2L4RA

Nmr solution structure of the n-terminal pas domain of herg
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
135
structure length
135
Chain Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title NMR solution structure of the N-terminal domain of hERG and its interaction with the S4-S5 linker.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 19
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l4rA00
5HDSA 4B9OA 5HZHA 1G28A 3LI9A 4PKYG 4HP9A 4L9EA 2PHYA 2Z6DA 2OOLA 4HH2A 4M4XA 4BBVA 3NOUC 3FG8A 3UB9A 4EETB 1D7EA 4LPZA 2YKHA 3SW1A 2D02A 2PR6A 4I3JA 3GDIA 1OTEA 3H7WB 3E4PA 1TS8A 1OT6A 3EWKA 1TS6A 1N9LA 4I39A 3IS2B 4LRYC 2I9VA 2OWHA 3H7WA 5AVFA 1LSXA 5HDCA 2QJ7A 4L9GA 2GJ3A 2PD8A 3IS2A 5EFWA 2J80A 4HJ4A 1OTBA 3OLOA 5HWWA 3LICA 4MN6A 5A8BA 3LIBA 1S1YA 2PD7A 5I5LA 4EEUA 1V9YA 4NXGA 4L9FA 4MN5A 2H28A 1XJ4A 2VV8A 1S67L 2PDRA 4WLAA 4EEPA 4R3AA 3KX0X 4HH3A 2W0NA 3NOPC 3VOLA 5F69A 4R38A 3NHQA 3LUQA 4HJ3A 1LT0A 1P97A 3MFXA 3VE3A 5AVEA 3MQOA 2PYPA 4EXOA 2PYRA 1T1CA 1GSVA 2HV1A 2WKQA 1Y28A 4E04A 4KUOA 2B02A 1F98A 1BYWA 3RTYA 1GSWA 1DP8A 3VE4A 3LIFA 3MXQA 4K08A 3P7NA 4GW9A 3IBRA 1S4SA 4I3AA 1OTAA 1XFQA 4I3IA 1T1BA 1F9IA 1UWNX 3H82A 4R6LA 2YKFA 3C8CA 3MQQA 5HD3A 3EEHA 4GS9A 2QJ5A 5DJTA 1T1AA 3NJAA 2V9AA 3H9WA 1EW0A 3D72A 2L4RA 3UMDA 1OT9A 2V0UA 4F3LB 3FC7A 4GHIB 4KUKA 1X0OA 3PYPA 5F6AA 5IS1A 5G4ZA 4EQ1A 5DKLA 2L0WA 4F3LA 4GHIA 3CLOA 1UWPX 3PHYA 2PR5A 3BWLA 4HJ6A 2D01A 3K3DA 2KX6A 3UB8A 2P7JA 1WA9A 4BBTA 3LIDA 4HY8A 4BBUA 4KQDA 2OWJA 4HI4A 1VB6A 2QHKA 4R70A 3F1PB 4LRZE 4WF0A 3NOTC 2ZBBA 4HP4A 1JNUA 3BY8A 3F1PA 2ZOIA 3HJIA 2JHEA 5DJUA 1S66L 3UB6A 5J3WA 1DP9A 2VLGA 1ODVA 4LRXC 1KOUA 1T19A 3HJKA 2KDKA 2QWSA 1XJ2A 4NXBA 1OTDA 4WN5A 3LYXA 4JGPA 1XFNA 2VEAA 3LIEA 2BASA 1D06A 3ULFA 4HHDA 5J4EA 4WUJA 4LLOB 3H82B 4HNBA 2JN7A 5G4YA 2WKPA 4GS9B 5HWTA 2V1BA 3UB7A 4RQ9A 3E4QA 3LI8A 1MZUA 1T18A 5HDDA 2L1MA 1OJGA 3F1NB 5HWVA 5KIZA 3K3CA 1OJ5A 4HIAA 4DJ2A 1S1ZA 3F1NA 3C2WA 5IU1A 5F68A 2M1CA 4WL9A 3A0RA 2W27A 4I5SA 4I38A 2WKRA 4XT2B 4H6JB 3RH8B 1LSWA 3E4OA 3T50A 1S4RA 2QKPA 3G6OA 1LL8A 4EERA 4XT2A 4H6JA 4JGOA 1DP6A 3MJQA 4EW7A 1V9ZA 4NXFA 5DKKA 3LIAA 1TS0A 3UMEA 3BY9A 2R78A 5HSQA 1N9NA 5HD5A 2ZOHA 2A24B 5F5YA 1N9OA 3ZQ5A 2A24A 3UE6A 4HQAA 4EESA 3MR0A 2VV7A 5TBMB 2K7SA 4PKYA 4YWZA 3CAXA 4NXEA 3A0VA 4JGQA 1P0ZA 1TS7A 1XJ6A 3GECA 2Z6CA 5TBMA 5J7EA 2INWA 2EA9A 3F1OB 1NWZA 4GCZA 3CWFA 2VV6A 4JGRA 1OTIA 1UGUA 4HOIA 2V1AA 1DRMA 3F1OA 4DJ3A 1XJ3A 3ICYA 2CMNA 3A0SA 1GSXA 3B33A 1LSVA 2V0WA
chains in the Genus database with same CATH superfamily
5HZHA 1IKIA 3DWKA 1NY0A 2JE5A 2Z2LB 4PKYG 3TOIA 4UHUA 1MWTA 2Y59A 5FAOA 2PHYA 1ONGA 4M4XA 2QMIA 1J9MA 1H8ZA 3UB9A 4LPZA 4YINA 4WZ4A 3IF6C 3DTEA 3OPLA 2V2FF 1XA1A 3LFVA 3SW1A 2D02A 4KZ9A 4I3JA 1NJ4A 4OQGA 3O88A 1ERMA 3GMWA 4LRYC 2OAP1 3N8LA 2W3HA 5EOEA 1XPBA 1MWRA 4S2KA 2H10A 4L9GA 3GRJA 2VZWA 4Q0IA 2PRFA 1W7FA 4RA7A 3DAVA 2P04A 2R9XA 3LICA 4MN6A 5A8BA 2PU2A 5E2EA 4OVDA 3ITBA 3RXXA 5HL6A 4N1HA 2WAFA 3QNBA 4LV1A 1LLBA 4MN5A 2XROA 2GX5A 4UQIM 5M18A 1L0EA 4FH4A 2GDNA 3UE3A 3LEQA 4MDZA 5GL9A 1M6KA 2PDRA 4EEPA 1ZC2A 4R3AA 5FDSA 3KYZA 5F83A 1QMFA 1YSQA 3EOIA 1IOUA 3MQ0A 2Y2LA 4EU0A 4UA6A 3RJUA 3SOIA 1GHPA 3MFXA 5IT5A 1G6AA 3NY4A 1T1CA 4KG6A 2VA0A 1H8MA 4UEYA 1F98A 1O7EA 4S2NA 2ZM2A 2EXBA 1PYYA 1YAXA 3IBRA 4YNRA 4WEKA 4P6BA 4Y15A 1S4SA 3FV7A 4Y7PA 5FL3A 3LCEA 3IHAA 1E3UD 4UAAA 1OTAA 1F9IA 1UWNX 3U4LP 4M3KA 4R6LA 2YKFA 4KZ5A 1PWGA 3EEHA 2QJ5A 1BLSA 3O87A 4H8RA 1BULA 1EW0A 3D72A 2VJWA 2KOIA 3BQAA 2GZAA 1XGIA 1O07A 4CPKA 1MPLA 3BFDA 3IXGA 4QY6A 1BSGA 2BLSA 4UA9A 5G4ZA 4O8GA 2RCXA 4BJPA 4HBTA 1NYYA 1ONHA 2L0WA 2C6WB 3E0YA 2OV5A 2VGKA 2P74A 1UWPX 3LR3A 5F1GA 3BFEA 4E3NA 2WYXA 4B88A 3BWLA 1LHYA 2Y2IA 4Q0HA 2D01A 2IA2A 2W1TB 4K0WA 4YFMA 4R4SA 4Y2FA 4WYYA 2ZMFA 2EX6A 4KQDA 4HI4A 1VB6A 1DJAA 3IWQA 3UE1A 5CEDA 1YMSA 2Y2JA 3P01A 3E2KA 5EOOA 5EECA 2ZQ9A 1PW8A 5CHJA 1CF0A 4ZJ1A 4EBNA 2ZQCA 4IBXA 4HP4A 3BECA 3BY8A 3R4KA 3F1PA 2ZOIA 3HJIA 4JPMA 3UB6A 5EVIB 2WKHA 3IX3A 3P98A 2O9CA 3UDXA 4R0QA 4JF4A 1ODVA 4MN7A 4JF6A 2J9PA 3S1YA 1YM1A 2QWSA 4LENA 1XJ2A 1XKZA 4NXBA 3D4FA 3OPRA 4KZAA 1U60A 1MKIA 4OQIA 4C3QA 5DFYA 4Y0UA 2EX9A 2ZQAA 4QJGA 3UDFA 1K56A 1IYOA 5CECA 3DTMA 3ZGAB 3M6BA 2V8FA 2ZC4B 4CJNA 3N4IA 3VOYA 1H3QA 3HLGA 2WKPA 1ESUA 5HWTA 2V1BA 1TEMA 1BT5A 4EQIA 2ZD8A 3V3SA 3IF5A 5HDDA 4R3BA 3LR5A 1OJGA 1HZOA 3KSGA 3AGDA 3T1XA 1Q2QA 3O5YA 3JPUA 3Q07A 3NI9A 3Q7VB 1W63Q 1S1ZA 2JKRI 3QP8A 4DRTA 2M1CA 2WAEA 1ESIA 3A0RA 3FYZA 2VGJA 3IH8A 4S2IA 2XFSA 4I38A 4FCFA 2GNXA 1S6RA 3T1QB 3SH7A 3E4OA 4E6WA 1YLTA 3G6OA 1LL8A 1PIOA 3VP4A 3T4KA 1ZHHB 1SKOB 3N7WA 3SS4A 1DP6A 3MJQA 3V50A 3FZCA 4NXFA 1CEGA 2Y8HA 1YSPA 5DKKA 4S2LA 3UMEA 2XA7S 2R78A 2G2WA 2W1RA 3PAGA 4BLMA 2ZOHA 2A24B 2W3FA 3CZDA 3L7HA 4OOMA 5I94A 4JXGA 4QU3A 1N9OA 3IX8A 3UE6A 4EBPA 3DTIA 4OQHA 3KSIA 2PBDP 3CHWP 4S2OA 2HZ5A 2I72A 1FR1A 1FCMA 3KSHA 4MNRA 3Q7ZA 1Z09A 3LR0A 5DF7A 5TBMA 3DTKA 3LEZA 1JWZA 2INWA 5CERA 1YMXA 5KSCA 3F1OB 2O9AA 1ES4A 1K57C 1OTIA 4OPRA 2EWVA 1AXBA 3WS0A 5FAPA 1FQGA 2CMNA 3A0SA 4E3JA 3B33A 3FKWA 2V1ZA 3V39A 1LSVA 5HAIA 2DMWA 1H8YA 3U2AA 3UN7A 1OMEA 1LL9A 3R7WA 3LI9A 3I7JA 5DFXA 4HP9A 4E3IA 2LB5A 4F94A 3UPPA 4BBVA 3DBAA 5CGXA 3JVUA 5U47A 1STZA 3B42A 2Y2OA 3VSLA 5EVEA 5GLCA 4E3KA 1OTEA 3H7WB 5FQJA 4LCMA 1KGFA 2Y55A 1N4OA 2XA7M 4PM8A 5TJJA 4XUZA 4PM5A 2V20A 1ES2A 5AVFA 3UB5P 1LSXA 3IH9A 3WS5A 5JYOA 5EFWA 1Y4OA 1ZKJA 2J80A 1K25A 5L07A 5E2FA 5HWWA 3LIBA 2DCFA 5FQMA 3EEAA 4LV0A 2WZZA 4EEUA 3NCKA 4KENB 2FZ0A 2ZC5B 3CMZA 2Q9NA 3FWLA 3C4PA 3MZDA 2P08A 4CQHA 3PBRA 4GZBA 2VV8A 2FFFB 4WLAA 3O3VA 3KX0X 4U0TA 5GHZA 2QPNA 3UDIA 1IELA 3TSGA 3BFCA 2ZLYA 3NOPC 4S2NC 3NHQA 1RGZA 4IVKA 3LUQA 2ZMAA 4U3TA 3HCYA 3T4SA 4HJ3A 1LT0A 3OPPA 4S2MA 5FA7A 3Q1FA 5AVEA 3MQOA 4EXOA 5JYPA 3SH8A 2FFYA 4G3VA 1Y28A 5J8XA 2EWWA 1E3UA 3PBSA 5HAQA 1CJFA 1I5QA 1BYWA 5CGSA 1GSWA 5E43A 1DP8A 3VE4A 4N9LA 3LIFA 1K57A 2UWXA 2NUTC 4NK3A 4Q8IA 1SDEA 4B4XA 2EX2A 3ISGA 3G31A 1IYSA 3AGFA 4KZ4A 3H82A 4MLLA 3Q81A 1J3WA 3C8CA 4JF5A 1YLPA 3BW6A 1T1AA 3GR2A 3NJAA 4GDBA 2JKFA 2V9AA 3W4PA 4UA7A 3B3XA 3UMDA 1XXMA 1JTDA 5CGWA 2HDQA 4DN0A 3LY4A 4GHIB 5FI2A 3KYEA 5TGFA 1X0OA 2XR0A 3PYPA 4O0PA 3LGOA 4E3OA 4Y0TA 5M19A 5F1FA 5DKLA 5E2HA 3PTEA 2ZL1B 5G18A 4N9KA 1MY8A 4XUXA 3PHYA 3HLDA 5FEGA 3HBRA 3QHYA 2PR5A 4HJ6A 2EFXA 2J7VA 3EGXC 3ZDJA 3NBLA 1GCEA 4HBUA 5FI7A 1K54A 5EE8A 3ZVTA 5EM1A 2W1TA 4P85A 3AGEA 2QHKA 4R1GA 1NZUA 2HJ9C 3BRMA 4FOFA 3T4JA 2XFTA 4IUKA 2JKTM 4KZ7A 1JWPA 5DJUA 1S66L 5J3WA 4LCLA 1DP9A 5DTKA 2O9BA 5E2GA 3G34A 4WELA 1IYPA 1K0KA 2H0TA 1FCOA 2B5RA 3HJKA 5HX9A 5EVIA 2WZXA 2KDKA 3MFDA 4K91A 3N8RA 3HUOA 3PXPA 3SS5A 3ITAA 3UPNA 4PAUA 4X1MA 4KQQA 4XXRA 1D06A 3ULFA 3CG5A 2ZJ9A 3WRTA 3QNCA 4LLOB 3H82B 1ZTUA 2Z2MB 4ZDXA 1H5XA 4OP5A 5FQIA 4ZJ3A 5G4YA 3UB7A 3A3JA 3CJMA 3ZNYA 5FEFA 4BL3A 3W4OA 5BOHA 1MKMA 2QZ6A 3IHBA 1SZVA 3F1NB 3W2ZA 3IQAA 3CITA 4LV2A 3K3CA 1P9WA 3K2NA 3SS3A 2Q0OA 3G32A 3OBFA 4O01A 5F68A 4WL9A 3Q7VA 4X25A 4IEDA 5AJGA 4BD0A 5EM0A 3TE8A 3RH8B 1YT4A 2E8JA 3IXHA 5GHXA 5TR7A 4IHQA 3KSFA 1BZAA 1S4RA 1PZPA 1CQAA 2QKPA 1KDSA 5HL1A 1AWIA 4GKUA 3ZYTA 4EW7A 2M7VA 3VP3A 3OCNA 1SKOA 2J9OA 4KG2A 2ZC6B 3C4OA 4Z1WA 5TFQA 4JLFA 4K0XA 4QHCA 1KGEA 3L9KA 5GLBA 5AQ9A 1A0KA 5F5YA 3IXDA 1HTZA 2A24A 2J3TD 1BTLA 2HP9A 3HUNA 4PMAA 4A5RA 3MR0A 2ZC3B 4PKYA 3V5MA 2B18A 4X6TA 1TS7A 2JCHA 1Q2PA 2Z6CA 1ALQA 1TD5A 3TRCA 3WS2A 4B4ZA 1PFLA 2G2UA 3CI6A 4KG5A 4BD1A 1NWZA 5C5KA 1SCWA 4RX3A 4EBLA 2WK0A 3CWFA 4KZBA 5EVID 4OH0A 5FSRA 3F1OA 5DF9A 4QY5A 3EQUA 4DJ3A 1XJ3A 4Y0OA 1F5MA 1K4FA 3UO9A 2VGLS 3ZFZA 5CRFA 5HDSA 4DXCA 1SHVA 5AQ7A 2XF3A 2QYBA 4X69A 3S7PA 3M2JA 1HD8A 4FD8A 4JKTA 5CX7A 4X68A 1E25A 2ZC7A 2Z6DA 1VHMA 2ACGA 3BEBA 2OOLA 4OOLA 3NIAA 1YLYA 3HLWA 2WKEA 1KE0A 1MWSA 2OLVA 1H0MA 4EETB 1D7EA 2YKHA 2M7UA 3S7QA 4WZ5A 3G30A 2PR6A 3VOZA 3MF0A 2WGVA 3ZVWA 3T4TA 3MSHA 4BQMA 3E4PA 1TS8A 4ARZA 3Q82A 4DMZA 1TS6A 4MBKA 4OONA 1N9LA 1Z6FA 3TJZC 3QP4A 3IS2B 2I9VA 2OWHA 3H7WA 3MXRA 5LBRA 3UY6A 3BLSA 3V67A 1FR6A 2PD8A 1IYQA 1ZG6A 3O86A 4GN2A 3MMHA 4HJ4A 5KSHA 3OPHA 1DJCA 1OTBA 3A3EA 2AVXA 2Y2MA 2EXAA 2PD7A 4C75A 5I5LA 4P87A 3ZHHA 3B47A 4KZ8A 1F2KA 2HP5A 2WKIA 3T1RA 1MC0A 3QP5A 1V9YA 3BYDA 4L9FA 1KDWA 1FCNA 2HDUA 1QMEA 3VP2A 1CEFA 4MMNA 2A3UA 1NZOA 1E4DA 3DW0A 1VM1A 1YPRA 1VETA 2X01A 1K55C 2Y4AA 2H0YA 3VE3A 2W3GA 3G2ZA 5M1AA 2PYPA 2PYRA 2JBFA 3PBQA 4WMCD 4ZBEA 3HLBA 4DE2A 2JKRM 4DDSA 1GA9A 1K38A 2CC1A 1PNEA 2EX8A 3RTYA 2FH5A 3T4OA 1GHIA 5CXWA 3MXQA 3VSKA 3VMAA 2WGWB 4Z9QA 5MC7A 3C30A 1SKFA 4NETA 3HREA 4PHTA 4I3IA 4ARZB 5FQQA 5HD3A 4ZAMA 4MEZA 1L3LA 3A3IA 3H9WA 4DE0A 1FIKA 2Y79A 4RVAA 2KLIA 4O7DA 4OPZA 2W3EA 4DE1A 2K2NA 1OT9A 3EGDC 4OLDA 3OC2A 3FC7A 3M2KA 4F3LB 2OAQ1 1PRQA 4E3MA 1K54C 5IS1A 3MXSA 1MXOA 1KGGA 4EQ1A 2J3TC 5L2FA 2MJ6A 3A3FA 4GHIA 1M40A 3GTCA 3CLOA 5D3OA 4EV4A 2ZL1A 3K3DA 3UB8A 2P7JA 1WA9A 1WYCA 3N6IA 3JVVA 4HY8A 3ZG5A 2Q9MA 4BBUA 3HL9A 4PM7A 5EVIC 4HESA 3IWOA 3LY3A 4WF0A 4CLCB 2ZBBA 2IWBA 3MKEA 1W63M 4Q0JA 1VETB 4ETXA 5HARA 3CUEC 5L09A 2Y2GA 4LGWA 1YLWA 1K6RA 1YLZA 3S7OA 2HGVA 4LRXC 3VP1A 1KOUA 3VFFA 5A90A 2Y91A 2XD1A 1BLPA 3C38A 2HDSA 3IX4A 4CLCD 3PR6A 5A93A 1OPXA 5HW3A 4OOYA 1WYBA 1W5DA 3LO7A 4Y5FA 3LYXA 4JGPA 4OP8A 1XA7A 2IWCA 1XFNA 4U0XA 3C7VA 3NDGA 3LIEA 2BASA 4FH2A 4D2OA 4LV3A 1NLZA 4WUJA 3T12B 1K55A 1KE3A 4BWIA 4DF6A 2PU4A 4FUWA 4MBHA 4JBFA 5L8MA 3MBZA 3IWIA 1PW1A 3IXBA 1NRFA 1FOFA 1P9RA 4RQ9A 3E4QA 3NDEA 2XK1A 1T18A 1MWUA 3D3OA 3SH9A 2L1MA 4AFIA 4HEFA 2VX8A 3OOVA 4DDYA 5KMWA 5KIZA 1PI5A 1K4EA 1OJ5A 4Y3IA 4HIAA 4GOGA 3LR4A 2HDRA 1PWCA 4IUHA 3F1NA 3A3DA 3T1SA 5DVAA 4I5SA 4NEED 1W79A 1G68A 5A92A 1XX2A 1YQSA 2WKRA 5EV0A 3P09A 4XT2B 4H6JB 4X1LA 4BENA 5HPIA 3MKFA 3KYQA 3T50A 4X55A 3NECA 1N9BA 3OZHA 1TDGA 3G2YA 2B95A 4EERA 4IVIA 1RP5A 4JGOA 2BG1A 3T4QA 3D9YA 1Y54A 3BFFA 1V9ZA 3WS1A 3BM6A 1JWVA 1KE4A 4DKIA 1TS0A 3BY9A 5HSQA 4RYEA 5HD5A 3UE0A 2XLNA 3DWZA 1YKDA 1L0DA 3ZQ5A 2X71A 5CTNA 4EUZA 4KZ3A 4Y13A 2O0YA 2VV7A 2K7SA 2XGNA 2BTFP 3CAXA 1CI8A 2P9VA 3G35A 4NXEA 3A0VA 1P0ZA 1XJ6A 3GECA 2DRWA 5J7EA 1L0FA 3VFHA 2Y2QA 4PPRA 3G4PA 2EA9A 1I2WA 3CUEA 4FSFA 5AQAA 4GCZA 1KVLA 2VV6A 3UPOA 4HOIA 2V1AA 3EQVA 4ID4A 1NYMA 1CI9A 1TVFA 2K31A 3HLFA 2JKGA 3ICYA 2H5SA 1SDNA 1GSXA 3KO6A 3IBJA 4WZ5C 5CTMA 2UV0E 2V0WA 4B9OA 4II7A 5FI6A 1G28A 5CHMA 3W8KA 3MZFA 1ES3A 1NXYA 4MBFA 4ETZA 4L9EA 5FQ9A 1S0WA 5EPHA 2XQZA 4HH2A 3NOUC 1L0GA 3FG8A 4P6ZS 2ZM0A 3IT9A 2JC7A 5GHYA 4GD8A 4GDNA 3M6HA 3GDIA 2ZQDA 3RFBA 4OPQA 1LI9A 5DTSA 1OT6A 3EWKA 3BFGA 3E2LA 2Y2PA 4I39A 1HVBA 4KQOA 1JTGA 5CEBA 4RX2A 5HDCA 3IF6A 2QJ7A 2GJ3A 3IS2A 4BL2A 2VK3A 4IJGA 3C5AA 1PWDA 4N92A 3C7UA 3OLOA 4CLCC 4R4RA 3BQ8A 2O99A 1S1YA 3FPVA 4OKPA 3VP0A 3WWXA 2RL3A 2OSUA 5FDHA 2WUQA 2J3WA 2P9VB 4NXGA 4R3JA 2H28A 5DF8A 1XJ4A 4EWFA 1HLUP 5A91A 4E6XA 1G5UA 2G7UA 4YOFA 1ZG4A 1S67L 5F82A 3NULA 4ZTKA 1W8QA 1K6SA 3UNWA 5AQBA 4HH3A 3V3RA 5CHUA 4ESPA 4Y17A 2W0NA 3HLCA 4ZJ2A 3S22A 1WE4A 2Y2NA 4C6YA 3VOLA 4WMCA 1W8YA 5F69A 3W4QA 1IFQA 4R38A 4QB8A 4X53A 3ZCZA 1P97A 2PT7A 4QPRA 3RXWA 4S2PA 2XD5A 1GSVA 2HV1A 4L0LA 2W3DA 3S7NA 2WKQA 4E04A 4P6ZM 4KUOA 2ZQ8A 2B02A 4S2JA 1RCJA 2A49A 5GLDA 4GB7A 2ZQ7A 4K08A 3P7NA 3VV4A 2Y2HA 4GJ4A 4GW9A 4I3AA 2HP6A 4G3WA 1FSYA 1XFQA 4NG2A 1T1BA 2WGWA 1BUEA 4N1XA 3CPTA 3MQQA 4E3LA 4GS9A 4CLCE 5DJTA 1D1JA 2XH9A 2L4RA 1NLYA 1GA0A 2NUPC 3IF6B 4ME4A 4NKPA 2V0UA 4D60A 2E8IA 4KUKA 4KQRA 5F6AA 3GV9A 3WRZA 4DXBA 3WS4A 1NRJA 1EI5A 4F3LA 1YLJA 5FASA 1TDLA 1IKGA 4PM9A 2KX6A 4ZRRA 3NC8A 4G3KA 4BBTA 2ZM8A 3LIDA 5EUAA 1IEMA 2OWJA 1TF1A 3ZG0A 5EVLA 2XDMA 2C5WB 3GVBA 4R70A 3F1PB 3JYIA 4LRZE 3ZG8B 3NOTC 2V8CA 1ES5A 1FILA 5FATA 4OLGA 1CK3A 1JNUA 5DTTA 5K5BA 4CLCA 3BLMA 2JHEA 2WADA 1XGJA 4EUVA 2VGLM 2VLGA 3FKVA 2R9WA 5HAPA 5L10A 1DJBA 1T19A 2VKSA 4MCWA 3MZEA 3PBOA 2HPBA 4WBGA 1OTDA 2WGIA 3E98A 4WN5A 1JVJA 2VEAA 4JXVA 4BMWA 4HHDA 5J4EA 2HF6A 4PM6A 1VEUA 1VQQA 4QWOA 1XP4A 1RGYA 4FTXA 3CPTB 3BJNA 4HNBA 2JN7A 5IHVA 1MBLA 4GS9B 2A2LA 2ZMVA 1G6OA 2IWDA 1K56D 3LI8A 1MZUA 3QP6A 5FAQA 2HJEA 3OCLA 4GD6A 4DE3A 4LFUA 3S4XA 5HWVA 1I2SA 2J8YA 1ACFA 3PAEA 5GLAA 4DJ2A 1EWZA 3C2WA 3MS6A 3FPWA 5IU1A 3ZG7B 4OPYA 2W27A 2XEPA 2PBYA 3HUMA 4WM9A 1C3BA 1LSWA 3TG9A 1FSWA 3SZTA 4XT2A 4H6JA 1LI0A 2PAVP 3ZG9B 1KVMA 4GLQA 1GHMA 3LIAA 5KZHA 4QD4A 1N9NA 1L2SA 1PZOA 4X56A 3N8SA 3PBTA 4GNUA 4HQAA 2Y2KA 1ERQA 3GQZA 4EESA 1LL5A 3HLEA 2X02A 2XRNA 5TBMB 1DY6A 3PBNA 3QP2A 4JXSA 4WEJA 2DNSA 2XSSA 4YWZA 4P0MA 3TW8A 4OQ0A 5HFOA 4JGQA 4IBRA 3ZNTA 1BLCA 2OLUA 2LB9A 1EROA 3QP1A 1BLHA 5FQKA 4UQIS 1VEUB 4KZ6A 4R23A 4JGRA 1UGUA 3HVFA 1DRMA 3T4LA 1PI4A 2EFUA 3GSGA 5HPFA 4B93A 4JXWA 3R7WB 2JKTI
chains in the Genus database with same CATH topology
5HDSA 4B9OA 5HZHA 4II7A 1G28A 3U2AA 3R7WA 3LI9A 2QYBA 3S7PA 4PKYG 5DFXA 4ETZA 4HP9A 4L9EA 5CX7A 2PHYA 2Z6DA 1VHMA 4OOLA 2OOLA 2LB5A 4HH2A 4M4XA 4BBVA 3NOUC 3FG8A 4P6ZS 3UB9A 4EETB 3DBAA 1D7EA 4LPZA 2YKHA 2M7UA 3JVUA 3S7QA 1STZA 3LFVA 3SW1A 3B42A 2D02A 2PR6A 3MF0A 4I3JA 3GDIA 3T4TA 3RFBA 1OTEA 3H7WB 3E4PA 1TS8A 4ARZA 1OT6A 4DMZA 3EWKA 1TS6A 2XA7M 1N9LA 5TJJA 4I39A 3TJZC 3IS2B 4KQOA 4LRYC 2I9VA 2OWHA 3H7WA 5AVFA 2OAP1 2W3HA 1LSXA 5LBRA 5HDCA 3V67A 2QJ7A 4L9GA 2GJ3A 2PD8A 2VZWA 3IS2A 4Q0IA 5EFWA 4IJGA 3MMHA 2J80A 4HJ4A 5KSHA 1OTBA 3OLOA 4CLCC 2P04A 5HWWA 3LICA 4MN6A 5A8BA 3LIBA 2O99A 1S1YA 2PD7A 3BQ8A 3FPVA 5I5LA 3B47A 3EEAA 4EEUA 5HL6A 1MC0A 2FZ0A 1V9YA 2J3WA 4NXGA 4L9FA 4MN5A 2XROA 2H28A 2P08A 2GX5A 1XJ4A 4UQIM 4CQHA 2G7UA 4YOFA 3PBRA 3UE3A 4MMNA 4MDZA 2VV8A 1S67L 2PDRA 4WLAA 4EEPA 4R3AA 3KYZA 3KX0X 4HH3A 2W0NA 3NOPC 3VOLA 1YSQA 3EOIA 5F69A 1IFQA 3MQ0A 1IOUA 4R38A 3NHQA 3LUQA 3HCYA 3T4SA 4HJ3A 4EU0A 1LT0A 1P97A 3MFXA 3VE3A 5IT5A 2W3GA 2PT7A 4QPRA 5AVEA 3MQOA 2PYPA 4EXOA 2PYRA 1T1CA 1GSVA 2HV1A 4L0LA 2W3DA 3PBQA 2VA0A 2WKQA 4G3VA 3S7NA 1H8MA 2JKRM 1Y28A 2EWWA 3PBSA 4E04A 4P6ZM 4KUOA 2B02A 4UEYA 1F98A 1BYWA 3RTYA 1GSWA 2FH5A 3T4OA 1DP8A 3VE4A 3LIFA 2NUTC 3MXQA 4K08A 3P7NA 3VV4A 4GJ4A 4GW9A 1YAXA 3IBRA 4YNRA 4WEKA 1S4SA 5FL3A 4I3AA 5MC7A 3C30A 4PHTA 4G3WA 1OTAA 1XFQA 4I3IA 1T1BA 1F9IA 1UWNX 3H82A 4ARZB 4R6LA 2YKFA 3C8CA 3BW6A 3MQQA 5HD3A 3EEHA 4GS9A 2QJ5A 4CLCE 5DJTA 1T1AA 3NJAA 2V9AA 3H9WA 1EW0A 3D72A 2L4RA 2VJWA 2Y79A 2KLIA 1NLYA 2KOIA 3BQAA 2GZAA 3UMDA 2W3EA 2NUPC 2K2NA 1OT9A 3EGDC 4ME4A 4NKPA 2V0UA 4DN0A 3OC2A 3FC7A 4F3LB 2OAQ1 4GHIB 4KUKA 1X0OA 3PYPA 5F6AA 5IS1A 4O0PA 5G4ZA 4EQ1A 2J3TC 4O8GA 4BJPA 5DKLA 2MJ6A 1NRJA 2L0WA 4F3LA 3E0YA 4GHIA 3CLOA 1UWPX 3LR3A 3PHYA 2PR5A 3BWLA 4HJ6A 4Q0HA 2D01A 3K3DA 2IA2A 2KX6A 4G3KA 4ZRRA 2P7JA 3UB8A 1WA9A 2W1TB 4BBTA 3JVVA 3LIDA 3EGXC 4HY8A 4Y2FA 2ZMFA 4BBUA 4KQDA 2OWJA 4HI4A 1TF1A 2W1TA 1VB6A 2QHKA 4R70A 3F1PB 4LRZE 4WF0A 3NOTC 3P01A 4CLCB 2ZBBA 2HJ9C 1W63M 4Q0JA 4FOFA 3T4JA 4IUKA 4ETXA 4HP4A 1JNUA 3BY8A 3R4KA 3F1PA 2JKTM 3CUEC 5K5BA 4CLCA 2ZOIA 3HJIA 2JHEA 5DJUA 1S66L 3UB6A 5J3WA 1DP9A 4EUVA 2VGLM 2O9BA 2O9CA 2VLGA 3S7OA 1ODVA 2HGVA 4LRXC 4MN7A 4WELA 1KOUA 1T19A 2VKSA 3HJKA 4MCWA 3C38A 2KDKA 4CLCD 3PBOA 3PR6A 2QWSA 1XJ2A 1OPXA 3PXPA 4NXBA 1OTDA 3E98A 4WN5A 4PAUA 3LYXA 4Y5FA 4JGPA 1XFNA 2VEAA 5DFYA 3LIEA 2BASA 1D06A 3ULFA 4BMWA 1NLZA 4HHDA 5J4EA 2HF6A 4WUJA 4BWIA 4LLOB 3H82B 1ZTUA 5L8MA 3BJNA 4HNBA 2JN7A 5G4YA 1H3QA 2WKPA 4GS9B 5HWTA 2V1BA 2A2LA 2ZMVA 3UB7A 1P9RA 1G6OA 4RQ9A 3E4QA 3LI8A 1MZUA 1T18A 3D3OA 5HDDA 2HJEA 3OCLA 1MKMA 2L1MA 3LR5A 1OJGA 4AFIA 3KSGA 2VX8A 3F1NB 3W2ZA 3OOVA 3CITA 5HWVA 5KIZA 3O5YA 3K3CA 1P9WA 3K2NA 1OJ5A 4Y3IA 4HIAA 1W63Q 3LR4A 4DJ2A 4IUHA 1S1ZA 3F1NA 2JKRI 3OBFA 4O01A 3C2WA 5IU1A 3FPWA 5F68A 2M1CA 4WL9A 3A0RA 2W27A 4I5SA 4NEED 5AJGA 4I38A 2WKRA 2GNXA 3TE8A 4XT2B 4H6JB 3RH8B 5HPIA 3KYQA 1LSWA 3E4OA 3T50A 4IHQA 3KSFA 1S4RA 2QKPA 3G6OA 1LL8A 4EERA 4XT2A 4H6JA 3T4KA 1ZHHB 4JGOA 1DP6A 3MJQA 3T4QA 4GLQA 3ZYTA 4EW7A 1V9ZA 4NXFA 2Y8HA 1YSPA 2M7VA 3OCNA 5DKKA 3LIAA 1TS0A 3UMEA 3BY9A 2XA7S 2R78A 5HSQA 2W1RA 4Z1WA 1N9NA 5HD5A 2ZOHA 2A24B 2W3FA 1YKDA 4OOMA 5F5YA 1N9OA 3PBTA 3ZQ5A 2A24A 2J3TD 3UE6A 4HQAA 4EESA 3MR0A 3KSIA 2O0YA 2VV7A 2XRNA 5TBMB 2K7SA 3PBNA 4PKYA 4WEJA 2XSSA 4YWZA 2B18A 3CAXA 3KSHA 4NXEA 3A0VA 3TW8A 4JGQA 1P0ZA 1TS7A 1XJ6A 3GECA 2Z6CA 3LR0A 1TD5A 5TBMA 5J7EA 2INWA 3TRCA 2EA9A 2LB9A 3F1OB 2O9AA 3CUEA 4FSFA 3CI6A 4UQIS 1NWZA 4GCZA 5C5KA 3CWFA 2VV6A 4JGRA 1OTIA 1UGUA 4HOIA 2V1AA 2EWVA 3EQVA 1DRMA 3F1OA 5DF9A 2K31A 3EQUA 3T4LA 4DJ3A 1XJ3A 3ICYA 2CMNA 3A0SA 1F5MA 1GSXA 5HPFA 3B33A 4B93A 3R7WB 3KO6A 1LSVA 2VGLS 3IBJA 2JKTI 2DMWA 2V0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDS A;  4B9O A;  5HZH A;  1G28 A;  3LI9 A;  4PKY G;  4HP9 A;  4L9E A;  2PHY A;  2Z6D A;  2OOL A;  4HH2 A;  4M4X A;  4BBV A;  3NOU C;  3FG8 A;  3UB9 A;  4EET B;  1D7E A;  4LPZ A;  2YKH A;  3SW1 A;  2D02 A;  2PR6 A;  4I3J A;  3GDI A;  1OTE A;  3H7W B;  3E4P A;  1TS8 A;  1OT6 A;  3EWK A;  1TS6 A;  1N9L A;  4I39 A;  3IS2 B;  4LRY C;  2I9V A;  2OWH A;  3H7W A;  5AVF A;  1LSX A;  5HDC A;  2QJ7 A;  4L9G A;  2GJ3 A;  2PD8 A;  3IS2 A;  5EFW A;  2J80 A;  4HJ4 A;  1OTB A;  3OLO A;  5HWW A;  3LIC A;  4MN6 A;  5A8B A;  3LIB A;  1S1Y A;  2PD7 A;  5I5L A;  4EEU A;  1V9Y A;  4NXG A;  4L9F A;  4MN5 A;  2H28 A;  1XJ4 A;  2VV8 A;  1S67 L;  2PDR A;  4WLA A;  4EEP A;  4R3A A;  3KX0 X;  4HH3 A;  2W0N A;  3NOP C;  3VOL A;  5F69 A;  4R38 A;  3NHQ A;  3LUQ A;  4HJ3 A;  1LT0 A;  1P97 A;  3MFX A;  3VE3 A;  5AVE A;  3MQO A;  2PYP A;  4EXO A;  2PYR A;  1T1C A;  1GSV A;  2HV1 A;  2WKQ A;  1Y28 A;  4E04 A;  4KUO A;  2B02 A;  1F98 A;  1BYW A;  3RTY A;  1GSW A;  1DP8 A;  3VE4 A;  3LIF A;  3MXQ A;  4K08 A;  3P7N A;  4GW9 A;  3IBR A;  1S4S A;  4I3A A;  1OTA A;  1XFQ A;  4I3I A;  1T1B A;  1F9I A;  1UWN X;  3H82 A;  4R6L A;  2YKF A;  3C8C A;  3MQQ A;  5HD3 A;  3EEH A;  4GS9 A;  2QJ5 A;  5DJT A;  1T1A A;  3NJA A;  2V9A A;  3H9W A;  1EW0 A;  3D72 A;  2L4R A;  3UMD A;  1OT9 A;  2V0U A;  4F3L B;  3FC7 A;  4GHI B;  4KUK A;  1X0O A;  3PYP A;  5F6A A;  5IS1 A;  5G4Z A;  4EQ1 A;  5DKL A;  2L0W A;  4F3L A;  4GHI A;  3CLO A;  1UWP X;  3PHY A;  2PR5 A;  3BWL A;  4HJ6 A;  2D01 A;  3K3D A;  2KX6 A;  3UB8 A;  2P7J A;  1WA9 A;  4BBT A;  3LID A;  4HY8 A;  4BBU A;  4KQD A;  2OWJ A;  4HI4 A;  1VB6 A;  2QHK A;  4R70 A;  3F1P B;  4LRZ E;  4WF0 A;  3NOT C;  2ZBB A;  4HP4 A;  1JNU A;  3BY8 A;  3F1P A;  2ZOI A;  3HJI A;  2JHE A;  5DJU A;  1S66 L;  3UB6 A;  5J3W A;  1DP9 A;  2VLG A;  1ODV A;  4LRX C;  1KOU A;  1T19 A;  3HJK A;  2KDK A;  2QWS A;  1XJ2 A;  4NXB A;  1OTD A;  4WN5 A;  3LYX A;  4JGP A;  1XFN A;  2VEA A;  3LIE A;  2BAS A;  1D06 A;  3ULF A;  4HHD A;  5J4E A;  4WUJ A;  4LLO B;  3H82 B;  4HNB A;  2JN7 A;  5G4Y A;  2WKP A;  4GS9 B;  5HWT A;  2V1B A;  3UB7 A;  4RQ9 A;  3E4Q A;  3LI8 A;  1MZU A;  1T18 A;  5HDD A;  2L1M A;  1OJG A;  3F1N B;  5HWV A;  5KIZ A;  3K3C A;  1OJ5 A;  4HIA A;  4DJ2 A;  1S1Z A;  3F1N A;  3C2W A;  5IU1 A;  5F68 A;  2M1C A;  4WL9 A;  3A0R A;  2W27 A;  4I5S A;  4I38 A;  2WKR A;  4XT2 B;  4H6J B;  3RH8 B;  1LSW A;  3E4O A;  3T50 A;  1S4R A;  2QKP A;  3G6O A;  1LL8 A;  4EER A;  4XT2 A;  4H6J A;  4JGO A;  1DP6 A;  3MJQ A;  4EW7 A;  1V9Z A;  4NXF A;  5DKK A;  3LIA A;  1TS0 A;  3UME A;  3BY9 A;  2R78 A;  5HSQ A;  1N9N A;  5HD5 A;  2ZOH A;  2A24 B;  5F5Y A;  1N9O A;  3ZQ5 A;  2A24 A;  3UE6 A;  4HQA A;  4EES A;  3MR0 A;  2VV7 A;  5TBM B;  2K7S A;  4PKY A;  4YWZ A;  3CAX A;  4NXE A;  3A0V A;  4JGQ A;  1P0Z A;  1TS7 A;  1XJ6 A;  3GEC A;  2Z6C A;  5TBM A;  5J7E A;  2INW A;  2EA9 A;  3F1O B;  1NWZ A;  4GCZ A;  3CWF A;  2VV6 A;  4JGR A;  1OTI A;  1UGU A;  4HOI A;  2V1A A;  1DRM A;  3F1O A;  4DJ3 A;  1XJ3 A;  3ICY A;  2CMN A;  3A0S A;  1GSX A;  3B33 A;  1LSV A;  2V0W A; 
#chains in the Genus database with same CATH topology
 5HZH A;  1IKI A;  3DWK A;  1NY0 A;  2JE5 A;  2Z2L B;  4PKY G;  3TOI A;  4UHU A;  1MWT A;  2Y59 A;  5FAO A;  2PHY A;  1ONG A;  4M4X A;  2QMI A;  1J9M A;  1H8Z A;  3UB9 A;  4LPZ A;  4YIN A;  4WZ4 A;  3IF6 C;  3DTE A;  3OPL A;  2V2F F;  1XA1 A;  3LFV A;  3SW1 A;  2D02 A;  4KZ9 A;  4I3J A;  1NJ4 A;  4OQG A;  3O88 A;  1ERM A;  3GMW A;  4LRY C;  2OAP 1;  3N8L A;  2W3H A;  5EOE A;  1XPB A;  1MWR A;  4S2K A;  2H10 A;  4L9G A;  3GRJ A;  2VZW A;  4Q0I A;  2PRF A;  1W7F A;  4RA7 A;  3DAV A;  2P04 A;  2R9X A;  3LIC A;  4MN6 A;  5A8B A;  2PU2 A;  5E2E A;  4OVD A;  3ITB A;  3RXX A;  5HL6 A;  4N1H A;  2WAF A;  3QNB A;  4LV1 A;  1LLB A;  4MN5 A;  2XRO A;  2GX5 A;  4UQI M;  5M18 A;  1L0E A;  4FH4 A;  2GDN A;  3UE3 A;  3LEQ A;  4MDZ A;  5GL9 A;  1M6K A;  2PDR A;  4EEP A;  1ZC2 A;  4R3A A;  5FDS A;  3KYZ A;  5F83 A;  1QMF A;  1YSQ A;  3EOI A;  1IOU A;  3MQ0 A;  2Y2L A;  4EU0 A;  4UA6 A;  3RJU A;  3SOI A;  1GHP A;  3MFX A;  5IT5 A;  1G6A A;  3NY4 A;  1T1C A;  4KG6 A;  2VA0 A;  1H8M A;  4UEY A;  1F98 A;  1O7E A;  4S2N A;  2ZM2 A;  2EXB A;  1PYY A;  1YAX A;  3IBR A;  4YNR A;  4WEK A;  4P6B A;  4Y15 A;  1S4S A;  3FV7 A;  4Y7P A;  5FL3 A;  3LCE A;  3IHA A;  1E3U D;  4UAA A;  1OTA A;  1F9I A;  1UWN X;  3U4L P;  4M3K A;  4R6L A;  2YKF A;  4KZ5 A;  1PWG A;  3EEH A;  2QJ5 A;  1BLS A;  3O87 A;  4H8R A;  1BUL A;  1EW0 A;  3D72 A;  2VJW A;  2KOI A;  3BQA A;  2GZA A;  1XGI A;  1O07 A;  4CPK A;  1MPL A;  3BFD A;  3IXG A;  4QY6 A;  1BSG A;  2BLS A;  4UA9 A;  5G4Z A;  4O8G A;  2RCX A;  4BJP A;  4HBT A;  1NYY A;  1ONH A;  2L0W A;  2C6W B;  3E0Y A;  2OV5 A;  2VGK A;  2P74 A;  1UWP X;  3LR3 A;  5F1G A;  3BFE A;  4E3N A;  2WYX A;  4B88 A;  3BWL A;  1LHY A;  2Y2I A;  4Q0H A;  2D01 A;  2IA2 A;  2W1T B;  4K0W A;  4YFM A;  4R4S A;  4Y2F A;  4WYY A;  2ZMF A;  2EX6 A;  4KQD A;  4HI4 A;  1VB6 A;  1DJA A;  3IWQ A;  3UE1 A;  5CED A;  1YMS A;  2Y2J A;  3P01 A;  3E2K A;  5EOO A;  5EEC A;  2ZQ9 A;  1PW8 A;  5CHJ A;  1CF0 A;  4ZJ1 A;  4EBN A;  2ZQC A;  4IBX A;  4HP4 A;  3BEC A;  3BY8 A;  3R4K A;  3F1P A;  2ZOI A;  3HJI A;  4JPM A;  3UB6 A;  5EVI B;  2WKH A;  3IX3 A;  3P98 A;  2O9C A;  3UDX A;  4R0Q A;  4JF4 A;  1ODV A;  4MN7 A;  4JF6 A;  2J9P A;  3S1Y A;  1YM1 A;  2QWS A;  4LEN A;  1XJ2 A;  1XKZ A;  4NXB A;  3D4F A;  3OPR A;  4KZA A;  1U60 A;  1MKI A;  4OQI A;  4C3Q A;  5DFY A;  4Y0U A;  2EX9 A;  2ZQA A;  4QJG A;  3UDF A;  1K56 A;  1IYO A;  5CEC A;  3DTM A;  3ZGA B;  3M6B A;  2V8F A;  2ZC4 B;  4CJN A;  3N4I A;  3VOY A;  1H3Q A;  3HLG A;  2WKP A;  1ESU A;  5HWT A;  2V1B A;  1TEM A;  1BT5 A;  4EQI A;  2ZD8 A;  3V3S A;  3IF5 A;  5HDD A;  4R3B A;  3LR5 A;  1OJG A;  1HZO A;  3KSG A;  3AGD A;  3T1X A;  1Q2Q A;  3O5Y A;  3JPU A;  3Q07 A;  3NI9 A;  3Q7V B;  1W63 Q;  1S1Z A;  2JKR I;  3QP8 A;  4DRT A;  2M1C A;  2WAE A;  1ESI A;  3A0R A;  3FYZ A;  2VGJ A;  3IH8 A;  4S2I A;  2XFS A;  4I38 A;  4FCF A;  2GNX A;  1S6R A;  3T1Q B;  3SH7 A;  3E4O A;  4E6W A;  1YLT A;  3G6O A;  1LL8 A;  1PIO A;  3VP4 A;  3T4K A;  1ZHH B;  1SKO B;  3N7W A;  3SS4 A;  1DP6 A;  3MJQ A;  3V50 A;  3FZC A;  4NXF A;  1CEG A;  2Y8H A;  1YSP A;  5DKK A;  4S2L A;  3UME A;  2XA7 S;  2R78 A;  2G2W A;  2W1R A;  3PAG A;  4BLM A;  2ZOH A;  2A24 B;  2W3F A;  3CZD A;  3L7H A;  4OOM A;  5I94 A;  4JXG A;  4QU3 A;  1N9O A;  3IX8 A;  3UE6 A;  4EBP A;  3DTI A;  4OQH A;  3KSI A;  2PBD P;  3CHW P;  4S2O A;  2HZ5 A;  2I72 A;  1FR1 A;  1FCM A;  3KSH A;  4MNR A;  3Q7Z A;  1Z09 A;  3LR0 A;  5DF7 A;  5TBM A;  3DTK A;  3LEZ A;  1JWZ A;  2INW A;  5CER A;  1YMX A;  5KSC A;  3F1O B;  2O9A A;  1ES4 A;  1K57 C;  1OTI A;  4OPR A;  2EWV A;  1AXB A;  3WS0 A;  5FAP A;  1FQG A;  2CMN A;  3A0S A;  4E3J A;  3B33 A;  3FKW A;  2V1Z A;  3V39 A;  1LSV A;  5HAI A;  2DMW A;  1H8Y A;  3U2A A;  3UN7 A;  1OME A;  1LL9 A;  3R7W A;  3LI9 A;  3I7J A;  5DFX A;  4HP9 A;  4E3I A;  2LB5 A;  4F94 A;  3UPP A;  4BBV A;  3DBA A;  5CGX A;  3JVU A;  5U47 A;  1STZ A;  3B42 A;  2Y2O A;  3VSL A;  5EVE A;  5GLC A;  4E3K A;  1OTE A;  3H7W B;  5FQJ A;  4LCM A;  1KGF A;  2Y55 A;  1N4O A;  2XA7 M;  4PM8 A;  5TJJ A;  4XUZ A;  4PM5 A;  2V20 A;  1ES2 A;  5AVF A;  3UB5 P;  1LSX A;  3IH9 A;  3WS5 A;  5JYO A;  5EFW A;  1Y4O A;  1ZKJ A;  2J80 A;  1K25 A;  5L07 A;  5E2F A;  5HWW A;  3LIB A;  2DCF A;  5FQM A;  3EEA A;  4LV0 A;  2WZZ A;  4EEU A;  3NCK A;  4KEN B;  2FZ0 A;  2ZC5 B;  3CMZ A;  2Q9N A;  3FWL A;  3C4P A;  3MZD A;  2P08 A;  4CQH A;  3PBR A;  4GZB A;  2VV8 A;  2FFF B;  4WLA A;  3O3V A;  3KX0 X;  4U0T A;  5GHZ A;  2QPN A;  3UDI A;  1IEL A;  3TSG A;  3BFC A;  2ZLY A;  3NOP C;  4S2N C;  3NHQ A;  1RGZ A;  4IVK A;  3LUQ A;  2ZMA A;  4U3T A;  3HCY A;  3T4S A;  4HJ3 A;  1LT0 A;  3OPP A;  4S2M A;  5FA7 A;  3Q1F A;  5AVE A;  3MQO A;  4EXO A;  5JYP A;  3SH8 A;  2FFY A;  4G3V A;  1Y28 A;  5J8X A;  2EWW A;  1E3U A;  3PBS A;  5HAQ A;  1CJF A;  1I5Q A;  1BYW A;  5CGS A;  1GSW A;  5E43 A;  1DP8 A;  3VE4 A;  4N9L A;  3LIF A;  1K57 A;  2UWX A;  2NUT C;  4NK3 A;  4Q8I A;  1SDE A;  4B4X A;  2EX2 A;  3ISG A;  3G31 A;  1IYS A;  3AGF A;  4KZ4 A;  3H82 A;  4MLL A;  3Q81 A;  1J3W A;  3C8C A;  4JF5 A;  1YLP A;  3BW6 A;  1T1A A;  3GR2 A;  3NJA A;  4GDB A;  2JKF A;  2V9A A;  3W4P A;  4UA7 A;  3B3X A;  3UMD A;  1XXM A;  1JTD A;  5CGW A;  2HDQ A;  4DN0 A;  3LY4 A;  4GHI B;  5FI2 A;  3KYE A;  5TGF A;  1X0O A;  2XR0 A;  3PYP A;  4O0P A;  3LGO A;  4E3O A;  4Y0T A;  5M19 A;  5F1F A;  5DKL A;  5E2H A;  3PTE A;  2ZL1 B;  5G18 A;  4N9K A;  1MY8 A;  4XUX A;  3PHY A;  3HLD A;  5FEG A;  3HBR A;  3QHY A;  2PR5 A;  4HJ6 A;  2EFX A;  2J7V A;  3EGX C;  3ZDJ A;  3NBL A;  1GCE A;  4HBU A;  5FI7 A;  1K54 A;  5EE8 A;  3ZVT A;  5EM1 A;  2W1T A;  4P85 A;  3AGE A;  2QHK A;  4R1G A;  1NZU A;  2HJ9 C;  3BRM A;  4FOF A;  3T4J A;  2XFT A;  4IUK A;  2JKT M;  4KZ7 A;  1JWP A;  5DJU A;  1S66 L;  5J3W A;  4LCL A;  1DP9 A;  5DTK A;  2O9B A;  5E2G A;  3G34 A;  4WEL A;  1IYP A;  1K0K A;  2H0T A;  1FCO A;  2B5R A;  3HJK A;  5HX9 A;  5EVI A;  2WZX A;  2KDK A;  3MFD A;  4K91 A;  3N8R A;  3HUO A;  3PXP A;  3SS5 A;  3ITA A;  3UPN A;  4PAU A;  4X1M A;  4KQQ A;  4XXR A;  1D06 A;  3ULF A;  3CG5 A;  2ZJ9 A;  3WRT A;  3QNC A;  4LLO B;  3H82 B;  1ZTU A;  2Z2M B;  4ZDX A;  1H5X A;  4OP5 A;  5FQI A;  4ZJ3 A;  5G4Y A;  3UB7 A;  3A3J A;  3CJM A;  3ZNY A;  5FEF A;  4BL3 A;  3W4O A;  5BOH A;  1MKM A;  2QZ6 A;  3IHB A;  1SZV A;  3F1N B;  3W2Z A;  3IQA A;  3CIT A;  4LV2 A;  3K3C A;  1P9W A;  3K2N A;  3SS3 A;  2Q0O A;  3G32 A;  3OBF A;  4O01 A;  5F68 A;  4WL9 A;  3Q7V A;  4X25 A;  4IED A;  5AJG A;  4BD0 A;  5EM0 A;  3TE8 A;  3RH8 B;  1YT4 A;  2E8J A;  3IXH A;  5GHX A;  5TR7 A;  4IHQ A;  3KSF A;  1BZA A;  1S4R A;  1PZP A;  1CQA A;  2QKP A;  1KDS A;  5HL1 A;  1AWI A;  4GKU A;  3ZYT A;  4EW7 A;  2M7V A;  3VP3 A;  3OCN A;  1SKO A;  2J9O A;  4KG2 A;  2ZC6 B;  3C4O A;  4Z1W A;  5TFQ A;  4JLF A;  4K0X A;  4QHC A;  1KGE A;  3L9K A;  5GLB A;  5AQ9 A;  1A0K A;  5F5Y A;  3IXD A;  1HTZ A;  2A24 A;  2J3T D;  1BTL A;  2HP9 A;  3HUN A;  4PMA A;  4A5R A;  3MR0 A;  2ZC3 B;  4PKY A;  3V5M A;  2B18 A;  4X6T A;  1TS7 A;  2JCH A;  1Q2P A;  2Z6C A;  1ALQ A;  1TD5 A;  3TRC A;  3WS2 A;  4B4Z A;  1PFL A;  2G2U A;  3CI6 A;  4KG5 A;  4BD1 A;  1NWZ A;  5C5K A;  1SCW A;  4RX3 A;  4EBL A;  2WK0 A;  3CWF A;  4KZB A;  5EVI D;  4OH0 A;  5FSR A;  3F1O A;  5DF9 A;  4QY5 A;  3EQU A;  4DJ3 A;  1XJ3 A;  4Y0O A;  1F5M A;  1K4F A;  3UO9 A;  2VGL S;  3ZFZ A;  5CRF A;  5HDS A;  4DXC A;  1SHV A;  5AQ7 A;  2XF3 A;  2QYB A;  4X69 A;  3S7P A;  3M2J A;  1HD8 A;  4FD8 A;  4JKT A;  5CX7 A;  4X68 A;  1E25 A;  2ZC7 A;  2Z6D A;  1VHM A;  2ACG A;  3BEB A;  2OOL A;  4OOL A;  3NIA A;  1YLY A;  3HLW A;  2WKE A;  1KE0 A;  1MWS A;  2OLV A;  1H0M A;  4EET B;  1D7E A;  2YKH A;  2M7U A;  3S7Q A;  4WZ5 A;  3G30 A;  2PR6 A;  3VOZ A;  3MF0 A;  2WGV A;  3ZVW A;  3T4T A;  3MSH A;  4BQM A;  3E4P A;  1TS8 A;  4ARZ A;  3Q82 A;  4DMZ A;  1TS6 A;  4MBK A;  4OON A;  1N9L A;  1Z6F A;  3TJZ C;  3QP4 A;  3IS2 B;  2I9V A;  2OWH A;  3H7W A;  3MXR A;  5LBR A;  3UY6 A;  3BLS A;  3V67 A;  1FR6 A;  2PD8 A;  1IYQ A;  1ZG6 A;  3O86 A;  4GN2 A;  3MMH A;  4HJ4 A;  5KSH A;  3OPH A;  1DJC A;  1OTB A;  3A3E A;  2AVX A;  2Y2M A;  2EXA A;  2PD7 A;  4C75 A;  5I5L A;  4P87 A;  3ZHH A;  3B47 A;  4KZ8 A;  1F2K A;  2HP5 A;  2WKI A;  3T1R A;  1MC0 A;  3QP5 A;  1V9Y A;  3BYD A;  4L9F A;  1KDW A;  1FCN A;  2HDU A;  1QME A;  3VP2 A;  1CEF A;  4MMN A;  2A3U A;  1NZO A;  1E4D A;  3DW0 A;  1VM1 A;  1YPR A;  1VET A;  2X01 A;  1K55 C;  2Y4A A;  2H0Y A;  3VE3 A;  2W3G A;  3G2Z A;  5M1A A;  2PYP A;  2PYR A;  2JBF A;  3PBQ A;  4WMC D;  4ZBE A;  3HLB A;  4DE2 A;  2JKR M;  4DDS A;  1GA9 A;  1K38 A;  2CC1 A;  1PNE A;  2EX8 A;  3RTY A;  2FH5 A;  3T4O A;  1GHI A;  5CXW A;  3MXQ A;  3VSK A;  3VMA A;  2WGW B;  4Z9Q A;  5MC7 A;  3C30 A;  1SKF A;  4NET A;  3HRE A;  4PHT A;  4I3I A;  4ARZ B;  5FQQ A;  5HD3 A;  4ZAM A;  4MEZ A;  1L3L A;  3A3I A;  3H9W A;  4DE0 A;  1FIK A;  2Y79 A;  4RVA A;  2KLI A;  4O7D A;  4OPZ A;  2W3E A;  4DE1 A;  2K2N A;  1OT9 A;  3EGD C;  4OLD A;  3OC2 A;  3FC7 A;  3M2K A;  4F3L B;  2OAQ 1;  1PRQ A;  4E3M A;  1K54 C;  5IS1 A;  3MXS A;  1MXO A;  1KGG A;  4EQ1 A;  2J3T C;  5L2F A;  2MJ6 A;  3A3F A;  4GHI A;  1M40 A;  3GTC A;  3CLO A;  5D3O A;  4EV4 A;  2ZL1 A;  3K3D A;  3UB8 A;  2P7J A;  1WA9 A;  1WYC A;  3N6I A;  3JVV A;  4HY8 A;  3ZG5 A;  2Q9M A;  4BBU A;  3HL9 A;  4PM7 A;  5EVI C;  4HES A;  3IWO A;  3LY3 A;  4WF0 A;  4CLC B;  2ZBB A;  2IWB A;  3MKE A;  1W63 M;  4Q0J A;  1VET B;  4ETX A;  5HAR A;  3CUE C;  5L09 A;  2Y2G A;  4LGW A;  1YLW A;  1K6R A;  1YLZ A;  3S7O A;  2HGV A;  4LRX C;  3VP1 A;  1KOU A;  3VFF A;  5A90 A;  2Y91 A;  2XD1 A;  1BLP A;  3C38 A;  2HDS A;  3IX4 A;  4CLC D;  3PR6 A;  5A93 A;  1OPX A;  5HW3 A;  4OOY A;  1WYB A;  1W5D A;  3LO7 A;  4Y5F A;  3LYX A;  4JGP A;  4OP8 A;  1XA7 A;  2IWC A;  1XFN A;  4U0X A;  3C7V A;  3NDG A;  3LIE A;  2BAS A;  4FH2 A;  4D2O A;  4LV3 A;  1NLZ A;  4WUJ A;  3T12 B;  1K55 A;  1KE3 A;  4BWI A;  4DF6 A;  2PU4 A;  4FUW A;  4MBH A;  4JBF A;  5L8M A;  3MBZ A;  3IWI A;  1PW1 A;  3IXB A;  1NRF A;  1FOF A;  1P9R A;  4RQ9 A;  3E4Q A;  3NDE A;  2XK1 A;  1T18 A;  1MWU A;  3D3O A;  3SH9 A;  2L1M A;  4AFI A;  4HEF A;  2VX8 A;  3OOV A;  4DDY A;  5KMW A;  5KIZ A;  1PI5 A;  1K4E A;  1OJ5 A;  4Y3I A;  4HIA A;  4GOG A;  3LR4 A;  2HDR A;  1PWC A;  4IUH A;  3F1N A;  3A3D A;  3T1S A;  5DVA A;  4I5S A;  4NEE D;  1W79 A;  1G68 A;  5A92 A;  1XX2 A;  1YQS A;  2WKR A;  5EV0 A;  3P09 A;  4XT2 B;  4H6J B;  4X1L A;  4BEN A;  5HPI A;  3MKF A;  3KYQ A;  3T50 A;  4X55 A;  3NEC A;  1N9B A;  3OZH A;  1TDG A;  3G2Y A;  2B95 A;  4EER A;  4IVI A;  1RP5 A;  4JGO A;  2BG1 A;  3T4Q A;  3D9Y A;  1Y54 A;  3BFF A;  1V9Z A;  3WS1 A;  3BM6 A;  1JWV A;  1KE4 A;  4DKI A;  1TS0 A;  3BY9 A;  5HSQ A;  4RYE A;  5HD5 A;  3UE0 A;  2XLN A;  3DWZ A;  1YKD A;  1L0D A;  3ZQ5 A;  2X71 A;  5CTN A;  4EUZ A;  4KZ3 A;  4Y13 A;  2O0Y A;  2VV7 A;  2K7S A;  2XGN A;  2BTF P;  3CAX A;  1CI8 A;  2P9V A;  3G35 A;  4NXE A;  3A0V A;  1P0Z A;  1XJ6 A;  3GEC A;  2DRW A;  5J7E A;  1L0F A;  3VFH A;  2Y2Q A;  4PPR A;  3G4P A;  2EA9 A;  1I2W A;  3CUE A;  4FSF A;  5AQA A;  4GCZ A;  1KVL A;  2VV6 A;  3UPO A;  4HOI A;  2V1A A;  3EQV A;  4ID4 A;  1NYM A;  1CI9 A;  1TVF A;  2K31 A;  3HLF A;  2JKG A;  3ICY A;  2H5S A;  1SDN A;  1GSX A;  3KO6 A;  3IBJ A;  4WZ5 C;  5CTM A;  2UV0 E;  2V0W A;  4B9O A;  4II7 A;  5FI6 A;  1G28 A;  5CHM A;  3W8K A;  3MZF A;  1ES3 A;  1NXY A;  4MBF A;  4ETZ A;  4L9E A;  5FQ9 A;  1S0W A;  5EPH A;  2XQZ A;  4HH2 A;  3NOU C;  1L0G A;  3FG8 A;  4P6Z S;  2ZM0 A;  3IT9 A;  2JC7 A;  5GHY A;  4GD8 A;  4GDN A;  3M6H A;  3GDI A;  2ZQD A;  3RFB A;  4OPQ A;  1LI9 A;  5DTS A;  1OT6 A;  3EWK A;  3BFG A;  3E2L A;  2Y2P A;  4I39 A;  1HVB A;  4KQO A;  1JTG A;  5CEB A;  4RX2 A;  5HDC A;  3IF6 A;  2QJ7 A;  2GJ3 A;  3IS2 A;  4BL2 A;  2VK3 A;  4IJG A;  3C5A A;  1PWD A;  4N92 A;  3C7U A;  3OLO A;  4CLC C;  4R4R A;  3BQ8 A;  2O99 A;  1S1Y A;  3FPV A;  4OKP A;  3VP0 A;  3WWX A;  2RL3 A;  2OSU A;  5FDH A;  2WUQ A;  2J3W A;  2P9V B;  4NXG A;  4R3J A;  2H28 A;  5DF8 A;  1XJ4 A;  4EWF A;  1HLU P;  5A91 A;  4E6X A;  1G5U A;  2G7U A;  4YOF A;  1ZG4 A;  1S67 L;  5F82 A;  3NUL A;  4ZTK A;  1W8Q A;  1K6S A;  3UNW A;  5AQB A;  4HH3 A;  3V3R A;  5CHU A;  4ESP A;  4Y17 A;  2W0N A;  3HLC A;  4ZJ2 A;  3S22 A;  1WE4 A;  2Y2N A;  4C6Y A;  3VOL A;  4WMC A;  1W8Y A;  5F69 A;  3W4Q A;  1IFQ A;  4R38 A;  4QB8 A;  4X53 A;  3ZCZ A;  1P97 A;  2PT7 A;  4QPR A;  3RXW A;  4S2P A;  2XD5 A;  1GSV A;  2HV1 A;  4L0L A;  2W3D A;  3S7N A;  2WKQ A;  4E04 A;  4P6Z M;  4KUO A;  2ZQ8 A;  2B02 A;  4S2J A;  1RCJ A;  2A49 A;  5GLD A;  4GB7 A;  2ZQ7 A;  4K08 A;  3P7N A;  3VV4 A;  2Y2H A;  4GJ4 A;  4GW9 A;  4I3A A;  2HP6 A;  4G3W A;  1FSY A;  1XFQ A;  4NG2 A;  1T1B A;  2WGW A;  1BUE A;  4N1X A;  3CPT A;  3MQQ A;  4E3L A;  4GS9 A;  4CLC E;  5DJT A;  1D1J A;  2XH9 A;  2L4R A;  1NLY A;  1GA0 A;  2NUP C;  3IF6 B;  4ME4 A;  4NKP A;  2V0U A;  4D60 A;  2E8I A;  4KUK A;  4KQR A;  5F6A A;  3GV9 A;  3WRZ A;  4DXB A;  3WS4 A;  1NRJ A;  1EI5 A;  4F3L A;  1YLJ A;  5FAS A;  1TDL A;  1IKG A;  4PM9 A;  2KX6 A;  4ZRR A;  3NC8 A;  4G3K A;  4BBT A;  2ZM8 A;  3LID A;  5EUA A;  1IEM A;  2OWJ A;  1TF1 A;  3ZG0 A;  5EVL A;  2XDM A;  2C5W B;  3GVB A;  4R70 A;  3F1P B;  3JYI A;  4LRZ E;  3ZG8 B;  3NOT C;  2V8C A;  1ES5 A;  1FIL A;  5FAT A;  4OLG A;  1CK3 A;  1JNU A;  5DTT A;  5K5B A;  4CLC A;  3BLM A;  2JHE A;  2WAD A;  1XGJ A;  4EUV A;  2VGL M;  2VLG A;  3FKV A;  2R9W A;  5HAP A;  5L10 A;  1DJB A;  1T19 A;  2VKS A;  4MCW A;  3MZE A;  3PBO A;  2HPB A;  4WBG A;  1OTD A;  2WGI A;  3E98 A;  4WN5 A;  1JVJ A;  2VEA A;  4JXV A;  4BMW A;  4HHD A;  5J4E A;  2HF6 A;  4PM6 A;  1VEU A;  1VQQ A;  4QWO A;  1XP4 A;  1RGY A;  4FTX A;  3CPT B;  3BJN A;  4HNB A;  2JN7 A;  5IHV A;  1MBL A;  4GS9 B;  2A2L A;  2ZMV A;  1G6O A;  2IWD A;  1K56 D;  3LI8 A;  1MZU A;  3QP6 A;  5FAQ A;  2HJE A;  3OCL A;  4GD6 A;  4DE3 A;  4LFU A;  3S4X A;  5HWV A;  1I2S A;  2J8Y A;  1ACF A;  3PAE A;  5GLA A;  4DJ2 A;  1EWZ A;  3C2W A;  3MS6 A;  3FPW A;  5IU1 A;  3ZG7 B;  4OPY A;  2W27 A;  2XEP A;  2PBY A;  3HUM A;  4WM9 A;  1C3B A;  1LSW A;  3TG9 A;  1FSW A;  3SZT A;  4XT2 A;  4H6J A;  1LI0 A;  2PAV P;  3ZG9 B;  1KVM A;  4GLQ A;  1GHM A;  3LIA A;  5KZH A;  4QD4 A;  1N9N A;  1L2S A;  1PZO A;  4X56 A;  3N8S A;  3PBT A;  4GNU A;  4HQA A;  2Y2K A;  1ERQ A;  3GQZ A;  4EES A;  1LL5 A;  3HLE A;  2X02 A;  2XRN A;  5TBM B;  1DY6 A;  3PBN A;  3QP2 A;  4JXS A;  4WEJ A;  2DNS A;  2XSS A;  4YWZ A;  4P0M A;  3TW8 A;  4OQ0 A;  5HFO A;  4JGQ A;  4IBR A;  3ZNT A;  1BLC A;  2OLU A;  2LB9 A;  1ERO A;  3QP1 A;  1BLH A;  5FQK A;  4UQI S;  1VEU B;  4KZ6 A;  4R23 A;  4JGR A;  1UGU A;  3HVF A;  1DRM A;  3T4L A;  1PI4 A;  2EFU A;  3GSG A;  5HPF A;  4B93 A;  4JXW A;  3R7W B;  2JKT I; 
#chains in the Genus database with same CATH homology
 5HDS A;  4B9O A;  5HZH A;  4II7 A;  1G28 A;  3U2A A;  3R7W A;  3LI9 A;  2QYB A;  3S7P A;  4PKY G;  5DFX A;  4ETZ A;  4HP9 A;  4L9E A;  5CX7 A;  2PHY A;  2Z6D A;  1VHM A;  4OOL A;  2OOL A;  2LB5 A;  4HH2 A;  4M4X A;  4BBV A;  3NOU C;  3FG8 A;  4P6Z S;  3UB9 A;  4EET B;  3DBA A;  1D7E A;  4LPZ A;  2YKH A;  2M7U A;  3JVU A;  3S7Q A;  1STZ A;  3LFV A;  3SW1 A;  3B42 A;  2D02 A;  2PR6 A;  3MF0 A;  4I3J A;  3GDI A;  3T4T A;  3RFB A;  1OTE A;  3H7W B;  3E4P A;  1TS8 A;  4ARZ A;  1OT6 A;  4DMZ A;  3EWK A;  1TS6 A;  2XA7 M;  1N9L A;  5TJJ A;  4I39 A;  3TJZ C;  3IS2 B;  4KQO A;  4LRY C;  2I9V A;  2OWH A;  3H7W A;  5AVF A;  2OAP 1;  2W3H A;  1LSX A;  5LBR A;  5HDC A;  3V67 A;  2QJ7 A;  4L9G A;  2GJ3 A;  2PD8 A;  2VZW A;  3IS2 A;  4Q0I A;  5EFW A;  4IJG A;  3MMH A;  2J80 A;  4HJ4 A;  5KSH A;  1OTB A;  3OLO A;  4CLC C;  2P04 A;  5HWW A;  3LIC A;  4MN6 A;  5A8B A;  3LIB A;  2O99 A;  1S1Y A;  2PD7 A;  3BQ8 A;  3FPV A;  5I5L A;  3B47 A;  3EEA A;  4EEU A;  5HL6 A;  1MC0 A;  2FZ0 A;  1V9Y A;  2J3W A;  4NXG A;  4L9F A;  4MN5 A;  2XRO A;  2H28 A;  2P08 A;  2GX5 A;  1XJ4 A;  4UQI M;  4CQH A;  2G7U A;  4YOF A;  3PBR A;  3UE3 A;  4MMN A;  4MDZ A;  2VV8 A;  1S67 L;  2PDR A;  4WLA A;  4EEP A;  4R3A A;  3KYZ A;  3KX0 X;  4HH3 A;  2W0N A;  3NOP C;  3VOL A;  1YSQ A;  3EOI A;  5F69 A;  1IFQ A;  3MQ0 A;  1IOU A;  4R38 A;  3NHQ A;  3LUQ A;  3HCY A;  3T4S A;  4HJ3 A;  4EU0 A;  1LT0 A;  1P97 A;  3MFX A;  3VE3 A;  5IT5 A;  2W3G A;  2PT7 A;  4QPR A;  5AVE A;  3MQO A;  2PYP A;  4EXO A;  2PYR A;  1T1C A;  1GSV A;  2HV1 A;  4L0L A;  2W3D A;  3PBQ A;  2VA0 A;  2WKQ A;  4G3V A;  3S7N A;  1H8M A;  2JKR M;  1Y28 A;  2EWW A;  3PBS A;  4E04 A;  4P6Z M;  4KUO A;  2B02 A;  4UEY A;  1F98 A;  1BYW A;  3RTY A;  1GSW A;  2FH5 A;  3T4O A;  1DP8 A;  3VE4 A;  3LIF A;  2NUT C;  3MXQ A;  4K08 A;  3P7N A;  3VV4 A;  4GJ4 A;  4GW9 A;  1YAX A;  3IBR A;  4YNR A;  4WEK A;  1S4S A;  5FL3 A;  4I3A A;  5MC7 A;  3C30 A;  4PHT A;  4G3W A;  1OTA A;  1XFQ A;  4I3I A;  1T1B A;  1F9I A;  1UWN X;  3H82 A;  4ARZ B;  4R6L A;  2YKF A;  3C8C A;  3BW6 A;  3MQQ A;  5HD3 A;  3EEH A;  4GS9 A;  2QJ5 A;  4CLC E;  5DJT A;  1T1A A;  3NJA A;  2V9A A;  3H9W A;  1EW0 A;  3D72 A;  2L4R A;  2VJW A;  2Y79 A;  2KLI A;  1NLY A;  2KOI A;  3BQA A;  2GZA A;  3UMD A;  2W3E A;  2NUP C;  2K2N A;  1OT9 A;  3EGD C;  4ME4 A;  4NKP A;  2V0U A;  4DN0 A;  3OC2 A;  3FC7 A;  4F3L B;  2OAQ 1;  4GHI B;  4KUK A;  1X0O A;  3PYP A;  5F6A A;  5IS1 A;  4O0P A;  5G4Z A;  4EQ1 A;  2J3T C;  4O8G A;  4BJP A;  5DKL A;  2MJ6 A;  1NRJ A;  2L0W A;  4F3L A;  3E0Y A;  4GHI A;  3CLO A;  1UWP X;  3LR3 A;  3PHY A;  2PR5 A;  3BWL A;  4HJ6 A;  4Q0H A;  2D01 A;  3K3D A;  2IA2 A;  2KX6 A;  4G3K A;  4ZRR A;  2P7J A;  3UB8 A;  1WA9 A;  2W1T B;  4BBT A;  3JVV A;  3LID A;  3EGX C;  4HY8 A;  4Y2F A;  2ZMF A;  4BBU A;  4KQD A;  2OWJ A;  4HI4 A;  1TF1 A;  2W1T A;  1VB6 A;  2QHK A;  4R70 A;  3F1P B;  4LRZ E;  4WF0 A;  3NOT C;  3P01 A;  4CLC B;  2ZBB A;  2HJ9 C;  1W63 M;  4Q0J A;  4FOF A;  3T4J A;  4IUK A;  4ETX A;  4HP4 A;  1JNU A;  3BY8 A;  3R4K A;  3F1P A;  2JKT M;  3CUE C;  5K5B A;  4CLC A;  2ZOI A;  3HJI A;  2JHE A;  5DJU A;  1S66 L;  3UB6 A;  5J3W A;  1DP9 A;  4EUV A;  2VGL M;  2O9B A;  2O9C A;  2VLG A;  3S7O A;  1ODV A;  2HGV A;  4LRX C;  4MN7 A;  4WEL A;  1KOU A;  1T19 A;  2VKS A;  3HJK A;  4MCW A;  3C38 A;  2KDK A;  4CLC D;  3PBO A;  3PR6 A;  2QWS A;  1XJ2 A;  1OPX A;  3PXP A;  4NXB A;  1OTD A;  3E98 A;  4WN5 A;  4PAU A;  3LYX A;  4Y5F A;  4JGP A;  1XFN A;  2VEA A;  5DFY A;  3LIE A;  2BAS A;  1D06 A;  3ULF A;  4BMW A;  1NLZ A;  4HHD A;  5J4E A;  2HF6 A;  4WUJ A;  4BWI A;  4LLO B;  3H82 B;  1ZTU A;  5L8M A;  3BJN A;  4HNB A;  2JN7 A;  5G4Y A;  1H3Q A;  2WKP A;  4GS9 B;  5HWT A;  2V1B A;  2A2L A;  2ZMV A;  3UB7 A;  1P9R A;  1G6O A;  4RQ9 A;  3E4Q A;  3LI8 A;  1MZU A;  1T18 A;  3D3O A;  5HDD A;  2HJE A;  3OCL A;  1MKM A;  2L1M A;  3LR5 A;  1OJG A;  4AFI A;  3KSG A;  2VX8 A;  3F1N B;  3W2Z A;  3OOV A;  3CIT A;  5HWV A;  5KIZ A;  3O5Y A;  3K3C A;  1P9W A;  3K2N A;  1OJ5 A;  4Y3I A;  4HIA A;  1W63 Q;  3LR4 A;  4DJ2 A;  4IUH A;  1S1Z A;  3F1N A;  2JKR I;  3OBF A;  4O01 A;  3C2W A;  5IU1 A;  3FPW A;  5F68 A;  2M1C A;  4WL9 A;  3A0R A;  2W27 A;  4I5S A;  4NEE D;  5AJG A;  4I38 A;  2WKR A;  2GNX A;  3TE8 A;  4XT2 B;  4H6J B;  3RH8 B;  5HPI A;  3KYQ A;  1LSW A;  3E4O A;  3T50 A;  4IHQ A;  3KSF A;  1S4R A;  2QKP A;  3G6O A;  1LL8 A;  4EER A;  4XT2 A;  4H6J A;  3T4K A;  1ZHH B;  4JGO A;  1DP6 A;  3MJQ A;  3T4Q A;  4GLQ A;  3ZYT A;  4EW7 A;  1V9Z A;  4NXF A;  2Y8H A;  1YSP A;  2M7V A;  3OCN A;  5DKK A;  3LIA A;  1TS0 A;  3UME A;  3BY9 A;  2XA7 S;  2R78 A;  5HSQ A;  2W1R A;  4Z1W A;  1N9N A;  5HD5 A;  2ZOH A;  2A24 B;  2W3F A;  1YKD A;  4OOM A;  5F5Y A;  1N9O A;  3PBT A;  3ZQ5 A;  2A24 A;  2J3T D;  3UE6 A;  4HQA A;  4EES A;  3MR0 A;  3KSI A;  2O0Y A;  2VV7 A;  2XRN A;  5TBM B;  2K7S A;  3PBN A;  4PKY A;  4WEJ A;  2XSS A;  4YWZ A;  2B18 A;  3CAX A;  3KSH A;  4NXE A;  3A0V A;  3TW8 A;  4JGQ A;  1P0Z A;  1TS7 A;  1XJ6 A;  3GEC A;  2Z6C A;  3LR0 A;  1TD5 A;  5TBM A;  5J7E A;  2INW A;  3TRC A;  2EA9 A;  2LB9 A;  3F1O B;  2O9A A;  3CUE A;  4FSF A;  3CI6 A;  4UQI S;  1NWZ A;  4GCZ A;  5C5K A;  3CWF A;  2VV6 A;  4JGR A;  1OTI A;  1UGU A;  4HOI A;  2V1A A;  2EWV A;  3EQV A;  1DRM A;  3F1O A;  5DF9 A;  2K31 A;  3EQU A;  3T4L A;  4DJ3 A;  1XJ3 A;  3ICY A;  2CMN A;  3A0S A;  1F5M A;  1GSX A;  5HPF A;  3B33 A;  4B93 A;  3R7W B;  3KO6 A;  1LSV A;  2VGL S;  3IBJ A;  2JKT I;  2DMW A;  2V0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...