2L4RA

Nmr solution structure of the n-terminal pas domain of herg
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
135
structure length
135
Chain Sequence
b'MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title NMR solution structure of the N-terminal domain of hERG and its interaction with the S4-S5 linker.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 19
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l4rA00
4WF0A 5J3WA 5HDDA 2OOLA 2V9AA 1S4RA 1D7EA 4YWZA 1MZUA 3LIFA 1G28A 3C2WA 5AVFA 2KDKA 4HH3A 5DJUA 4RQ9A 4H6JA 1T19A 3MQOA 5DKLA 5DKKA 4LRXC 3UB7A 1XJ4A 3IBRA 4MN6A 3HJKA 2J80A 4EQ1A 2PYRA 1S67L 4PKYG 2A24A 5HDCA 3A0SA 1XJ6A 4HJ3A 5J4EA 3ULFA 3NOPC 2W27A 4BBUA 3IS2A 3LYXA 1OT6A 3B33A 2YKFA 3PYPA 4EEUA 1OTEA 4GS9B 3F1NA 4WUJA 5HWTA 1N9OA 1LT0A 4WLAA 1OJ5A 1BYWA 2B02A 3C8CA 1TS6A 1UWNX 1UWPX 3OLOA 3GECA 3UB8A 2D01A 2OWHA 4HH2A 1NWZA 3LIEA 2INWA 2QHKA 1V9ZA 3F1OA 3NOTC 5HD5A 2VV6A 4JGRA 2WKRA 3CWFA 3MJQA 5HSQA 2QKPA 3K3CA 4I3AA 5AVEA 2CMNA 4DJ3A 4GHIA 3MQQA 1UGUA 3BY9A 2PR5A 1Y28A 3PHYA 4HY8A 1OTIA 5I5LA 4WL9A 5KIZA 2L1MA 2QJ7A 3LUQA 1TS0A 4HP4A 5IS1A 3RTYA 3H82A 1V9YA 3A0VA 4R3AA 2ZOIA 2VV8A 4HOIA 4L9EA 4LRYC 3H7WB 2PD7A 5TBMB 5A8BA 4HHDA 1GSVA 4F3LB 3GDIA 4GCZA 2YKHA 1ODVA 3H9WA 5F68A 2H28A 3F1PA 3LI9A 4I38A 4DJ2A 1S66L 1T1BA 1EW0A 2L0WA 2VLGA 2KX6A 3SW1A 1N9NA 3EEHA 1GSWA 2M1CA 2JN7A 4GW9A 5F69A 3NHQA 2D02A 1TS8A 3BWLA 3LICA 1OTAA 2PR6A 4H6JB 2I9VA 1F98A 4HNBA 4LRZE 3A0RA 4E04A 2ZBBA 4LLOB 2BASA 1T1AA 5IU1A 1OT9A 4NXGA 2A24B 2WKQA 1OTDA 3D72A 5EFWA 1XJ3A 1P0ZA 1KOUA 4LPZA 3E4QA 3FG8A 3IS2B 2VEAA 1S1YA 4I3IA 3F1NB 3NOUC 1JNUA 4XT2A 3RH8B 1XFQA 3LIDA 5DJTA 4M4XA 1LSWA 2OWJA 3MFXA 4MN5A 3BY8A 4EEPA 1S1ZA 4EETB 3NJAA 5G4ZA 4I3JA 3G6OA 5HD3A 3CAXA 2Z6CA 3EWKA 3HJIA 4HI4A 3F1OB 5F5YA 2W0NA 2QWSA 3ICYA 2GJ3A 3KX0X 2V1BA 1XFNA 2HV1A 4HP9A 3VE3A 4HIAA 1LSVA 4GHIB 4HQAA 4NXBA 1S4SA 3LI8A 4BBTA 1TS7A 1P97A 1X0OA 3VE4A 1LSXA 4JGOA 4I39A 2V0WA 2L4RA 3FC7A 3P7NA 2Z6DA 1T1CA 2PYPA 3UB9A 3CLOA 4GS9A 3T50A 3H82B 3MXQA 1DP8A 3MR0A 2V1AA 2K7SA 3UB6A 4KQDA 2ZOHA 4NXFA 3K3DA 4KUKA 3LIBA 4KUOA 3UE6A 2V0UA 1DP6A 3F1PB 2QJ5A 4L9FA 5J7EA 5HWWA 1OJGA 1WA9A 4WN5A 5G4YA 1F9IA 4HJ4A 2PDRA 2EA9A 5F6AA 3VOLA 1T18A 1LL8A 3E4OA 2WKPA 3UMEA 5HWVA 5HZHA 4EERA 4EXOA 2VV7A 4R6LA 4PKYA 2PD8A 1D06A 2P7JA 3E4PA 2PHYA 4B9OA 4I5SA 4EESA 2R78A 1XJ2A 4R70A 1VB6A 2JHEA 4K08A 4HJ6A 4L9GA 3H7WA 5TBMA 4BBVA 4JGQA 3UMDA 1GSXA 1N9LA 4F3LA 3ZQ5A 1OTBA 1DRMA 4JGPA 4R38A 4NXEA 3LIAA 4XT2B 1DP9A 5HDSA 4EW7A
chains in the Genus database with same CATH superfamily
3IXGA 1VETA 2O9BA 2WGIA 4RA7A 3ZDJA 5HDDA 3ZNYA 2JC7A 2V9AA 5KSCA 1S4RA 2ZC3B 4YWZA 3LIFA 1MWTA 2KDKA 3G4PA 5DFYA 4H6JA 2Y59A 2Z2MB 1GA0A 1YMXA 1BLPA 1PNEA 2GDNA 5HL1A 1JVJA 1W5DA 5DKKA 3BECA 3WS0A 3UB7A 3C30A 1E4DA 3HJKA 3S7QA 3RFBA 4O0PA 3M2JA 4MN7A 4DE3A 1FR6A 2A24A 4JF5A 3V3RA 3BLSA 2A2LA 2KOIA 1LLBA 2H10A 4S2PA 3WRTA 2ZL1A 2RL3A 2ZQAA 2DCFA 4CJNA 3ULFA 3NI9A 3MZFA 4NK3A 4KZBA 3PBSA 4IVKA 5E2GA 5EVEA 1N9OA 3JVUA 1LT0A 1MC0A 5K5BA 2ZC4B 4WLAA 1OJ5A 3C4PA 3CI6A 2Y2QA 4OLDA 2Y8HA 4Y3IA 3DTIA 3UB8A 1H5XA 4HH2A 3T4OA 2HJEA 3IWIA 2INWA 4KZAA 2QHKA 4X1MA 3HREA 3NOTC 1FIKA 3E2KA 3QP6A 3MJQA 4E3LA 2JKRI 3HUOA 5CGXA 3Q7VB 3K3CA 3FYZA 3KSIA 2Y2PA 4M3KA 2VKSA 4DJ3A 3LR3A 5EVLA 4GHIA 5FQJA 1UGUA 1W79A 3MXSA 1Y28A 5A91A 2WZZA 3PHYA 3LY4A 4NG2A 2GX5A 4BD0A 2QJ7A 1FR1A 2W1TB 3WWXA 4Y13A 2ZQ7A 3VFHA 5IS1A 3RTYA 3VP0A 2A3UA 5FQMA 2ZOIA 5EUAA 3WS2A 4MBFA 1PIOA 4YFMA 1TD5A 3NULA 2VV8A 3G31A 2EWWA 4S2MA 1Z6FA 5A8BA 3ZG7B 4CQHA 1I2WA 3A3FA 1XA7A 2ZQ9A 4PM9A 4OP5A 3MS6A 3P98A 5AQBA 1O07A 3W2ZA 3LI9A 1T1BA 2L0WA 1BULA 2LB9A 2WGWA 4JPMA 2KX6A 4Y0OA 3QP8A 4Y15A 2J3WA 3NHQA 1CF0A 3LICA 1OTAA 3OC2A 1IYQA 4OOYA 2FFFB 5FDHA 3LR0A 3A0RA 3OBFA 2ZBBA 4LLOB 3T1RA 3UDXA 1M6KA 1L2SA 1T1AA 5L2FA 1HD8A 2IWBA 5CEDA 5F1FA 5CGWA 4MEZA 2WUQA 1CEFA 4PPRA 1BLSA 1OTDA 3CUEC 3D72A 4X69A 3BRMA 2HDUA 2EFXA 4ESPA 2CC1A 2V8CA 3TSGA 3PBTA 3FG8A 4Y0TA 1S0WA 3QP1A 1S1YA 1TF1A 1MWUA 4QU3A 2O99A 2HGVA 2V2FF 1L0DA 1M40A 1MWSA 4U0TA 2XD5A 4WMCA 4OPZA 2OWJA 4MN5A 3O5YA 3VP3A 2ZC7A 3CHWP 3KSHA 4OQGA 1L0GA 3NJAA 2NUTC 3FV7A 4I3JA 3N8RA 4EWFA 3O86A 3CAXA 4OPQA 2Z6CA 3EWKA 2PT7A 3G30A 1YSPA 5GHXA 1ES4A 3PTEA 2WGVA 1AWIA 4R1GA 3A3DA 4OH0A 3ZNTA 3SS4A 2V1BA 1E25A 2HV1A 4CLCB 5GLBA 3UPNA 4RX2A 1LSVA 4IHQA 1XXMA 3LI8A 1P97A 5EV0A 2O9CA 4JXVA 1LSXA 3S7NA 4I39A 2V0WA 3P7NA 1CI8A 3MQ0A 4JF4A 3HLEA 3RJUA 1JTGA 3MR0A 2K7SA 2WKHA 3UB6A 1TEMA 2W3FA 1NY0A 1EI5A 2HJ9C 3LGOA 1ALQA 4WZ4A 5CXWA 1FILA 4YOFA 1PI5A 4C3QA 2ZMVA 4R4SA 3SS5A 2LB5A 4DMZA 5M1AA 1ES2A 5FI7A 2QZ6A 5FEGA 5HWWA 1YLWA 3RXXA 3G2YA 3CZDA 3Q7VA 1F9IA 3CPTB 2PDRA 1LHYA 1XKZA 1QMEA 2EA9A 1MBLA 3UNWA 5TGFA 2DNSA 1LL8A 5EECA 3W8KA 3UMEA 4PM6A 5CECA 4EBLA 3HLWA 5AJGA 2W1TA 1BLCA 4EXOA 2WADA 4R6LA 3S1YA 1W7FA 2PD8A 2P7JA 4Y0UA 2PHYA 1QMFA 4B9OA 4CLCC 4R70A 1VB6A 3IF5A 4P6BA 4L9GA 2XF3A 4JGQA 2BLSA 3UMDA 2ZM8A 1BLHA 2V20A 4FH4A 2Y2GA 3GV9A 1PWCA 1OTBA 2Y79A 5CX7A 4B93A 1XA1A 5HAIA 3HLCA 3ZGAB 2BG1A 3QNCA 3GMWA 3T4SA 4GB7A 4XT2B 3QP2A 3IXDA 4EW7A 4WF0A 2XQZA 4ME4A 3PBRA 3AGDA 2G2UA 2PBDP 4EQIA 3IWOA 2J9PA 3V50A 1K6RA 3T4KA 3WS5A 2XR0A 3W4PA 2OLVA 5EVIB 3FPVA 2HDSA 4QPRA 1GA9A 3Q81A 3S22A 3LO7A 4PKYG 1KVMA 3NDGA 4Q0HA 3IH8A 3CG5A 3CJMA 4S2JA 4UQIM 3JYIA 1XJ6A 4GN2A 4MNRA 1XP4A 1DY6A 4MLLA 4MMNA 3OPHA 2EXBA 2W27A 3E2LA 3KSFA 4BBUA 3LYXA 4G3VA 2V8FA 3B33A 1K0KA 1NZOA 2YKFA 3PYPA 4Y7PA 4EEUA 3NBLA 1SKOB 4GS9B 2JE5A 2UWXA 3Q07A 5F1GA 2M7VA 4CLCE 3IF6C 4R3JA 4S2KA 1PZOA 1K55A 2P74A 4ETXA 3MZDA 1BYWA 1LI9A 2C5WB 3D4FA 5FQQA 4WELA 5FI6A 5F82A 3C8CA 3C5AA 3U2AA 4D60A 5M18A 2ACGA 3VFFA 3LIEA 1YLJA 1V9ZA 3N8SA 5HD5A 2VA0A 3KYQA 4LV2A 3CWFA 4Y2FA 3T4LA 5HSQA 1Y4OA 2R9XA 3V3SA 4I3AA 3CMZA 5AVEA 4B4ZA 4OQIA 4CLCA 1IYOA 1W63M 2HF6A 3T4QA 3IX4A 2XEPA 4UQIS 5DF8A 1K4FA 4HY8A 3VV4A 5GLCA 5L10A 3IXBA 5EVIC 1TS0A 1KDWA 4RVAA 5KMWA 3B42A 1PFLA 3LFVA 5E2FA 4X68A 3A0VA 5CGSA 2W1RA 2K31A 4IUKA 1FCNA 2EWVA 3HUMA 3P01A 4E3MA 5CHUA 4F3LB 4RX3A 4GCZA 5FDSA 1OMEA 4KENB 1SDNA 5F68A 5FL3A 4O7DA 1L3LA 1MPLA 3JPUA 3T1XA 5HAQA 4MDZA 4KG2A 3PXPA 4F94A 5L07A 4QY6A 2VLGA 2J7VA 4OP8A 4Y5FA 3D9YA 3CPTA 3RXWA 3EEHA 4Z1WA 2JKFA 4PAUA 1H8YA 1W8QA 4WMCD 4WZ5A 2D02A 3VP4A 3O87A 3UDFA 1TS8A 2ZMFA 3BWLA 2G2WA 5DFXA 4QHCA 2I9VA 1RGYA 3TW8A 1SDEA 2VX8A 4R0QA 4H8RA 1ZTUA 3CITA 5FQ9A 5IU1A 3BFCA 3UY6A 1NYMA 4NXGA 4X25A 5GLAA 4EBNA 4A5RA 5FQKA 1CQAA 2O9AA 4LPZA 1SCWA 3T4JA 1BT5A 3DWKA 4II7A 1MKIA 2Y4AA 3SH8A 1TVFA 2MJ6A 4G3WA 4X56A 1FQGA 4S2LA 4XT2A 5DJTA 3W4OA 2EX2A 4KZ8A 1LSWA 3MFXA 3E0YA 1K54C 3BY8A 4EEPA 4DE0A 1K6SA 3MF0A 1IYSA 4EETB 3PR6A 5FAOA 2WKEA 5HAPA 1YPRA 1ES3A 1SHVA 3OPPA 3LEQA 3HJIA 2XROA 4KZ9A 2ZC5B 4PHTA 3C7VA 2JKTM 3L7HA 4NKPA 5EVIA 2W0NA 2QWSA 1YSQA 1KGFA 3UE0A 1KGEA 4BWIA 5C5KA 3VE3A 1TDGA 4BBTA 4K91A 3VMAA 3M2KA 1X0OA 4JGOA 4LENA 4JLFA 3ZG0A 3UB9A 4GS9A 1SKOA 5FEFA 3IWQA 5EOEA 3MXQA 2PU4A 2V1AA 4GOGA 1MY8A 1FOFA 1H0MA 1Z09A 3N6IA 2ZOHA 3K3DA 1BTLA 2C6WB 2ZJ9A 2JCHA 2VGJA 3LCEA 4JXGA 4MBKA 3KO6A 3LR5A 3VOYA 3PAEA 3EEAA 3F1PB 3IH9A 5M19A 3BFDA 1OJGA 2GNXA 3VOZA 4EU0A 3HCYA 2EX9A 2W3DA 2XDMA 2VJWA 4KZ7A 4BQMA 4HBTA 2HDRA 2EX6A 1FCOA 3OCLA 5FI2A 3HLGA 5GHZA 1JWVA 5A90A 5HZHA 5DF9A 3SS3A 5AQ9A 3MXRA 2VV7A 5TR7A 1I2SA 5IHVA 5TFQA 1G6OA 4GDBA 1D06A 2XD1A 3E4PA 5CERA 5DTTA 1IOUA 3C38A 2R78A 3BFGA 3SH7A 1K54A 4G3KA 1PYYA 1K38A 4BL3A 3NCKA 1N9LA 4F3LA 3P09A 2Q0OA 3ZQ5A 1NLZA 4XUXA 1DRMA 3TJZC 1I5QA 4R38A 4NXEA 5HDSA 3ITBA 4N1HA 5J3WA 3NDEA 1W63Q 4N92A 2OOLA 2QMIA 3IQAA 3NC8A 1MZUA 2HZ5A 1G28A 3C2WA 1GHMA 1RGZA 4HH3A 4ARZB 5DJUA 4RQ9A 4HBUA 2KLIA 4UHUA 3ZCZA 1T19A 5E2HA 1F5MA 1BUEA 4E3KA 4HESA 5DKLA 2W3HA 2PU2A 4LRXC 4S2OA 2P04A 3IBRA 4MN6A 1NRFA 2QPNA 2E8IA 3D3OA 2J80A 4EQ1A 1S67L 3MKEA 3BEBA 5L8MA 2ZC6B 1EROA 2IWCA 3KYZA 2XSSA 2E8JA 4CLCD 1VQQA 3A0SA 4HJ3A 3BYDA 2OAP1 3NOPC 2P9VB 3FKWA 2NUPC 3KSGA 4L0LA 3I7JA 5HWTA 3ZG5A 2ZLYA 5HPFA 2B02A 3CUEA 4IUHA 1TS6A 3V67A 2X02A 1YT4A 4N9KA 3GTCA 3GRJA 4ZDXA 1IEMA 5GL9A 5CHMA 4DE2A 1ONHA 3FPWA 2VV6A 2J3TD 4C6YA 3IF6B 1VHMA 3R4KA 2VGLM 2V1ZA 3IBJA 4ZJ2A 4E3JA 2Q9NA 4KZ5A 1E3UD 3M6BA 4LCLA 3BY9A 2PR5A 1W8YA 1WYCA 4U3TA 5CTMA 1OTIA 3EQUA 5I5LA 3LUQA 5JYOA 1ZC2A 3ZG8B 1K25A 3M6HA 4JKTA 4YNRA 1V9YA 4KZ6A 4R3AA 2IWDA 1ESUA 1ZHHB 4EUZA 3S7OA 4LFUA 4HOIA 4LV1A 3FZCA 4ZTKA 4LRYC 3H7WB 4OONA 1DJBA 4LGWA 3VP1A 3HVFA 1SKFA 3MMHA 2EXAA 3GDIA 2YKHA 1ODVA 2K2NA 1ERQA 1K57C 3HUNA 3F1PA 2O0YA 4KQRA 1H3QA 4I38A 4K0XA 1EW0A 3VP2A 1XGJA 3ZG9B 4WM9A 1N9NA 1GSWA 2W3EA 2VGLS 2X71A 4S2NC 4O01A 3R7WB 3HLBA 3ISGA 4GJ4A 2H0TA 2PR6A 3UE1A 3IHBA 4E04A 3AGFA 3WS4A 3DW0A 4BMWA 1DJAA 4X55A 1G68A 1JTDA 2P08A 1ERMA 1YMSA 5JYPA 4GKUA 5EVID 1RCJA 1YM1A 4PM5A 1YLZA 1XGIA 5DF7A 4KG6A 4FD8A 1P0ZA 4GDNA 4Q8IA 1KOUA 4X1LA 3PAGA 2AVXA 3S7PA 3OZHA 3GSGA 1L0EA 2XH9A 3IS2B 2VEAA 2OAQ1 4I3IA 1OPXA 1U60A 1P9RA 3SZTA 3F1NB 3RH8B 1XFQA 4QY5A 3LIDA 4EUVA 4JBFA 3IX8A 1KVLA 3OPLA 1H8ZA 4QD4A 3A3EA 4UA7A 1S1ZA 1FCMA 4Z9QA 4E6WA 3LEZA 5G4ZA 1GHIA 4ARZA 5DTSA 3G6OA 5HD3A 2B95A 1F2KA 3WRZA 3GQZA 4E3IA 3DTEA 3LY3A 5FA7A 1LL9A 3F1OB 4OPYA 5F5YA 4DXCA 2FH5A 1CJFA 5U47A 4YINA 1N4OA 1GCEA 3U4LP 3HL9A 4HP9A 3NECA 2Y2JA 4OLGA 4HIAA 2Y91A 4EBPA 1PRQA 3C7UA 4HQAA 1C3BA 4NXBA 1S4SA 3NY4A 1A0KA 2H5SA 1Q2PA 2FFYA 5CEBA 2P9VA 1K56A 3TG9A 2Z6DA 1T1CA 4DE1A 2PYPA 3N7WA 1PZPA 3FWLA 4ID4A 5E2EA 1K57A 4LV0A 3ZVWA 1BZAA 3H82B 2X01A 1E3UA 1L0FA 4FUWA 1NXYA 4KQDA 2XLNA 4KUKA 4UA9A 4ZJ1A 1NJ4A 2PRFA 1KE3A 4O8GA 4QB8A 4S2NA 2DMWA 2WZXA 1FSYA 3G2ZA 1DP6A 2Y2IA 5FAPA 4WYYA 2QJ5A 5FSRA 4U0XA 4L9FA 4ETZA 4E3OA 4OOMA 1WA9A 3IF6A 3UN7A 3IHAA 1STZA 2WAFA 1CK3A 3BW6A 3EGXC 2JBFA 1T18A 3E4OA 3PBOA 3G34A 5HWVA 5MC7A 1G5UA 1IYPA 3HLDA 5KZHA 2EFUA 2Y2LA 1YAXA 4EERA 4DXBA 3BQAA 2HPBA 2GZAA 3IT9A 3IXHA 1O7EA 4C75A 4PKYA 4NEED 1D1JA 4UEYA 1KE4A 2ZMAA 3E98A 4PMAA 3QHYA 1GHPA 1XJ2A 3SOIA 2JHEA 3S4XA 4WBGA 3H7WA 1YLTA 4BBVA 3T1QB 1H8MA 4JXWA 2HP6A 2OV5A 5BOHA 2ZQ8A 1CI9A 3EOIA 3OPRA 3TRCA 5KSHA 4LCMA 4DN0A 2Y2NA 4JGPA 1PWDA 1ES5A 3LIAA 1KDSA 1DP9A 1G6AA 4FTXA 3GVBA 2J9OA 2Y2MA 3PBQA 4B4XA 1RP5A 1HTZA 1TDLA 2ZM0A 1D7EA 5CHJA 3R7WA 4GLQA 5AVFA 3QP4A 2VK3A 4B88A 4OQ0A 2IA2A 3MQOA 2WYXA 3ZFZA 3OOVA 2VGKA 3OCNA 4MCWA 2HDQA 4IVIA 4OOLA 2Q9MA 5EM1A 5A93A 1EWZA 1XJ4A 5I94A 2Y2OA 3HBRA 2PYRA 3LR4A 3A3JA 5AQ7A 5HDCA 1YQSA 3Q7ZA 3ZYTA 5J4EA 3MFDA 4AFIA 3C4OA 3IS2A 3BQ8A 3UO9A 1OT6A 4X6TA 1NLYA 5FASA 1LL5A 1OTEA 3F1NA 1S6RA 5FQIA 4WUJA 3UPPA 1YLYA 3UDIA 4QWOA 4OKPA 4OVDA 4ZAMA 4N1XA 5FAQA 5HL6A 1IELA 1ZKJA 4PM8A 2ZD8A 1UWNX 3QNBA 3BM6A 1UWPX 3OLOA 3T1SA 1N9BA 3GECA 4R4RA 2D01A 4IJGA 2G7UA 5LBRA 2OWHA 3G35A 1NWZA 5L09A 3F1OA 4JGRA 5FATA 3SH9A 2WKRA 5EE8A 4ZJ3A 2A49A 2QKPA 2R9WA 4QJGA 4BENA 2CMNA 3N8LA 4KG5A 1Q2QA 1HLUP 4GD8A 4DDSA 3MQQA 2JKRM 5J8XA 1VEUB 2OLUA 4E3NA 2I72A 2XA7M 1HZOA 4D2OA 5CRFA 4OQHA 4WL9A 5KIZA 2L1MA 3T4TA 3K2NA 2HP5A 3L9KA 4HP4A 3WS1A 3W4QA 3H82A 2ZQDA 2QYBA 4KZ3A 1IKGA 1NRJA 5IT5A 3BJNA 4L9EA 1P9WA 2PD7A 5TBMB 3KYEA 2PBYA 4HHDA 3TOIA 4KZ4A 2XRNA 4BL2A 1GSVA 4DF6A 1YLPA 5AQAA 3H9WA 3FKVA 3MZEA 2B18A 2H28A 1WYBA 1VM1A 4KQOA 4FCFA 2Y2KA 4DJ2A 1S66L 4XUZA 1MXOA 3SW1A 4LV3A 2M1CA 1AXBA 5HFOA 3O3VA 1VETB 4FH2A 4WEJA 2BTFP 5HX9A 4JXSA 3VSLA 2JN7A 4GW9A 5F69A 1J3WA 4GZBA 4X53A 4GD6A 4Q0JA 4H6JB 2ZQCA 1F98A 2W3GA 2ZM2A 4HNBA 4LRZE 2XA7S 3O88A 2PAVP 1DJCA 2BASA 5E43A 3Q82A 3T12B 4DKIA 2XFTA 4P85A 3V39A 1OT9A 1HVBA 2VZWA 5DTKA 3DAVA 1K55C 4S2IA 3ZVTA 2A24B 2WKQA 5EFWA 1XJ3A 2EX8A 4IBRA 5HW3A 2ZL1B 4BJPA 2Y55A 3E4QA 1IKIA 3QP5A 4P6ZM 2XK1A 1K56D 3JVVA 4MBHA 4HEFA 4RYEA 4DDYA 3NOUC 1JNUA 1MWRA 5A92A 4M4XA 4IEDA 2M7UA 2H0YA 2OSUA 4GNUA 4Y17A 2JKGA 3B3XA 1K4EA 3DTMA 1NYYA 4K0WA 4IBXA 4HI4A 5GLDA 1YKDA 4FSFA 3IX3A 2RCXA 3DTKA 2WAEA 3ICYA 2GJ3A 2WKIA 5EM0A 1KE0A 3KX0X 2UV0E 3ITAA 1WE4A 3GR2A 5GHYA 1PWGA 4JF6A 1MKMA 1XFNA 2FZ0A 1FSWA 4Q0IA 4GHIB 4ZBEA 3Q1FA 1TS7A 2Y2HA 3VE4A 3FC7A 2L4RA 3AGEA 5G18A 4CPKA 4R3BA 1IFQA 2J3TC 4ZRRA 1CEGA 3CLOA 1XPBA 3T50A 4P6ZS 5DVAA 5HPIA 1DP8A 3MBZA 3V5MA 4NXFA 1BSGA 3UE3A 3HLFA 5EOOA 5F83A 4E6XA 1NZUA 4WZ5C 3UB5P 3LIBA 2Z2LB 3G32A 3ZHHA 1ACFA 4KUOA 3UE6A 2V0UA 5EPHA 1XX2A 4UA6A 4P87A 4WEKA 4PM7A 5J7EA 3EGDC 3A3IA 4FOFA 4OPRA 3TE8A 4WN5A 1ZG4A 4N9LA 5G4YA 3EQVA 2WGWB 3VSKA 4HJ4A 2HP9A 1ZG6A 5F6AA 2DRWA 3VOLA 1VEUA 1SZVA 4BLMA 3MKFA 2WKPA 2XFSA 4BD1A 2WK0A 1PW8A 1J9MA 3NIAA 4NETA 3B47A 3BLMA 3DWZA 5D3OA 5CTNA 1ONGA 4KQQA 4R23A 5HARA 1Y54A 4I5SA 3N4IA 1PI4A 4EESA 5TJJA 3UPOA 4XXRA 4K08A 3BFEA 4HJ6A 2JKTI 5TBMA 2XGNA 4EV4A 3DBAA 4UAAA 1GSXA 2B5RA 1ESIA 1JWZA 3PBNA 3BFFA 3MSHA 1LI0A 4P0MA 4DRTA 1JWPA 2J8YA 1PW1A 1KGGA
chains in the Genus database with same CATH topology
4WF0A 3PBQA 4ME4A 2O9BA 3PBRA 5J3WA 1W63Q 5HDDA 2OOLA 2V9AA 1S4RA 1D7EA 4YWZA 1MZUA 3R7WA 3LIFA 4GLQA 1G28A 3C2WA 5AVFA 2KDKA 4HH3A 4ARZB 5DJUA 4RQ9A 5DFYA 4H6JA 2KLIA 1T19A 2IA2A 3MQOA 3T4KA 1F5MA 3OOVA 3OCNA 4MCWA 4OOLA 5DKLA 2W3HA 5DKKA 3FPVA 4LRXC 3C30A 3UB7A 1XJ4A 2P04A 3IBRA 4QPRA 4MN6A 3HJKA 3D3OA 3S7QA 3RFBA 2J80A 4O0PA 4MN7A 4EQ1A 2PYRA 1S67L 4PKYG 2A24A 3LR4A 5L8MA 2A2LA 2KOIA 4Q0HA 5HDCA 3KYZA 2XSSA 4CLCD 4UQIM 3A0SA 1XJ6A 4HJ3A 3ZYTA 5J4EA 3ULFA 2OAP1 4MMNA 4AFIA 3NOPC 2W27A 3KSFA 4BBUA 2NUPC 3IS2A 3LYXA 3BQ8A 3PBSA 4G3VA 3KSGA 1OT6A 3B33A 2YKFA 4L0LA 1NLYA 3PYPA 4EEUA 1OTEA 4GS9B 3F1NA 4WUJA 5HWTA 2M7VA 4CLCE 1N9OA 3JVUA 1LT0A 1MC0A 5K5BA 4ETXA 4WLAA 1OJ5A 5HPFA 1BYWA 2B02A 3CUEA 5HL6A 4IUHA 3CI6A 4WELA 3C8CA 1TS6A 1UWNX 3V67A 1UWPX 3U2AA 3OLOA 2Y8HA 4Y3IA 3GECA 3UB8A 2D01A 4IJGA 2G7UA 5LBRA 2OWHA 4HH2A 1NWZA 3LIEA 3T4OA 2HJEA 2INWA 2QHKA 1V9ZA 3F1OA 3NOTC 5HD5A 2VA0A 3FPWA 2VV6A 2J3TD 3KYQA 4JGRA 2WKRA 3CWFA 4Y2FA 3T4LA 3MJQA 1VHMA 5HSQA 3R4KA 2JKRI 2QKPA 3K3CA 2VGLM 4I3AA 3IBJA 3KSIA 2VKSA 5AVEA 2CMNA 4DJ3A 3LR3A 4CLCA 4GHIA 3MQQA 2JKRM 1W63M 1UGUA 2HF6A 3BY9A 3T4QA 2PR5A 2XA7M 4UQIS 1Y28A 3PHYA 4HY8A 3VV4A 2GX5A 1OTIA 3EQUA 5I5LA 4WL9A 5KIZA 2L1MA 2QJ7A 3T4TA 2W1TB 3LUQA 3K2NA 1TS0A 4HP4A 5IS1A 3RTYA 3H82A 3B42A 3LFVA 2QYBA 4YNRA 1V9YA 3A0VA 1NRJA 4R3AA 2ZOIA 2W1RA 1ZHHB 5IT5A 3S7OA 1TD5A 2VV8A 3BJNA 4HOIA 2K31A 2EWWA 4L9EA 4IUKA 4LRYC 1P9WA 3H7WB 2PD7A 5TBMB 2EWVA 5A8BA 4HHDA 4CQHA 2XRNA 3P01A 3MMHA 1GSVA 4F3LB 3GDIA 4GCZA 2YKHA 1ODVA 2K2NA 3H9WA 5F68A 5FL3A 2B18A 2H28A 2O0YA 3F1PA 4KQOA 4MDZA 3W2ZA 3LI9A 1H3QA 3PXPA 4I38A 4DJ2A 1S66L 1T1BA 1EW0A 2L0WA 2VLGA 2LB9A 4Y5FA 2KX6A 3SW1A 1N9NA 3EEHA 1GSWA 2M1CA 2W3EA 4WEJA 4Z1WA 2VGLS 2J3WA 4PAUA 2JN7A 4GW9A 4O01A 3NHQA 2D02A 5F69A 1TS8A 3R7WB 2ZMFA 3BWLA 4Q0JA 4GJ4A 3LICA 1OTAA 3OC2A 5DFXA 2PR6A 4H6JB 2I9VA 1F98A 2W3GA 4HNBA 4LRZE 2XA7S 3A0RA 3LR0A 3OBFA 4E04A 3TW8A 2ZBBA 4BMWA 2VX8A 4LLOB 2BASA 1T1AA 1ZTUA 2P08A 3CITA 5IU1A 1OT9A 2VZWA 4NXGA 2A24B 2WKQA 1OTDA 3CUEC 3D72A 1XJ3A 5EFWA 1P0ZA 1KOUA 4BJPA 2O9AA 4LPZA 3T4JA 3E4QA 3S7PA 4II7A 3PBTA 3FG8A 3IS2B 2VEAA 2OAQ1 1S1YA 4I3IA 1TF1A 2MJ6A 4P6ZM 4G3WA 2O99A 2HGVA 3JVVA 1OPXA 1P9RA 3F1NB 3NOUC 1JNUA 4XT2A 3RH8B 1XFQA 3LIDA 5DJTA 4EUVA 4M4XA 2M7UA 1LSWA 2OWJA 3E0YA 3MFXA 3O5YA 3BY8A 4MN5A 4EEPA 1S1ZA 3KSHA 3MF0A 4EETB 3NJAA 3PR6A 5G4ZA 2NUTC 4I3JA 4ARZA 3G6OA 5HD3A 3CAXA 2Z6CA 3EWKA 2PT7A 1YSPA 3HJIA 4HI4A 2XROA 1YKDA 4FSFA 4PHTA 3F1OB 2JKTM 5F5YA 4NKPA 2W0NA 2QWSA 3ICYA 2GJ3A 2FH5A 3KX0X 1YSQA 4BWIA 5C5KA 2V1BA 1MKMA 1XFNA 2HV1A 2FZ0A 4HP9A 4CLCB 3VE3A 4HIAA 4Q0IA 1LSVA 4GHIB 4IHQA 4HQAA 4NXBA 1S4SA 3LI8A 4BBTA 1TS7A 1P97A 1X0OA 2O9CA 3VE4A 1LSXA 4JGOA 3S7NA 4I39A 2V0WA 2L4RA 3FC7A 3P7NA 2Z6DA 1T1CA 2PYPA 3MQ0A 1IFQA 2J3TC 4ZRRA 3UB9A 3CLOA 4GS9A 3T50A 4P6ZS 3H82B 3MXQA 5HPIA 1DP8A 3MR0A 2V1AA 2K7SA 3UB6A 2W3FA 4KQDA 2ZOHA 4NXFA 3K3DA 2HJ9C 3UE3A 4KUKA 3LIBA 4YOFA 4O8GA 3KO6A 2DMWA 3LR5A 4KUOA 3UE6A 2ZMVA 2V0UA 1DP6A 2LB5A 4DMZA 3EEAA 3F1PB 2QJ5A 4WEKA 4L9FA 4ETZA 5J7EA 3EGDC 5HWWA 4FOFA 1OJGA 2GNXA 3TE8A 4OOMA 1WA9A 4WN5A 4EU0A 5G4YA 3HCYA 3EQVA 1STZA 1F9IA 4HJ4A 2W3DA 2PDRA 2VJWA 3BW6A 3EGXC 2EA9A 5F6AA 3VOLA 1T18A 1LL8A 3E4OA 3PBOA 2WKPA 3UMEA 5HWVA 5MC7A 3OCLA 1YAXA 5HZHA 5AJGA 3B47A 5DF9A 2W1TA 4EERA 3BQAA 4EXOA 2GZAA 2VV7A 4R6LA 1G6OA 4PKYA 2PD8A 1D06A 4NEED 2P7JA 3E4PA 4UEYA 2PHYA 3E98A 1IOUA 4B9OA 3C38A 4CLCC 4I5SA 4EESA 2R78A 5TJJA 1XJ2A 4R70A 1VB6A 2JHEA 4K08A 4HJ6A 4L9GA 3H7WA 2JKTI 5TBMA 4BBVA 3DBAA 4G3KA 4JGQA 3UMDA 1GSXA 1H8MA 1N9LA 4F3LA 3PBNA 3ZQ5A 1OTBA 1NLZA 2Y79A 5CX7A 4B93A 3EOIA 3TRCA 1DRMA 5KSHA 4DN0A 3TJZC 4JGPA 4R38A 4NXEA 3T4SA 3LIAA 4XT2B 1DP9A 5HDSA 4EW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF0 A;  5J3W A;  5HDD A;  2OOL A;  2V9A A;  1S4R A;  1D7E A;  4YWZ A;  1MZU A;  3LIF A;  1G28 A;  3C2W A;  5AVF A;  2KDK A;  4HH3 A;  5DJU A;  4RQ9 A;  4H6J A;  1T19 A;  3MQO A;  5DKL A;  5DKK A;  4LRX C;  3UB7 A;  1XJ4 A;  3IBR A;  4MN6 A;  3HJK A;  2J80 A;  4EQ1 A;  2PYR A;  1S67 L;  4PKY G;  2A24 A;  5HDC A;  3A0S A;  1XJ6 A;  4HJ3 A;  5J4E A;  3ULF A;  3NOP C;  2W27 A;  4BBU A;  3IS2 A;  3LYX A;  1OT6 A;  3B33 A;  2YKF A;  3PYP A;  4EEU A;  1OTE A;  4GS9 B;  3F1N A;  4WUJ A;  5HWT A;  1N9O A;  1LT0 A;  4WLA A;  1OJ5 A;  1BYW A;  2B02 A;  3C8C A;  1TS6 A;  1UWN X;  1UWP X;  3OLO A;  3GEC A;  3UB8 A;  2D01 A;  2OWH A;  4HH2 A;  1NWZ A;  3LIE A;  2INW A;  2QHK A;  1V9Z A;  3F1O A;  3NOT C;  5HD5 A;  2VV6 A;  4JGR A;  2WKR A;  3CWF A;  3MJQ A;  5HSQ A;  2QKP A;  3K3C A;  4I3A A;  5AVE A;  2CMN A;  4DJ3 A;  4GHI A;  3MQQ A;  1UGU A;  3BY9 A;  2PR5 A;  1Y28 A;  3PHY A;  4HY8 A;  1OTI A;  5I5L A;  4WL9 A;  5KIZ A;  2L1M A;  2QJ7 A;  3LUQ A;  1TS0 A;  4HP4 A;  5IS1 A;  3RTY A;  3H82 A;  1V9Y A;  3A0V A;  4R3A A;  2ZOI A;  2VV8 A;  4HOI A;  4L9E A;  4LRY C;  3H7W B;  2PD7 A;  5TBM B;  5A8B A;  4HHD A;  1GSV A;  4F3L B;  3GDI A;  4GCZ A;  2YKH A;  1ODV A;  3H9W A;  5F68 A;  2H28 A;  3F1P A;  3LI9 A;  4I38 A;  4DJ2 A;  1S66 L;  1T1B A;  1EW0 A;  2L0W A;  2VLG A;  2KX6 A;  3SW1 A;  1N9N A;  3EEH A;  1GSW A;  2M1C A;  2JN7 A;  4GW9 A;  5F69 A;  3NHQ A;  2D02 A;  1TS8 A;  3BWL A;  3LIC A;  1OTA A;  2PR6 A;  4H6J B;  2I9V A;  1F98 A;  4HNB A;  4LRZ E;  3A0R A;  4E04 A;  2ZBB A;  4LLO B;  2BAS A;  1T1A A;  5IU1 A;  1OT9 A;  4NXG A;  2A24 B;  2WKQ A;  1OTD A;  3D72 A;  5EFW A;  1XJ3 A;  1P0Z A;  1KOU A;  4LPZ A;  3E4Q A;  3FG8 A;  3IS2 B;  2VEA A;  1S1Y A;  4I3I A;  3F1N B;  3NOU C;  1JNU A;  4XT2 A;  3RH8 B;  1XFQ A;  3LID A;  5DJT A;  4M4X A;  1LSW A;  2OWJ A;  3MFX A;  4MN5 A;  3BY8 A;  4EEP A;  1S1Z A;  4EET B;  3NJA A;  5G4Z A;  4I3J A;  3G6O A;  5HD3 A;  3CAX A;  2Z6C A;  3EWK A;  3HJI A;  4HI4 A;  3F1O B;  5F5Y A;  2W0N A;  2QWS A;  3ICY A;  2GJ3 A;  3KX0 X;  2V1B A;  1XFN A;  2HV1 A;  4HP9 A;  3VE3 A;  4HIA A;  1LSV A;  4GHI B;  4HQA A;  4NXB A;  1S4S A;  3LI8 A;  4BBT A;  1TS7 A;  1P97 A;  1X0O A;  3VE4 A;  1LSX A;  4JGO A;  4I39 A;  2V0W A;  2L4R A;  3FC7 A;  3P7N A;  2Z6D A;  1T1C A;  2PYP A;  3UB9 A;  3CLO A;  4GS9 A;  3T50 A;  3H82 B;  3MXQ A;  1DP8 A;  3MR0 A;  2V1A A;  2K7S A;  3UB6 A;  4KQD A;  2ZOH A;  4NXF A;  3K3D A;  4KUK A;  3LIB A;  4KUO A;  3UE6 A;  2V0U A;  1DP6 A;  3F1P B;  2QJ5 A;  4L9F A;  5J7E A;  5HWW A;  1OJG A;  1WA9 A;  4WN5 A;  5G4Y A;  1F9I A;  4HJ4 A;  2PDR A;  2EA9 A;  5F6A A;  3VOL A;  1T18 A;  1LL8 A;  3E4O A;  2WKP A;  3UME A;  5HWV A;  5HZH A;  4EER A;  4EXO A;  2VV7 A;  4R6L A;  4PKY A;  2PD8 A;  1D06 A;  2P7J A;  3E4P A;  2PHY A;  4B9O A;  4I5S A;  4EES A;  2R78 A;  1XJ2 A;  4R70 A;  1VB6 A;  2JHE A;  4K08 A;  4HJ6 A;  4L9G A;  3H7W A;  5TBM A;  4BBV A;  4JGQ A;  3UMD A;  1GSX A;  1N9L A;  4F3L A;  3ZQ5 A;  1OTB A;  1DRM A;  4JGP A;  4R38 A;  4NXE A;  3LIA A;  4XT2 B;  1DP9 A;  5HDS A;  4EW7 A; 
#chains in the Genus database with same CATH topology
 3IXG A;  1VET A;  2O9B A;  2WGI A;  4RA7 A;  3ZDJ A;  5HDD A;  3ZNY A;  2JC7 A;  2V9A A;  5KSC A;  1S4R A;  2ZC3 B;  4YWZ A;  3LIF A;  1MWT A;  2KDK A;  3G4P A;  5DFY A;  4H6J A;  2Y59 A;  2Z2M B;  1GA0 A;  1YMX A;  1BLP A;  1PNE A;  2GDN A;  5HL1 A;  1JVJ A;  1W5D A;  5DKK A;  3BEC A;  3WS0 A;  3UB7 A;  3C30 A;  1E4D A;  3HJK A;  3S7Q A;  3RFB A;  4O0P A;  3M2J A;  4MN7 A;  4DE3 A;  1FR6 A;  2A24 A;  4JF5 A;  3V3R A;  3BLS A;  2A2L A;  2KOI A;  1LLB A;  2H10 A;  4S2P A;  3WRT A;  2ZL1 A;  2RL3 A;  2ZQA A;  2DCF A;  4CJN A;  3ULF A;  3NI9 A;  3MZF A;  4NK3 A;  4KZB A;  3PBS A;  4IVK A;  5E2G A;  5EVE A;  1N9O A;  3JVU A;  1LT0 A;  1MC0 A;  5K5B A;  2ZC4 B;  4WLA A;  1OJ5 A;  3C4P A;  3CI6 A;  2Y2Q A;  4OLD A;  2Y8H A;  4Y3I A;  3DTI A;  3UB8 A;  1H5X A;  4HH2 A;  3T4O A;  2HJE A;  3IWI A;  2INW A;  4KZA A;  2QHK A;  4X1M A;  3HRE A;  3NOT C;  1FIK A;  3E2K A;  3QP6 A;  3MJQ A;  4E3L A;  2JKR I;  3HUO A;  5CGX A;  3Q7V B;  3K3C A;  3FYZ A;  3KSI A;  2Y2P A;  4M3K A;  2VKS A;  4DJ3 A;  3LR3 A;  5EVL A;  4GHI A;  5FQJ A;  1UGU A;  1W79 A;  3MXS A;  1Y28 A;  5A91 A;  2WZZ A;  3PHY A;  3LY4 A;  4NG2 A;  2GX5 A;  4BD0 A;  2QJ7 A;  1FR1 A;  2W1T B;  3WWX A;  4Y13 A;  2ZQ7 A;  3VFH A;  5IS1 A;  3RTY A;  3VP0 A;  2A3U A;  5FQM A;  2ZOI A;  5EUA A;  3WS2 A;  4MBF A;  1PIO A;  4YFM A;  1TD5 A;  3NUL A;  2VV8 A;  3G31 A;  2EWW A;  4S2M A;  1Z6F A;  5A8B A;  3ZG7 B;  4CQH A;  1I2W A;  3A3F A;  1XA7 A;  2ZQ9 A;  4PM9 A;  4OP5 A;  3MS6 A;  3P98 A;  5AQB A;  1O07 A;  3W2Z A;  3LI9 A;  1T1B A;  2L0W A;  1BUL A;  2LB9 A;  2WGW A;  4JPM A;  2KX6 A;  4Y0O A;  3QP8 A;  4Y15 A;  2J3W A;  3NHQ A;  1CF0 A;  3LIC A;  1OTA A;  3OC2 A;  1IYQ A;  4OOY A;  2FFF B;  5FDH A;  3LR0 A;  3A0R A;  3OBF A;  2ZBB A;  4LLO B;  3T1R A;  3UDX A;  1M6K A;  1L2S A;  1T1A A;  5L2F A;  1HD8 A;  2IWB A;  5CED A;  5F1F A;  5CGW A;  4MEZ A;  2WUQ A;  1CEF A;  4PPR A;  1BLS A;  1OTD A;  3CUE C;  3D72 A;  4X69 A;  3BRM A;  2HDU A;  2EFX A;  4ESP A;  2CC1 A;  2V8C A;  3TSG A;  3PBT A;  3FG8 A;  4Y0T A;  1S0W A;  3QP1 A;  1S1Y A;  1TF1 A;  1MWU A;  4QU3 A;  2O99 A;  2HGV A;  2V2F F;  1L0D A;  1M40 A;  1MWS A;  4U0T A;  2XD5 A;  4WMC A;  4OPZ A;  2OWJ A;  4MN5 A;  3O5Y A;  3VP3 A;  2ZC7 A;  3CHW P;  3KSH A;  4OQG A;  1L0G A;  3NJA A;  2NUT C;  3FV7 A;  4I3J A;  3N8R A;  4EWF A;  3O86 A;  3CAX A;  4OPQ A;  2Z6C A;  3EWK A;  2PT7 A;  3G30 A;  1YSP A;  5GHX A;  1ES4 A;  3PTE A;  2WGV A;  1AWI A;  4R1G A;  3A3D A;  4OH0 A;  3ZNT A;  3SS4 A;  2V1B A;  1E25 A;  2HV1 A;  4CLC B;  5GLB A;  3UPN A;  4RX2 A;  1LSV A;  4IHQ A;  1XXM A;  3LI8 A;  1P97 A;  5EV0 A;  2O9C A;  4JXV A;  1LSX A;  3S7N A;  4I39 A;  2V0W A;  3P7N A;  1CI8 A;  3MQ0 A;  4JF4 A;  3HLE A;  3RJU A;  1JTG A;  3MR0 A;  2K7S A;  2WKH A;  3UB6 A;  1TEM A;  2W3F A;  1NY0 A;  1EI5 A;  2HJ9 C;  3LGO A;  1ALQ A;  4WZ4 A;  5CXW A;  1FIL A;  4YOF A;  1PI5 A;  4C3Q A;  2ZMV A;  4R4S A;  3SS5 A;  2LB5 A;  4DMZ A;  5M1A A;  1ES2 A;  5FI7 A;  2QZ6 A;  5FEG A;  5HWW A;  1YLW A;  3RXX A;  3G2Y A;  3CZD A;  3Q7V A;  1F9I A;  3CPT B;  2PDR A;  1LHY A;  1XKZ A;  1QME A;  2EA9 A;  1MBL A;  3UNW A;  5TGF A;  2DNS A;  1LL8 A;  5EEC A;  3W8K A;  3UME A;  4PM6 A;  5CEC A;  4EBL A;  3HLW A;  5AJG A;  2W1T A;  1BLC A;  4EXO A;  2WAD A;  4R6L A;  3S1Y A;  1W7F A;  2PD8 A;  2P7J A;  4Y0U A;  2PHY A;  1QMF A;  4B9O A;  4CLC C;  4R70 A;  1VB6 A;  3IF5 A;  4P6B A;  4L9G A;  2XF3 A;  4JGQ A;  2BLS A;  3UMD A;  2ZM8 A;  1BLH A;  2V20 A;  4FH4 A;  2Y2G A;  3GV9 A;  1PWC A;  1OTB A;  2Y79 A;  5CX7 A;  4B93 A;  1XA1 A;  5HAI A;  3HLC A;  3ZGA B;  2BG1 A;  3QNC A;  3GMW A;  3T4S A;  4GB7 A;  4XT2 B;  3QP2 A;  3IXD A;  4EW7 A;  4WF0 A;  2XQZ A;  4ME4 A;  3PBR A;  3AGD A;  2G2U A;  2PBD P;  4EQI A;  3IWO A;  2J9P A;  3V50 A;  1K6R A;  3T4K A;  3WS5 A;  2XR0 A;  3W4P A;  2OLV A;  5EVI B;  3FPV A;  2HDS A;  4QPR A;  1GA9 A;  3Q81 A;  3S22 A;  3LO7 A;  4PKY G;  1KVM A;  3NDG A;  4Q0H A;  3IH8 A;  3CG5 A;  3CJM A;  4S2J A;  4UQI M;  3JYI A;  1XJ6 A;  4GN2 A;  4MNR A;  1XP4 A;  1DY6 A;  4MLL A;  4MMN A;  3OPH A;  2EXB A;  2W27 A;  3E2L A;  3KSF A;  4BBU A;  3LYX A;  4G3V A;  2V8F A;  3B33 A;  1K0K A;  1NZO A;  2YKF A;  3PYP A;  4Y7P A;  4EEU A;  3NBL A;  1SKO B;  4GS9 B;  2JE5 A;  2UWX A;  3Q07 A;  5F1G A;  2M7V A;  4CLC E;  3IF6 C;  4R3J A;  4S2K A;  1PZO A;  1K55 A;  2P74 A;  4ETX A;  3MZD A;  1BYW A;  1LI9 A;  2C5W B;  3D4F A;  5FQQ A;  4WEL A;  5FI6 A;  5F82 A;  3C8C A;  3C5A A;  3U2A A;  4D60 A;  5M18 A;  2ACG A;  3VFF A;  3LIE A;  1YLJ A;  1V9Z A;  3N8S A;  5HD5 A;  2VA0 A;  3KYQ A;  4LV2 A;  3CWF A;  4Y2F A;  3T4L A;  5HSQ A;  1Y4O A;  2R9X A;  3V3S A;  4I3A A;  3CMZ A;  5AVE A;  4B4Z A;  4OQI A;  4CLC A;  1IYO A;  1W63 M;  2HF6 A;  3T4Q A;  3IX4 A;  2XEP A;  4UQI S;  5DF8 A;  1K4F A;  4HY8 A;  3VV4 A;  5GLC A;  5L10 A;  3IXB A;  5EVI C;  1TS0 A;  1KDW A;  4RVA A;  5KMW A;  3B42 A;  1PFL A;  3LFV A;  5E2F A;  4X68 A;  3A0V A;  5CGS A;  2W1R A;  2K31 A;  4IUK A;  1FCN A;  2EWV A;  3HUM A;  3P01 A;  4E3M A;  5CHU A;  4F3L B;  4RX3 A;  4GCZ A;  5FDS A;  1OME A;  4KEN B;  1SDN A;  5F68 A;  5FL3 A;  4O7D A;  1L3L A;  1MPL A;  3JPU A;  3T1X A;  5HAQ A;  4MDZ A;  4KG2 A;  3PXP A;  4F94 A;  5L07 A;  4QY6 A;  2VLG A;  2J7V A;  4OP8 A;  4Y5F A;  3D9Y A;  3CPT A;  3RXW A;  3EEH A;  4Z1W A;  2JKF A;  4PAU A;  1H8Y A;  1W8Q A;  4WMC D;  4WZ5 A;  2D02 A;  3VP4 A;  3O87 A;  3UDF A;  1TS8 A;  2ZMF A;  3BWL A;  2G2W A;  5DFX A;  4QHC A;  2I9V A;  1RGY A;  3TW8 A;  1SDE A;  2VX8 A;  4R0Q A;  4H8R A;  1ZTU A;  3CIT A;  5FQ9 A;  5IU1 A;  3BFC A;  3UY6 A;  1NYM A;  4NXG A;  4X25 A;  5GLA A;  4EBN A;  4A5R A;  5FQK A;  1CQA A;  2O9A A;  4LPZ A;  1SCW A;  3T4J A;  1BT5 A;  3DWK A;  4II7 A;  1MKI A;  2Y4A A;  3SH8 A;  1TVF A;  2MJ6 A;  4G3W A;  4X56 A;  1FQG A;  4S2L A;  4XT2 A;  5DJT A;  3W4O A;  2EX2 A;  4KZ8 A;  1LSW A;  3MFX A;  3E0Y A;  1K54 C;  3BY8 A;  4EEP A;  4DE0 A;  1K6S A;  3MF0 A;  1IYS A;  4EET B;  3PR6 A;  5FAO A;  2WKE A;  5HAP A;  1YPR A;  1ES3 A;  1SHV A;  3OPP A;  3LEQ A;  3HJI A;  2XRO A;  4KZ9 A;  2ZC5 B;  4PHT A;  3C7V A;  2JKT M;  3L7H A;  4NKP A;  5EVI A;  2W0N A;  2QWS A;  1YSQ A;  1KGF A;  3UE0 A;  1KGE A;  4BWI A;  5C5K A;  3VE3 A;  1TDG A;  4BBT A;  4K91 A;  3VMA A;  3M2K A;  1X0O A;  4JGO A;  4LEN A;  4JLF A;  3ZG0 A;  3UB9 A;  4GS9 A;  1SKO A;  5FEF A;  3IWQ A;  5EOE A;  3MXQ A;  2PU4 A;  2V1A A;  4GOG A;  1MY8 A;  1FOF A;  1H0M A;  1Z09 A;  3N6I A;  2ZOH A;  3K3D A;  1BTL A;  2C6W B;  2ZJ9 A;  2JCH A;  2VGJ A;  3LCE A;  4JXG A;  4MBK A;  3KO6 A;  3LR5 A;  3VOY A;  3PAE A;  3EEA A;  3F1P B;  3IH9 A;  5M19 A;  3BFD A;  1OJG A;  2GNX A;  3VOZ A;  4EU0 A;  3HCY A;  2EX9 A;  2W3D A;  2XDM A;  2VJW A;  4KZ7 A;  4BQM A;  4HBT A;  2HDR A;  2EX6 A;  1FCO A;  3OCL A;  5FI2 A;  3HLG A;  5GHZ A;  1JWV A;  5A90 A;  5HZH A;  5DF9 A;  3SS3 A;  5AQ9 A;  3MXR A;  2VV7 A;  5TR7 A;  1I2S A;  5IHV A;  5TFQ A;  1G6O A;  4GDB A;  1D06 A;  2XD1 A;  3E4P A;  5CER A;  5DTT A;  1IOU A;  3C38 A;  2R78 A;  3BFG A;  3SH7 A;  1K54 A;  4G3K A;  1PYY A;  1K38 A;  4BL3 A;  3NCK A;  1N9L A;  4F3L A;  3P09 A;  2Q0O A;  3ZQ5 A;  1NLZ A;  4XUX A;  1DRM A;  3TJZ C;  1I5Q A;  4R38 A;  4NXE A;  5HDS A;  3ITB A;  4N1H A;  5J3W A;  3NDE A;  1W63 Q;  4N92 A;  2OOL A;  2QMI A;  3IQA A;  3NC8 A;  1MZU A;  2HZ5 A;  1G28 A;  3C2W A;  1GHM A;  1RGZ A;  4HH3 A;  4ARZ B;  5DJU A;  4RQ9 A;  4HBU A;  2KLI A;  4UHU A;  3ZCZ A;  1T19 A;  5E2H A;  1F5M A;  1BUE A;  4E3K A;  4HES A;  5DKL A;  2W3H A;  2PU2 A;  4LRX C;  4S2O A;  2P04 A;  3IBR A;  4MN6 A;  1NRF A;  2QPN A;  2E8I A;  3D3O A;  2J80 A;  4EQ1 A;  1S67 L;  3MKE A;  3BEB A;  5L8M A;  2ZC6 B;  1ERO A;  2IWC A;  3KYZ A;  2XSS A;  2E8J A;  4CLC D;  1VQQ A;  3A0S A;  4HJ3 A;  3BYD A;  2OAP 1;  3NOP C;  2P9V B;  3FKW A;  2NUP C;  3KSG A;  4L0L A;  3I7J A;  5HWT A;  3ZG5 A;  2ZLY A;  5HPF A;  2B02 A;  3CUE A;  4IUH A;  1TS6 A;  3V67 A;  2X02 A;  1YT4 A;  4N9K A;  3GTC A;  3GRJ A;  4ZDX A;  1IEM A;  5GL9 A;  5CHM A;  4DE2 A;  1ONH A;  3FPW A;  2VV6 A;  2J3T D;  4C6Y A;  3IF6 B;  1VHM A;  3R4K A;  2VGL M;  2V1Z A;  3IBJ A;  4ZJ2 A;  4E3J A;  2Q9N A;  4KZ5 A;  1E3U D;  3M6B A;  4LCL A;  3BY9 A;  2PR5 A;  1W8Y A;  1WYC A;  4U3T A;  5CTM A;  1OTI A;  3EQU A;  5I5L A;  3LUQ A;  5JYO A;  1ZC2 A;  3ZG8 B;  1K25 A;  3M6H A;  4JKT A;  4YNR A;  1V9Y A;  4KZ6 A;  4R3A A;  2IWD A;  1ESU A;  1ZHH B;  4EUZ A;  3S7O A;  4LFU A;  4HOI A;  4LV1 A;  3FZC A;  4ZTK A;  4LRY C;  3H7W B;  4OON A;  1DJB A;  4LGW A;  3VP1 A;  3HVF A;  1SKF A;  3MMH A;  2EXA A;  3GDI A;  2YKH A;  1ODV A;  2K2N A;  1ERQ A;  1K57 C;  3HUN A;  3F1P A;  2O0Y A;  4KQR A;  1H3Q A;  4I38 A;  4K0X A;  1EW0 A;  3VP2 A;  1XGJ A;  3ZG9 B;  4WM9 A;  1N9N A;  1GSW A;  2W3E A;  2VGL S;  2X71 A;  4S2N C;  4O01 A;  3R7W B;  3HLB A;  3ISG A;  4GJ4 A;  2H0T A;  2PR6 A;  3UE1 A;  3IHB A;  4E04 A;  3AGF A;  3WS4 A;  3DW0 A;  4BMW A;  1DJA A;  4X55 A;  1G68 A;  1JTD A;  2P08 A;  1ERM A;  1YMS A;  5JYP A;  4GKU A;  5EVI D;  1RCJ A;  1YM1 A;  4PM5 A;  1YLZ A;  1XGI A;  5DF7 A;  4KG6 A;  4FD8 A;  1P0Z A;  4GDN A;  4Q8I A;  1KOU A;  4X1L A;  3PAG A;  2AVX A;  3S7P A;  3OZH A;  3GSG A;  1L0E A;  2XH9 A;  3IS2 B;  2VEA A;  2OAQ 1;  4I3I A;  1OPX A;  1U60 A;  1P9R A;  3SZT A;  3F1N B;  3RH8 B;  1XFQ A;  4QY5 A;  3LID A;  4EUV A;  4JBF A;  3IX8 A;  1KVL A;  3OPL A;  1H8Z A;  4QD4 A;  3A3E A;  4UA7 A;  1S1Z A;  1FCM A;  4Z9Q A;  4E6W A;  3LEZ A;  5G4Z A;  1GHI A;  4ARZ A;  5DTS A;  3G6O A;  5HD3 A;  2B95 A;  1F2K A;  3WRZ A;  3GQZ A;  4E3I A;  3DTE A;  3LY3 A;  5FA7 A;  1LL9 A;  3F1O B;  4OPY A;  5F5Y A;  4DXC A;  2FH5 A;  1CJF A;  5U47 A;  4YIN A;  1N4O A;  1GCE A;  3U4L P;  3HL9 A;  4HP9 A;  3NEC A;  2Y2J A;  4OLG A;  4HIA A;  2Y91 A;  4EBP A;  1PRQ A;  3C7U A;  4HQA A;  1C3B A;  4NXB A;  1S4S A;  3NY4 A;  1A0K A;  2H5S A;  1Q2P A;  2FFY A;  5CEB A;  2P9V A;  1K56 A;  3TG9 A;  2Z6D A;  1T1C A;  4DE1 A;  2PYP A;  3N7W A;  1PZP A;  3FWL A;  4ID4 A;  5E2E A;  1K57 A;  4LV0 A;  3ZVW A;  1BZA A;  3H82 B;  2X01 A;  1E3U A;  1L0F A;  4FUW A;  1NXY A;  4KQD A;  2XLN A;  4KUK A;  4UA9 A;  4ZJ1 A;  1NJ4 A;  2PRF A;  1KE3 A;  4O8G A;  4QB8 A;  4S2N A;  2DMW A;  2WZX A;  1FSY A;  3G2Z A;  1DP6 A;  2Y2I A;  5FAP A;  4WYY A;  2QJ5 A;  5FSR A;  4U0X A;  4L9F A;  4ETZ A;  4E3O A;  4OOM A;  1WA9 A;  3IF6 A;  3UN7 A;  3IHA A;  1STZ A;  2WAF A;  1CK3 A;  3BW6 A;  3EGX C;  2JBF A;  1T18 A;  3E4O A;  3PBO A;  3G34 A;  5HWV A;  5MC7 A;  1G5U A;  1IYP A;  3HLD A;  5KZH A;  2EFU A;  2Y2L A;  1YAX A;  4EER A;  4DXB A;  3BQA A;  2HPB A;  2GZA A;  3IT9 A;  3IXH A;  1O7E A;  4C75 A;  4PKY A;  4NEE D;  1D1J A;  4UEY A;  1KE4 A;  2ZMA A;  3E98 A;  4PMA A;  3QHY A;  1GHP A;  1XJ2 A;  3SOI A;  2JHE A;  3S4X A;  4WBG A;  3H7W A;  1YLT A;  4BBV A;  3T1Q B;  1H8M A;  4JXW A;  2HP6 A;  2OV5 A;  5BOH A;  2ZQ8 A;  1CI9 A;  3EOI A;  3OPR A;  3TRC A;  5KSH A;  4LCM A;  4DN0 A;  2Y2N A;  4JGP A;  1PWD A;  1ES5 A;  3LIA A;  1KDS A;  1DP9 A;  1G6A A;  4FTX A;  3GVB A;  2J9O A;  2Y2M A;  3PBQ A;  4B4X A;  1RP5 A;  1HTZ A;  1TDL A;  2ZM0 A;  1D7E A;  5CHJ A;  3R7W A;  4GLQ A;  5AVF A;  3QP4 A;  2VK3 A;  4B88 A;  4OQ0 A;  2IA2 A;  3MQO A;  2WYX A;  3ZFZ A;  3OOV A;  2VGK A;  3OCN A;  4MCW A;  2HDQ A;  4IVI A;  4OOL A;  2Q9M A;  5EM1 A;  5A93 A;  1EWZ A;  1XJ4 A;  5I94 A;  2Y2O A;  3HBR A;  2PYR A;  3LR4 A;  3A3J A;  5AQ7 A;  5HDC A;  1YQS A;  3Q7Z A;  3ZYT A;  5J4E A;  3MFD A;  4AFI A;  3C4O A;  3IS2 A;  3BQ8 A;  3UO9 A;  1OT6 A;  4X6T A;  1NLY A;  5FAS A;  1LL5 A;  1OTE A;  3F1N A;  1S6R A;  5FQI A;  4WUJ A;  3UPP A;  1YLY A;  3UDI A;  4QWO A;  4OKP A;  4OVD A;  4ZAM A;  4N1X A;  5FAQ A;  5HL6 A;  1IEL A;  1ZKJ A;  4PM8 A;  2ZD8 A;  1UWN X;  3QNB A;  3BM6 A;  1UWP X;  3OLO A;  3T1S A;  1N9B A;  3GEC A;  4R4R A;  2D01 A;  4IJG A;  2G7U A;  5LBR A;  2OWH A;  3G35 A;  1NWZ A;  5L09 A;  3F1O A;  4JGR A;  5FAT A;  3SH9 A;  2WKR A;  5EE8 A;  4ZJ3 A;  2A49 A;  2QKP A;  2R9W A;  4QJG A;  4BEN A;  2CMN A;  3N8L A;  4KG5 A;  1Q2Q A;  1HLU P;  4GD8 A;  4DDS A;  3MQQ A;  2JKR M;  5J8X A;  1VEU B;  2OLU A;  4E3N A;  2I72 A;  2XA7 M;  1HZO A;  4D2O A;  5CRF A;  4OQH A;  4WL9 A;  5KIZ A;  2L1M A;  3T4T A;  3K2N A;  2HP5 A;  3L9K A;  4HP4 A;  3WS1 A;  3W4Q A;  3H82 A;  2ZQD A;  2QYB A;  4KZ3 A;  1IKG A;  1NRJ A;  5IT5 A;  3BJN A;  4L9E A;  1P9W A;  2PD7 A;  5TBM B;  3KYE A;  2PBY A;  4HHD A;  3TOI A;  4KZ4 A;  2XRN A;  4BL2 A;  1GSV A;  4DF6 A;  1YLP A;  5AQA A;  3H9W A;  3FKV A;  3MZE A;  2B18 A;  2H28 A;  1WYB A;  1VM1 A;  4KQO A;  4FCF A;  2Y2K A;  4DJ2 A;  1S66 L;  4XUZ A;  1MXO A;  3SW1 A;  4LV3 A;  2M1C A;  1AXB A;  5HFO A;  3O3V A;  1VET B;  4FH2 A;  4WEJ A;  2BTF P;  5HX9 A;  4JXS A;  3VSL A;  2JN7 A;  4GW9 A;  5F69 A;  1J3W A;  4GZB A;  4X53 A;  4GD6 A;  4Q0J A;  4H6J B;  2ZQC A;  1F98 A;  2W3G A;  2ZM2 A;  4HNB A;  4LRZ E;  2XA7 S;  3O88 A;  2PAV P;  1DJC A;  2BAS A;  5E43 A;  3Q82 A;  3T12 B;  4DKI A;  2XFT A;  4P85 A;  3V39 A;  1OT9 A;  1HVB A;  2VZW A;  5DTK A;  3DAV A;  1K55 C;  4S2I A;  3ZVT A;  2A24 B;  2WKQ A;  5EFW A;  1XJ3 A;  2EX8 A;  4IBR A;  5HW3 A;  2ZL1 B;  4BJP A;  2Y55 A;  3E4Q A;  1IKI A;  3QP5 A;  4P6Z M;  2XK1 A;  1K56 D;  3JVV A;  4MBH A;  4HEF A;  4RYE A;  4DDY A;  3NOU C;  1JNU A;  1MWR A;  5A92 A;  4M4X A;  4IED A;  2M7U A;  2H0Y A;  2OSU A;  4GNU A;  4Y17 A;  2JKG A;  3B3X A;  1K4E A;  3DTM A;  1NYY A;  4K0W A;  4IBX A;  4HI4 A;  5GLD A;  1YKD A;  4FSF A;  3IX3 A;  2RCX A;  3DTK A;  2WAE A;  3ICY A;  2GJ3 A;  2WKI A;  5EM0 A;  1KE0 A;  3KX0 X;  2UV0 E;  3ITA A;  1WE4 A;  3GR2 A;  5GHY A;  1PWG A;  4JF6 A;  1MKM A;  1XFN A;  2FZ0 A;  1FSW A;  4Q0I A;  4GHI B;  4ZBE A;  3Q1F A;  1TS7 A;  2Y2H A;  3VE4 A;  3FC7 A;  2L4R A;  3AGE A;  5G18 A;  4CPK A;  4R3B A;  1IFQ A;  2J3T C;  4ZRR A;  1CEG A;  3CLO A;  1XPB A;  3T50 A;  4P6Z S;  5DVA A;  5HPI A;  1DP8 A;  3MBZ A;  3V5M A;  4NXF A;  1BSG A;  3UE3 A;  3HLF A;  5EOO A;  5F83 A;  4E6X A;  1NZU A;  4WZ5 C;  3UB5 P;  3LIB A;  2Z2L B;  3G32 A;  3ZHH A;  1ACF A;  4KUO A;  3UE6 A;  2V0U A;  5EPH A;  1XX2 A;  4UA6 A;  4P87 A;  4WEK A;  4PM7 A;  5J7E A;  3EGD C;  3A3I A;  4FOF A;  4OPR A;  3TE8 A;  4WN5 A;  1ZG4 A;  4N9L A;  5G4Y A;  3EQV A;  2WGW B;  3VSK A;  4HJ4 A;  2HP9 A;  1ZG6 A;  5F6A A;  2DRW A;  3VOL A;  1VEU A;  1SZV A;  4BLM A;  3MKF A;  2WKP A;  2XFS A;  4BD1 A;  2WK0 A;  1PW8 A;  1J9M A;  3NIA A;  4NET A;  3B47 A;  3BLM A;  3DWZ A;  5D3O A;  5CTN A;  1ONG A;  4KQQ A;  4R23 A;  5HAR A;  1Y54 A;  4I5S A;  3N4I A;  1PI4 A;  4EES A;  5TJJ A;  3UPO A;  4XXR A;  4K08 A;  3BFE A;  4HJ6 A;  2JKT I;  5TBM A;  2XGN A;  4EV4 A;  3DBA A;  4UAA A;  1GSX A;  2B5R A;  1ESI A;  1JWZ A;  3PBN A;  3BFF A;  3MSH A;  1LI0 A;  4P0M A;  4DRT A;  1JWP A;  2J8Y A;  1PW1 A;  1KGG A; 
#chains in the Genus database with same CATH homology
 4WF0 A;  3PBQ A;  4ME4 A;  2O9B A;  3PBR A;  5J3W A;  1W63 Q;  5HDD A;  2OOL A;  2V9A A;  1S4R A;  1D7E A;  4YWZ A;  1MZU A;  3R7W A;  3LIF A;  4GLQ A;  1G28 A;  3C2W A;  5AVF A;  2KDK A;  4HH3 A;  4ARZ B;  5DJU A;  4RQ9 A;  5DFY A;  4H6J A;  2KLI A;  1T19 A;  2IA2 A;  3MQO A;  3T4K A;  1F5M A;  3OOV A;  3OCN A;  4MCW A;  4OOL A;  5DKL A;  2W3H A;  5DKK A;  3FPV A;  4LRX C;  3C30 A;  3UB7 A;  1XJ4 A;  2P04 A;  3IBR A;  4QPR A;  4MN6 A;  3HJK A;  3D3O A;  3S7Q A;  3RFB A;  2J80 A;  4O0P A;  4MN7 A;  4EQ1 A;  2PYR A;  1S67 L;  4PKY G;  2A24 A;  3LR4 A;  5L8M A;  2A2L A;  2KOI A;  4Q0H A;  5HDC A;  3KYZ A;  2XSS A;  4CLC D;  4UQI M;  3A0S A;  1XJ6 A;  4HJ3 A;  3ZYT A;  5J4E A;  3ULF A;  2OAP 1;  4MMN A;  4AFI A;  3NOP C;  2W27 A;  3KSF A;  4BBU A;  2NUP C;  3IS2 A;  3LYX A;  3BQ8 A;  3PBS A;  4G3V A;  3KSG A;  1OT6 A;  3B33 A;  2YKF A;  4L0L A;  1NLY A;  3PYP A;  4EEU A;  1OTE A;  4GS9 B;  3F1N A;  4WUJ A;  5HWT A;  2M7V A;  4CLC E;  1N9O A;  3JVU A;  1LT0 A;  1MC0 A;  5K5B A;  4ETX A;  4WLA A;  1OJ5 A;  5HPF A;  1BYW A;  2B02 A;  3CUE A;  5HL6 A;  4IUH A;  3CI6 A;  4WEL A;  3C8C A;  1TS6 A;  1UWN X;  3V67 A;  1UWP X;  3U2A A;  3OLO A;  2Y8H A;  4Y3I A;  3GEC A;  3UB8 A;  2D01 A;  4IJG A;  2G7U A;  5LBR A;  2OWH A;  4HH2 A;  1NWZ A;  3LIE A;  3T4O A;  2HJE A;  2INW A;  2QHK A;  1V9Z A;  3F1O A;  3NOT C;  5HD5 A;  2VA0 A;  3FPW A;  2VV6 A;  2J3T D;  3KYQ A;  4JGR A;  2WKR A;  3CWF A;  4Y2F A;  3T4L A;  3MJQ A;  1VHM A;  5HSQ A;  3R4K A;  2JKR I;  2QKP A;  3K3C A;  2VGL M;  4I3A A;  3IBJ A;  3KSI A;  2VKS A;  5AVE A;  2CMN A;  4DJ3 A;  3LR3 A;  4CLC A;  4GHI A;  3MQQ A;  2JKR M;  1W63 M;  1UGU A;  2HF6 A;  3BY9 A;  3T4Q A;  2PR5 A;  2XA7 M;  4UQI S;  1Y28 A;  3PHY A;  4HY8 A;  3VV4 A;  2GX5 A;  1OTI A;  3EQU A;  5I5L A;  4WL9 A;  5KIZ A;  2L1M A;  2QJ7 A;  3T4T A;  2W1T B;  3LUQ A;  3K2N A;  1TS0 A;  4HP4 A;  5IS1 A;  3RTY A;  3H82 A;  3B42 A;  3LFV A;  2QYB A;  4YNR A;  1V9Y A;  3A0V A;  1NRJ A;  4R3A A;  2ZOI A;  2W1R A;  1ZHH B;  5IT5 A;  3S7O A;  1TD5 A;  2VV8 A;  3BJN A;  4HOI A;  2K31 A;  2EWW A;  4L9E A;  4IUK A;  4LRY C;  1P9W A;  3H7W B;  2PD7 A;  5TBM B;  2EWV A;  5A8B A;  4HHD A;  4CQH A;  2XRN A;  3P01 A;  3MMH A;  1GSV A;  4F3L B;  3GDI A;  4GCZ A;  2YKH A;  1ODV A;  2K2N A;  3H9W A;  5F68 A;  5FL3 A;  2B18 A;  2H28 A;  2O0Y A;  3F1P A;  4KQO A;  4MDZ A;  3W2Z A;  3LI9 A;  1H3Q A;  3PXP A;  4I38 A;  4DJ2 A;  1S66 L;  1T1B A;  1EW0 A;  2L0W A;  2VLG A;  2LB9 A;  4Y5F A;  2KX6 A;  3SW1 A;  1N9N A;  3EEH A;  1GSW A;  2M1C A;  2W3E A;  4WEJ A;  4Z1W A;  2VGL S;  2J3W A;  4PAU A;  2JN7 A;  4GW9 A;  4O01 A;  3NHQ A;  2D02 A;  5F69 A;  1TS8 A;  3R7W B;  2ZMF A;  3BWL A;  4Q0J A;  4GJ4 A;  3LIC A;  1OTA A;  3OC2 A;  5DFX A;  2PR6 A;  4H6J B;  2I9V A;  1F98 A;  2W3G A;  4HNB A;  4LRZ E;  2XA7 S;  3A0R A;  3LR0 A;  3OBF A;  4E04 A;  3TW8 A;  2ZBB A;  4BMW A;  2VX8 A;  4LLO B;  2BAS A;  1T1A A;  1ZTU A;  2P08 A;  3CIT A;  5IU1 A;  1OT9 A;  2VZW A;  4NXG A;  2A24 B;  2WKQ A;  1OTD A;  3CUE C;  3D72 A;  1XJ3 A;  5EFW A;  1P0Z A;  1KOU A;  4BJP A;  2O9A A;  4LPZ A;  3T4J A;  3E4Q A;  3S7P A;  4II7 A;  3PBT A;  3FG8 A;  3IS2 B;  2VEA A;  2OAQ 1;  1S1Y A;  4I3I A;  1TF1 A;  2MJ6 A;  4P6Z M;  4G3W A;  2O99 A;  2HGV A;  3JVV A;  1OPX A;  1P9R A;  3F1N B;  3NOU C;  1JNU A;  4XT2 A;  3RH8 B;  1XFQ A;  3LID A;  5DJT A;  4EUV A;  4M4X A;  2M7U A;  1LSW A;  2OWJ A;  3E0Y A;  3MFX A;  3O5Y A;  3BY8 A;  4MN5 A;  4EEP A;  1S1Z A;  3KSH A;  3MF0 A;  4EET B;  3NJA A;  3PR6 A;  5G4Z A;  2NUT C;  4I3J A;  4ARZ A;  3G6O A;  5HD3 A;  3CAX A;  2Z6C A;  3EWK A;  2PT7 A;  1YSP A;  3HJI A;  4HI4 A;  2XRO A;  1YKD A;  4FSF A;  4PHT A;  3F1O B;  2JKT M;  5F5Y A;  4NKP A;  2W0N A;  2QWS A;  3ICY A;  2GJ3 A;  2FH5 A;  3KX0 X;  1YSQ A;  4BWI A;  5C5K A;  2V1B A;  1MKM A;  1XFN A;  2HV1 A;  2FZ0 A;  4HP9 A;  4CLC B;  3VE3 A;  4HIA A;  4Q0I A;  1LSV A;  4GHI B;  4IHQ A;  4HQA A;  4NXB A;  1S4S A;  3LI8 A;  4BBT A;  1TS7 A;  1P97 A;  1X0O A;  2O9C A;  3VE4 A;  1LSX A;  4JGO A;  3S7N A;  4I39 A;  2V0W A;  2L4R A;  3FC7 A;  3P7N A;  2Z6D A;  1T1C A;  2PYP A;  3MQ0 A;  1IFQ A;  2J3T C;  4ZRR A;  3UB9 A;  3CLO A;  4GS9 A;  3T50 A;  4P6Z S;  3H82 B;  3MXQ A;  5HPI A;  1DP8 A;  3MR0 A;  2V1A A;  2K7S A;  3UB6 A;  2W3F A;  4KQD A;  2ZOH A;  4NXF A;  3K3D A;  2HJ9 C;  3UE3 A;  4KUK A;  3LIB A;  4YOF A;  4O8G A;  3KO6 A;  2DMW A;  3LR5 A;  4KUO A;  3UE6 A;  2ZMV A;  2V0U A;  1DP6 A;  2LB5 A;  4DMZ A;  3EEA A;  3F1P B;  2QJ5 A;  4WEK A;  4L9F A;  4ETZ A;  5J7E A;  3EGD C;  5HWW A;  4FOF A;  1OJG A;  2GNX A;  3TE8 A;  4OOM A;  1WA9 A;  4WN5 A;  4EU0 A;  5G4Y A;  3HCY A;  3EQV A;  1STZ A;  1F9I A;  4HJ4 A;  2W3D A;  2PDR A;  2VJW A;  3BW6 A;  3EGX C;  2EA9 A;  5F6A A;  3VOL A;  1T18 A;  1LL8 A;  3E4O A;  3PBO A;  2WKP A;  3UME A;  5HWV A;  5MC7 A;  3OCL A;  1YAX A;  5HZH A;  5AJG A;  3B47 A;  5DF9 A;  2W1T A;  4EER A;  3BQA A;  4EXO A;  2GZA A;  2VV7 A;  4R6L A;  1G6O A;  4PKY A;  2PD8 A;  1D06 A;  4NEE D;  2P7J A;  3E4P A;  4UEY A;  2PHY A;  3E98 A;  1IOU A;  4B9O A;  3C38 A;  4CLC C;  4I5S A;  4EES A;  2R78 A;  5TJJ A;  1XJ2 A;  4R70 A;  1VB6 A;  2JHE A;  4K08 A;  4HJ6 A;  4L9G A;  3H7W A;  2JKT I;  5TBM A;  4BBV A;  3DBA A;  4G3K A;  4JGQ A;  3UMD A;  1GSX A;  1H8M A;  1N9L A;  4F3L A;  3PBN A;  3ZQ5 A;  1OTB A;  1NLZ A;  2Y79 A;  5CX7 A;  4B93 A;  3EOI A;  3TRC A;  1DRM A;  5KSH A;  4DN0 A;  3TJZ C;  4JGP A;  4R38 A;  4NXE A;  3T4S A;  3LIA A;  4XT2 B;  1DP9 A;  5HDS A;  4EW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...