H;  4FF2 A;  1ESF A;  4LJZ C;  1M4V A;  1XNQ Q;  5CV7 A;  1TS3 A;  1U9R A;  2F0S A;  2NVT H;  1WOC A;  1F9S A;  1KAA A;  3FP9 A;  3PSI A;  1XPO A;  4TSS A;  5FLM H;  5IGE A;  4DUZ Q;  1QG7 A;  3I8Z A;  1PZK D;  3HFZ B;  1SJE D;  3K0X A;  5LL6 S;  3SR1 A;  3TDQ A;  5I9P A;  4C3H B;  1SE2 A;  2WAQ E;  3GTJ H;  3JAM L;  3MEF A;  4C3I B;  1Q8K A;  3KLW A;  2F3W A;  2AQ3 B;  1WTR A;  2A8V A;  4KLK A;  4JBJ A;  3C1E A;  1Q7Y C;  4BBS G;  1ET9 A;  5E4W C;  3BYY B;  5C3X A;  4EX5 A;  3UE1 A;  4J1M A;  4XYO A;  1TWC B;  4POF A;  3HOU B;  2D62 A;  1G6Z A;  3NQI A;  2HQE A;  2ATW A;  1X3E A;  1X3G A;  1Y1W B;  5ISR A;  2B2T A; 
#chains in the Genus database with same CATH homology
 3RZD B;  1Q1B A;  3V2T A;  3HP3 A;  3PIP 3;  3A8J E;  1VF5 C;  4PMB A;  2VXW A;  2E75 C;  4CJ1 B;  1W6K A;  4CHT B;  3OIQ A;  3DM1 A;  3GTP B;  1KAB A;  3OW7 A;  3E0J A;  4XQN A;  1LT5 D;  2SNM A;  1QNU A;  3J7A V;  1L0X B;  2F3V A;  3OIP A;  1DOL A;  2KVM A;  1EEF D;  2F4I A;  4IN3 A;  3KK7 A;  2BE5 C;  3BDO A;  1IKL A;  2PMZ B;  1G2T A;  1R4Q B;  1S5C D;  4ME5 A;  1PFM A;  5KYL A;  2IL8 A;  2XRS D;  4DXF A;  5COY A;  1GHK A;  1FYC A;  5C3E B;  1Y1V B;  3GP7 A;  2PQE A;  4G57 A;  3I4M B;  3FVQ A;  5IOC A;  2MGS A;  1BOS A;  4F7X A;  2IX0 A;  4OGQ C;  5TSS A;  3IFD A;  3SVM A;  1G91 A;  1KLU D;  2A6H D;  1E2V A;  1D1I A;  4C3J B;  4C3I G;  3A8K E;  1B53 A;  1KDB A;  1A2U A;  4KMU C;  4G7Z C;  3HRZ C;  4FF1 A;  2JEB I;  1BO0 A;  2JA8 B;  3K57 A;  2EYP A;  3VA7 A;  1I4X A;  2PW7 A;  1LTI D;  4L8J A;  2F0V A;  2SEB D;  2KEE A;  2DN8 A;  3I70 A;  2WIN B;  1JOO A;  5D65 A;  5FLX E;  1EFI D;  3SHL A;  2EY6 A;  3DWA A;  5F2D A;  3NK9 A;  5BN5 A;  2F0T A;  5ELD A;  1SE3 A;  4KN7 C;  3K58 A;  2K1B A;  3J7Y W;  2ZXR A;  2IJ0 A;  1BF4 A;  3L3O C;  1I4R A;  2L5T A;  1QE6 A;  3PV0 A;  4DAY A;  1F2Z A;  1RD9 D;  5A35 A;  2JP1 A;  5IGC A;  1I4Q A;  2A6E D;  4KI0 A;  1JWU D;  4HSV A;  3NHH A;  2EY2 A;  4KJO A;  4OIK A;  4ZUI A;  4BS9 A;  4FF3 A;  3ONA B;  1Z6H A;  1AZQ A;  1A15 A;  5J1Z A;  2I46 A;  2NBF A;  1GUW A;  2HDL A;  3VR4 A;  5BN3 A;  3R3O A;  2X69 A;  1PTO C;  2E74 C;  4C1N K;  3Q0A A;  2F0M A;  3TZU A;  1X3Q A;  5KIX A;  1RTO A;  3G7L A;  2RKS A;  2EJF C;  4DA2 A;  2E76 C;  2EDG A;  2BA0 A;  3J80 L;  3IFT A;  1LT6 D;  3S1R B;  3FEW X;  1HA6 A;  2D9U A;  1HTL D;  3LX0 A;  3QB3 A;  1A3U A;  1CFM A;  5C3W A;  2O5J C;  4KK7 A;  1ESR A;  5T1I A;  1A3V A;  3SE0 A;  4IUR A;  2PPB C;  4K5W A;  2XIW A;  2NN6 I;  4B9W A;  3U9O A;  1STH A;  1VCI A;  3TP5 A;  1LTG D;  2NN6 G;  3P7J A;  2NTS A;  1ILP A;  1GUN A;  2A6E C;  4K2K A;  5EKI A;  1K8M A;  3J7A F;  2K05 A;  1LT3 D;  3P1H A;  5FOB B;  1LT4 D;  2QDB A;  3P75 A;  1ZKO A;  1STY A;  1NR2 A;  3GO5 A;  2LS0 1;  3KLS X;  1KLG D;  1D5M C;  1PYW D;  2BA1 A;  5KGU A;  4PMW A;  4A93 B;  3D3R A;  3BZD B;  2EOT A;  2R6G A;  3QO2 A;  5EGT A;  2EYL A;  1BCP F;  1EWH A;  1A3T A;  2Z4I A;  4H0L C;  1S5E D;  4A3F B;  3DMU A;  2G9H D;  3EJI A;  3NXW A;  1BR9 A;  1TY0 A;  5CR3 A;  3PMF A;  1EYA A;  2B63 B;  2GA4 B;  4K5X A;  1WTQ A;  4RCO A;  1IYV A;  1CQF A;  1NCV A;  3H0G B;  3J81 L;  2NUC A;  1EY0 A;  1I3Q B;  4HED A;  3TME A;  3GTL B;  3CKI B;  3OMG A;  4DK1 A;  2K28 A;  3BDL A;  2B2U C;  1SDF A;  3DEP A;  4KHZ A;  2KJX A;  3VR3 A;  1GXD C;  3K0Y A;  3TP6 A;  3LNN A;  3PUX A;  3K59 A;  2WP8 J;  1I4P A;  1II3 A;  4HTH A;  3GTO B;  1XXG A;  1EOT A;  3DEO A;  4IUN A;  1JE4 A;  3OOC A;  1PMR A;  2AUK A;  1PTO H;  1J9O A;  3QG1 A;  3E5S A;  4G7H C;  2ICI A;  1R9T B;  4IUU A;  1D5Z C;  4FF4 A;  1IW7 C;  3I3C A;  2EVB A;  2KEC A;  2HDM A;  1H9K A;  5I2Y A;  1FD7 D;  5C0X J;  4B08 A;  3C2P A;  2Q8R E;  3K6O A;  3NBH A;  2LFN A;  3TP7 A;  4HCE A;  5CC4 A;  1SNQ A;  1PZJ D;  2QCP X;  2Z1C A;  2F0P A;  5JEA H;  4FP5 D;  1EY4 A;  5FO7 B;  1E2W A;  3A54 A;  3D8G A;  4BWG B;  4LAA A;  1SBB B;  1SNO A;  3WOF A;  3BVZ A;  3X3N A;  2R7Z B;  1TWH B;  3QOJ A;  3KBX A;  3CHB D;  3I73 A;  3K5L A;  3GTQ B;  5K36 G;  1PRT B;  5C4J B;  2B2Y C;  4A3D B;  2VB3 X;  4ZKC B;  2CHB D;  3NSW A;  3HEJ A;  4K6L A;  3IKJ A;  2L0C A;  3M3Y B;  3MFG A;  2F0N A;  1EYC A;  2E2D C;  4Q5V A;  5C4Z A;  1O7Y A;  3I90 A;  3VYU A;  5EPL A;  3IAY A;  1KDC A;  1F9P A;  2OEO A;  2E2H B;  1EU3 A;  1MI2 A;  3CRL C;  4HR7 B;  4I65 A;  2L11 A;  3HKZ B;  1TS2 A;  2RDF A;  5IGF A;  3Q24 A;  1F2M A;  3HOW B;  2A74 C;  2EYH A;  2ENB A;  4ZRZ A;  1G29 1;  1TWF B;  2A69 C;  2N88 A;  2F0W A;  1U4P A;  4DNT B;  3K5M A;  2RQX A;  1K8O A;  3J81 E;  1DM0 B;  1CT1 D;  2KCN A;  2B2W A;  2F1M A;  2MUY A;  1SSO A;  5I6Y A;  2F03 A;  5K36 H;  2JXM B;  5AFW A;  4H44 C;  1HCZ A;  5CBE E;  3N52 A;  3HS0 C;  1X3P A;  3TSS A;  1L0Y B;  3DUZ A;  2F0K A;  1OXV A;  3H6M A;  2D5D A;  5E3F A;  2PZU A;  4IFD I;  3I4N B;  2F0I A;  2H4O A;  3MWY W;  3VR2 A;  1B44 D;  4U67 3;  4YIJ A;  1UUP A;  2EXZ A;  2QKI C;  1JC7 A;  1BDO A;  1I4G A;  1SYF A;  2K5Q A;  1I6V C;  1SMY D;  2ZXO A;  2L9H A;  2NVY B;  1ILQ A;  1HA5 A;  3BDC A;  1TWA B;  1WTV A;  5KRU A;  1SE4 A;  3A7A B;  5J22 A;  3W3A A;  1WD0 A;  1LAC A;  4OHJ A;  2YYZ A;  2OF1 A;  4PMC A;  4FXG C;  5ELC A;  1QB5 D;  4DAP A;  1JOQ A;  2F0Q A;  1ROD A;  1WVL A;  1PTO B;  5EKL A;  4PQX A;  2DNC A;  3AMU A;  4J8Q A;  1TT2 A;  3CQZ B;  4XT1 B;  1TU2 B;  1HHV A;  3WOE A;  3Q23 A;  2SNS A;  5EJW A;  4A3G B;  2RVL A;  4KJN A;  3KLS A;  4F8M A;  3NBI A;  1TY2 A;  2K33 A;  3MC0 B;  3MFY A;  2VB2 X;  4FO2 A;  1CA5 A;  3V05 A;  3GTJ B;  3V96 A;  4GZY C;  3S14 B;  2Z8L A;  4ZLT F;  4XXE A;  5C0X H;  1ZEQ X;  2Z4H A;  4DN4 M;  2B2V C;  3EQL C;  4RH6 A;  4OO1 I;  2O4X A;  3U9S A;  4F88 A;  2E2I B;  5FO8 B;  3BVG A;  4O42 A;  4TRD A;  3D4D A;  3W2D A;  3KF8 A;  1HQM C;  5IT9 E;  1ET6 A;  2RDG A;  5ELE A;  2PW5 A;  4HSP A;  4KD4 A;  3NWT A;  2VUM B;  4K8J A;  3FRP B;  4KTA A;  3URY A;  4BY1 B;  3RD4 A;  1FGB D;  5A2Q L;  1ZXT A;  3T13 A;  5COR A;  3H91 A;  5K5P A;  5IOD A;  4RKL A;  1MGS A;  2MJ8 A;  3EA6 A;  1F77 A;  4DU9 A;  3D4R A;  1ENF A;  2JYO A;  1WTX A;  1W6J A;  1SEB D;  4A3E B;  1CHQ D;  1K83 B;  1C8C A;  5CBA E;  3VR6 A;  1EY6 A;  4FYD A;  2RSO A;  4JK1 C;  2A6H C;  2M9V A;  4HCS A;  1Y8O B;  4PNY A;  1D1K A;  1H9S A;  4RHR A;  4RKB A;  3FKI B;  1U4R A;  4DFA A;  1PTO D;  2H1E A;  3GTG B;  3QJY A;  1YNN C;  3R2T A;  1JQY D;  2QIL A;  2RBM A;  2F0G A;  4RCN A;  1KDA A;  3EFX D;  1LTB D;  2JA5 B;  3GV6 A;  1QIL A;  2TMP A;  2C9O A;  2B2V A;  5DAU A;  3J80 E;  3S1M B;  2NZ1 D;  1LTT D;  3DHQ A;  4KY7 A;  1HPC A;  4NW2 A;  4N9T A;  3D31 A;  4X3T A;  2L1B A;  2NVT B;  4K14 A;  1Z47 A;  3IL8 A;  4QCL A;  1PLF A;  1DD2 A;  1H9J A;  4V0B A;  2RDH A;  4JBW A;  1YNN D;  4ODG A;  3S17 B;  2JE6 I;  2ZT9 C;  2FJ2 A;  2EZV A;  4WJW A;  3S9W A;  3S2D B;  2JA7 B;  1I6H B;  2EY1 A;  4XIG S;  5C44 B;  4FXK C;  1KTK A;  3G6J B;  2EYO A;  2MP1 A;  3GQB A;  4R8I A;  2B2U A;  4RAU C;  2CW0 D;  2R92 B;  5C5L A;  1GJX A;  2AQ2 B;  1GOZ A;  5M3M B;  1O7L A;  1IKM A;  1EWC A;  3TZD A;  3CU7 A;  1B9N A;  3FPU B;  3SDZ A;  5JPN C;  5C6A A;  5DNF A;  5KEE A;  1IW7 D;  1B4O A;  1V1O A;  5I9O A;  1B2T A;  4EQN A;  1F2Y A;  5M9O A;  5G3L F;  1Q3L A;  2EYF A;  2WAC A;  2NWG A;  3KBG A;  4HMJ A;  3JAM E;  4RA8 A;  3PUW A;  5A2Q E;  1U4M A;  1Y8N B;  4ZK9 B;  2AUJ D;  1EQV A;  2IX3 A;  1SJH D;  1JOR A;  3OWE B;  1TQO A;  3I4L A;  5I4D A;  1OO9 B;  3N6R A;  1AFP A;  1HFN A;  5HUR A;  5IGB A;  2XWJ B;  1PRT C;  3EVQ A;  1NSN S;  2K6A A;  2PNR C;  1H9M A;  1ONL A;  1QWY A;  4BBS B;  1JWS D;  3A8I E;  2F0F A;  1DJR D;  5EPK A;  4J6H A;  3OPO A;  4IUV A;  3MZ5 A;  3RUZ A;  1I50 B;  3F2U A;  3L7Z C;  2ICE C;  4KKU A;  1V1P A;  3MVV A;  1QNK A;  2PO4 A;  3MAQ A;  3O13 A;  2BCO A;  2F0O A;  1RJT A;  4QF4 A;  1I4H A;  2F0E A;  1BXT A;  2NB0 A;  2FFK B;  4DK0 A;  3OHX C;  2HCI A;  2EY5 A;  4K5V A;  3PO2 B;  1S5D D;  3OSO A;  4OO1 H;  3D6C A;  3A55 A;  2I07 B;  1DCZ A;  4C3H G;  3H09 A;  3I91 A;  2K5D A;  3A56 A;  1EZ8 A;  2E2J B;  2WKC A;  2J7Z A;  1EY8 A;  1F9R A;  2FHT A;  4H13 C;  3FMC A;  4Y7N B;  3VA5 A;  4PV1 C;  1NUC A;  3MTS A;  4MIU A;  5LHY 1;  3GTM B;  2XWB B;  2FIN B;  3NQT A;  1XTC D;  2WB1 B;  1WTP A;  1EY5 A;  1QCB D;  5KND A;  3PO3 B;  2KHS A;  1ZYR D;  1PDQ A;  1X32 A;  4ZQ3 A;  3BG3 A;  2F0L A;  2R61 A;  2TSS A;  1CI3 M;  1YNJ C;  1DZ1 A;  3GD7 A;  1MBY A;  1SYC A;  2ZXP A;  4RGO S;  1B9M A;  4A3B B;  4IQZ A;  5E4X A;  2NN6 H;  2F0H A;  1RTN A;  5KNB A;  2XN9 C;  5CGK A;  4P2C B;  4NMZ A;  1QJO A;  1ICW A;  5M3F B;  3T4A C;  4TQU S;  2RSN A;  3NP8 A;  4A3J B;  1CHP D;  1LO5 D;  3HOV B;  3DWP A;  1Q8I A;  1LAB A;  5NUC A;  4KD3 A;  3MXU A;  4RFB A;  5JEA J;  1S5F D;  3BS1 A;  1LV9 A;  2L4N A;  5DM7 3;  1UAP A;  4OL7 A;  3M85 A;  3GTK B;  4Z9C B;  1STN A;  3P20 A;  2AWO A;  2BDO A;  3NUC A;  3RLF A;  2K7V A;  2D2C C;  1HUM A;  1EIH A;  1Q12 A;  3M7G A;  1SMY C;  4M1U B;  2OXP A;  5D3I B;  3DXJ C;  5C5M A;  4ULL A;  1LLR D;  5D14 A;  2A68 C;  4EQO A;  2IW3 A;  4FNF A;  5EKK A;  5HGT A;  2WKD A;  4IFD H;  2K32 A;  3C1F A;  2HCC A;  1VF7 A;  3T51 B;  1JB3 A;  1SAP A;  2B39 A;  4CKB A;  2OT2 A;  1GHJ A;  4S3S A;  1PRT D;  1RDP D;  1D2B A;  5LL6 X;  3SK4 A;  5T1G A;  1GUO A;  4O1N A;  5JVH 3;  2HUG A;  3VYS A;  5CV6 A;  4WOR A;  3PIO 3;  3NE5 B;  3QWN A;  2DNE A;  3UI2 A;  4XYQ A;  3HOX B;  1J8I A;  3MA2 B;  3RMH A;  1C48 A;  2O2L D;  4H7B A;  3PUZ A;  3I72 A;  1IYU A;  4C3J G;  3NTH A;  2NYZ D;  3FPP A;  4RHS A;  1ML0 D;  2ID0 A;  2F0D A;  1TKW B;  4I7Z C;  4A3K B;  5KNC A;  5JEA G;  4ID6 A;  4MN3 A;  3NTI A;  3M4O B;  1LTR D;  4RGN A;  2DY7 A;  5CYU A;  3VR5 A;  2F0J A;  4KY6 A;  4E6I A;  4B9X A;  2BOS A;  3PUY A;  2KUM A;  4U68 A;  1TVX A;  2A73 B;  4KKT A;  1GUS A;  2K01 A;  4BY7 B;  3MXN A;  1VMC A;  1BNZ A;  3ZYY X;  4IZ8 A;  5ELB A;  3C3L A;  1S5B D;  4X3S A;  1HQR D;  1MSH A;  1HTP A;  3ERO A;  3Q22 A;  5G3L D;  1WD1 A;  3KLR A;  5CV5 A;  1OXS C;  3E6Z X;  1AZP A;  1SNP A;  1RHP A;  5EQ0 A;  1XYI A;  2WAQ B;  2MHV A;  5C0X G;  1IL8 A;  1CZW A;  3QOL A;  4IUQ A;  3ERQ A;  2V4D A;  2B2T C;  3LWE A;  2YU9 B;  1RKN A;  1ENA A;  1EEI D;  1AN8 A;  3H94 A;  1NR4 A;  1LTS D;  4A3M B;  4IFD G;  2PCF B;  2CW0 C;  4BA1 I;  1D5X C;  4NP5 A;  1RCV D;  1DON A;  2XRQ D;  1GUT A;  5J39 A;  4ILW A;  5FKA C;  2Q8T A;  1AW7 A;  2LY7 A;  1OXU A;  4WRD A;  4QMG A;  1EQT A;  4A3I B;  1CTM A;  3R8B A;  2B8F A;  2VNU D;  2NVQ B;  1DOM A;  1F2L A;  1Y8P B;  1FR3 A;  3SK5 A;  4C56 C;  2CVR A;  1SND A;  4QIW B;  2XSC A;  3T16 A;  5JOB A;  5CV4 A;  1R4P B;  1HUN A;  2J4X A;  2M2L A;  2BDN A;  1FNW A;  4NKL A;  3S1N B;  4RGT A;  2EE1 A;  2R93 B;  1XWE A;  2FMM A;  3H3V C;  4C2M B;  1VMP A;  4TKO B;  1BCP B;  3HG9 A;  3A7L A;  3K5N A;  4BBR B;  4R9W A;  3GV3 A;  4N9P A;  2M00 A;  3SK8 A;  4X3U A;  3K5O A;  2EPB A;  4F87 A;  5JAV A;  4MHE A;  2PZT A;  1CQV A;  1EL0 A;  4KY5 A;  2N55 A;  1JCK B;  2KOL A;  2EJG C;  3S16 B;  1JR0 D;  2MPM A;  1EZ6 A;  1QOH A;  2DY8 A;  1B1Z A;  4DGZ A;  2XVS A;  3RZO B;  4KHV A;  4R8N A;  4M8A A;  3MXP A;  1OXX K;  1SFO B;  5I2X A;  1MSG A;  1E0B A;  2B2Y A;  2J0T D;  4K2L A;  5I6W A;  3SEB A;  1CK1 A;  2LMC B;  5C0X I;  2Y0S B;  1DXM A;  3TP8 A;  5KYI A;  5M5Y B;  3NPP A;  5FO9 B;  3QIA A;  3ND9 A;  4ZAI A;  1SYB A;  4G7O C;  1PXU A;  1C4Q A;  4KKS A;  1PTO F;  1XX8 A;  4V19 0;  1Z7T A;  4K8I A;  2IPK D;  5IIF A;  2Q8I B;  4DXG A;  3HGB A;  2O5I C;  4RWS C;  3MHB A;  1EIG A;  3AB9 A;  3D4W A;  3D6W A;  3M7N A;  1O7Z A;  4ZYS A;  4EQP A;  1FNV A;  4L6T B;  2NTT A;  4IAL A;  4UDU C;  1SYG A;  3M4Y A;  3TN2 A;  3HOZ B;  2F0U A;  1A2T A;  2QEJ C;  1TS5 A;  1PRT F;  4UAI A;  2JEA I;  3OWF A;  5M5X B;  1WCM B;  4IUT A;  1STG A;  2JA6 B;  2IX1 A;  3BYT B;  1PFN A;  3TBI B;  5CV8 A;  2A69 D;  2BE5 D;  1EU4 A;  3R2I A;  2AQ1 B;  1EY7 A;  1M8A A;  5JJZ A;  4HAE A;  3S1Q B;  1T5E A;  1BQQ T;  1V43 A;  1O78 A;  2LKV A;  1Y69 U;  3PUV A;  1RF2 D;  1G8Z D;  5C4X B;  1STE A;  4OO1 G;  5IT9 L;  2PYK A;  1WTO A;  1OXT A;  2K04 A;  3DWQ A;  5D3D A;  1PFB A;  1JOK A;  4WFN 3;  1TWG B;  2L55 A;  4FVM A;  4CBV A;  1T5X D;  3CRK C;  1SYD A;  1H9R A;  1BBX C;  5E1F A;  1Q90 A;  5EBC A;  4CKE A;  3HZX A;  1AEX A;  4CJ2 C;  1NAP A;  2EYJ A;  2SOB A;  2XNA C;  2K5W A;  1STB A;  1TII D;  5CV9 A;  1H9S B;  2X6L A;  1ENC A;  4DAV A;  1VDZ A;  2K03 A;  4AYB B;  2EYM A;  4G4K A;  1UEA B;  2X6G A;  1A6X A;  1SXT A;  4KN4 C;  5CMD A;  2KED A;  5DM6 3;  1EY9 A;  1O80 A;  4NDX A;  2PZW A;  2QF7 A;  3S15 B;  4K6D A;  2B8G A;  4CJ0 B;  1G2S A;  4LMQ D;  4C1N I;  4L63 B;  4QB4 A;  2CQA A;  2R3Z A;  4QUF A;  3T53 B;  3SXH A;  2EJM A;  2JSO A;  3S2H B;  1AP0 A;  5JVG 3;  3C46 A;  2A68 D;  1CA6 A;  3MXG A;  2IWH A;  5DEH A;  2WII B;  5C4H A;  1WTW A;  3ITP A;  5IGG A;  5FLX L;  4DF7 A;  1KNE A;  4EVO A;  3ND8 A;  4CGY B;  1HXY D;  1SYE A;  1KNA A;  1B50 A;  2FMC A;  1E2Z A;  3LWU A;  1SNC A;  5ELF A;  4RGM A;  3Q6S A;  1DYQ A;  3SK6 A;  3KUP A;  4BA2 I;  2G9D A;  3R93 A;  5EBD A;  1UNS A;  5M5W B;  1B3A A;  1FNU A;  3T56 B;  1YNJ D;  3VYT A;  4XDX A;  5FK9 C;  3OMC A;  4Q0F A;  1CZG A;  5JPM C;  4OIJ A;  1Q1E A;  4CKC A;  1D6E C;  4EGV A;  3FDT A;  2L12 A;  4LK1 C;  2WV6 D;  4HN7 A;  3L9A X;  4ZKB B;  4XQJ A;  1BUV T;  4XTC S;  3VYR A;  2B2W C;  1MD2 D;  4QUC A;  1HRJ A;  1IHZ A;  2KQ3 A;  4X3K A;  2RA4 A;  1V1P B;  3NTK A;  1EYD A;  1TR5 A;  4XT3 B;  2AWN A;  4IUP A;  3AU7 A;  1TS4 A;  4DNR B;  1BCP C;  1F9Q A;  1V8Q A;  1SNM A;  2C5C A;  5EPJ A;  3HOY B;  1DOK A;  2NVX B;  1S4Z A;  2A5H A;  1U4L A;  3MEH A;  1LTA D;  2SDF A;  1GUG A;  3BVM A;  3NWS A;  5BN4 A;  1JWM D;  3X3M A;  1BCP D;  4KV6 A;  4ZUJ A;  4XQQ A;  1STA A;  4IFD J;  1CM9 A;  1PZI D;  4FXD A;  4HMI A;  4ABN A;  2KA7 A;  3WDN A;  1JIC A;  2KCC A;  3K7A B;  1ZYR C;  2IT1 A;  1HFG A;  5IGD A;  4FF2 A;  1ESF A;  4LJZ C;  1M4V A;  5CV7 A;  1TS3 A;  1U9R A;  2F0S A;  1F9S A;  1KAA A;  4TSS A;  5IGE A;  1QG7 A;  3I8Z A;  1PZK D;  5LL6 S;  1SJE D;  3SR1 A;  3TDQ A;  5I9P A;  4C3H B;  1SE2 A;  3JAM L;  4C3I B;  1WTR A;  2F3W A;  2AQ3 B;  3C1E A;  1ET9 A;  5E4W C;  3BYY B;  5C3X A;  4J1M A;  4XYO A;  1TWC B;  3HOU B;  2D62 A;  1G6Z A;  3NQI A;  2HQE A;  1Y1W B;  5ISR A;  2B2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...