2L4NA

Solution structure of the chemokine ccl21
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 21
publication title Solution structure of CCL21 and identification of a putative CCR7 binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l4nA00
5EPKA 5D65A 1MSGA 1GUWA 4ZKCB 2B2YC 1WVLA 1WTVA 2K04A 3I3CA 1PFNA 1PFMA 2K03A 1JICA 2J7ZA 3P7JA 1PDQA 1O7YA 3IL8A 3N52A 1BNZA 1NCVA 2MPMA 2B2UC 5CMDA 2D9UA 2L11A 4CJ1B 4XDXA 1RTOA 2KECA 2B2WC 2B2TA 1QG7A 3HP3A 2L12A 4QUFA 1BBXC 1ESRA 3FPUB 1E0BA 4OIJA 4R8IA 3Q6SA 1F2LA 2R3ZA 3F2UA 2K05A 4HSVA 1WD1A 2FMMA 4IURA 2EPBA 2DY8A 2RSNA 1B50A 1QNKA 2N88A 4IUPA 1EL0A 3H91A 4QUCA 4DN4M 1QE6A 1NR4A 1X32A 1EIGA 2MJ8A 5EQ0A 3I91A 1O7ZA 1DONA 5T1IA 3KUPA 4ZKBB 3LWEA 1RODA 2Q8TA 4CJ2C 1F9PA 1Q3LA 1J9OA 4MN3A 5D14A 1HFNA 1EOTA 2RA4A 4HCSA 3KBXA 1G2SA 2K28A 4IUVA 5EJWA 1RHPA 1G91A 4U68A 4UAIA 1AZPA 2HCCA 1HUMA 1PLFA 2B2TC 1KNAA 2K01A 4HAEA 3D6WA 2KOLA 1WTRA 3DEOA 2X69A 1F9RA 2L1BA 3IFDA 4IUQA 1SSOA 4R9WA 5COYA 2HDLA 1WTQA 1J8IA 1VMPA 2KVMA 1C8CA 1U4LA 1DOKA 3MWYW 5EPLA 1AP0A 3UI2A 1IKMA 2JP1A 1ML0D 1ICWA 2EE1A 2CVRA 2FHTA 2X6LA 2XIWA 4RAUC 1DOLA 2FINB 2KEEA 4OIKA 2Q8RE 2FFKB 2NZ1D 2HDMA 1VMCA 1S4ZA 1MSHA 1MI2A 3FDTA 1HA6A 4RA8A 1IL8A 2L4NA 5E4XA 4O42A 1X3QA 5EKIA 2NYZD 2N55A 3MTSA 1B4OA 1KNEA 1DOMA 1EQTA 5CBEE 1JE4A 1WTXA 1HHVA 1BO0A 1CM9A 1U4MA 1BF4A 1B53A 2DY7A 2RSOA 4NW2A 1F9QA 1G6ZA 4X3UA 1RTNA 3TZDA 1XYIA 2M2LA 4X3KA 1WD0A 2B2VA 5CORA 4XT1B 3GV3A 1SAPA 2HCIA 1U4PA 2K1BA 2MP1A 1X3PA 3GV6A 3I90A 4IUTA 4RWSC 2EOTA 4X3SA 5CBAE 1IKLA 2B2YA 2NWGA 4ZK9B 1A15A 1WTOA 1CA5A 2BDNA 5EPJA 1PFBA 1NR2A 1RJTA 5AFWA 2FJ2A 2JYOA 1SDFA 2B2UA 4HEDA 2H1EA 2L9HA 4ZLTF 2B2WA 1XX8A 1F9SA 2KEDA 4IUUA 1HUNA 1ILQA 3QO2A 2VXWA 2IL8A 4CJ0B 1CA6A 1B3AA 1DZ1A 1LV9A 5T1GA 4XT3B 3DM1A 1EIHA 5E4WC 1M8AA 2RVLA 2KUMA 4MHEA 1U4RA 3TN2A 3SVMA 3ONAB 4X3TA 1NAPA 2MGSA 5DNFA 1MGSA 5JJZA 1ILPA 1B2TA 3DEPA 3G7LA 4LMQD 3I8ZA 3R93A 1AZQA 1G2TA 1HRJA 2HUGA 1HFGA 4ZAIA 1WTWA 1O80A 1TVXA 1ZXTA 2B2VC 2X6GA 1WTPA 2SDFA
chains in the Genus database with same CATH superfamily
4LF5Q 1BCPD 1STGA 3HRZC 3OIQA 4WJWA 5FOBB 3URYA 1TWFH 2KCMA 1LTGD 1PZKD 4DV4L 3M4PA 2QEXA 2RDGA 1GUNA 2ICEC 3HOWB 3FPUB 5D3DA 2LXJA 3F2UA 4FVMA 1E2VA 4KHZA 2A68C 1WD1A 4QF4A 3CF5A 1DGSA 1HR0Q 2VUMB 3K5MA 4H7BA 1I4QA 3FMCA 1PH4A 1IW7D 3LWEA 3CMEA 4M8AA 1GHKA 2EY6A 4DV1L 2LXKA 3PO3G 2RA4A 1G2SA 3NBHB 1OXVA 4C56C 5LHY1 1H9JA 2F4VL 5C4JH 4L5SA 3M7NA 1STEA 1QZGA 1X9NA 4R4CA 4OX9Q 3BZKA 1I94L 3HOWG 4DV7Q 1I3QB 2JEAI 3HOUB 2TSSA 3GTPB 1JE5A 1BKBA 2B8FA 2XGTA 5HY6A 5M3MG 3S17H 4XXEA 1EZ8A 4IOAA 4HTHA 2L4NA 3NHHA 1K3RA 4CKEA 3H0GG 1PTOC 2AQ3B 2NYZD 1IYVA 1K0SA 3MTSA 2VUMG 1PH2A 4MNOA 1HPCA 1GO3E 2PZTA 1PYBA 2H5XA 5CV6A 1K73C 4HIKA 4HCEA 1XYIA 4FYDA 3M4YA 5EBCA 4JI8L 2R7FA 3HOVG 3L3OC 1DD2A 2EVBA 1RJTA 3I4OA 1N32Q 3T16A 1FVIA 3CCSA 3HOUG 2NN6I 4MHEA 3TSSA 4UPAA 5BN4A 2UUAL 4X3TA 1U9RA 1B2TA 2J0TD 3A74A 3BDLA 3TP5A 5EPKA 1RDPD 3J81L 1KAWA 2F0WA 1JICA 5FLXL 5JEAJ 2ZM6Q 1L0XB 3U50C 1X56A 4XDXA 4Z9CB 5J3BA 3JAME 5IT9E 4K6DA 4QUFA 3S2HB 4CHTB 2K5QA 4HSVA 1CSQA 2UXBQ 2F0TA 2F3VA 4JBWA 3AQQA 1KDBA 4BY1B 1QE6A 3MC0B 1R9TH 1HR0W 1SFOH 1AW7A 1PH9A 2AUJD 1SE4A 3KUPA 4C3HH 3H09A 1KTKA 2PW7A 1UE6A 3RN5A 1YZ6A 3P20A 4JI0Q 3LX0A 1EOTA 1RL2A 1L1OB 4GN4B 2E2HH 2B2TC 2NBFA 4BBRG 3CCLA 4IUNA 1Q86C 1WTQA 1TS3A 2JA5H 2KCNA 2R93H 1HNWQ 1TWCH 2FMCA 2YTXA 4CDCC 3R2TA 2BE5C 3MWYW 5EPLA 1X55A 1QNUA 1PH5A 2MHVA 3GDEA 1L1OA 2A73B 2VB3X 4LFBQ 2UXDQ 2NVTB 5IP7H 4QQBX 4RA8A 2ZTDA 1M90C 1VCIA 4BBSG 1MHWC 4YWLA 4LF4L 3S1MH 5BR8L 2Z9HA 4MZ9A 3NK9A 5JEAH 2XRSD 4L63B 1UAPA 1IL2A 2PMZB 4ODGA 1JWSD 3NWSA 3WWVA 1HXYD 5GADC 4F87A 5KGUA 5ELNA 2B2VA 1EWCA 1JOKA 1SAPA 4PG3A 1X3PA 4KI0A 1SEBD 4PMWA 4A3MH 5EKLA 1J5EQ 4JI3Q 4IFDG 1FJGQ 4R4TA 1LTBD 4LF9Q 1B8AA 1EZ6A 1QJOA 3D3RA 3SEBA 4ZLTF 3EJIA 4IPHA 4Q5VA 1XTCD 3F1ZA 3V05A 2IL8A 3AFPA 2F0PA 4CJ0B 1VQDA 4XT3B 2A6HD 2EJMA 4A3IB 4PMCA 1N33Q 4KV6A 4GLVB 1S72A 5KEEA 1G2TA 1HFGA 3GTOB 2K5DA 1NBWA 1VS0A 3TS0A 4TSSA 2VZAA 4JI7Q 2PW5A 4HR7B 3AYHB 2J7ZA 5ISRA 1TWHB 2XRQD 2JA8H 1A0IA 4I7ZC 3CC2A 3DXJC 4OIJA 1VQAA 2MUYA 4WRDA 5K36G 2Y0SG 1Y1VH 2I5LX 1WFQA 1CHQD 4IUPA 3UDIA 4J15A 3VYTA 2FXQA 4OO1G 3S14B 4CDFC 1Z6HA 3S16H 2KENA 4QL5A 2ZJRA 5HGQA 4UP7A 4MN3A 1S5ED 2F0FA 4KJNA 4O1NA 4RHSA 3KBXA 2CHBD 1S5DD 4X64L 5FO9B 2HCCA 3DEOA 1GXDC 3OMGA 1I3QH 5GROA 4JI6Q 3H3VH 1SYGA 1ESFA 1C8CA 3TZUA 1Y14B 4N9TA 1MD2D 5IYBG 1PZJD 1TQOA 3UI2A 3I4NH 1VQ9A 1ML0D 2FHTA 2BA0A 2LS01 3QJYA 5C5MA 1X65A 3RNUA 3HOXG 1EY0A 4PQXA 2KA7A 2M00A 3C3LA 2F0SA 4HSPA 3K0XA 2V1CC 4B3TQ 1YNNC 2I5HA 4DR3L 1SYDA 4EQNA 1ZEQX 2HHHQ 4GKKL 4LJZC 4EGVA 5CBAE 4IUTA 1SNQA 5KNBA 1YNJD 1A15A 3ULJA 1WTOA 5KRUA 4FF1A 1N36Q 5A2QE 2Z4IA 4X62Q 3CCRA 1NY4A 2L9HA 1TR5A 2JJQA 3J80E 4DNIA 5HURA 2E74C 1HUNA 4DNRB 4U673 1TXYA 3LWUA 1EEID 1V1QA 3G6EA 4JI5Q 3RZOH 1CK1A 1MGSA 1NSNS 4IJHA 4HJ7A 3I8ZA 3B6YA 5J1ZA 3P75A 4K5XA 2MQHA 1DCZA 2CH4A 2NVQH 3DLLA 1MSGA 3BDOA 3Q22A 3G71A 3OYYA 3P7JA 1PDQA 2QILA 3A7AB 1EYGA 3MZ5A 5LMUQ 2A74C 4G4KA 1LACA 1K83H 5DM73 5LMNW 4DV0L 3PSIA 2E2JH 4RG1A 4F88A 4A93B 1PVOA 1H95A 1DXMA 1I4XA 1Q1BA 4DAMA 3UDXA 3FKIH 4B3MQ 3D4RA 4DN4M 1JORA 5C3EH 5C44G 1JWMD 4RMFA 1XMOQ 2K4KA 4PZ8A 1QUQB 2LY7A 1K8OA 1Y8OB 4ZCKA 1XMQQ 2A6EC 2SNSA 4CJ2C 4X66Q 4IALA 1SLJA 3HG9A 4HCSA 1AEXA 3A0JA 3NUCA 4HIDA 1KIXA 3KBGA 1BNZA 2X69A 1PH3A 3RD4A 4ME5A 3NSWA 2PZUA 1ICFB 1XPRA 4PNYA 1L2FA 1YBYA 1YVCA 3F2DA 4A3JH 4C3JB 1A3TA 1IYJB 2V4DA 2EE1A 2X6LA 1A2UA 2NZ1D 4A3EG 3PUWA 3S1RB 3Q0AA 1IL8A 4M1UB 3HS0C 3WDNA 1QB5D 3BU2A 2NTTA 3K80C 4A3FH 1BR9A 4DR5Q 3GTLB 4E6IA 1B4OA 1HNZQ 2F03A 1JC7A 3PO2G 3CD6A 3W1GA 1XNRQ 2WV6D 2R7DA 1U4MA 4LFCL 4IFDI 5C6AA 3RN2A 3GTGH 4ZRZA 3CPWA 1WD0A 2ZJQA 2M2LA 4X3KA 2JA7B 2C35B 3T51B 2QA4A 1HTLD 3R8BA 2E2IH 2F0UA 4A3GH 1Y1WB 2CW0C 1XNQQ 1E3PA 1IBKL 3SE0A 3OW2A 3NXWA 2DNCA 3HOZB 4YY3L 5AJ3Q 4HEDA 4PZ6A 1STYA 1RF2D 2ZTEA 2R92H 5C4XG 4DV2L 2XWJB 5FLMG 5EAYA 3KF8B 1SNCA 1JQYD 3C2PA 1L0YB 5FJ8H 2WAQE 2MGSA 3M4OB 2UUBQ 4QGUA 4LUVA 3GTKB 1HZ9A 1D8LA 4GNXB 2ZXRA 4A3KG 5KNDA 3KF8A 4N8X1 1XPOA 2EIFA 5GAEC 2CWPA 2K04A 5IT9c 2CCZA 5M5WH 1LTTD 1P8LA 2B2UC 3CRKC 3K5OA 5CV8A 4DA2A 2L11A 1D1IA 1Y1WG 1BQQT 4JBKA 4AQYQ 4OO1I 2LFNA 4GNXA 3T1YQ 1F2MA 2F0EA 2KBNA 3HOZG 3S1NH 2K05A 2KQ3A 2K7VA 1VQKA 1HQRD 1C48A 3NTHA 4XYOA 2KHJA 2K5NA 4HJAA 2DN8A 2R6GA 3G48A 4DR4L 2JK8A 5FK9C 1IHZA 2F0VA 1QILA 1GUGA 2SNMA 1D1KA 4UDUC 3S1QH 1W3SA 4OHJA 4JI2L 3DWQA 1UEBA 2K33A 4IUQA 4HIOA 1STHA 2EYPA 1CHPD 4IN3A 2ZXPA 4P73A 2KEEA 1PA6A 4P71A 2Q8RE 4AYBE 1E7ZA 1SE2A 2N3SA 4TKOB 1J6QA 2XNAC 1YJWA 1NE3A 4EQ5A 3J7AV 4L8JA 2VQFQ 1TWGH 4L5RC 2EYOA 1GOZA 1BF4A 1RIPA 3NQIA 2WB1E 4FO2A 4RHRA 2DY7A 1RTNA 4DUYL 2MP1A 2EJGC 1AFPA 5IODA 2BDNA 1B7YB 1JCKB 3AMUA 1Q7YC 5HGTA 4NDXA 1CKOA 4B3RL 3BJUA 5E1FA 3GTJB 1CQVA 1LV9A 4KHPL 4JOIC 4C3IG 1QVCA 3TBIB 4DV3Q 2OXPA 4WJ4A 1Y8NB 1WTWA 2F0MA 1MIUA 2UU9Q 1VQLA 4NXMQ 3Q8DA 5C3WA 1BDOA 3NPPA 4O2DA 4QIWB 3HOYB 2JA6H 3GP7A 4JI1L 2KECA 4DAPA 4LF7L 4KMUC 5FKAC 3JAMi 1ENCA 3AU7A 3BG3A 2D0OA 3F2BA 2UUCQ 4JG2A 1PTOB 3QOLA 4FDBA 4K0KL 4C3HG 3EA6A 5JVG3 2UXCQ 2MJ8A 2HD3A 3PO3B 4ULLA 1N8RC 3Q23A 1PFSA 3L2PA 1C4QA 2E76C 4CBVA 3TS2A 2JA5G 2E5LL 2R93G 1UE7A 3J7ZC 1RHPA 3G4SA 5M5XB 4WORA 3A56A 3L0OA 2ALYB 1WTHA 2OWOA 1D6EC 1H9RA 1SSOA 2ENBA 5M3MB 4YHHL 3HOYG 4IPCA 2AKWB 4BA1I 1WCMH 5IP7G 3H0GB 3GTMB 5BN5A 3UE1A 1EQVA 3OTOL 1DOLA 4OIKA 1PMRA 3TMEA 1XPUA 1OXSC 2D0PA 1DM0B 4YCWA 4DV6L 3AEVA 4ID6A 3S2DH 1L0WA 1Y8PB 3S15H 3PIO3 3HOVB 3A7LA 5CBEE 1JE4A 3C46A 1E1TA 1HZCA 3J81E 2IHFA 2F0DA 4DV5Q 2VY3A 3QG1A 4NW2A 4A3MG 4JYAQ 1JJGA 4CDDC 4DAYB 1PRTC 1JOOA 1Y69U 1LUZA 4RWSC 1SROA 4RH6A 1SMYC 3NBHA 3J80c 2HIVA 2Z0SA 3VR5A 2JYOA 5IGEA 1LT4D 3U9SA 1A63A 2KEDA 1D2BA 1LABA 1HH2P 1ZYRD 4LF8Q 2RVLA 3SVMA 4Y7NH 1EY6A 1W6KA 2JE6I 2WKDA 1NNXA 1AZQA 4LF6L 3M4QA 2K75A 2NVYB 2X6GA 4POFA 5D65A 2B2YC 3FVQA 2F0KA 4G57A 5KNCA 2JA9A 4LF5L 2N78A 2B2TA 1BBXC 4DR6Q 1A3VA 1A3UA 5G3LD 2FMMA 2I46A 1OXXK 5IGFA 4BY7H 2I5MX 2N88A 1VQEA 2JEBI 2Q2HA 5DAUA 4QUCA 5I9OA 4LF4Q 3NE5B 1C7YA 3A8KE 4B3SL 3HKZE 3I72A 1M1KC 3CU7A 1MBYA 1LTID 4BBRB 1FD7D 1GM5A 2K32A 2ES2A 1PZID 4IPGA 1LTLA 4DR1Q 3GTQB 1V43A 3F2CA 2A6ED 4P2CB 4BXXH 4HAEA 1SNMA 4R4OA 3T1HQ 4A3DH 1I50B 3I4NG 1F9RA 5GAGC 5K5PA 4BA2I 1SN8A 2RKSA 4BBSB 3A8IE 4C2MH 1SE3A 2B39A 1FR3A 1VMCA 3WOEA 3MXUA 1YIJA 3J7A5 3M3YH 4DNTB 1X3QA 4MIUA 4OX9L 1PTOF 2R7ZH 4DR2L 3F8TA 4DV7L 2D2CC 3UDGA 1DOMA 2VQEL 4K8JA 4KKSA 2QF7A 1F9QA 1A6XA 1BOSA 3GV3A 5CV5A 2EOTA 1YITA 1IKLA 1F2ZA 2JXMB 5IGDA 1EU3A 1N34L 4K2LA 5AFWA 4JV5Q 1NUCA 4CGYB 1LT6D 3CMAA 1AH9A 1ET9A 3A54A 3N6RA 5JJKA 2VXWA 3I4MH 1E22A 3J80i 4RCNA 3ND9A 1M8AA 2EYHA 3CQZH 5ELBA 1N32L 5IYDG 2A69D 2YU9B 1X3FA 3EBEA 2RDFA 1S5CD 2HUGA 1S5FD 1OXTA 2OTLA 1O80A 4G7OC 4GLXA 4A3BH 4A3LG 4L5QA 1WTVA 3VR2A 1BBUA 3SK4A 1O7YA 1P16A 4FNFA 1YJNA 3MXPA 4HJ8A 1UNSA 2Y0SB 1KRSA 3I70A 4IPDA 2ZJPA 2B2WC 1YHBA 1SBBB 1T5EA 1YNXA 1E0BA 1FL0A 5C3EG 5IWAQ 1YEZA 2NZOA 2ZM6L 3JAML 2EYLA 2PO4A 5IT9L 5TSSA 2CWAA 3BYTB 3IFTA 5LL6S 2YV5A 3RMHA 5I2YA 1VQMA 1KLGD 3A55A 4RGTA 4GKJQ 2UXBL 3EFXD 2PNRC 2R61A 4IQZA 1Q8IA 2MO1A 5C0XJ 1WI5A 3HOWH 1XXGA 1F9PA 1EQQA 1EQRA 1Q3LA 4AH6A 3I56A 3J7YW 1KRTA 2A8VA 2F0QA 1VQCA 3K59A 1K9MC 4JCVE 1EWHA 1SE8A 4A3JG 3KLWA 4DXFA 3V2TA 1MKHA 5M5YB 3M9BA 2VUMH 4JI0L 2KVMA 3PF5A 3HOXB 3BYYB 2MNAA 2QGQA 3PIP3 3DWAA 2F1MA 4OWWB 4B08A 1HZBA 2E2DC 3LNNA 1AE3A 1RKNA 1VQHA 4RAUC 1HNXQ 4FXDA 3K5NA 1B70B 3HOVH 3UE0A 5IGCA 1ONLA 1MSHA 1HNWL 3OW7A 4DK6C 1V1OA 1NMGA 3FHWA 1CFMA 1F77A 2AWNA 4FF4A 3KK7A 1V1PB 3W2DA 4DR7L 4YCVA 1BBWA 1IBMQ 2AMCB 4S3SA 3K8AA 4LFBL 4A3GG 1BCPC 1KDCA 2QDBA 4X3UA 5BN3A 3HOUH 3GTPH 2DJFC 1U4PA 2K1BA 5FO7B 2F3WA 2IJ0A 2NWGA 3PUZA 1I4GA 4PZ7A 2RQXA 2R92G 3K7AB 3CCQA 3RLOA 2FJ2A 5I6WA 4F8MA 3NTKA 1R4QB 5C0XH 4PV1C 1ILQA 2B63B 4JI3L 2K6AA 2NVYH 1FJGL 4LF9L 1C0AA 4XQNA 1A62A 1II3A 4DXGA 3ICEA 2CQAA 1TVXA 1K28A 3GO5A 1Z9FA 1LTSD 1N33L 4JI4Q 1T5XD 1PFNA 4A3CG 3U4ZA 1NCVA 3CCUA 5CV7A 1Z47A 4OEMB 4OWTB 3CPFA 1QG7A 1G51A 3RLNA 1I6HB 1KLUD 4R8IA 5C44B 4WJ3M 1F2LA 1VQ4A 1Q8KA 2RSNA 5LMNL 2B63G 3KLSX 2AWOA 1EOVA 3VR3A 4ZKBB 3ZJYC 2Q8TA 3MAQA 4KKUA 2CKZB 2NB0A 3S2HH 1J9OA 5D14A 3PUYA 1TY0A 4IUVA 5EJWA 4Q0FA 1JWUD 4U68A 3TP7A 4R9WA 4BY1H 4K14A 1SJHD 3SGIA 4LFAQ 1VQ5A 3H15A 4YY3Q 4A3EB 3C1EA 2VS1A 1QVGA 3SHLA 3M85A 2AUKA 3MA2B 1LYLA 3RZDB 2A68D 1CSPA 2F0GA 1U5KA 3PO2B 4FXGC 2IWHA 1HA6A 4KK7A 1VQ7A 3J81c 4H02A 2F0IA 5FLXc 2YTVA 1WTXA 1HHVA 3A8JE 3SK5A 2NVXB 3CAMA 2JSOA 1KL9A 3A5ZB 1QUQA 1IBLQ 3HFZB 2WP8J 3I73A 1TWAB 2HCIA 4ME3A 4B3TL 2NVTH 3T56B 3MHBA 2PYKA 3KF6B 1JT8A 5ELDA 2HHHL 2K5WA 5C4XB 1LO5D 3BZDB 1CKNB 1BUVT 3ER0A 5M3FB 2B2UA 3TP8A 3U58A 2DGYA 2C9OA 3QO2A 1TWFB 5JPNC 1N36L 5CV9A 3KF6A 5E4WC 4X62L 5A2QL 4A3KB 1PTOD 3S9WA 3VA7A 4POGA 1CKNA 4X65Q 4QCLA 2Z4HA 4JBMA 3DEPA 3NTIA 1EY5A 2F0LA 3I2ZA 1K8AC 2JA6G 1S5BD 5K36H 1GUWA 4ZKCB 3W5OA 4JI5L 2E8GA 1CI3M 3CC4A 2K03A 1EFID 2A5HA 1BXTA 4OO1H 2EY2A 1EYAA 1EUJA 1KD1C 4GN3B 5IP9G 4A3IH 4P75A 1RTOA 1EIFA 3L9AX 4XIGS 2O2LD 2GN5A 2AQ2B 2EYFA 4DPGA 3GTOH 4DFAA 3Q6SA 5M3FG 2R3ZA 4JVZA 1I4RA 4APVA 1UE5A 5LMUL 1FGBD 1EY7A 4IURA 4RGOS 1VQJA 1PYWD 1NR4A 3RR5A 1TWHH 5C4JB 1DONA 4CDEC 4XTCS 2AHOB 5C3XA 1Q46A 3ERSX 5IYBH 4FF3A 2IHEA 4B3ML 3V96A 3S17B 3HOXH 3KLRA 1XMOL 1G91A 1I5FA 1WCMG 4XQJA 3IKJA 1XMQL 1AN8A 4HMJA 2A19A 5COYA 4X66L 3PV0A 1SYBA 2ZXOA 4NXNQ 3S14H 2PZWA 1DOKA 2OQKA 4CKCA 1IXRA 3NEMA 4IOCA 4QMGA 3I55A 2A6HC 2Z6BA 4KY7A 2EQSA 2HIXA 3O13A 4H0LC 1S40A 3QB3A 2KCTA 3PIOA 2VW9A 4JOIA 4ABNA 3SDZA 3J81j 3VR4A 3J81i 3TDQA 2ID0A 3TZDA 3HZXA 4DR5L 4TVAB 1VQPA 1HNZL 4JI1Q 3D8GA 1XNRL 1HJPA 4RGMA 3PUVA 3EROA 4IJLA 4KN4C 1F2YA 4DUZQ 3PF4A 2MO0A 2N8NA 3ULLA 5IGBA 2K50A 2BE5D 4C3IB 1SDFA 2EYJA 4UP9A 3TRZA 2MFIA 1XNQL 1SYCA 3W3AA 2KUMA 5CC4A 1A8VA 3E9IA 5AJ3L 2YTYA 3IRBA 5DNFA 5JJZA 1JJ2A 1S3OA 2B29A 2G5DA 1KAAA 4DV4Q 3U9OA 3VYRA 2PQAB 2Z6KC 1EIYB 1V8QA 1C9OA 3FEWX 1VF7A 4GN5A 1R9TB 2UUBL 4GOPC 2MPMA 4B9WA 1B44D 4C3HB 3BZCA 5JVH3 2L0CA 4BY7G 2L12A 1EU4A 3G6JB 4RFBA 4BS9A 2IX0A 1LTRD 2NTSA 2DY8A 4DV1Q 2E2HB 4AQYL 4JK1C 5IYCH 3T1YL 2JA5B 4G7HC 2R93B 3I91A 1TWCB 3UDFA 1PRTB 1RODA 2F4VQ 3DWPA 2BA1A 4LNQA 1HFNA 4A93H 3D4DA 3DHQA 4EVOA 2EJFC 1HUMA 2K5HA 1I94Q 5KIXA 4KLKA 3D6WA 2PMZE 1YNJC 4K5VA 1KC8C 1JR0D 3OIPA 3S1MB 1I4HA 1VMPA 2PNHA 3RUZA 2XSCA 1X6OA 4DK3C 3L7ZC 4RCOA 3QR8A 2LKVA 2R7ZG 2DJGC 2FFKB 4ALPA 1STAA 1MI2A 3HGBA 2Y0SE 4V0BA 4A3MB 1EY4A 4DGZA 1OXUA 2B3GA 1ET6A 4JI8Q 4K6LA 1I6VC 2HQEA 3CRLC 2YYZA 1HQMC 2IY5B 1B53A 1LLRD 2ZT9C 4C3JH 3TREA 4KHVA 5FLMH 4XT1B 2VQFL 3S1RH 4X3SA 5ELEA 2EXDA 2B2YA 3MFYA 1E2WA 1PFBA 1NR2A 2QDLA 3GTLH 4RGNA 3I4MG 1M4VA 1Q12A 4LK1C 5JEAG 1WYDA 3BVGA 4OXPA 3EIVA 2UUAQ 3C1FA 4A3KH 2JN4A 4KKTA 4QJFA 3MXGA 4B3SQ 1VQ8A 2JA7H 2OTJA 2JA8B 1R4PB 5IGGA 1Y1WH 1K8GA 2DNEA 4A3BG 1ILPA 4LMQD 5FLXE 1YNND 1HRJA 5GQOA 1EY8A 3HOZH 1Q81C 1HCZA 4JBJA 2PI2A 5CGKA 3PCOB 1Y1VB 5I6YA 4DV3L 2KHIA 5J39A 3EN2A 4LUZA 5CMDA 5CYUA 2NN6H 4ZYSA 1H9KA 4DAYA 1G6PA 3M7GA 3S16B 2UU9L 4NXML 3HP3A 1CQFA 1VQNA 3M4OH 1SJED 4EQOA 1E24A 3ERQA 4ZUIA 3STBC 3GTKH 2WAQB 5C4ZA 1YHQA 1TT2A 5I4DA 2BOSA 2RDHA 1RD9D 2D5DA 4DR2Q 2QCPX 2IT1A 2UUCL 4FXKC 4J6HA 4P74A 1O7ZA 2JA8G 1FYCA 2VQEQ 3GQBA 4Y52H 4N9PA 4B9XA 3I4NB 2RCNA 2I07B 1D5XC 3T4AC 2UXCL 4GZYC 1PXUA 2K28A 4G7ZC 5DEHA 1EYDA 4UAIA 2G9HD 1Y1VG 2K01A 4IZ8A 1DZ1A 1N34Q 3SK6A 2Q2UA 1O7LA 1HA5A 1U4LA 3KOJA 3PIPA 1LTAD 2IW3A 2D62A 1VQFA 1KQSA 5BR8Q 5LL6X 2HDMA 2WAQG 4J8QA 4NB3A 1TS5A 5EKIA 3ITPA 1B9NA 1ASZA 2ICIA 2QW7A 5EBDA 1HR0L 1DJRD 3KYHC 3K7UC 5H1SE 3BDCA 5EKKA 1DYQA 3CHBD 3W1BA 1UUPA 1PRTF 4C3IH 2OEOA 3S24A 3EVQA 3RZOB 4OELB 3OHXC 5C0XG 4DV5L 5EPJA 4R4IA 1SR3A 4AYBB 3OWEB 4JYAL 1FNUA 2H4OA 2NVQB 4KD4A 2B2WA 3AFQA 2BDOA 5JJLA 5T1GA 4WFN3 3DUZA 3TN2A 1GD7A 1K83B 2WB1B 5DLQE 3H3VC 3I4LA 2E2JB 4ILWA 4DU9A 1SYEA 2XN9C 1CZWA 1KHIA 3D31A 4N8FA 4LF8L 3GTJH 3OSOA 2ZTCA 1ZKOA 3FKIB 1X54A 3KFUA 3D4WA 3WOFA 3IL8A 5C3EB 2CW0D 4TQUS 2L5TA 1OTCA 3PGZA 2SOBA 2WKCA 4NP5A 4AYBG 1SNPA 4RKBA 3E3XA 3PUXA 3SK8A 3MVVA 4JW0A 3ND8A 1SNOA 4L5TA 1E2ZA 1D5MC 3HOYH 5IY0A 4DR7Q 1GJXA 4DR6L 5C5LA 4XQQA 4X64Q 1BCPB 2N49A 5T1IA 1EY9A 2WB1G 4A3JB 1QVFA 3NBIA 1SXTA 2GVAA 1U0LA 2IX1A 4BY1G 3VA5A 4EX5A 1PTOH 5KYLA 4KY6A 2BH8A 3DMUA 1AZPA 1PLFA 3K5LA 3FKIG 1N9WA 2EY1A 1WTRA 4A3FB 2SEBD 5D3IB 2HDLA 1EEFD 3PO3H 2VNUD 5EGTA 4DR1L 1W6JA 2CVRA 3T1HL 3GTGB 4DR3Q 3RLFA 2E2IB 3FDTA 1LM0A 4KN7C 5M5XH 4A3GB 3X3NA 4GKKQ 1O7IA 2CH4W 5M3MH 2N55A 4NMZA 1EQTA 3OPOA 3T53B 2K5VA 4OL7A 2Z8LA 3H0GH 2EZVA 5L37A 3MXNB 3GTMH 2CQOA 2WACA 2R92B 5CR3A 2IX3A 1W2BA 1CT1D 1UWVA 2F0HA 3QIAA 3SXHA 1CA5A 4BWGB 1WOCA 1X3EA 4A3FG 1L1OC 3MXNA 1KABA 2ASBA 4I65A 5F2DA 5LMNQ 1F9SA 5M5WB 3LGJA 1VQIA 4JV5L 3OMCA 2VB2X 1TS2A 2UXDL 1ENAA 4A75A 3VDYA 1Q82C 3G7LA 4NKLA 4ZAIA 1RCVD 2B2VC 3S1NB 3K57A 1V1PA 2PQEA 2SDFA 3NELA 4LAAA 2K14A 4DV0Q 2VL6A 4A3IG 4H44C 3K58A 1WVLA 4FF2A 1T9HA 2RBMA 3J7AF 4UHVA 1VQOA 3FRPB 5FJ8G 5ELOA 4CJ1B 2ATWA 3P1HA 5FO8B 2Q2TA 1J5EL 4OGQC 4OWXB 3FP9A 3A5UA 1TU2B 2EXZA 2KHSA 1B50A 2RHQB 1QNKA 3S1QB 2M9VA 1IW7C 3H91A 5JOBA 1EIGA 4DK0A 1ASYA 5IWAL 1FNWA 5ELFA 1X3GA 4TRDA 1BVSA 3E9HA 2B8GA 3IAYA 3T13A 4IFDJ 3CCEA 1TIID 1TS4A 4JI7L 2F0OA 4L6TB 4HIMA 4GKJL 5J22A 2L55A 4GLAC 3I7FA 1J8IA 2A1AA 1TWGB 2K52A 2BCOA 5IIFA 2KJXA 3KDFB 3CKIB 3E0EA 4DF7A 1AP0A 4BBRH 1IKMA 3H3VI 4LW1A 3HKZB 2FINB 3TP6A 4LUOA 3SR1A 1STBA 1S4ZA 1XTDA 3GTQH 4LFCQ 1ZYRC 5E4XA 3QWNA 1I50H 3KDFA 4C1NK 2LMCB 2HT1A 1WJJA 2C5CA 1MJCA 3K0YA 1PH1A 1KNEA 1HNXL 5IE8A 5C0XI 1KDAA 4CKBA 2PCFB 1H9MA 2LSSA 1IBKQ 4KD3A 3ULPA 3FPPA 4BBSH 2RSOA 1BCPF 1B9MA 2L15A 5CORA 1CUKA 3CP0A 4UP8A 4HN7A 1IBML 3GV6A 4KY5A 4R8NA 3OOCA 2F3IA 5IYDH 4DV2Q 1CZGA 2IPKD 2XVSA 4QIWE 5M9OA 4JC0A 2NZHA 4JI6L 5JJIA 1SNDA 4YWKA 1GHJA 4UY8C 1JOQA 3MEHA 4F7XA 1XJVA 2H1EA 3BVZA 4A3LH 1STNA 1PHJA 3E5SA 4IUUA 3HKZG 1B3AA 4IFDH 1B3QA 2JA6B 2Q2IA 1PV4A 1U4RA 2I0QA 2WINB 1NMFA 4HJ9A 2HQLA 1GVPA 1WTPA 3KJOA 5DM63 3BS1A 1PRTD 1K0RA 3HKSA 1PFMA 1XWEA 4I7AA 3N52A 3KJPA 2D9UA 1SMYD 3H94A 5KYIA 1PH8A 2YU9H 4JI4L 1ESRA 2Z1CA 3VR6A 5IYCG 3OWFA 3PQIA 4K8IA 4J1MA 1FNVA 3TQYA 3ZYYX 1GUSA 4ZUJA 5GAHC 3J80L 4DR4Q 3STBD 1PH6A 1X32A 5EQ0A 1QZHA 1KXLA 3NENA 1G291 3K6OA 4A93G 1WCMB 3E0JA 1VF5C 3CCMA 4JI2Q 2RHSB 3VYSA 3E6ZX 4PMBA 1YJ9A 2O4XA 4AIMA 2WFWA 2Q8IB 2PI2E 5A35A 3KLSA 4K5WA 2F0NA 1O78A 3QOJA 3D6CA 2KCCA 1AE2A 3IFDA 1IYUA 3S2DB 1EFWA 3S15B 3AB9A 3H6MA 3CCJA 1JJCB 3EQLC 1B1ZA 3CCVA 1VQ6A 1GUOA 4R1JA 2JP1A 1ICWA 3NWTA 3PMFA 2EY5A 1VQGA 4LFAL 4C1NI 1ENFA 1OO9B 4IO9A 2RF4A 4C3JG 4DUYQ 2EDGA 5G3LF 5M5YH 1H9SB 2A69C 4O0AA 4QB4A 1BO0A 1VDZA 4HJ5A 1CM9A 4GOPB 2XWBB 1A2TA 1G6ZA 2P5ZX 4B3RQ 4R4QA 3CC7A 4Y7NB 4HMIA 2Z6KA 1MJEA 1H9SA 4ZK9B 3U4VA 3JAMc 1PH7A 1D7QA 4KHPQ 5CV4A 1IBLL 2F52A 5JPMC 4GOPA 1SMXA 2JA7G 1GUTA 4RKLA 2O5JC 4FP5D 1XX8A 1NJIC 5C4HA 3HEJA 1CA6A 4A3CH 3Q24A 3D0FA 2E75C 1CKMA 1NAPA 1GKHA 1UE1A 3R93A 1IZ6A 1LT5D 2PPBC 3K7AH 3MEFA 4XYQA 1Q90A 3NP8A 2NN6G 1YI2A 4LF7Q 4DK1A 3VYUA 4BY7B 2F4IA 3NQTA 3I3CA 1K8MA 5E3FA 4X65L 1Z7TA 5E7NA 2B63H 1K3BC 2DUDA 2WIIB 4K0KQ 3CW2C 1D5ZC 1HZAA 4DAVA 2QEJC 1JB7A 3K81C 4ZQ3A 4OONA 1E1OA 1QCBD 1TY2A 2EPBA 4A3DB 1EL0A 3TEHB 2G9DA 4P72A 4V190 1HTPA 2E5LQ 5ELCA 4GS3A 2OQ0A 1PYSB 4A4IA 4C2MB 4YHHQ 4LWCA 3BVMA 1I6HH 2BH2A 1SFOB 5C44H 1Q1EA 5NUCA 1JMCA 1EYCA 2EYMA 3M3YB 1G8ZD 1KNAA 3DM3A 4GNXC 2KOLA 2PQAA 3OTOQ 2L1BA 2R7ZB 2GA4B 5I9PA 2XTIA 2OT2A 4KTAA 4YCUA 5I2XA 4DV6Q 2XIWA 1QWYA 4H13C 1VQBA 3CXCA 4K2KA 4NXNL 4BXXG 1SRUA 3R2IA 4O42A 4A3DG 3MFGA 4NPSA 2TMPA 4A3EH 2AQ1B 2RCFA 4YIJA 2JQOA 2J4XA 2QKIC 1FGUA 1V9PA 3RZDH 1LT3D 3I4MB 2GVBA 5IOCA 3PO2H 2NUCA 1SYFA 3GD7A 3I90A 2OCEA 4A76A 3CQZB 4JPBW 4KJOA 1UEAB 1JB3A 1I4PA 4EQPA 4MTKA 3R3OA 3X3MA 4DKAC 5JAVA 4A3BB 1NTGA 4YWMA 2NVXH 4MTNA 2F0JA 4LF6Q 4X6AH 2CFMA 1QOHA 4DUZL 1YHAA 1CTMA 3DM1A 1TKWB 1EIHA 1TWAH 5IP9H 2O5IC 3ONAB 4QY7A 5C4XH 3JC66 1ZXTA 5M3FH 2OF1A 1EWIA
chains in the Genus database with same CATH topology
1BCPD 1STGA 3HRZC 3OIQA 4WJWA 5FOBB 3URYA 1LTGD 1PZKD 2RDGA 1GUNA 2ICEC 3HOWB 3FPUB 5D3DA 3F2UA 4FVMA 1WD1A 1E2VA 4KHZA 2A68C 4QF4A 2VUMB 3K5MA 4H7BA 1I4QA 3FMCA 1IW7D 3LWEA 4M8AA 1GHKA 2EY6A 2RA4A 1G2SA 1OXVA 4C56C 5LHY1 1H9JA 3M7NA 1STEA 1I3QB 2JEAI 3HOUB 2TSSA 3GTPB 2B8FA 4XXEA 1EZ8A 4HTHA 2L4NA 3NHHA 4CKEA 1PTOC 2AQ3B 2NYZD 1IYVA 3MTSA 1HPCA 2PZTA 5CV6A 4HCEA 1XYIA 4FYDA 3M4YA 5EBCA 3L3OC 1DD2A 2EVBA 1RJTA 3T16A 2NN6I 4MHEA 3TSSA 5BN4A 4X3TA 1U9RA 1B2TA 2J0TD 3BDLA 3TP5A 5EPKA 1RDPD 3J81L 2F0WA 1JICA 5FLXL 5JEAJ 1L0XB 3JAME 4XDXA 4Z9CB 5IT9E 4K6DA 4QUFA 3S2HB 4CHTB 2K5QA 4HSVA 2F0TA 2F3VA 4JBWA 1KDBA 4BY1B 1QE6A 3MC0B 1AW7A 2AUJD 1SE4A 3KUPA 3H09A 1KTKA 2PW7A 3P20A 3LX0A 1EOTA 2B2TC 2NBFA 4IUNA 1WTQA 1TS3A 2KCNA 2FMCA 3R2TA 2BE5C 3MWYW 5EPLA 1QNUA 2MHVA 2A73B 2VB3X 2NVTB 4RA8A 1VCIA 3NK9A 5JEAH 2XRSD 4L63B 1UAPA 2PMZB 4ODGA 1JWSD 3NWSA 1HXYD 4F87A 5KGUA 2B2VA 1EWCA 1JOKA 1SAPA 1X3PA 4KI0A 1SEBD 4PMWA 5EKLA 4IFDG 1LTBD 1EZ6A 1QJOA 3D3RA 3SEBA 4ZLTF 3EJIA 4Q5VA 1XTCD 4CJ0B 3V05A 2IL8A 2F0PA 4XT3B 2A6HD 2EJMA 4A3IB 4PMCA 4KV6A 5KEEA 1G2TA 1HFGA 3GTOB 2K5DA 4TSSA 2PW5A 4HR7B 2J7ZA 5ISRA 1TWHB 2XRQD 4I7ZC 3DXJC 4OIJA 2MUYA 4WRDA 5K36G 1CHQD 4IUPA 3VYTA 4OO1G 3S14B 1Z6HA 4MN3A 1S5ED 2F0FA 4KJNA 4O1NA 4RHSA 3KBXA 2CHBD 1S5DD 5FO9B 2HCCA 3DEOA 1GXDC 3OMGA 1SYGA 1ESFA 1C8CA 3TZUA 4N9TA 1MD2D 3UI2A 1PZJD 1TQOA 1ML0D 2FHTA 2BA0A 2LS01 3QJYA 5C5MA 1EY0A 4PQXA 2KA7A 2M00A 3C3LA 2F0SA 4HSPA 1YNNC 1SYDA 4EQNA 1ZEQX 4LJZC 4EGVA 5CBAE 4IUTA 1SNQA 5KNBA 1YNJD 1A15A 1WTOA 5KRUA 4FF1A 5A2QE 2Z4IA 2L9HA 1TR5A 3J80E 1HUNA 5HURA 2E74C 4DNRB 4U673 3LWUA 1EEID 1CK1A 1MGSA 1NSNS 3I8ZA 5J1ZA 3P75A 4K5XA 1DCZA 1MSGA 3BDOA 3Q22A 3P7JA 1PDQA 2QILA 3A7AB 3MZ5A 2A74C 4G4KA 1LACA 5DM73 4F88A 4A93B 1DXMA 1I4XA 1Q1BA 3D4RA 4DN4M 1JORA 1JWMD 2LY7A 1K8OA 1Y8OB 2A6EC 2SNSA 4CJ2C 4IALA 3HG9A 4HCSA 1AEXA 3NUCA 3KBGA 1BNZA 2X69A 3RD4A 4ME5A 3NSWA 2PZUA 4PNYA 4C3JB 1A3TA 2V4DA 2EE1A 2X6LA 1A2UA 2NZ1D 3PUWA 3S1RB 3Q0AA 1IL8A 4M1UB 3HS0C 3WDNA 1QB5D 2NTTA 1BR9A 3GTLB 4E6IA 1B4OA 2F03A 1JC7A 2WV6D 1U4MA 4IFDI 5C6AA 4ZRZA 1WD0A 2M2LA 4X3KA 2JA7B 3T51B 1HTLD 3R8BA 2F0UA 1Y1WB 2CW0C 3SE0A 3NXWA 2DNCA 3HOZB 4HEDA 1STYA 1RF2D 2XWJB 1SNCA 1JQYD 3C2PA 1L0YB 2MGSA 3M4OB 3GTKB 2ZXRA 5KNDA 3KF8A 2K04A 1LTTD 2B2UC 3CRKC 3K5OA 5CV8A 4DA2A 2L11A 1D1IA 1BQQT 4OO1I 2LFNA 1F2MA 2F0EA 2K05A 2KQ3A 2K7VA 1HQRD 1C48A 3NTHA 4XYOA 2DN8A 2R6GA 5FK9C 1IHZA 2F0VA 1QILA 1GUGA 2SNMA 1D1KA 4UDUC 4OHJA 3DWQA 2K33A 4IUQA 1STHA 2EYPA 1CHPD 4IN3A 2ZXPA 2KEEA 2Q8RE 1SE2A 4TKOB 2XNAC 3J7AV 4L8JA 2EYOA 1GOZA 1BF4A 3NQIA 4FO2A 4RHRA 2DY7A 1RTNA 2MP1A 2EJGC 1AFPA 5IODA 2BDNA 1JCKB 3AMUA 5HGTA 4NDXA 5E1FA 3GTJB 1CQVA 1LV9A 4C3IG 3TBIB 2OXPA 1Y8NB 1WTWA 2F0MA 5C3WA 1BDOA 3NPPA 4QIWB 3HOYB 3GP7A 2KECA 4DAPA 4KMUC 5FKAC 1ENCA 3AU7A 3BG3A 1PTOB 3QOLA 4C3HG 3EA6A 5JVG3 2MJ8A 3PO3B 4ULLA 3Q23A 1C4QA 2E76C 4CBVA 1RHPA 5M5XB 4WORA 3A56A 1D6EC 1H9RA 1SSOA 2ENBA 5M3MB 4BA1I 3H0GB 3GTMB 5BN5A 1EQVA 1DOLA 4OIKA 1PMRA 3TMEA 1OXSC 1DM0B 4ID6A 1Y8PB 3PIO3 3HOVB 3A7LA 5CBEE 1JE4A 3C46A 3J81E 2F0DA 3QG1A 4NW2A 1PRTC 1JOOA 1Y69U 4RWSC 4RH6A 1SMYC 3NBHA 5IGEA 2JYOA 3VR5A 1LT4D 3U9SA 2KEDA 1D2BA 1LABA 1ZYRD 2RVLA 3SVMA 1EY6A 1W6KA 2JE6I 2WKDA 1AZQA 2NVYB 2X6GA 5D65A 2B2YC 3FVQA 2F0KA 4G57A 5KNCA 2B2TA 1BBXC 1A3VA 1A3UA 5G3LD 2FMMA 2I46A 1OXXK 5IGFA 2N88A 2JEBI 5DAUA 4QUCA 5I9OA 3NE5B 3A8KE 3I72A 3CU7A 1MBYA 1LTID 4BBRB 1FD7D 2K32A 1PZID 3GTQB 1V43A 2A6ED 4P2CB 4HAEA 1SNMA 1I50B 1F9RA 5K5PA 4BA2I 2RKSA 4BBSB 3A8IE 1SE3A 2B39A 1FR3A 1VMCA 3WOEA 3MXUA 4DNTB 1X3QA 4MIUA 1PTOF 2D2CC 1DOMA 4K8JA 4KKSA 2QF7A 1F9QA 1A6XA 1BOSA 3GV3A 5CV5A 2EOTA 1IKLA 1F2ZA 2JXMB 5IGDA 1EU3A 4K2LA 5AFWA 1NUCA 4CGYB 1LT6D 1ET9A 3A54A 3N6RA 2VXWA 4RCNA 3ND9A 1M8AA 2EYHA 5ELBA 2A69D 2YU9B 2HUGA 1S5CD 2RDFA 1S5FD 1OXTA 1O80A 4G7OC 1WTVA 3VR2A 3SK4A 1O7YA 4FNFA 3MXPA 1UNSA 2Y0SB 3I70A 2B2WC 1SBBB 1T5EA 1E0BA 3JAML 2EYLA 2PO4A 5IT9L 5TSSA 3IFTA 3BYTB 5LL6S 3RMHA 5I2YA 1KLGD 3A55A 4RGTA 3EFXD 2PNRC 2R61A 4IQZA 1Q8IA 5C0XJ 1XXGA 1F9PA 1Q3LA 3J7YW 2F0QA 3K59A 1EWHA 4DXFA 3V2TA 5M5YB 2KVMA 3HOXB 3BYYB 3PIP3 3DWAA 2F1MA 4B08A 2E2DC 3LNNA 4RAUC 1RKNA 4FXDA 3K5NA 5IGCA 1ONLA 1MSHA 3OW7A 1V1OA 1CFMA 1F77A 2AWNA 4FF4A 3KK7A 1V1PB 3W2DA 4S3SA 1BCPC 1KDCA 2QDBA 4X3UA 5BN3A 1U4PA 2K1BA 5FO7B 2F3WA 2IJ0A 2NWGA 3PUZA 1I4GA 2RQXA 3K7AB 2FJ2A 5I6WA 4F8MA 3NTKA 1R4QB 5C0XH 4PV1C 1ILQA 2B63B 2K6AA 4XQNA 1II3A 4DXGA 2CQAA 1TVXA 3GO5A 1LTSD 1T5XD 1PFNA 1NCVA 5CV7A 1Z47A 1QG7A 1I6HB 1KLUD 4R8IA 5C44B 1F2LA 2RSNA 3KLSX 2AWOA 3VR3A 4ZKBB 2Q8TA 3MAQA 4KKUA 2NB0A 1J9OA 5D14A 3PUYA 1TY0A 4IUVA 5EJWA 4Q0FA 1JWUD 4U68A 3TP7A 4R9WA 4K14A 1SJHD 4A3EB 3C1EA 3SHLA 3M85A 2AUKA 3MA2B 3RZDB 2A68D 2F0GA 3PO2B 4FXGC 2IWHA 1HA6A 4KK7A 2F0IA 1WTXA 1HHVA 3A8JE 3SK5A 2NVXB 2JSOA 2WP8J 3I73A 1TWAB 2HCIA 3T56B 3MHBA 2PYKA 5ELDA 2K5WA 5C4XB 1LO5D 3BZDB 1BUVT 5M3FB 2B2UA 3TP8A 2C9OA 3QO2A 1TWFB 5JPNC 5CV9A 5E4WC 5A2QL 4A3KB 1PTOD 3S9WA 3VA7A 4QCLA 2Z4HA 3DEPA 3NTIA 1EY5A 2F0LA 1S5BD 5K36H 1GUWA 4ZKCB 1CI3M 2K03A 1EFID 2A5HA 1BXTA 4OO1H 2EY2A 1EYAA 1RTOA 3L9AX 4XIGS 2O2LD 2AQ2B 2EYFA 4DFAA 3Q6SA 2R3ZA 1I4RA 1FGBD 1EY7A 4IURA 4RGOS 1PYWD 1NR4A 5C4JB 1DONA 4XTCS 5C3XA 4FF3A 3V96A 3S17B 3KLRA 1G91A 4XQJA 3IKJA 1AN8A 4HMJA 5COYA 3PV0A 1SYBA 2ZXOA 2PZWA 1DOKA 4CKCA 4QMGA 2A6HC 4KY7A 3O13A 4H0LC 3QB3A 4ABNA 3SDZA 3VR4A 3TDQA 2ID0A 3TZDA 3HZXA 3D8GA 4RGMA 3PUVA 3EROA 4KN4C 1F2YA 5IGBA 2BE5D 4C3IB 1SDFA 2EYJA 1SYCA 3W3AA 2KUMA 5CC4A 5DNFA 5JJZA 1KAAA 3U9OA 3VYRA 1V8QA 3FEWX 1VF7A 1R9TB 2MPMA 4B9WA 1B44D 4C3HB 5JVH3 2L0CA 2L12A 1EU4A 3G6JB 4RFBA 4BS9A 2IX0A 1LTRD 2NTSA 2DY8A 2E2HB 4JK1C 2JA5B 4G7HC 2R93B 3I91A 1TWCB 1PRTB 1RODA 3DWPA 2BA1A 1HFNA 3D4DA 3DHQA 4EVOA 2EJFC 1HUMA 5KIXA 3D6WA 1YNJC 4K5VA 1JR0D 3OIPA 3S1MB 1I4HA 1VMPA 3RUZA 2XSCA 3L7ZC 4RCOA 2LKVA 2FFKB 1STAA 1MI2A 3HGBA 4V0BA 4A3MB 1EY4A 4DGZA 1OXUA 1ET6A 4K6LA 1I6VC 2HQEA 3CRLC 2YYZA 1HQMC 1B53A 1LLRD 2ZT9C 4KHVA 4XT1B 4X3SA 5ELEA 2B2YA 3MFYA 1E2WA 1PFBA 1NR2A 4RGNA 1M4VA 1Q12A 4LK1C 5JEAG 3BVGA 3C1FA 4KKTA 3MXGA 2JA8B 1R4PB 5IGGA 2DNEA 1ILPA 4LMQD 5FLXE 1YNND 1HRJA 1EY8A 1HCZA 5CGKA 5I6YA 1Y1VB 5J39A 5CMDA 5CYUA 2NN6H 4ZYSA 1H9KA 4DAYA 3M7GA 3S16B 3HP3A 1CQFA 1SJED 4EQOA 3ERQA 4ZUIA 2WAQB 5C4ZA 1TT2A 5I4DA 2BOSA 2RDHA 1RD9D 2D5DA 2QCPX 2IT1A 4FXKC 4J6HA 1O7ZA 1FYCA 3GQBA 4N9PA 4B9XA 3I4NB 2I07B 1D5XC 3T4AC 4GZYC 1PXUA 2K28A 4G7ZC 5DEHA 1EYDA 4UAIA 2G9HD 2K01A 4IZ8A 1DZ1A 3SK6A 1O7LA 1HA5A 1U4LA 1LTAD 2IW3A 2D62A 5LL6X 2HDMA 4J8QA 1TS5A 5EKIA 3ITPA 1B9NA 2ICIA 5EBDA 1DJRD 3BDCA 5EKKA 1DYQA 3CHBD 1UUPA 1PRTF 2OEOA 3EVQA 3RZOB 3OHXC 5C0XG 5EPJA 4AYBB 3OWEB 1FNUA 2H4OA 2NVQB 4KD4A 2B2WA 2BDOA 5T1GA 4WFN3 3DUZA 3TN2A 1K83B 2WB1B 3H3VC 3I4LA 2E2JB 4ILWA 4DU9A 1SYEA 2XN9C 1CZWA 3D31A 3OSOA 1ZKOA 3FKIB 3D4WA 3WOFA 3IL8A 5C3EB 2CW0D 4TQUS 2L5TA 2SOBA 2WKCA 4NP5A 1SNPA 4RKBA 3PUXA 3SK8A 3MVVA 3ND8A 1SNOA 1E2ZA 1D5MC 1GJXA 5C5LA 4XQQA 1BCPB 5T1IA 1EY9A 4A3JB 3NBIA 1SXTA 2IX1A 3VA5A 1PTOH 5KYLA 4KY6A 3DMUA 1AZPA 1PLFA 3K5LA 2EY1A 1WTRA 4A3FB 2SEBD 5D3IB 2HDLA 1EEFD 2VNUD 5EGTA 1W6JA 2CVRA 3GTGB 3RLFA 2E2IB 3FDTA 4KN7C 4A3GB 3X3NA 2N55A 4NMZA 1EQTA 3OPOA 3T53B 4OL7A 2Z8LA 2EZVA 2WACA 2R92B 5CR3A 2IX3A 1CT1D 2F0HA 3QIAA 3SXHA 1CA5A 4BWGB 3MXNA 1KABA 4I65A 5F2DA 1F9SA 5M5WB 3OMCA 2VB2X 1TS2A 1ENAA 3G7LA 4NKLA 4ZAIA 1RCVD 2B2VC 3S1NB 3K57A 1V1PA 2PQEA 2SDFA 4LAAA 4H44C 3K58A 1WVLA 4FF2A 2RBMA 3J7AF 3FRPB 4CJ1B 3P1HA 5FO8B 4OGQC 1TU2B 2EXZA 2KHSA 1B50A 1QNKA 3S1QB 2M9VA 1IW7C 3H91A 5JOBA 1EIGA 4DK0A 1FNWA 5ELFA 4TRDA 2B8GA 3IAYA 3T13A 4IFDJ 1TIID 1TS4A 2F0OA 4L6TB 5J22A 2L55A 1J8IA 1TWGB 2BCOA 5IIFA 2KJXA 3CKIB 4DF7A 1AP0A 1IKMA 3HKZB 2FINB 3TP6A 3SR1A 1STBA 1S4ZA 1ZYRC 5E4XA 3QWNA 4C1NK 2LMCB 2C5CA 3K0YA 1KNEA 5C0XI 1KDAA 4CKBA 2PCFB 1H9MA 4KD3A 3FPPA 2RSOA 1BCPF 1B9MA 5CORA 4HN7A 3GV6A 4KY5A 4R8NA 3OOCA 1CZGA 2IPKD 2XVSA 5M9OA 1SNDA 1GHJA 1JOQA 3MEHA 4F7XA 2H1EA 3BVZA 1STNA 3E5SA 4IUUA 4IFDH 1B3AA 2JA6B 1U4RA 2WINB 1WTPA 5DM63 3BS1A 1PRTD 1PFMA 1XWEA 3N52A 2D9UA 1SMYD 3H94A 5KYIA 1ESRA 2Z1CA 3VR6A 3OWFA 4K8IA 4J1MA 1FNVA 3ZYYX 1GUSA 4ZUJA 3J80L 1X32A 5EQ0A 1G291 3K6OA 1WCMB 3E0JA 1VF5C 3VYSA 3E6ZX 4PMBA 2O4XA 2Q8IB 5A35A 3KLSA 4K5WA 2F0NA 1O78A 3QOJA 3D6CA 2KCCA 3IFDA 1IYUA 3S2DB 3S15B 3AB9A 3H6MA 3EQLC 1B1ZA 1GUOA 2JP1A 1ICWA 3NWTA 3PMFA 2EY5A 4C1NI 1ENFA 1OO9B 4C3JG 2EDGA 5G3LF 1H9SB 2A69C 4QB4A 1BO0A 1VDZA 1CM9A 2XWBB 1A2TA 1G6ZA 4Y7NB 4HMIA 1H9SA 4ZK9B 5CV4A 5JPMC 1GUTA 4RKLA 2O5JC 4FP5D 1XX8A 5C4HA 3HEJA 1CA6A 3Q24A 2E75C 1NAPA 3R93A 2PPBC 1LT5D 4XYQA 1Q90A 3NP8A 2NN6G 4DK1A 3VYUA 4BY7B 2F4IA 3NQTA 3I3CA 1K8MA 5E3FA 1Z7TA 2WIIB 1D5ZC 4DAVA 2QEJC 4ZQ3A 1QCBD 1TY2A 2EPBA 4A3DB 1EL0A 2G9DA 4V190 1HTPA 5ELCA 4C2MB 3BVMA 1SFOB 1Q1EA 5NUCA 1EYCA 2EYMA 3M3YB 1G8ZD 1KNAA 2KOLA 2L1BA 2R7ZB 2GA4B 5I9PA 2OT2A 4KTAA 5I2XA 2XIWA 1QWYA 4H13C 4K2KA 3R2IA 4O42A 3MFGA 2TMPA 2AQ1B 4YIJA 2J4XA 2QKIC 1LT3D 3I4MB 5IOCA 2NUCA 1SYFA 3GD7A 3I90A 3CQZB 4KJOA 1UEAB 1JB3A 1I4PA 4EQPA 3R3OA 3X3MA 5JAVA 4A3BB 2F0JA 1QOHA 1CTMA 3DM1A 1TKWB 1EIHA 2O5IC 3ONAB 1ZXTA 2OF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPK A;  5D65 A;  1MSG A;  1GUW A;  4ZKC B;  2B2Y C;  1WVL A;  1WTV A;  2K04 A;  3I3C A;  1PFN A;  1PFM A;  2K03 A;  1JIC A;  2J7Z A;  3P7J A;  1PDQ A;  1O7Y A;  3IL8 A;  3N52 A;  1BNZ A;  1NCV A;  2MPM A;  2B2U C;  5CMD A;  2D9U A;  2L11 A;  4CJ1 B;  4XDX A;  1RTO A;  2KEC A;  2B2W C;  2B2T A;  1QG7 A;  3HP3 A;  2L12 A;  4QUF A;  1BBX C;  1ESR A;  3FPU B;  1E0B A;  4OIJ A;  4R8I A;  3Q6S A;  1F2L A;  2R3Z A;  3F2U A;  2K05 A;  4HSV A;  1WD1 A;  2FMM A;  4IUR A;  2EPB A;  2DY8 A;  2RSN A;  1B50 A;  1QNK A;  2N88 A;  4IUP A;  1EL0 A;  3H91 A;  4QUC A;  4DN4 M;  1QE6 A;  1NR4 A;  1X32 A;  1EIG A;  2MJ8 A;  5EQ0 A;  3I91 A;  1O7Z A;  1DON A;  5T1I A;  3KUP A;  4ZKB B;  3LWE A;  1ROD A;  2Q8T A;  4CJ2 C;  1F9P A;  1Q3L A;  1J9O A;  4MN3 A;  5D14 A;  1HFN A;  1EOT A;  2RA4 A;  4HCS A;  3KBX A;  1G2S A;  2K28 A;  4IUV A;  5EJW A;  1RHP A;  1G91 A;  4U68 A;  4UAI A;  1AZP A;  2HCC A;  1HUM A;  1PLF A;  2B2T C;  1KNA A;  2K01 A;  4HAE A;  3D6W A;  2KOL A;  1WTR A;  3DEO A;  2X69 A;  1F9R A;  2L1B A;  3IFD A;  4IUQ A;  1SSO A;  4R9W A;  5COY A;  2HDL A;  1WTQ A;  1J8I A;  1VMP A;  2KVM A;  1C8C A;  1U4L A;  1DOK A;  3MWY W;  5EPL A;  1AP0 A;  3UI2 A;  1IKM A;  2JP1 A;  1ML0 D;  1ICW A;  2EE1 A;  2CVR A;  2FHT A;  2X6L A;  2XIW A;  4RAU C;  1DOL A;  2FIN B;  2KEE A;  4OIK A;  2Q8R E;  2FFK B;  2NZ1 D;  2HDM A;  1VMC A;  1S4Z A;  1MSH A;  1MI2 A;  3FDT A;  1HA6 A;  4RA8 A;  1IL8 A;  2L4N A;  5E4X A;  4O42 A;  1X3Q A;  5EKI A;  2NYZ D;  2N55 A;  3MTS A;  1B4O A;  1KNE A;  1DOM A;  1EQT A;  5CBE E;  1JE4 A;  1WTX A;  1HHV A;  1BO0 A;  1CM9 A;  1U4M A;  1BF4 A;  1B53 A;  2DY7 A;  2RSO A;  4NW2 A;  1F9Q A;  1G6Z A;  4X3U A;  1RTN A;  3TZD A;  1XYI A;  2M2L A;  4X3K A;  1WD0 A;  2B2V A;  5COR A;  4XT1 B;  3GV3 A;  1SAP A;  2HCI A;  1U4P A;  2K1B A;  2MP1 A;  1X3P A;  3GV6 A;  3I90 A;  4IUT A;  4RWS C;  2EOT A;  4X3S A;  5CBA E;  1IKL A;  2B2Y A;  2NWG A;  4ZK9 B;  1A15 A;  1WTO A;  1CA5 A;  2BDN A;  5EPJ A;  1PFB A;  1NR2 A;  1RJT A;  5AFW A;  2FJ2 A;  2JYO A;  1SDF A;  2B2U A;  4HED A;  2H1E A;  2L9H A;  4ZLT F;  2B2W A;  1XX8 A;  1F9S A;  2KED A;  4IUU A;  1HUN A;  1ILQ A;  3QO2 A;  2VXW A;  2IL8 A;  4CJ0 B;  1CA6 A;  1B3A A;  1DZ1 A;  1LV9 A;  5T1G A;  4XT3 B;  3DM1 A;  1EIH A;  5E4W C;  1M8A A;  2RVL A;  2KUM A;  4MHE A;  1U4R A;  3TN2 A;  3SVM A;  3ONA B;  4X3T A;  1NAP A;  2MGS A;  5DNF A;  1MGS A;  5JJZ A;  1ILP A;  1B2T A;  3DEP A;  3G7L A;  4LMQ D;  3I8Z A;  3R93 A;  1AZQ A;  1G2T A;  1HRJ A;  2HUG A;  1HFG A;  4ZAI A;  1WTW A;  1O80 A;  1TVX A;  1ZXT A;  2B2V C;  2X6G A;  1WTP A;  2SDF A; 
#chains in the Genus database with same CATH topology
 4LF5 Q;  1BCP D;  1STG A;  3HRZ C;  3OIQ A;  4WJW A;  5FOB B;  3URY A;  1TWF H;  2KCM A;  1LTG D;  1PZK D;  4DV4 L;  3M4P A;  2QEX A;  2RDG A;  1GUN A;  2ICE C;  3HOW B;  3FPU B;  5D3D A;  2LXJ A;  3F2U A;  4FVM A;  1E2V A;  4KHZ A;  2A68 C;  1WD1 A;  4QF4 A;  3CF5 A;  1DGS A;  1HR0 Q;  2VUM B;  3K5M A;  4H7B A;  1I4Q A;  3FMC A;  1PH4 A;  1IW7 D;  3LWE A;  3CME A;  4M8A A;  1GHK A;  2EY6 A;  4DV1 L;  2LXK A;  3PO3 G;  2RA4 A;  1G2S A;  3NBH B;  1OXV A;  4C56 C;  5LHY 1;  1H9J A;  2F4V L;  5C4J H;  4L5S A;  3M7N A;  1STE A;  1QZG A;  1X9N A;  4R4C A;  4OX9 Q;  3BZK A;  1I94 L;  3HOW G;  4DV7 Q;  1I3Q B;  2JEA I;  3HOU B;  2TSS A;  3GTP B;  1JE5 A;  1BKB A;  2B8F A;  2XGT A;  5HY6 A;  5M3M G;  3S17 H;  4XXE A;  1EZ8 A;  4IOA A;  4HTH A;  2L4N A;  3NHH A;  1K3R A;  4CKE A;  3H0G G;  1PTO C;  2AQ3 B;  2NYZ D;  1IYV A;  1K0S A;  3MTS A;  2VUM G;  1PH2 A;  4MNO A;  1HPC A;  1GO3 E;  2PZT A;  1PYB A;  2H5X A;  5CV6 A;  1K73 C;  4HIK A;  4HCE A;  1XYI A;  4FYD A;  3M4Y A;  5EBC A;  4JI8 L;  2R7F A;  3HOV G;  3L3O C;  1DD2 A;  2EVB A;  1RJT A;  3I4O A;  1N32 Q;  3T16 A;  1FVI A;  3CCS A;  3HOU G;  2NN6 I;  4MHE A;  3TSS A;  4UPA A;  5BN4 A;  2UUA L;  4X3T A;  1U9R A;  1B2T A;  2J0T D;  3A74 A;  3BDL A;  3TP5 A;  5EPK A;  1RDP D;  3J81 L;  1KAW A;  2F0W A;  1JIC A;  5FLX L;  5JEA J;  2ZM6 Q;  1L0X B;  3U50 C;  1X56 A;  4XDX A;  4Z9C B;  5J3B A;  3JAM E;  5IT9 E;  4K6D A;  4QUF A;  3S2H B;  4CHT B;  2K5Q A;  4HSV A;  1CSQ A;  2UXB Q;  2F0T A;  2F3V A;  4JBW A;  3AQQ A;  1KDB A;  4BY1 B;  1QE6 A;  3MC0 B;  1R9T H;  1HR0 W;  1SFO H;  1AW7 A;  1PH9 A;  2AUJ D;  1SE4 A;  3KUP A;  4C3H H;  3H09 A;  1KTK A;  2PW7 A;  1UE6 A;  3RN5 A;  1YZ6 A;  3P20 A;  4JI0 Q;  3LX0 A;  1EOT A;  1RL2 A;  1L1O B;  4GN4 B;  2E2H H;  2B2T C;  2NBF A;  4BBR G;  3CCL A;  4IUN A;  1Q86 C;  1WTQ A;  1TS3 A;  2JA5 H;  2KCN A;  2R93 H;  1HNW Q;  1TWC H;  2FMC A;  2YTX A;  4CDC C;  3R2T A;  2BE5 C;  3MWY W;  5EPL A;  1X55 A;  1QNU A;  1PH5 A;  2MHV A;  3GDE A;  1L1O A;  2A73 B;  2VB3 X;  4LFB Q;  2UXD Q;  2NVT B;  5IP7 H;  4QQB X;  4RA8 A;  2ZTD A;  1M90 C;  1VCI A;  4BBS G;  1MHW C;  4YWL A;  4LF4 L;  3S1M H;  5BR8 L;  2Z9H A;  4MZ9 A;  3NK9 A;  5JEA H;  2XRS D;  4L63 B;  1UAP A;  1IL2 A;  2PMZ B;  4ODG A;  1JWS D;  3NWS A;  3WWV A;  1HXY D;  5GAD C;  4F87 A;  5KGU A;  5ELN A;  2B2V A;  1EWC A;  1JOK A;  1SAP A;  4PG3 A;  1X3P A;  4KI0 A;  1SEB D;  4PMW A;  4A3M H;  5EKL A;  1J5E Q;  4JI3 Q;  4IFD G;  1FJG Q;  4R4T A;  1LTB D;  4LF9 Q;  1B8A A;  1EZ6 A;  1QJO A;  3D3R A;  3SEB A;  4ZLT F;  3EJI A;  4IPH A;  4Q5V A;  1XTC D;  3F1Z A;  3V05 A;  2IL8 A;  3AFP A;  2F0P A;  4CJ0 B;  1VQD A;  4XT3 B;  2A6H D;  2EJM A;  4A3I B;  4PMC A;  1N33 Q;  4KV6 A;  4GLV B;  1S72 A;  5KEE A;  1G2T A;  1HFG A;  3GTO B;  2K5D A;  1NBW A;  1VS0 A;  3TS0 A;  4TSS A;  2VZA A;  4JI7 Q;  2PW5 A;  4HR7 B;  3AYH B;  2J7Z A;  5ISR A;  1TWH B;  2XRQ D;  2JA8 H;  1A0I A;  4I7Z C;  3CC2 A;  3DXJ C;  4OIJ A;  1VQA A;  2MUY A;  4WRD A;  5K36 G;  2Y0S G;  1Y1V H;  2I5L X;  1WFQ A;  1CHQ D;  4IUP A;  3UDI A;  4J15 A;  3VYT A;  2FXQ A;  4OO1 G;  3S14 B;  4CDF C;  1Z6H A;  3S16 H;  2KEN A;  4QL5 A;  2ZJR A;  5HGQ A;  4UP7 A;  4MN3 A;  1S5E D;  2F0F A;  4KJN A;  4O1N A;  4RHS A;  3KBX A;  2CHB D;  1S5D D;  4X64 L;  5FO9 B;  2HCC A;  3DEO A;  1GXD C;  3OMG A;  1I3Q H;  5GRO A;  4JI6 Q;  3H3V H;  1SYG A;  1ESF A;  1C8C A;  3TZU A;  1Y14 B;  4N9T A;  1MD2 D;  5IYB G;  1PZJ D;  1TQO A;  3UI2 A;  3I4N H;  1VQ9 A;  1ML0 D;  2FHT A;  2BA0 A;  2LS0 1;  3QJY A;  5C5M A;  1X65 A;  3RNU A;  3HOX G;  1EY0 A;  4PQX A;  2KA7 A;  2M00 A;  3C3L A;  2F0S A;  4HSP A;  3K0X A;  2V1C C;  4B3T Q;  1YNN C;  2I5H A;  4DR3 L;  1SYD A;  4EQN A;  1ZEQ X;  2HHH Q;  4GKK L;  4LJZ C;  4EGV A;  5CBA E;  4IUT A;  1SNQ A;  5KNB A;  1YNJ D;  1A15 A;  3ULJ A;  1WTO A;  5KRU A;  4FF1 A;  1N36 Q;  5A2Q E;  2Z4I A;  4X62 Q;  3CCR A;  1NY4 A;  2L9H A;  1TR5 A;  2JJQ A;  3J80 E;  4DNI A;  5HUR A;  2E74 C;  1HUN A;  4DNR B;  4U67 3;  1TXY A;  3LWU A;  1EEI D;  1V1Q A;  3G6E A;  4JI5 Q;  3RZO H;  1CK1 A;  1MGS A;  1NSN S;  4IJH A;  4HJ7 A;  3I8Z A;  3B6Y A;  5J1Z A;  3P75 A;  4K5X A;  2MQH A;  1DCZ A;  2CH4 A;  2NVQ H;  3DLL A;  1MSG A;  3BDO A;  3Q22 A;  3G71 A;  3OYY A;  3P7J A;  1PDQ A;  2QIL A;  3A7A B;  1EYG A;  3MZ5 A;  5LMU Q;  2A74 C;  4G4K A;  1LAC A;  1K83 H;  5DM7 3;  5LMN W;  4DV0 L;  3PSI A;  2E2J H;  4RG1 A;  4F88 A;  4A93 B;  1PVO A;  1H95 A;  1DXM A;  1I4X A;  1Q1B A;  4DAM A;  3UDX A;  3FKI H;  4B3M Q;  3D4R A;  4DN4 M;  1JOR A;  5C3E H;  5C44 G;  1JWM D;  4RMF A;  1XMO Q;  2K4K A;  4PZ8 A;  1QUQ B;  2LY7 A;  1K8O A;  1Y8O B;  4ZCK A;  1XMQ Q;  2A6E C;  2SNS A;  4CJ2 C;  4X66 Q;  4IAL A;  1SLJ A;  3HG9 A;  4HCS A;  1AEX A;  3A0J A;  3NUC A;  4HID A;  1KIX A;  3KBG A;  1BNZ A;  2X69 A;  1PH3 A;  3RD4 A;  4ME5 A;  3NSW A;  2PZU A;  1ICF B;  1XPR A;  4PNY A;  1L2F A;  1YBY A;  1YVC A;  3F2D A;  4A3J H;  4C3J B;  1A3T A;  1IYJ B;  2V4D A;  2EE1 A;  2X6L A;  1A2U A;  2NZ1 D;  4A3E G;  3PUW A;  3S1R B;  3Q0A A;  1IL8 A;  4M1U B;  3HS0 C;  3WDN A;  1QB5 D;  3BU2 A;  2NTT A;  3K80 C;  4A3F H;  1BR9 A;  4DR5 Q;  3GTL B;  4E6I A;  1B4O A;  1HNZ Q;  2F03 A;  1JC7 A;  3PO2 G;  3CD6 A;  3W1G A;  1XNR Q;  2WV6 D;  2R7D A;  1U4M A;  4LFC L;  4IFD I;  5C6A A;  3RN2 A;  3GTG H;  4ZRZ A;  3CPW A;  1WD0 A;  2ZJQ A;  2M2L A;  4X3K A;  2JA7 B;  2C35 B;  3T51 B;  2QA4 A;  1HTL D;  3R8B A;  2E2I H;  2F0U A;  4A3G H;  1Y1W B;  2CW0 C;  1XNQ Q;  1E3P A;  1IBK L;  3SE0 A;  3OW2 A;  3NXW A;  2DNC A;  3HOZ B;  4YY3 L;  5AJ3 Q;  4HED A;  4PZ6 A;  1STY A;  1RF2 D;  2ZTE A;  2R92 H;  5C4X G;  4DV2 L;  2XWJ B;  5FLM G;  5EAY A;  3KF8 B;  1SNC A;  1JQY D;  3C2P A;  1L0Y B;  5FJ8 H;  2WAQ E;  2MGS A;  3M4O B;  2UUB Q;  4QGU A;  4LUV A;  3GTK B;  1HZ9 A;  1D8L A;  4GNX B;  2ZXR A;  4A3K G;  5KND A;  3KF8 A;  4N8X 1;  1XPO A;  2EIF A;  5GAE C;  2CWP A;  2K04 A;  5IT9 c;  2CCZ A;  5M5W H;  1LTT D;  1P8L A;  2B2U C;  3CRK C;  3K5O A;  5CV8 A;  4DA2 A;  2L11 A;  1D1I A;  1Y1W G;  1BQQ T;  4JBK A;  4AQY Q;  4OO1 I;  2LFN A;  4GNX A;  3T1Y Q;  1F2M A;  2F0E A;  2KBN A;  3HOZ G;  3S1N H;  2K05 A;  2KQ3 A;  2K7V A;  1VQK A;  1HQR D;  1C48 A;  3NTH A;  4XYO A;  2KHJ A;  2K5N A;  4HJA A;  2DN8 A;  2R6G A;  3G48 A;  4DR4 L;  2JK8 A;  5FK9 C;  1IHZ A;  2F0V A;  1QIL A;  1GUG A;  2SNM A;  1D1K A;  4UDU C;  3S1Q H;  1W3S A;  4OHJ A;  4JI2 L;  3DWQ A;  1UEB A;  2K33 A;  4IUQ A;  4HIO A;  1STH A;  2EYP A;  1CHP D;  4IN3 A;  2ZXP A;  4P73 A;  2KEE A;  1PA6 A;  4P71 A;  2Q8R E;  4AYB E;  1E7Z A;  1SE2 A;  2N3S A;  4TKO B;  1J6Q A;  2XNA C;  1YJW A;  1NE3 A;  4EQ5 A;  3J7A V;  4L8J A;  2VQF Q;  1TWG H;  4L5R C;  2EYO A;  1GOZ A;  1BF4 A;  1RIP A;  3NQI A;  2WB1 E;  4FO2 A;  4RHR A;  2DY7 A;  1RTN A;  4DUY L;  2MP1 A;  2EJG C;  1AFP A;  5IOD A;  2BDN A;  1B7Y B;  1JCK B;  3AMU A;  1Q7Y C;  5HGT A;  4NDX A;  1CKO A;  4B3R L;  3BJU A;  5E1F A;  3GTJ B;  1CQV A;  1LV9 A;  4KHP L;  4JOI C;  4C3I G;  1QVC A;  3TBI B;  4DV3 Q;  2OXP A;  4WJ4 A;  1Y8N B;  1WTW A;  2F0M A;  1MIU A;  2UU9 Q;  1VQL A;  4NXM Q;  3Q8D A;  5C3W A;  1BDO A;  3NPP A;  4O2D A;  4QIW B;  3HOY B;  2JA6 H;  3GP7 A;  4JI1 L;  2KEC A;  4DAP A;  4LF7 L;  4KMU C;  5FKA C;  3JAM i;  1ENC A;  3AU7 A;  3BG3 A;  2D0O A;  3F2B A;  2UUC Q;  4JG2 A;  1PTO B;  3QOL A;  4FDB A;  4K0K L;  4C3H G;  3EA6 A;  5JVG 3;  2UXC Q;  2MJ8 A;  2HD3 A;  3PO3 B;  4ULL A;  1N8R C;  3Q23 A;  1PFS A;  3L2P A;  1C4Q A;  2E76 C;  4CBV A;  3TS2 A;  2JA5 G;  2E5L L;  2R93 G;  1UE7 A;  3J7Z C;  1RHP A;  3G4S A;  5M5X B;  4WOR A;  3A56 A;  3L0O A;  2ALY B;  1WTH A;  2OWO A;  1D6E C;  1H9R A;  1SSO A;  2ENB A;  5M3M B;  4YHH L;  3HOY G;  4IPC A;  2AKW B;  4BA1 I;  1WCM H;  5IP7 G;  3H0G B;  3GTM B;  5BN5 A;  3UE1 A;  1EQV A;  3OTO L;  1DOL A;  4OIK A;  1PMR A;  3TME A;  1XPU A;  1OXS C;  2D0P A;  1DM0 B;  4YCW A;  4DV6 L;  3AEV A;  4ID6 A;  3S2D H;  1L0W A;  1Y8P B;  3S15 H;  3PIO 3;  3HOV B;  3A7L A;  5CBE E;  1JE4 A;  3C46 A;  1E1T A;  1HZC A;  3J81 E;  2IHF A;  2F0D A;  4DV5 Q;  2VY3 A;  3QG1 A;  4NW2 A;  4A3M G;  4JYA Q;  1JJG A;  4CDD C;  4DAY B;  1PRT C;  1JOO A;  1Y69 U;  1LUZ A;  4RWS C;  1SRO A;  4RH6 A;  1SMY C;  3NBH A;  3J80 c;  2HIV A;  2Z0S A;  3VR5 A;  2JYO A;  5IGE A;  1LT4 D;  3U9S A;  1A63 A;  2KED A;  1D2B A;  1LAB A;  1HH2 P;  1ZYR D;  4LF8 Q;  2RVL A;  3SVM A;  4Y7N H;  1EY6 A;  1W6K A;  2JE6 I;  2WKD A;  1NNX A;  1AZQ A;  4LF6 L;  3M4Q A;  2K75 A;  2NVY B;  2X6G A;  4POF A;  5D65 A;  2B2Y C;  3FVQ A;  2F0K A;  4G57 A;  5KNC A;  2JA9 A;  4LF5 L;  2N78 A;  2B2T A;  1BBX C;  4DR6 Q;  1A3V A;  1A3U A;  5G3L D;  2FMM A;  2I46 A;  1OXX K;  5IGF A;  4BY7 H;  2I5M X;  2N88 A;  1VQE A;  2JEB I;  2Q2H A;  5DAU A;  4QUC A;  5I9O A;  4LF4 Q;  3NE5 B;  1C7Y A;  3A8K E;  4B3S L;  3HKZ E;  3I72 A;  1M1K C;  3CU7 A;  1MBY A;  1LTI D;  4BBR B;  1FD7 D;  1GM5 A;  2K32 A;  2ES2 A;  1PZI D;  4IPG A;  1LTL A;  4DR1 Q;  3GTQ B;  1V43 A;  3F2C A;  2A6E D;  4P2C B;  4BXX H;  4HAE A;  1SNM A;  4R4O A;  3T1H Q;  4A3D H;  1I50 B;  3I4N G;  1F9R A;  5GAG C;  5K5P A;  4BA2 I;  1SN8 A;  2RKS A;  4BBS B;  3A8I E;  4C2M H;  1SE3 A;  2B39 A;  1FR3 A;  1VMC A;  3WOE A;  3MXU A;  1YIJ A;  3J7A 5;  3M3Y H;  4DNT B;  1X3Q A;  4MIU A;  4OX9 L;  1PTO F;  2R7Z H;  4DR2 L;  3F8T A;  4DV7 L;  2D2C C;  3UDG A;  1DOM A;  2VQE L;  4K8J A;  4KKS A;  2QF7 A;  1F9Q A;  1A6X A;  1BOS A;  3GV3 A;  5CV5 A;  2EOT A;  1YIT A;  1IKL A;  1F2Z A;  2JXM B;  5IGD A;  1EU3 A;  1N34 L;  4K2L A;  5AFW A;  4JV5 Q;  1NUC A;  4CGY B;  1LT6 D;  3CMA A;  1AH9 A;  1ET9 A;  3A54 A;  3N6R A;  5JJK A;  2VXW A;  3I4M H;  1E22 A;  3J80 i;  4RCN A;  3ND9 A;  1M8A A;  2EYH A;  3CQZ H;  5ELB A;  1N32 L;  5IYD G;  2A69 D;  2YU9 B;  1X3F A;  3EBE A;  2RDF A;  1S5C D;  2HUG A;  1S5F D;  1OXT A;  2OTL A;  1O80 A;  4G7O C;  4GLX A;  4A3B H;  4A3L G;  4L5Q A;  1WTV A;  3VR2 A;  1BBU A;  3SK4 A;  1O7Y A;  1P16 A;  4FNF A;  1YJN A;  3MXP A;  4HJ8 A;  1UNS A;  2Y0S B;  1KRS A;  3I70 A;  4IPD A;  2ZJP A;  2B2W C;  1YHB A;  1SBB B;  1T5E A;  1YNX A;  1E0B A;  1FL0 A;  5C3E G;  5IWA Q;  1YEZ A;  2NZO A;  2ZM6 L;  3JAM L;  2EYL A;  2PO4 A;  5IT9 L;  5TSS A;  2CWA A;  3BYT B;  3IFT A;  5LL6 S;  2YV5 A;  3RMH A;  5I2Y A;  1VQM A;  1KLG D;  3A55 A;  4RGT A;  4GKJ Q;  2UXB L;  3EFX D;  2PNR C;  2R61 A;  4IQZ A;  1Q8I A;  2MO1 A;  5C0X J;  1WI5 A;  3HOW H;  1XXG A;  1F9P A;  1EQQ A;  1EQR A;  1Q3L A;  4AH6 A;  3I56 A;  3J7Y W;  1KRT A;  2A8V A;  2F0Q A;  1VQC A;  3K59 A;  1K9M C;  4JCV E;  1EWH A;  1SE8 A;  4A3J G;  3KLW A;  4DXF A;  3V2T A;  1MKH A;  5M5Y B;  3M9B A;  2VUM H;  4JI0 L;  2KVM A;  3PF5 A;  3HOX B;  3BYY B;  2MNA A;  2QGQ A;  3PIP 3;  3DWA A;  2F1M A;  4OWW B;  4B08 A;  1HZB A;  2E2D C;  3LNN A;  1AE3 A;  1RKN A;  1VQH A;  4RAU C;  1HNX Q;  4FXD A;  3K5N A;  1B70 B;  3HOV H;  3UE0 A;  5IGC A;  1ONL A;  1MSH A;  1HNW L;  3OW7 A;  4DK6 C;  1V1O A;  1NMG A;  3FHW A;  1CFM A;  1F77 A;  2AWN A;  4FF4 A;  3KK7 A;  1V1P B;  3W2D A;  4DR7 L;  4YCV A;  1BBW A;  1IBM Q;  2AMC B;  4S3S A;  3K8A A;  4LFB L;  4A3G G;  1BCP C;  1KDC A;  2QDB A;  4X3U A;  5BN3 A;  3HOU H;  3GTP H;  2DJF C;  1U4P A;  2K1B A;  5FO7 B;  2F3W A;  2IJ0 A;  2NWG A;  3PUZ A;  1I4G A;  4PZ7 A;  2RQX A;  2R92 G;  3K7A B;  3CCQ A;  3RLO A;  2FJ2 A;  5I6W A;  4F8M A;  3NTK A;  1R4Q B;  5C0X H;  4PV1 C;  1ILQ A;  2B63 B;  4JI3 L;  2K6A A;  2NVY H;  1FJG L;  4LF9 L;  1C0A A;  4XQN A;  1A62 A;  1II3 A;  4DXG A;  3ICE A;  2CQA A;  1TVX A;  1K28 A;  3GO5 A;  1Z9F A;  1LTS D;  1N33 L;  4JI4 Q;  1T5X D;  1PFN A;  4A3C G;  3U4Z A;  1NCV A;  3CCU A;  5CV7 A;  1Z47 A;  4OEM B;  4OWT B;  3CPF A;  1QG7 A;  1G51 A;  3RLN A;  1I6H B;  1KLU D;  4R8I A;  5C44 B;  4WJ3 M;  1F2L A;  1VQ4 A;  1Q8K A;  2RSN A;  5LMN L;  2B63 G;  3KLS X;  2AWO A;  1EOV A;  3VR3 A;  4ZKB B;  3ZJY C;  2Q8T A;  3MAQ A;  4KKU A;  2CKZ B;  2NB0 A;  3S2H H;  1J9O A;  5D14 A;  3PUY A;  1TY0 A;  4IUV A;  5EJW A;  4Q0F A;  1JWU D;  4U68 A;  3TP7 A;  4R9W A;  4BY1 H;  4K14 A;  1SJH D;  3SGI A;  4LFA Q;  1VQ5 A;  3H15 A;  4YY3 Q;  4A3E B;  3C1E A;  2VS1 A;  1QVG A;  3SHL A;  3M85 A;  2AUK A;  3MA2 B;  1LYL A;  3RZD B;  2A68 D;  1CSP A;  2F0G A;  1U5K A;  3PO2 B;  4FXG C;  2IWH A;  1HA6 A;  4KK7 A;  1VQ7 A;  3J81 c;  4H02 A;  2F0I A;  5FLX c;  2YTV A;  1WTX A;  1HHV A;  3A8J E;  3SK5 A;  2NVX B;  3CAM A;  2JSO A;  1KL9 A;  3A5Z B;  1QUQ A;  1IBL Q;  3HFZ B;  2WP8 J;  3I73 A;  1TWA B;  2HCI A;  4ME3 A;  4B3T L;  2NVT H;  3T56 B;  3MHB A;  2PYK A;  3KF6 B;  1JT8 A;  5ELD A;  2HHH L;  2K5W A;  5C4X B;  1LO5 D;  3BZD B;  1CKN B;  1BUV T;  3ER0 A;  5M3F B;  2B2U A;  3TP8 A;  3U58 A;  2DGY A;  2C9O A;  3QO2 A;  1TWF B;  5JPN C;  1N36 L;  5CV9 A;  3KF6 A;  5E4W C;  4X62 L;  5A2Q L;  4A3K B;  1PTO D;  3S9W A;  3VA7 A;  4POG A;  1CKN A;  4X65 Q;  4QCL A;  2Z4H A;  4JBM A;  3DEP A;  3NTI A;  1EY5 A;  2F0L A;  3I2Z A;  1K8A C;  2JA6 G;  1S5B D;  5K36 H;  1GUW A;  4ZKC B;  3W5O A;  4JI5 L;  2E8G A;  1CI3 M;  3CC4 A;  2K03 A;  1EFI D;  2A5H A;  1BXT A;  4OO1 H;  2EY2 A;  1EYA A;  1EUJ A;  1KD1 C;  4GN3 B;  5IP9 G;  4A3I H;  4P75 A;  1RTO A;  1EIF A;  3L9A X;  4XIG S;  2O2L D;  2GN5 A;  2AQ2 B;  2EYF A;  4DPG A;  3GTO H;  4DFA A;  3Q6S A;  5M3F G;  2R3Z A;  4JVZ A;  1I4R A;  4APV A;  1UE5 A;  5LMU L;  1FGB D;  1EY7 A;  4IUR A;  4RGO S;  1VQJ A;  1PYW D;  1NR4 A;  3RR5 A;  1TWH H;  5C4J B;  1DON A;  4CDE C;  4XTC S;  2AHO B;  5C3X A;  1Q46 A;  3ERS X;  5IYB H;  4FF3 A;  2IHE A;  4B3M L;  3V96 A;  3S17 B;  3HOX H;  3KLR A;  1XMO L;  1G91 A;  1I5F A;  1WCM G;  4XQJ A;  3IKJ A;  1XMQ L;  1AN8 A;  4HMJ A;  2A19 A;  5COY A;  4X66 L;  3PV0 A;  1SYB A;  2ZXO A;  4NXN Q;  3S14 H;  2PZW A;  1DOK A;  2OQK A;  4CKC A;  1IXR A;  3NEM A;  4IOC A;  4QMG A;  3I55 A;  2A6H C;  2Z6B A;  4KY7 A;  2EQS A;  2HIX A;  3O13 A;  4H0L C;  1S40 A;  3QB3 A;  2KCT A;  3PIO A;  2VW9 A;  4JOI A;  4ABN A;  3SDZ A;  3J81 j;  3VR4 A;  3J81 i;  3TDQ A;  2ID0 A;  3TZD A;  3HZX A;  4DR5 L;  4TVA B;  1VQP A;  1HNZ L;  4JI1 Q;  3D8G A;  1XNR L;  1HJP A;  4RGM A;  3PUV A;  3ERO A;  4IJL A;  4KN4 C;  1F2Y A;  4DUZ Q;  3PF4 A;  2MO0 A;  2N8N A;  3ULL A;  5IGB A;  2K50 A;  2BE5 D;  4C3I B;  1SDF A;  2EYJ A;  4UP9 A;  3TRZ A;  2MFI A;  1XNQ L;  1SYC A;  3W3A A;  2KUM A;  5CC4 A;  1A8V A;  3E9I A;  5AJ3 L;  2YTY A;  3IRB A;  5DNF A;  5JJZ A;  1JJ2 A;  1S3O A;  2B29 A;  2G5D A;  1KAA A;  4DV4 Q;  3U9O A;  3VYR A;  2PQA B;  2Z6K C;  1EIY B;  1V8Q A;  1C9O A;  3FEW X;  1VF7 A;  4GN5 A;  1R9T B;  2UUB L;  4GOP C;  2MPM A;  4B9W A;  1B44 D;  4C3H B;  3BZC A;  5JVH 3;  2L0C A;  4BY7 G;  2L12 A;  1EU4 A;  3G6J B;  4RFB A;  4BS9 A;  2IX0 A;  1LTR D;  2NTS A;  2DY8 A;  4DV1 Q;  2E2H B;  4AQY L;  4JK1 C;  5IYC H;  3T1Y L;  2JA5 B;  4G7H C;  2R93 B;  3I91 A;  1TWC B;  3UDF A;  1PRT B;  1ROD A;  2F4V Q;  3DWP A;  2BA1 A;  4LNQ A;  1HFN A;  4A93 H;  3D4D A;  3DHQ A;  4EVO A;  2EJF C;  1HUM A;  2K5H A;  1I94 Q;  5KIX A;  4KLK A;  3D6W A;  2PMZ E;  1YNJ C;  4K5V A;  1KC8 C;  1JR0 D;  3OIP A;  3S1M B;  1I4H A;  1VMP A;  2PNH A;  3RUZ A;  2XSC A;  1X6O A;  4DK3 C;  3L7Z C;  4RCO A;  3QR8 A;  2LKV A;  2R7Z G;  2DJG C;  2FFK B;  4ALP A;  1STA A;  1MI2 A;  3HGB A;  2Y0S E;  4V0B A;  4A3M B;  1EY4 A;  4DGZ A;  1OXU A;  2B3G A;  1ET6 A;  4JI8 Q;  4K6L A;  1I6V C;  2HQE A;  3CRL C;  2YYZ A;  1HQM C;  2IY5 B;  1B53 A;  1LLR D;  2ZT9 C;  4C3J H;  3TRE A;  4KHV A;  5FLM H;  4XT1 B;  2VQF L;  3S1R H;  4X3S A;  5ELE A;  2EXD A;  2B2Y A;  3MFY A;  1E2W A;  1PFB A;  1NR2 A;  2QDL A;  3GTL H;  4RGN A;  3I4M G;  1M4V A;  1Q12 A;  4LK1 C;  5JEA G;  1WYD A;  3BVG A;  4OXP A;  3EIV A;  2UUA Q;  3C1F A;  4A3K H;  2JN4 A;  4KKT A;  4QJF A;  3MXG A;  4B3S Q;  1VQ8 A;  2JA7 H;  2OTJ A;  2JA8 B;  1R4P B;  5IGG A;  1Y1W H;  1K8G A;  2DNE A;  4A3B G;  1ILP A;  4LMQ D;  5FLX E;  1YNN D;  1HRJ A;  5GQO A;  1EY8 A;  3HOZ H;  1Q81 C;  1HCZ A;  4JBJ A;  2PI2 A;  5CGK A;  3PCO B;  1Y1V B;  5I6Y A;  4DV3 L;  2KHI A;  5J39 A;  3EN2 A;  4LUZ A;  5CMD A;  5CYU A;  2NN6 H;  4ZYS A;  1H9K A;  4DAY A;  1G6P A;  3M7G A;  3S16 B;  2UU9 L;  4NXM L;  3HP3 A;  1CQF A;  1VQN A;  3M4O H;  1SJE D;  4EQO A;  1E24 A;  3ERQ A;  4ZUI A;  3STB C;  3GTK H;  2WAQ B;  5C4Z A;  1YHQ A;  1TT2 A;  5I4D A;  2BOS A;  2RDH A;  1RD9 D;  2D5D A;  4DR2 Q;  2QCP X;  2IT1 A;  2UUC L;  4FXK C;  4J6H A;  4P74 A;  1O7Z A;  2JA8 G;  1FYC A;  2VQE Q;  3GQB A;  4Y52 H;  4N9P A;  4B9X A;  3I4N B;  2RCN A;  2I07 B;  1D5X C;  3T4A C;  2UXC L;  4GZY C;  1PXU A;  2K28 A;  4G7Z C;  5DEH A;  1EYD A;  4UAI A;  2G9H D;  1Y1V G;  2K01 A;  4IZ8 A;  1DZ1 A;  1N34 Q;  3SK6 A;  2Q2U A;  1O7L A;  1HA5 A;  1U4L A;  3KOJ A;  3PIP A;  1LTA D;  2IW3 A;  2D62 A;  1VQF A;  1KQS A;  5BR8 Q;  5LL6 X;  2HDM A;  2WAQ G;  4J8Q A;  4NB3 A;  1TS5 A;  5EKI A;  3ITP A;  1B9N A;  1ASZ A;  2ICI A;  2QW7 A;  5EBD A;  1HR0 L;  1DJR D;  3KYH C;  3K7U C;  5H1S E;  3BDC A;  5EKK A;  1DYQ A;  3CHB D;  3W1B A;  1UUP A;  1PRT F;  4C3I H;  2OEO A;  3S24 A;  3EVQ A;  3RZO B;  4OEL B;  3OHX C;  5C0X G;  4DV5 L;  5EPJ A;  4R4I A;  1SR3 A;  4AYB B;  3OWE B;  4JYA L;  1FNU A;  2H4O A;  2NVQ B;  4KD4 A;  2B2W A;  3AFQ A;  2BDO A;  5JJL A;  5T1G A;  4WFN 3;  3DUZ A;  3TN2 A;  1GD7 A;  1K83 B;  2WB1 B;  5DLQ E;  3H3V C;  3I4L A;  2E2J B;  4ILW A;  4DU9 A;  1SYE A;  2XN9 C;  1CZW A;  1KHI A;  3D31 A;  4N8F A;  4LF8 L;  3GTJ H;  3OSO A;  2ZTC A;  1ZKO A;  3FKI B;  1X54 A;  3KFU A;  3D4W A;  3WOF A;  3IL8 A;  5C3E B;  2CW0 D;  4TQU S;  2L5T A;  1OTC A;  3PGZ A;  2SOB A;  2WKC A;  4NP5 A;  4AYB G;  1SNP A;  4RKB A;  3E3X A;  3PUX A;  3SK8 A;  3MVV A;  4JW0 A;  3ND8 A;  1SNO A;  4L5T A;  1E2Z A;  1D5M C;  3HOY H;  5IY0 A;  4DR7 Q;  1GJX A;  4DR6 L;  5C5L A;  4XQQ A;  4X64 Q;  1BCP B;  2N49 A;  5T1I A;  1EY9 A;  2WB1 G;  4A3J B;  1QVF A;  3NBI A;  1SXT A;  2GVA A;  1U0L A;  2IX1 A;  4BY1 G;  3VA5 A;  4EX5 A;  1PTO H;  5KYL A;  4KY6 A;  2BH8 A;  3DMU A;  1AZP A;  1PLF A;  3K5L A;  3FKI G;  1N9W A;  2EY1 A;  1WTR A;  4A3F B;  2SEB D;  5D3I B;  2HDL A;  1EEF D;  3PO3 H;  2VNU D;  5EGT A;  4DR1 L;  1W6J A;  2CVR A;  3T1H L;  3GTG B;  4DR3 Q;  3RLF A;  2E2I B;  3FDT A;  1LM0 A;  4KN7 C;  5M5X H;  4A3G B;  3X3N A;  4GKK Q;  1O7I A;  2CH4 W;  5M3M H;  2N55 A;  4NMZ A;  1EQT A;  3OPO A;  3T53 B;  2K5V A;  4OL7 A;  2Z8L A;  3H0G H;  2EZV A;  5L37 A;  3MXN B;  3GTM H;  2CQO A;  2WAC A;  2R92 B;  5CR3 A;  2IX3 A;  1W2B A;  1CT1 D;  1UWV A;  2F0H A;  3QIA A;  3SXH A;  1CA5 A;  4BWG B;  1WOC A;  1X3E A;  4A3F G;  1L1O C;  3MXN A;  1KAB A;  2ASB A;  4I65 A;  5F2D A;  5LMN Q;  1F9S A;  5M5W B;  3LGJ A;  1VQI A;  4JV5 L;  3OMC A;  2VB2 X;  1TS2 A;  2UXD L;  1ENA A;  4A75 A;  3VDY A;  1Q82 C;  3G7L A;  4NKL A;  4ZAI A;  1RCV D;  2B2V C;  3S1N B;  3K57 A;  1V1P A;  2PQE A;  2SDF A;  3NEL A;  4LAA A;  2K14 A;  4DV0 Q;  2VL6 A;  4A3I G;  4H44 C;  3K58 A;  1WVL A;  4FF2 A;  1T9H A;  2RBM A;  3J7A F;  4UHV A;  1VQO A;  3FRP B;  5FJ8 G;  5ELO A;  4CJ1 B;  2ATW A;  3P1H A;  5FO8 B;  2Q2T A;  1J5E L;  4OGQ C;  4OWX B;  3FP9 A;  3A5U A;  1TU2 B;  2EXZ A;  2KHS A;  1B50 A;  2RHQ B;  1QNK A;  3S1Q B;  2M9V A;  1IW7 C;  3H91 A;  5JOB A;  1EIG A;  4DK0 A;  1ASY A;  5IWA L;  1FNW A;  5ELF A;  1X3G A;  4TRD A;  1BVS A;  3E9H A;  2B8G A;  3IAY A;  3T13 A;  4IFD J;  3CCE A;  1TII D;  1TS4 A;  4JI7 L;  2F0O A;  4L6T B;  4HIM A;  4GKJ L;  5J22 A;  2L55 A;  4GLA C;  3I7F A;  1J8I A;  2A1A A;  1TWG B;  2K52 A;  2BCO A;  5IIF A;  2KJX A;  3KDF B;  3CKI B;  3E0E A;  4DF7 A;  1AP0 A;  4BBR H;  1IKM A;  3H3V I;  4LW1 A;  3HKZ B;  2FIN B;  3TP6 A;  4LUO A;  3SR1 A;  1STB A;  1S4Z A;  1XTD A;  3GTQ H;  4LFC Q;  1ZYR C;  5E4X A;  3QWN A;  1I50 H;  3KDF A;  4C1N K;  2LMC B;  2HT1 A;  1WJJ A;  2C5C A;  1MJC A;  3K0Y A;  1PH1 A;  1KNE A;  1HNX L;  5IE8 A;  5C0X I;  1KDA A;  4CKB A;  2PCF B;  1H9M A;  2LSS A;  1IBK Q;  4KD3 A;  3ULP A;  3FPP A;  4BBS H;  2RSO A;  1BCP F;  1B9M A;  2L15 A;  5COR A;  1CUK A;  3CP0 A;  4UP8 A;  4HN7 A;  1IBM L;  3GV6 A;  4KY5 A;  4R8N A;  3OOC A;  2F3I A;  5IYD H;  4DV2 Q;  1CZG A;  2IPK D;  2XVS A;  4QIW E;  5M9O A;  4JC0 A;  2NZH A;  4JI6 L;  5JJI A;  1SND A;  4YWK A;  1GHJ A;  4UY8 C;  1JOQ A;  3MEH A;  4F7X A;  1XJV A;  2H1E A;  3BVZ A;  4A3L H;  1STN A;  1PHJ A;  3E5S A;  4IUU A;  3HKZ G;  1B3A A;  4IFD H;  1B3Q A;  2JA6 B;  2Q2I A;  1PV4 A;  1U4R A;  2I0Q A;  2WIN B;  1NMF A;  4HJ9 A;  2HQL A;  1GVP A;  1WTP A;  3KJO A;  5DM6 3;  3BS1 A;  1PRT D;  1K0R A;  3HKS A;  1PFM A;  1XWE A;  4I7A A;  3N52 A;  3KJP A;  2D9U A;  1SMY D;  3H94 A;  5KYI A;  1PH8 A;  2YU9 H;  4JI4 L;  1ESR A;  2Z1C A;  3VR6 A;  5IYC G;  3OWF A;  3PQI A;  4K8I A;  4J1M A;  1FNV A;  3TQY A;  3ZYY X;  1GUS A;  4ZUJ A;  5GAH C;  3J80 L;  4DR4 Q;  3STB D;  1PH6 A;  1X32 A;  5EQ0 A;  1QZH A;  1KXL A;  3NEN A;  1G29 1;  3K6O A;  4A93 G;  1WCM B;  3E0J A;  1VF5 C;  3CCM A;  4JI2 Q;  2RHS B;  3VYS A;  3E6Z X;  4PMB A;  1YJ9 A;  2O4X A;  4AIM A;  2WFW A;  2Q8I B;  2PI2 E;  5A35 A;  3KLS A;  4K5W A;  2F0N A;  1O78 A;  3QOJ A;  3D6C A;  2KCC A;  1AE2 A;  3IFD A;  1IYU A;  3S2D B;  1EFW A;  3S15 B;  3AB9 A;  3H6M A;  3CCJ A;  1JJC B;  3EQL C;  1B1Z A;  3CCV A;  1VQ6 A;  1GUO A;  4R1J A;  2JP1 A;  1ICW A;  3NWT A;  3PMF A;  2EY5 A;  1VQG A;  4LFA L;  4C1N I;  1ENF A;  1OO9 B;  4IO9 A;  2RF4 A;  4C3J G;  4DUY Q;  2EDG A;  5G3L F;  5M5Y H;  1H9S B;  2A69 C;  4O0A A;  4QB4 A;  1BO0 A;  1VDZ A;  4HJ5 A;  1CM9 A;  4GOP B;  2XWB B;  1A2T A;  1G6Z A;  2P5Z X;  4B3R Q;  4R4Q A;  3CC7 A;  4Y7N B;  4HMI A;  2Z6K A;  1MJE A;  1H9S A;  4ZK9 B;  3U4V A;  3JAM c;  1PH7 A;  1D7Q A;  4KHP Q;  5CV4 A;  1IBL L;  2F52 A;  5JPM C;  4GOP A;  1SMX A;  2JA7 G;  1GUT A;  4RKL A;  2O5J C;  4FP5 D;  1XX8 A;  1NJI C;  5C4H A;  3HEJ A;  1CA6 A;  4A3C H;  3Q24 A;  3D0F A;  2E75 C;  1CKM A;  1NAP A;  1GKH A;  1UE1 A;  3R93 A;  1IZ6 A;  1LT5 D;  2PPB C;  3K7A H;  3MEF A;  4XYQ A;  1Q90 A;  3NP8 A;  2NN6 G;  1YI2 A;  4LF7 Q;  4DK1 A;  3VYU A;  4BY7 B;  2F4I A;  3NQT A;  3I3C A;  1K8M A;  5E3F A;  4X65 L;  1Z7T A;  5E7N A;  2B63 H;  1K3B C;  2DUD A;  2WII B;  4K0K Q;  3CW2 C;  1D5Z C;  1HZA A;  4DAV A;  2QEJ C;  1JB7 A;  3K81 C;  4ZQ3 A;  4OON A;  1E1O A;  1QCB D;  1TY2 A;  2EPB A;  4A3D B;  1EL0 A;  3TEH B;  2G9D A;  4P72 A;  4V19 0;  1HTP A;  2E5L Q;  5ELC A;  4GS3 A;  2OQ0 A;  1PYS B;  4A4I A;  4C2M B;  4YHH Q;  4LWC A;  3BVM A;  1I6H H;  2BH2 A;  1SFO B;  5C44 H;  1Q1E A;  5NUC A;  1JMC A;  1EYC A;  2EYM A;  3M3Y B;  1G8Z D;  1KNA A;  3DM3 A;  4GNX C;  2KOL A;  2PQA A;  3OTO Q;  2L1B A;  2R7Z B;  2GA4 B;  5I9P A;  2XTI A;  2OT2 A;  4KTA A;  4YCU A;  5I2X A;  4DV6 Q;  2XIW A;  1QWY A;  4H13 C;  1VQB A;  3CXC A;  4K2K A;  4NXN L;  4BXX G;  1SRU A;  3R2I A;  4O42 A;  4A3D G;  3MFG A;  4NPS A;  2TMP A;  4A3E H;  2AQ1 B;  2RCF A;  4YIJ A;  2JQO A;  2J4X A;  2QKI C;  1FGU A;  1V9P A;  3RZD H;  1LT3 D;  3I4M B;  2GVB A;  5IOC A;  3PO2 H;  2NUC A;  1SYF A;  3GD7 A;  3I90 A;  2OCE A;  4A76 A;  3CQZ B;  4JPB W;  4KJO A;  1UEA B;  1JB3 A;  1I4P A;  4EQP A;  4MTK A;  3R3O A;  3X3M A;  4DKA C;  5JAV A;  4A3B B;  1NTG A;  4YWM A;  2NVX H;  4MTN A;  2F0J A;  4LF6 Q;  4X6A H;  2CFM A;  1QOH A;  4DUZ L;  1YHA A;  1CTM A;  3DM1 A;  1TKW B;  1EIH A;  1TWA H;  5IP9 H;  2O5I C;  3ONA B;  4QY7 A;  5C4X H;  3JC6 6;  1ZXT A;  5M3F H;  2OF1 A;  1EWI A; 
#chains in the Genus database with same CATH homology
 1BCP D;  1STG A;  3HRZ C;  3OIQ A;  4WJW A;  5FOB B;  3URY A;  1LTG D;  1PZK D;  2RDG A;  1GUN A;  2ICE C;  3HOW B;  3FPU B;  5D3D A;  3F2U A;  4FVM A;  1WD1 A;  1E2V A;  4KHZ A;  2A68 C;  4QF4 A;  2VUM B;  3K5M A;  4H7B A;  1I4Q A;  3FMC A;  1IW7 D;  3LWE A;  4M8A A;  1GHK A;  2EY6 A;  2RA4 A;  1G2S A;  1OXV A;  4C56 C;  5LHY 1;  1H9J A;  3M7N A;  1STE A;  1I3Q B;  2JEA I;  3HOU B;  2TSS A;  3GTP B;  2B8F A;  4XXE A;  1EZ8 A;  4HTH A;  2L4N A;  3NHH A;  4CKE A;  1PTO C;  2AQ3 B;  2NYZ D;  1IYV A;  3MTS A;  1HPC A;  2PZT A;  5CV6 A;  4HCE A;  1XYI A;  4FYD A;  3M4Y A;  5EBC A;  3L3O C;  1DD2 A;  2EVB A;  1RJT A;  3T16 A;  2NN6 I;  4MHE A;  3TSS A;  5BN4 A;  4X3T A;  1U9R A;  1B2T A;  2J0T D;  3BDL A;  3TP5 A;  5EPK A;  1RDP D;  3J81 L;  2F0W A;  1JIC A;  5FLX L;  5JEA J;  1L0X B;  3JAM E;  4XDX A;  4Z9C B;  5IT9 E;  4K6D A;  4QUF A;  3S2H B;  4CHT B;  2K5Q A;  4HSV A;  2F0T A;  2F3V A;  4JBW A;  1KDB A;  4BY1 B;  1QE6 A;  3MC0 B;  1AW7 A;  2AUJ D;  1SE4 A;  3KUP A;  3H09 A;  1KTK A;  2PW7 A;  3P20 A;  3LX0 A;  1EOT A;  2B2T C;  2NBF A;  4IUN A;  1WTQ A;  1TS3 A;  2KCN A;  2FMC A;  3R2T A;  2BE5 C;  3MWY W;  5EPL A;  1QNU A;  2MHV A;  2A73 B;  2VB3 X;  2NVT B;  4RA8 A;  1VCI A;  3NK9 A;  5JEA H;  2XRS D;  4L63 B;  1UAP A;  2PMZ B;  4ODG A;  1JWS D;  3NWS A;  1HXY D;  4F87 A;  5KGU A;  2B2V A;  1EWC A;  1JOK A;  1SAP A;  1X3P A;  4KI0 A;  1SEB D;  4PMW A;  5EKL A;  4IFD G;  1LTB D;  1EZ6 A;  1QJO A;  3D3R A;  3SEB A;  4ZLT F;  3EJI A;  4Q5V A;  1XTC D;  4CJ0 B;  3V05 A;  2IL8 A;  2F0P A;  4XT3 B;  2A6H D;  2EJM A;  4A3I B;  4PMC A;  4KV6 A;  5KEE A;  1G2T A;  1HFG A;  3GTO B;  2K5D A;  4TSS A;  2PW5 A;  4HR7 B;  2J7Z A;  5ISR A;  1TWH B;  2XRQ D;  4I7Z C;  3DXJ C;  4OIJ A;  2MUY A;  4WRD A;  5K36 G;  1CHQ D;  4IUP A;  3VYT A;  4OO1 G;  3S14 B;  1Z6H A;  4MN3 A;  1S5E D;  2F0F A;  4KJN A;  4O1N A;  4RHS A;  3KBX A;  2CHB D;  1S5D D;  5FO9 B;  2HCC A;  3DEO A;  1GXD C;  3OMG A;  1SYG A;  1ESF A;  1C8C A;  3TZU A;  4N9T A;  1MD2 D;  3UI2 A;  1PZJ D;  1TQO A;  1ML0 D;  2FHT A;  2BA0 A;  2LS0 1;  3QJY A;  5C5M A;  1EY0 A;  4PQX A;  2KA7 A;  2M00 A;  3C3L A;  2F0S A;  4HSP A;  1YNN C;  1SYD A;  4EQN A;  1ZEQ X;  4LJZ C;  4EGV A;  5CBA E;  4IUT A;  1SNQ A;  5KNB A;  1YNJ D;  1A15 A;  1WTO A;  5KRU A;  4FF1 A;  5A2Q E;  2Z4I A;  2L9H A;  1TR5 A;  3J80 E;  1HUN A;  5HUR A;  2E74 C;  4DNR B;  4U67 3;  3LWU A;  1EEI D;  1CK1 A;  1MGS A;  1NSN S;  3I8Z A;  5J1Z A;  3P75 A;  4K5X A;  1DCZ A;  1MSG A;  3BDO A;  3Q22 A;  3P7J A;  1PDQ A;  2QIL A;  3A7A B;  3MZ5 A;  2A74 C;  4G4K A;  1LAC A;  5DM7 3;  4F88 A;  4A93 B;  1DXM A;  1I4X A;  1Q1B A;  3D4R A;  4DN4 M;  1JOR A;  1JWM D;  2LY7 A;  1K8O A;  1Y8O B;  2A6E C;  2SNS A;  4CJ2 C;  4IAL A;  3HG9 A;  4HCS A;  1AEX A;  3NUC A;  3KBG A;  1BNZ A;  2X69 A;  3RD4 A;  4ME5 A;  3NSW A;  2PZU A;  4PNY A;  4C3J B;  1A3T A;  2V4D A;  2EE1 A;  2X6L A;  1A2U A;  2NZ1 D;  3PUW A;  3S1R B;  3Q0A A;  1IL8 A;  4M1U B;  3HS0 C;  3WDN A;  1QB5 D;  2NTT A;  1BR9 A;  3GTL B;  4E6I A;  1B4O A;  2F03 A;  1JC7 A;  2WV6 D;  1U4M A;  4IFD I;  5C6A A;  4ZRZ A;  1WD0 A;  2M2L A;  4X3K A;  2JA7 B;  3T51 B;  1HTL D;  3R8B A;  2F0U A;  1Y1W B;  2CW0 C;  3SE0 A;  3NXW A;  2DNC A;  3HOZ B;  4HED A;  1STY A;  1RF2 D;  2XWJ B;  1SNC A;  1JQY D;  3C2P A;  1L0Y B;  2MGS A;  3M4O B;  3GTK B;  2ZXR A;  5KND A;  3KF8 A;  2K04 A;  1LTT D;  2B2U C;  3CRK C;  3K5O A;  5CV8 A;  4DA2 A;  2L11 A;  1D1I A;  1BQQ T;  4OO1 I;  2LFN A;  1F2M A;  2F0E A;  2K05 A;  2KQ3 A;  2K7V A;  1HQR D;  1C48 A;  3NTH A;  4XYO A;  2DN8 A;  2R6G A;  5FK9 C;  1IHZ A;  2F0V A;  1QIL A;  1GUG A;  2SNM A;  1D1K A;  4UDU C;  4OHJ A;  3DWQ A;  2K33 A;  4IUQ A;  1STH A;  2EYP A;  1CHP D;  4IN3 A;  2ZXP A;  2KEE A;  2Q8R E;  1SE2 A;  4TKO B;  2XNA C;  3J7A V;  4L8J A;  2EYO A;  1GOZ A;  1BF4 A;  3NQI A;  4FO2 A;  4RHR A;  2DY7 A;  1RTN A;  2MP1 A;  2EJG C;  1AFP A;  5IOD A;  2BDN A;  1JCK B;  3AMU A;  5HGT A;  4NDX A;  5E1F A;  3GTJ B;  1CQV A;  1LV9 A;  4C3I G;  3TBI B;  2OXP A;  1Y8N B;  1WTW A;  2F0M A;  5C3W A;  1BDO A;  3NPP A;  4QIW B;  3HOY B;  3GP7 A;  2KEC A;  4DAP A;  4KMU C;  5FKA C;  1ENC A;  3AU7 A;  3BG3 A;  1PTO B;  3QOL A;  4C3H G;  3EA6 A;  5JVG 3;  2MJ8 A;  3PO3 B;  4ULL A;  3Q23 A;  1C4Q A;  2E76 C;  4CBV A;  1RHP A;  5M5X B;  4WOR A;  3A56 A;  1D6E C;  1H9R A;  1SSO A;  2ENB A;  5M3M B;  4BA1 I;  3H0G B;  3GTM B;  5BN5 A;  1EQV A;  1DOL A;  4OIK A;  1PMR A;  3TME A;  1OXS C;  1DM0 B;  4ID6 A;  1Y8P B;  3PIO 3;  3HOV B;  3A7L A;  5CBE E;  1JE4 A;  3C46 A;  3J81 E;  2F0D A;  3QG1 A;  4NW2 A;  1PRT C;  1JOO A;  1Y69 U;  4RWS C;  4RH6 A;  1SMY C;  3NBH A;  5IGE A;  2JYO A;  3VR5 A;  1LT4 D;  3U9S A;  2KED A;  1D2B A;  1LAB A;  1ZYR D;  2RVL A;  3SVM A;  1EY6 A;  1W6K A;  2JE6 I;  2WKD A;  1AZQ A;  2NVY B;  2X6G A;  5D65 A;  2B2Y C;  3FVQ A;  2F0K A;  4G57 A;  5KNC A;  2B2T A;  1BBX C;  1A3V A;  1A3U A;  5G3L D;  2FMM A;  2I46 A;  1OXX K;  5IGF A;  2N88 A;  2JEB I;  5DAU A;  4QUC A;  5I9O A;  3NE5 B;  3A8K E;  3I72 A;  3CU7 A;  1MBY A;  1LTI D;  4BBR B;  1FD7 D;  2K32 A;  1PZI D;  3GTQ B;  1V43 A;  2A6E D;  4P2C B;  4HAE A;  1SNM A;  1I50 B;  1F9R A;  5K5P A;  4BA2 I;  2RKS A;  4BBS B;  3A8I E;  1SE3 A;  2B39 A;  1FR3 A;  1VMC A;  3WOE A;  3MXU A;  4DNT B;  1X3Q A;  4MIU A;  1PTO F;  2D2C C;  1DOM A;  4K8J A;  4KKS A;  2QF7 A;  1F9Q A;  1A6X A;  1BOS A;  3GV3 A;  5CV5 A;  2EOT A;  1IKL A;  1F2Z A;  2JXM B;  5IGD A;  1EU3 A;  4K2L A;  5AFW A;  1NUC A;  4CGY B;  1LT6 D;  1ET9 A;  3A54 A;  3N6R A;  2VXW A;  4RCN A;  3ND9 A;  1M8A A;  2EYH A;  5ELB A;  2A69 D;  2YU9 B;  2HUG A;  1S5C D;  2RDF A;  1S5F D;  1OXT A;  1O80 A;  4G7O C;  1WTV A;  3VR2 A;  3SK4 A;  1O7Y A;  4FNF A;  3MXP A;  1UNS A;  2Y0S B;  3I70 A;  2B2W C;  1SBB B;  1T5E A;  1E0B A;  3JAM L;  2EYL A;  2PO4 A;  5IT9 L;  5TSS A;  3IFT A;  3BYT B;  5LL6 S;  3RMH A;  5I2Y A;  1KLG D;  3A55 A;  4RGT A;  3EFX D;  2PNR C;  2R61 A;  4IQZ A;  1Q8I A;  5C0X J;  1XXG A;  1F9P A;  1Q3L A;  3J7Y W;  2F0Q A;  3K59 A;  1EWH A;  4DXF A;  3V2T A;  5M5Y B;  2KVM A;  3HOX B;  3BYY B;  3PIP 3;  3DWA A;  2F1M A;  4B08 A;  2E2D C;  3LNN A;  4RAU C;  1RKN A;  4FXD A;  3K5N A;  5IGC A;  1ONL A;  1MSH A;  3OW7 A;  1V1O A;  1CFM A;  1F77 A;  2AWN A;  4FF4 A;  3KK7 A;  1V1P B;  3W2D A;  4S3S A;  1BCP C;  1KDC A;  2QDB A;  4X3U A;  5BN3 A;  1U4P A;  2K1B A;  5FO7 B;  2F3W A;  2IJ0 A;  2NWG A;  3PUZ A;  1I4G A;  2RQX A;  3K7A B;  2FJ2 A;  5I6W A;  4F8M A;  3NTK A;  1R4Q B;  5C0X H;  4PV1 C;  1ILQ A;  2B63 B;  2K6A A;  4XQN A;  1II3 A;  4DXG A;  2CQA A;  1TVX A;  3GO5 A;  1LTS D;  1T5X D;  1PFN A;  1NCV A;  5CV7 A;  1Z47 A;  1QG7 A;  1I6H B;  1KLU D;  4R8I A;  5C44 B;  1F2L A;  2RSN A;  3KLS X;  2AWO A;  3VR3 A;  4ZKB B;  2Q8T A;  3MAQ A;  4KKU A;  2NB0 A;  1J9O A;  5D14 A;  3PUY A;  1TY0 A;  4IUV A;  5EJW A;  4Q0F A;  1JWU D;  4U68 A;  3TP7 A;  4R9W A;  4K14 A;  1SJH D;  4A3E B;  3C1E A;  3SHL A;  3M85 A;  2AUK A;  3MA2 B;  3RZD B;  2A68 D;  2F0G A;  3PO2 B;  4FXG C;  2IWH A;  1HA6 A;  4KK7 A;  2F0I A;  1WTX A;  1HHV A;  3A8J E;  3SK5 A;  2NVX B;  2JSO A;  2WP8 J;  3I73 A;  1TWA B;  2HCI A;  3T56 B;  3MHB A;  2PYK A;  5ELD A;  2K5W A;  5C4X B;  1LO5 D;  3BZD B;  1BUV T;  5M3F B;  2B2U A;  3TP8 A;  2C9O A;  3QO2 A;  1TWF B;  5JPN C;  5CV9 A;  5E4W C;  5A2Q L;  4A3K B;  1PTO D;  3S9W A;  3VA7 A;  4QCL A;  2Z4H A;  3DEP A;  3NTI A;  1EY5 A;  2F0L A;  1S5B D;  5K36 H;  1GUW A;  4ZKC B;  1CI3 M;  2K03 A;  1EFI D;  2A5H A;  1BXT A;  4OO1 H;  2EY2 A;  1EYA A;  1RTO A;  3L9A X;  4XIG S;  2O2L D;  2AQ2 B;  2EYF A;  4DFA A;  3Q6S A;  2R3Z A;  1I4R A;  1FGB D;  1EY7 A;  4IUR A;  4RGO S;  1PYW D;  1NR4 A;  5C4J B;  1DON A;  4XTC S;  5C3X A;  4FF3 A;  3V96 A;  3S17 B;  3KLR A;  1G91 A;  4XQJ A;  3IKJ A;  1AN8 A;  4HMJ A;  5COY A;  3PV0 A;  1SYB A;  2ZXO A;  2PZW A;  1DOK A;  4CKC A;  4QMG A;  2A6H C;  4KY7 A;  3O13 A;  4H0L C;  3QB3 A;  4ABN A;  3SDZ A;  3VR4 A;  3TDQ A;  2ID0 A;  3TZD A;  3HZX A;  3D8G A;  4RGM A;  3PUV A;  3ERO A;  4KN4 C;  1F2Y A;  5IGB A;  2BE5 D;  4C3I B;  1SDF A;  2EYJ A;  1SYC A;  3W3A A;  2KUM A;  5CC4 A;  5DNF A;  5JJZ A;  1KAA A;  3U9O A;  3VYR A;  1V8Q A;  3FEW X;  1VF7 A;  1R9T B;  2MPM A;  4B9W A;  1B44 D;  4C3H B;  5JVH 3;  2L0C A;  2L12 A;  1EU4 A;  3G6J B;  4RFB A;  4BS9 A;  2IX0 A;  1LTR D;  2NTS A;  2DY8 A;  2E2H B;  4JK1 C;  2JA5 B;  4G7H C;  2R93 B;  3I91 A;  1TWC B;  1PRT B;  1ROD A;  3DWP A;  2BA1 A;  1HFN A;  3D4D A;  3DHQ A;  4EVO A;  2EJF C;  1HUM A;  5KIX A;  3D6W A;  1YNJ C;  4K5V A;  1JR0 D;  3OIP A;  3S1M B;  1I4H A;  1VMP A;  3RUZ A;  2XSC A;  3L7Z C;  4RCO A;  2LKV A;  2FFK B;  1STA A;  1MI2 A;  3HGB A;  4V0B A;  4A3M B;  1EY4 A;  4DGZ A;  1OXU A;  1ET6 A;  4K6L A;  1I6V C;  2HQE A;  3CRL C;  2YYZ A;  1HQM C;  1B53 A;  1LLR D;  2ZT9 C;  4KHV A;  4XT1 B;  4X3S A;  5ELE A;  2B2Y A;  3MFY A;  1E2W A;  1PFB A;  1NR2 A;  4RGN A;  1M4V A;  1Q12 A;  4LK1 C;  5JEA G;  3BVG A;  3C1F A;  4KKT A;  3MXG A;  2JA8 B;  1R4P B;  5IGG A;  2DNE A;  1ILP A;  4LMQ D;  5FLX E;  1YNN D;  1HRJ A;  1EY8 A;  1HCZ A;  5CGK A;  5I6Y A;  1Y1V B;  5J39 A;  5CMD A;  5CYU A;  2NN6 H;  4ZYS A;  1H9K A;  4DAY A;  3M7G A;  3S16 B;  3HP3 A;  1CQF A;  1SJE D;  4EQO A;  3ERQ A;  4ZUI A;  2WAQ B;  5C4Z A;  1TT2 A;  5I4D A;  2BOS A;  2RDH A;  1RD9 D;  2D5D A;  2QCP X;  2IT1 A;  4FXK C;  4J6H A;  1O7Z A;  1FYC A;  3GQB A;  4N9P A;  4B9X A;  3I4N B;  2I07 B;  1D5X C;  3T4A C;  4GZY C;  1PXU A;  2K28 A;  4G7Z C;  5DEH A;  1EYD A;  4UAI A;  2G9H D;  2K01 A;  4IZ8 A;  1DZ1 A;  3SK6 A;  1O7L A;  1HA5 A;  1U4L A;  1LTA D;  2IW3 A;  2D62 A;  5LL6 X;  2HDM A;  4J8Q A;  1TS5 A;  5EKI A;  3ITP A;  1B9N A;  2ICI A;  5EBD A;  1DJR D;  3BDC A;  5EKK A;  1DYQ A;  3CHB D;  1UUP A;  1PRT F;  2OEO A;  3EVQ A;  3RZO B;  3OHX C;  5C0X G;  5EPJ A;  4AYB B;  3OWE B;  1FNU A;  2H4O A;  2NVQ B;  4KD4 A;  2B2W A;  2BDO A;  5T1G A;  4WFN 3;  3DUZ A;  3TN2 A;  1K83 B;  2WB1 B;  3H3V C;  3I4L A;  2E2J B;  4ILW A;  4DU9 A;  1SYE A;  2XN9 C;  1CZW A;  3D31 A;  3OSO A;  1ZKO A;  3FKI B;  3D4W A;  3WOF A;  3IL8 A;  5C3E B;  2CW0 D;  4TQU S;  2L5T A;  2SOB A;  2WKC A;  4NP5 A;  1SNP A;  4RKB A;  3PUX A;  3SK8 A;  3MVV A;  3ND8 A;  1SNO A;  1E2Z A;  1D5M C;  1GJX A;  5C5L A;  4XQQ A;  1BCP B;  5T1I A;  1EY9 A;  4A3J B;  3NBI A;  1SXT A;  2IX1 A;  3VA5 A;  1PTO H;  5KYL A;  4KY6 A;  3DMU A;  1AZP A;  1PLF A;  3K5L A;  2EY1 A;  1WTR A;  4A3F B;  2SEB D;  5D3I B;  2HDL A;  1EEF D;  2VNU D;  5EGT A;  1W6J A;  2CVR A;  3GTG B;  3RLF A;  2E2I B;  3FDT A;  4KN7 C;  4A3G B;  3X3N A;  2N55 A;  4NMZ A;  1EQT A;  3OPO A;  3T53 B;  4OL7 A;  2Z8L A;  2EZV A;  2WAC A;  2R92 B;  5CR3 A;  2IX3 A;  1CT1 D;  2F0H A;  3QIA A;  3SXH A;  1CA5 A;  4BWG B;  3MXN A;  1KAB A;  4I65 A;  5F2D A;  1F9S A;  5M5W B;  3OMC A;  2VB2 X;  1TS2 A;  1ENA A;  3G7L A;  4NKL A;  4ZAI A;  1RCV D;  2B2V C;  3S1N B;  3K57 A;  1V1P A;  2PQE A;  2SDF A;  4LAA A;  4H44 C;  3K58 A;  1WVL A;  4FF2 A;  2RBM A;  3J7A F;  3FRP B;  4CJ1 B;  3P1H A;  5FO8 B;  4OGQ C;  1TU2 B;  2EXZ A;  2KHS A;  1B50 A;  1QNK A;  3S1Q B;  2M9V A;  1IW7 C;  3H91 A;  5JOB A;  1EIG A;  4DK0 A;  1FNW A;  5ELF A;  4TRD A;  2B8G A;  3IAY A;  3T13 A;  4IFD J;  1TII D;  1TS4 A;  2F0O A;  4L6T B;  5J22 A;  2L55 A;  1J8I A;  1TWG B;  2BCO A;  5IIF A;  2KJX A;  3CKI B;  4DF7 A;  1AP0 A;  1IKM A;  3HKZ B;  2FIN B;  3TP6 A;  3SR1 A;  1STB A;  1S4Z A;  1ZYR C;  5E4X A;  3QWN A;  4C1N K;  2LMC B;  2C5C A;  3K0Y A;  1KNE A;  5C0X I;  1KDA A;  4CKB A;  2PCF B;  1H9M A;  4KD3 A;  3FPP A;  2RSO A;  1BCP F;  1B9M A;  5COR A;  4HN7 A;  3GV6 A;  4KY5 A;  4R8N A;  3OOC A;  1CZG A;  2IPK D;  2XVS A;  5M9O A;  1SND A;  1GHJ A;  1JOQ A;  3MEH A;  4F7X A;  2H1E A;  3BVZ A;  1STN A;  3E5S A;  4IUU A;  4IFD H;  1B3A A;  2JA6 B;  1U4R A;  2WIN B;  1WTP A;  5DM6 3;  3BS1 A;  1PRT D;  1PFM A;  1XWE A;  3N52 A;  2D9U A;  1SMY D;  3H94 A;  5KYI A;  1ESR A;  2Z1C A;  3VR6 A;  3OWF A;  4K8I A;  4J1M A;  1FNV A;  3ZYY X;  1GUS A;  4ZUJ A;  3J80 L;  1X32 A;  5EQ0 A;  1G29 1;  3K6O A;  1WCM B;  3E0J A;  1VF5 C;  3VYS A;  3E6Z X;  4PMB A;  2O4X A;  2Q8I B;  5A35 A;  3KLS A;  4K5W A;  2F0N A;  1O78 A;  3QOJ A;  3D6C A;  2KCC A;  3IFD A;  1IYU A;  3S2D B;  3S15 B;  3AB9 A;  3H6M A;  3EQL C;  1B1Z A;  1GUO A;  2JP1 A;  1ICW A;  3NWT A;  3PMF A;  2EY5 A;  4C1N I;  1ENF A;  1OO9 B;  4C3J G;  2EDG A;  5G3L F;  1H9S B;  2A69 C;  4QB4 A;  1BO0 A;  1VDZ A;  1CM9 A;  2XWB B;  1A2T A;  1G6Z A;  4Y7N B;  4HMI A;  1H9S A;  4ZK9 B;  5CV4 A;  5JPM C;  1GUT A;  4RKL A;  2O5J C;  4FP5 D;  1XX8 A;  5C4H A;  3HEJ A;  1CA6 A;  3Q24 A;  2E75 C;  1NAP A;  3R93 A;  2PPB C;  1LT5 D;  4XYQ A;  1Q90 A;  3NP8 A;  2NN6 G;  4DK1 A;  3VYU A;  4BY7 B;  2F4I A;  3NQT A;  3I3C A;  1K8M A;  5E3F A;  1Z7T A;  2WII B;  1D5Z C;  4DAV A;  2QEJ C;  4ZQ3 A;  1QCB D;  1TY2 A;  2EPB A;  4A3D B;  1EL0 A;  2G9D A;  4V19 0;  1HTP A;  5ELC A;  4C2M B;  3BVM A;  1SFO B;  1Q1E A;  5NUC A;  1EYC A;  2EYM A;  3M3Y B;  1G8Z D;  1KNA A;  2KOL A;  2L1B A;  2R7Z B;  2GA4 B;  5I9P A;  2OT2 A;  4KTA A;  5I2X A;  2XIW A;  1QWY A;  4H13 C;  4K2K A;  3R2I A;  4O42 A;  3MFG A;  2TMP A;  2AQ1 B;  4YIJ A;  2J4X A;  2QKI C;  1LT3 D;  3I4M B;  5IOC A;  2NUC A;  1SYF A;  3GD7 A;  3I90 A;  3CQZ B;  4KJO A;  1UEA B;  1JB3 A;  1I4P A;  4EQP A;  3R3O A;  3X3M A;  5JAV A;  4A3B B;  2F0J A;  1QOH A;  1CTM A;  3DM1 A;  1TKW B;  1EIH A;  2O5I C;  3ONA B;  1ZXT A;  2OF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...