2L57A

Solution structure of an uncharacterized thioredoin-like protein from clostridium perfringens
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
b'MSLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANIVPTTVFLDKEGNKFYVHQGLMRKNNIETILNSLGVKEGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution Structure of an Uncharacterized Thioredoin-like Protein from Clostridium perfringens
rcsb
source organism Clostridium perfringens
molecule tags Structural genomics, unknown function
total genus 41
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2l57A00
1Z3EA 1DE1A 2LUSA 5HR2A 1FVJA 2GSSA 4G19A 1TI1A 2REMA 1ZZYA 2HYXA 1HQOA 4NAXA 3IAM2 3TGZA 2VL2A 1RK4A 4F82A 1JHBA 3FK8A 4TOPA 1K3YA 2AAWA 2JACA 3C71A 2RUFA 4I2UA 4ZL9A 4MK3A 4LMVA 2JSYA 3TKQA 1EP7A 3F8UA 5HR3A 2A4VA 4P3YB 1K0BA 4XIHA 4PGTA 2CZ2A 1XOAA 1N2AA 3H79A 4JZQA 1TRWA 4EXJA 2LV3A 2M72A 3UEMA 3VWUA 2H1AA 2E2GA 2IIYA 1GSDA 4AJ6A 2LQOA 2FY6A 4KDUA 2VAFA 2ALBA 5AISA 3GRXA 4MPGA 3Q74A 1GUMA 4JR6A 3KGKA 4Q5NA 4GRFA 3H93A 1PMTA 1TI3A 1GL8A 3LG6A 4LMWA 2VL2C 4EDZA 4BWSA 4NV2A 4POBA 2B7KA 3D0ZA 4IHUA 1K0OA 5G31A 3GL5A 3GURA 2H0GA 2C80A 1PL2A 5CRDA 1K0DA 5A4UA 1HYUA 1GRXA 1F3AA 2N5FA 2VL9A 2XPDA 2I81A 2MMNA 5IIZA 4KH7A 5E4WA 1VGLA 2QC7A 3ZLPA 4D73B 3BCKA 4IGJA 1Z6NA 1E2YA 4D73A 3FZ5A 2OE3A 4IP1A 3ZVJD 2YWNA 2YZUA 3GFKA 3N9JA 3H1NA 5DDLA 1TW9A 1I5GA 1SKSB 4TR4A 3ZIJA 2G2QA 4RI6A 5IMDA 3LEFA 3LGCA 2K8VA 1ML6A 2DSAA 5H5SA 4OCEA 3DEXA 2IMFA 1A23A 3DD3A 4G9HA 2CX3A 5CRHA 3RHBA 1LU4A 1K3LA 4EC0A 3DVXA 2K6VA 5G5EA 3HCZA 1AIUA 3EURA 3KMOA 1PL1A 3KIJA 1JLWA 5KN2A 4LA1A 5DALB 3QDNA 3KXOA 1X5EA 1EWXA 2MMOA 1AAZA 5DALA 4CW9A 2PMTA 3ZZXA 2P5QA 4KAEA 3DWVA 2H8LA 1TXXA 4G2EA 1PX6A 1A2MA 1ACVA 2HRFA 2CAQA 2JU5A 2F8AA 1G7EA 1XWKA 2VCWA 2PGTA 3M8NA 3ERFA 3GX8A 2VCZA 4MJCA 1EV9A 2DJ3A 2PUKC 3KM6A 1ERUA 2DJKA 1SK2A 2EIQA 5IMCA 1MTCA 4RI7A 5DJLA 1FOVA 4BWQA 2WB9A 1OE7A 3DRNA 2GQLA 5IOWA 1CQGA 1PQNA 2LSTA 3RPPA 1X5CA 3KMNA 2VL3A 2YANA 3NZNA 2K18A 3HVSA 4O32A 1C72A 1BEDA 2GSTA 3EVIA 3G9BA 3KEBA 4K0NA 2F3MA 2IN3A 2X8GA 5HR1A 2VCVA 1BAYA 2B6MA 5F06A 2C0DA 2YJHA 1A24A 2IMKA 4N0VA 4NV5A 2LJKA 1S3AA 2C4JA 5CNWA 4XRDA 1ON4A 2O7KA 4KDXA 3IV4A 1WPIA 3R2QA 5D9XA 3ZRDA 3C1SA 3QPMA 4ZB9A 3I9V2 2H1BA 2PPTA 2OACA 2LQQA 1M7TA 5DAKB 3EYTA 4OFNA 1TU7A 4ML1A 3QAGA 3VLNA 2VOCA 5DAKA 3LJRA 3HXSA 2CVKA 2FD3A 6GSXA 1AC1A 6GSWA 2AV4A 4IS0A 2KOKA 1TRVA 3ERGA 2YV7A 1F2EA 2ES7A 3TOUA 1SKWB 4TRXA 3F63A 2F9SA 4ZB6A 2R37A 1XWBA 3M9JA 2LRNA 1V58A 1B4QA 4Q5QA 1UC7A 2DJ1A 2HT9A 3ZFBA 4N11A 5INYA 4AF2A 1ERTA 3DXBA 3ZL5A 4IQ1A 4MA9A 1G7OA 3CSJA 4TVEA 2NDOA 4WKWA 2LRCA 3PH9A 4I8BA 3GTUB 2YWOA 3LXZA 2B5XA 3GTUA 2HXKA 1K0AA 3HDCA 2YPMA 4V1Ag 2GGTA 2FCHA 3UOMA 3F4SA 5IQYA 1XW5A 1K0NA 3D21A 3D4MA 4BL7A 3J7Yb 4ZL8A 3I6AA 3HJMA 1THOA 2CT6A 3TOTA 2LTKA 2NPBA 5IO2A 2I1UA 3EU3A 4IW9A 3RDWA 2QSIA 2XPEA 4L0UA 2V6OA 1GSUA 3QAVA 4HU9A 1ILOA 3TDGA 3C1RA 2VLVA 4KX4A 5CP1A 2HFDA 2HSYA 5HQPA 3A5WA 16GSA 3E9JB 5GZZB 5IM9A 2MBTA 5D73A 2HZEB 3F4TA 4BVXA 3J7Yk 2H76A 5CAXA 2HZEA 4RQXA 3VK9A 2YCDA 2I3YA 3FYGA 1R5PA 1T3BA 1EZKA 4KCEA 2H1DA 4GSSA 3ZVJA 4ZIJA 4PQHA 2K8SA 5EVOA 1Z6MA 1A8YA 1S3DA 2H66A 4V2NA 2GZYA 4ZILA 3UBKA 1JZWA 1GNWA 4GTUA 3KCMA 1BQ7A 2BTOT 5DQSA 18GSA 2YZHA 1O8WA 1Q4JA 3G7JA 2BMXA 3F0IA 1U3AA 4TXVA 2OKAA 2HZFA 3E0UA 1A8LA 3IXRA 2IWTA 5D9WA 3APQA 4NMUA 1VRSD 2PVOC 4PXOA 2DMLA 4ISDA 3ZFLA 1SL0B 1MD3A 2B7JA 1GSFA 5CYYA 2VCQA 4EKZA 1O7UA 1JLVA 3LXTA 4PUFC 4HOJA 4IKHA 3ZMLA 2A2RA 4V2LA 1W4VA 5DQYA 5ID2B 5ECKB 3Q19A 4IQAA 1XXUA 3RAZA 5J5NA 4MH3A 5JWRB 4Z7XA 2FA4A 1R26A 4OO4A 4QL9A 1IYHA 2R4VA 4K6XA 1OYJA 5DBQA 6GSYA 5IMVA 3WT1A 1V40A 1TU8A 3VWVA 4DVCA 2XC2A 1TK5B 2QKEA 5J41A 5IPHA 3S9FA 2GDRA 3O6TA 3PGTA 6GSSA 1PSQA 2F51A 3F4RA 1M2BA 1H75A 4J57E 2CQ9A 3CBUA 5ECPB 4F03A 2H6ZA 2CVDA 3UL3A 5A4WA 2IPAA 2RUEA 2MZCA 1ZL9A 1HNAA 5B7CA 1B9XC 5DVBA 3DIEA 4GSTA 4GF0A 2C8UA 1B4PA 2D2ZA 4KA0A 2DJ2A 3H4KA 4E8EA 1SYXA 4BPYA 2WDUA 3CMIA 1MDJA 3BCIA 3IDVA 3I69A 1YY7A 3IOSA 3LYPA 1T4YA 1AUCA 1SJZA 1OVNA 3N5OA 3GKKA 1UN2A 3C7MA 1OAZA 2GTUA 2IJYA 3EE2A 4IELA 2VD0A 3GSTA 3APOA 4Q5FA 1ZGNA 3DYRA 5DJMA 3W8JA 3G7YA 2LNTA 3DMLA 3GKNA 1RQMA 4MMMA 3JCML 1UVZA 4MJBA 5ECHB 2OBKA 1O73A 2VLTA 4K9ZA 1FB0A 1Q98A 5KEJA 5DCGA 4K7IA 2LRTA 1JZRA 2LEGA 14GSA 4EVMA 4GWRA 1F3BA 3IBHA 1QQ2A 1WRYA 3VFIA 3FR9A 1O8XA 4WBRD 3FEUA 3F3RA 1T8EB 5CRGA 1J9BA 1GUKA 1I9DA 5ECQB 1QXHA 1WE0A 3L0HA 4OMVA 4XTSA 2JADA 1YZXA 1AXDA 2ZNMA 1PKWA 2VLUA 1X0RA 5G5FA 3L9SA 5GSSA 4K2DA 4X0XA 3WGXA 1F37A 1ERVA 1VF2A 4JR4A 2O89A 4ZBDA 4ZL7A 1J08A 2NTOA 3NOFA 3LFLA 1FVKA 3DVWA 4BA7A 3P2AA 4TR1B 1ST9A 2N5BA 2V1MA 2PERA 3HKRA 2PWJA 5ECIB 5GSTA 4TR1A 4YQVA 1YF0A 2YN1A 4BVYA 1KEBA 3QAWA 2B5YA 2WJUA 2VO4A 1XCCA 1T1VA 6GSTA 2C3TA 2ZCTA 3VI5A 3IHQA 3HY2A 3KJYA 4KB3A 5EY6A 3UMAA 2RM5A 5H5QA 4ML6A 1M9AA 4X1UA 3CTFA 2H1GA 2JZRA 3BBYA 4XHMA 2L4QA 3GHAA 4MF5A 3O76A 4KW6A 2H19A 3CRTA 1TK0B 4XCSA 4WXTA 4N10A 3US3A 1SJ6A 1U6TA 2AUVA 2P5RA 1MDKA 4H86A 4JE1A 5EPFA 4GSNA 1EOHA 1FAAA 2EIOA 1DUGA 3A2VA 4DSSB 3ZMKA 3GH6A 5ECSA 1AW9A 1AQWA 1KNGA 4DSRA 4NHWA 5J9BA 3FRCA 4DSSA 5E59A 1GSYA 5J9CA 3D4TA 3PR8A 4L5OA 5F0GA 2X99A 3SWLA 1MEKA 5JCUA 1XPVA 2V2GA 3RPNA 3G7IA 2K9FA 2VD1A 3GMFA 2O8VB 1TP9A 2O85A 3F6DA 3GH9A 1XBSA 3UARA 1EGOA 5IMZA 2DIZA 3IRAA 5D96A 1T4ZA 4F2IA 4TXOB 5F05A 1VF4A 2TIRA 3ZTLA 4POMA 4TXOA 4TN8A 3FZAA 5AIVA 4O7HA 3U6VA 2WGRA 2YNXA 5FHIA 3GSSA 4RQRA 1LJRA 2R3XA 5C04A 1XWCA 3ME8A 3L9VA 4HQZA 5ABRA 5G1LA 2FWFA 2E0QA 10GSA 4KSOA 3A2XA 3TKSA 3DGQA 4GXZA 1XWAA 4MZWA 2GZZA 1SENA 4ILFA 2H6YA 3EMXA 1NHOA 3VPQA 1Y25A 4N0ZA 4MH2A 2GQKA 1G6WA 3O3TA 2C3NA 2GZPA 3CYNA 4HDEA 1YEXA 2VCXA 1GNEA 1V9WA 5GAND 1O85A 2C1YA 5ECLB 3MWHA 3KP8A 3HJOA 4MJAA 1HNCA 2XBIA 3UVTA 3WGEA 4TKYA 3VWXA 3FW2A 2E2MA 1EEJA 5JWOB 4ZBBA 1PA3A 5D9VA 3F3QA 2A2SA 4MF7A 5G2ZA 3HJPA 1Z7RA 2YJ7A 3QMXA 1YQ1A 3GYKA 4G10A 4K7NA 1GLQA 1NW2A 1J0FA 1T00A 5ECOB 1K0MA 3D6IA 5J3RA 3TKSC 2B5EA 2CV4A 2M46A 1PGTA 4RUVA 5HFIA 5H5RA 5IPGA 4ULXA 2ON5A 1FW1A 5L71A 1U87A 4X43A 3CTGA 4PURA 2DC5A 3WYWA 3UVHA 1MDIA 1XVWA 1TJDA 2KHPA 3TJFA 2HI7A 4OCFA 1GTIA 4ACSA 4WETA 4YH2A 2GT6A 3EU4A 2V32A 2L6DA 1F6MC 1TK8B 1FHEA 1OKDA 2LJRA 4PX1A 1X9SB 1X5DA 1GLPA 3L9UA 4WR5A 1SKRB 2AB6A 2FWGA 3GKMA 2WS2A 3TJGA 5IO0A 2MMAA 2RM6A 3APSA 1Y6EA 4HJMA 5LD0A 3GX0A 3AY8A 4TR3A 2YWMA 4HQSA 4YAVA 4V2MA 3UIWA 2LNSA 1T7PB 3GUSA 3F9UA 4DEJA 4N30A 2B1LA 4YAPA 2FWHA 4ZXGA 5JCGA 1N8JA 5FT3A 4O92A 2IL3A 4AGSA 3IE3A 3BD2A 3P7XA 4WBJA 4MPFA 4XRAA 2CAIA 1THXA 3V1WA 4PNGA 4J56E 2B3SA 3M1GA 3BJ5A 6GSVA 2CA8A 1YKAA 1BYEA 3ED3A 4HEA2 22GSA 1ABAA 4JU5A 2VM1A 4FYUA 2YWIA 1K3OA 4MF6A 1KBNA 4YQUA 2RIIA 2LKUA 2LJAA 3RHCA 4KE3A 3FY7A 4HI7A 1TDIA 2P0GA 4IN0A 2CVBA 2CZ3A 3ZYWA 1WMJA 1SL2B 3DKSA 4OFMA 1W89A 3IC4A 3TJKA 1ZYQB 1JFUA 3FR6A 2V41A 2JZTA 2L4CA 5B8BA 2YP6A 3VI7A 5HFGA 1G6YA 4MLYA 2QGVA 2IMEA 2FWEA 2MBSA 1M9BA 4I2TA 2GVPA 2OA7A 2TRXA 3D5JA 3W6GA 4EF0A 1SL1B 3EC3A 5ENUA 2PU9C 1USBA 2X64A 4LL1B 2RLIA 3HYPA 1ERWA 5DCHA 3ME7A 1E6BA 17GSA 4GQCA 4K8MA 1QK8A 1GSSA 1TOFA 4PQIA 5ECRB 1B8XA 4EDYA 1G0TA 2B1KA 1BJXA 2VIMA 4POLA 2DLXA 1V98A 3GA4A 1A2JA 2J23A 2FNOA 5J4UA 4MZBA 2YOIA 3UBLA 4GLTA 3KH7A 2GQMA 1SD9A 3EINA 1U3IA 1SD8A 3D22A 6GSUA 2R5GA 1YKCA 3M0FA 4IVFA 4I5QA 1M2AA 1OE8A 4JRRA 4L8EA 3CSIA 4OO5A 2GSRA 1GWCA 4EE0A 1ZMAA 4QQ7A 1AQVA 3IR4A 5D8IA 4YQMA 2H71A 3HHVA 3QR6A 1PRXA 4CDOA 2WRTA 1BX9A 3QD9A 3ZIVA 4MDCA 4E8HA 9GSSA 2O87A 1VF3A 4FH8A 4ZBAA 4XS6A 5KN0A 2IMDA 3BOAA 4OD7A 5ELAA 3QOUA 4POKA 4I6XA 4TR0A 5KN3A 1HD2A 4ECJA 4EO3A 3Q6OA 1A2LA 1OC8A 2FGXA 2IMIA 1SK1A 3UJ1A 1GTBA 1O6JA 3TCOA 5IMAA 5B6MA 1DBYA 1WOUA 2FHEA 4TW5A 2Z9SA 3P90A 2H75A 1GSEA 3WT2A 3TJJA 2VM2A 2JSZA 1V57A 1DSBA 1OKTA 2VUPA 3GNJA 4J2FA 3L78A 3KP9A 5F8BA 1B48A 1O81A 4KNDA 3GL3A 3IA1A 3VPTA 3MSZA 4IP6A 2H72A 3SBCA 3A2WA 5B6NA 4K0GA 4NHZA 13GSA 2XBQA 1PKZA 3P8WA 1M0UA 2KP1A 2OJLA 3CRUA 2FUG2 4XS4B 1R4WA 2OADA 2H73A 2MYGA 4JEDA 3TRQA 4XS4A 3ERWA 3Q18A 4GQFA 4HUAA 3LYKA 1M99A 1LBKA 1XVQA 1PN9A 1SK0A 1ZYEA 2TRCP 4NPBA 2H01A 2GT5A 3PINA 1SJIA 3QCPA 4HS1A 2HLSA 1S3CA 1XW6A 2C3QA 4KGIA 4FIWA 1GH2A 1A0FA 4AJ8A 8GSSA 3CSHA 4K7OA 3TKRA 4F0CA 4L5LA 4IJ3A 4F0BA 1WP0A 2CX4A 4PNFA 5KN1A 1FB6A 1XFLA 1EOGA 1EEMA 1V2AA 4LLRA 2ZUPA 4GCIA 2MMZA 2OBIA 1QGVA 1EGRA 4DSQA 1IYIA 3HVXA 5A5KA 3GV1A 1URMA 4IBPA 4K1FA 2AHEA 2L57A 2J9HA 2H0HA 2DJJA 4NXIA 3MAKA 4V1Ap 3HA9A 5LNKe 1R5AA 1XIYA 2L5OA 2PN8A 4O5RA 1NM3A 3IK9A 1GUHA 1SYRA 1Z7PA 1XW9A 2H0IA 1Z9HA 1YDKA 2FLSA 2WZ9A 3TUEA 5CREA 2R6KA 3IAS2 5CRWA 1X9WB 1PX7A 1VF1A 2DMMA 5G1KA 5HFKA 3TRPA 3QFBC 3WGDA 4QL7A 5D93A 1GTAA 3HZ4A 4CHSA 2XHFA 5FWGA 2GS3A 4OFTA 2KLXA 1SU9A 1NHYA 1OC9B 2F8FA 1XWGA 5ECNB 3L4NA 1WWJA 1PD21 1OC9A 4ECIA 2AJQB 2EIRA 2WFCA 3GIXA 3GKXA 1M2DA 19GSA 4IJIA 4FO5A 4MCUA 2JL4A 2DBCA 2V6KA 3FZ9A 2OE1A 1RW1A 3H8QA 1GP1A 1FO5A 5AN1A 5B8AA 1R7HA 1UA5A 5GAPD 1ZCPA 4F9ZA 2OE0A 3TKPA 1QMVA 2DIYA 3W8SA 1JZOA 2E7PA 7GSSA 3A3TA 4ECCA 3IPZA 2C0FA 3FKFA 1CQHA 4WEYA 1XOBA 3NIVA 1YF1A 5JCWA 1KTEA 4Q5RA 5EL8A 1GTUA 2L59A 1QUWA 2GSQA 2GLRA 2DJ0A 3K8NA 4KCAA 3C8EA 2H70A 5COHA 5D9TA 4KDYA 2H30A 2HRNA 1EV4A 2H6XA 2N5AA 3LORA 4XS1A 3FHKA 2HNLA 3I43A 1AQXA 1TTZA 1QFNA 4MZCA 3MDKA 5CO3A 2HE3A 2FA8A 2WULA 2C0EA 4EUYA 4WF5A 5G30A 5JWQB 1WIKA 1HNBA 2LS5A 4MJEA 2YV9A 2I4AA 3KZQA 5F07A 1XZOA 1EP8A 2KP2A 3EWLA 1OC3A 3OR5A 1GSQA 4HZ4A 1DE2A 5IMFA 2AYTA 3ZITA 5AIXA 2JZSA 1Z5YE 5HR0A 2P31A 1FG4A 2G0FA 3QFAC 3RBTA 3CXGA 3E3EA 4HZ2A 3TKSE 1B9YC 3ZREA 4PUAA 1JZDA 2KUCA 4HU7A 4HJ2A 3FZ4A 4MABA 4MP4A 5ELGA 3M9KA 5A4VA 2H74A 20GSA 5AGYA 3U5RE 4PQ1A 1NSWA 4FYCA 3TB2A 1F9MA 1TRSA 1K0CA 2X8HA 2I9HA 2M80A 1TRUA 3HD5A 3IK7A 2NBSA 3HVVA 3LSZA 3KD0A 2C0GA 4I97A 1X9MB 4FYBA 3F6FA 4LL4B 4JBBA 2NVLA 5IOXA 2WCIA 3LQ7A 4KUNA 1TKDB 4WF4A 2VCTA 3HZ8A 2PBJA 3WD6A 1YEPA 11GSA 2X8CA 4ZB8A 3UAPA 3C73A 1A0RP 3EMPA 12GSA 4EL1A 3VWWA 5LCZA 3MNGA 4L0WA 3KTLA 3GN3A 1H4OA 3ISOA 4ID0A 3TJBA 4OWYA 4AJ7A 2BJXA 4KSMA 5ECMB 5C00A 3KH9A 4ECBA 1ZOFA 2EC4A 4NWYA 3TRXA 2PVQA 3VURA 2L6CA 1GULA 1YJ6A 5ID2A 2R2JA 2HSHA 2IFQB 1WJKA 1BG5A 3LWAA 3KTBA 3M3MA 1U88A 1MD4A 2IFQA 2L5LA 2ON7A 3FR3A 4WR4A
chains in the Genus database with same CATH superfamily
1Z3EA 1DE1A 2LUSA 5HR2A 1ZYPA 1FVJA 2GSSA 4G19A 1TI1A 2REMA 1ZZYA 2HYXA 1HQOA 4NAXA 3IAM2 3TGZA 2VL2A 1RK4A 4F82A 1JHBA 3FK8A 4TOPA 1K3YA 2AAWA 2JACA 3C71A 1XG8A 2RUFA 4I2UA 4ZL9A 4MK3A 4LMVA 2JSYA 3TKQA 1EP7A 3F8UA 5HR3A 2A4VA 4P3YB 1K0BA 4XIHA 4PGTA 2CZ2A 1XOAA 1N2AA 3H79A 4JZQA 1TRWA 4EXJA 2LV3A 2M72A 3UEMA 3VWUA 2H1AA 2E2GA 2IIYA 1GSDA 4AJ6A 2LQOA 2FY6A 4KDUA 2VAFA 2ALBA 5AISA 3GRXA 4MPGA 3Q74A 1GUMA 4JR6A 3KGKA 4Q5NA 4GRFA 3H93A 1PMTA 1TI3A 1GL8A 3LG6A 4LMWA 2VL2C 4EDZA 4BWSA 4NV2A 4POBA 2B7KA 3D0ZA 4IHUA 1K0OA 5G31A 3GL5A 3GURA 2H0GA 2C80A 1PL2A 5CRDA 1K0DA 5A4UA 1HYUA 1GRXA 1F3AA 2N5FA 2VL9A 2XPDA 2I81A 2MMNA 5IIZA 2X49A 4KH7A 5E4WA 1VGLA 2QC7A 3ZLPA 4D73B 2R0GA 3BCKA 4IGJA 1Z6NA 1E2YA 4D73A 3FZ5A 3EPTA 2OE3A 4IP1A 3ZVJD 2YWNA 3A5IA 2YZUA 3GFKA 3N9JA 3H1NA 5DDLA 1TW9A 1I5GA 1SKSB 4TR4A 3ZIJA 2G2QA 4RI6A 5IMDA 3LEFA 3LGCA 2K8VA 1ML6A 2DSAA 5H5SA 4OCEA 3DEXA 2IMFA 1A23A 3DD3A 4G9HA 2CX3A 5CRHA 3RHBA 1LU4A 1K3LA 4HSCX 4EC0A 3DVXA 2K6VA 5G5EA 3HCZA 1AIUA 3EURA 3KMOA 1PL1A 3KIJA 1JLWA 5KN2A 4LA1A 5DALB 3QDNA 3KXOA 1X5EA 1EWXA 2MMOA 1AAZA 5DALA 4CW9A 2PMTA 3HVNA 3MIXA 3ZZXA 2P5QA 4KAEA 3DWVA 2H8LA 1TXXA 4G2EA 1PX6A 1A2MA 1ACVA 2HRFA 2CAQA 2JU5A 2F8AA 1G7EA 1XWKA 2VCWA 2PGTA 3M8NA 3ERFA 3GX8A 2VCZA 4MJCA 1EV9A 2DJ3A 2PUKC 4YKFA 3KM6A 1ERUA 2DJKA 1SK2A 2EIQA 5IMCA 1MTCA 1PFOA 4RI7A 5DJLA 1FOVA 4BWQA 2WB9A 1OE7A 3DRNA 2GQLA 5IOWA 1CQGA 1PQNA 2LSTA 3RPPA 1X5CA 3KMNA 2VL3A 2YANA 3NZNA 2K18A 3HVSA 4O32A 1C72A 1BEDA 2GSTA 3EVIA 3G9BA 3KEBA 4K0NA 2F3MA 2IN3A 2X8GA 5HR1A 2VCVA 1BAYA 2B6MA 5F06A 2C0DA 2YJHA 2QA1A 1A24A 2IMKA 4N0VA 4NV5A 2LJKA 1S3AA 2C4JA 5CNWA 4XRDA 1ON4A 2O7KA 4KDXA 3IV4A 4G0LA 1WPIA 3R2QA 5D9XA 3ZRDA 3C1SA 3QPMA 4ZB9A 3I9V2 2H1BA 2PPTA 1M3JA 2OACA 2LQQA 1M7TA 5DAKB 3EYTA 3FMWA 4OFNA 1TU7A 4ML1A 3QAGA 3VLNA 2VOCA 5DAKA 3LJRA 3HXSA 2CVKA 4YKGA 2FD3A 6GSXA 1AC1A 6GSWA 2AV4A 4IS0A 2KOKA 1TRVA 3ERGA 2YV7A 1F2EA 2ES7A 3TOUA 1SKWB 4TRXA 3F63A 2F9SA 4ZB6A 2R37A 1XWBA 3M9JA 2LRNA 1V58A 1B4QA 4Q5QA 1UC7A 2DJ1A 2HT9A 3ZFBA 4N11A 5INYA 4AF2A 1ERTA 3DXBA 3ZL5A 4IQ1A 4MA9A 1G7OA 3CSJA 4TVEA 2NDOA 4WKWA 2LRCA 3PH9A 4I8BA 3GTUB 2YWOA 3LXZA 4FQUA 2B5XA 3GTUA 2HXKA 1K0AA 3HDCA 2YPMA 4V1Ag 2GGTA 2FCHA 4BL7B 3UOMA 3F4SA 5IQYA 1XW5A 1K0NA 3D21A 3D4MA 4BL7A 3J7Yb 4ZL8A 3I6AA 5KOXA 3HJMA 1THOA 2CT6A 3TOTA 2LTKA 2NPBA 5IO2A 2I1UA 3EU3A 4IW9A 3RDWA 2QSIA 2XPEA 4L0UA 2V6OA 1GSUA 3QAVA 4HU9A 1ILOA 3TDGA 3C1RA 2VLVA 4KX4A 5CP1A 2HFDA 2HSYA 5HQPA 3A5WA 16GSA 3E9JB 5GZZB 5IM9A 2MBTA 5D73A 2HZEB 3F4TA 4BVXA 3J7Yk 2H76A 5CAXA 2HZEA 4RQXA 3VK9A 2YCDA 2I3YA 3FYGA 1R5PA 1T3BA 1EZKA 4KCEA 2H1DA 4GSSA 3ZVJA 4ZIJA 4PQHA 2K8SA 4K5RA 5EVOA 1Z6MA 1A8YA 1S3DA 2H66A 4V2NA 2GZYA 4ZILA 3UBKA 1JZWA 1GNWA 4GTUA 3KCMA 1BQ7A 2BTOT 5DQSA 18GSA 2YZHA 1O8WA 1Q4JA 3G7JA 2BMXA 3F0IA 1U3AA 4TXVA 2OKAA 2HZFA 2R0CA 3E0UA 1A8LA 3IXRA 2IWTA 5D9WA 3APQA 4NMUA 1VRSD 4PTSA 2PVOC 4PXOA 2DMLA 4ISDA 3ZFLA 1SL0B 1MD3A 2B7JA 1GSFA 5CYYA 2VCQA 4EKZA 1O7UA 1JLVA 3LXTA 4PUFC 4HOJA 4IKHA 3ZMLA 2A2RA 4V2LA 1W4VA 5DQYA 5ID2B 5ECKB 3Q19A 4IQAA 3MYDA 1XXUA 3RAZA 5J5NA 4MH3A 5BMUA 5JWRB 4Z7XA 2FA4A 1R26A 4OO4A 4QL9A 1IYHA 2R4VA 4K6XA 1OYJA 5DBQA 6GSYA 5IMVA 3WT1A 4G0KA 1V40A 1TU8A 3VWVA 4DVCA 2XC2A 1TK5B 2QKEA 4EIQA 5J41A 5IPHA 3S9FA 2GDRA 3O6TA 3PGTA 4A5PA 6GSSA 1PSQA 2F51A 3F4RA 1M2BA 1H75A 4J57E 2CQ9A 3CBUA 5ECPB 4F03A 2H6ZA 2CVDA 2A4HA 3UL3A 5A4WA 2IPAA 2RUEA 2MZCA 1ZL9A 1HNAA 5B7CA 1B9XC 5DVBA 3DIEA 4GSTA 4Z2RA 4GF0A 2C8UA 1B4PA 2D2ZA 4KA0A 2DJ2A 3H4KA 4CY8A 4E8EA 1SYXA 4BPYA 2WDUA 3CMIA 1MDJA 3BCIA 3IDVA 3I69A 1YY7A 3IOSA 3LYPA 1T4YA 1AUCA 1SJZA 1OVNA 3N5OA 3GKKA 1UN2A 3C7MA 1OAZA 2GTUA 2IJYA 3EE2A 4MNNA 4IELA 2VD0A 2HRAA 3GSTA 3APOA 4Q5FA 1ZGNA 3DYRA 5DJMA 3W8JA 3G7YA 2LNTA 3DMLA 3GKNA 1RQMA 4MMMA 3JCML 1UVZA 4MJBA 5ECHB 2OBKA 1O73A 2VLTA 4K9ZA 1FB0A 1Q98A 5KEJA 5DCGA 4K7IA 2LRTA 2UZ8A 1JZRA 2LEGA 14GSA 4O5UA 4EVMA 4GWRA 1F3BA 3IBHA 1QQ2A 1WRYA 3VFIA 3FR9A 1O8XA 4WBRD 3FEUA 3F3RA 1T8EB 5CRGA 2A2PA 1J9BA 1GUKA 1I9DA 5ECQB 1QXHA 1WE0A 3L0HA 4OMVA 4XTSA 2JADA 1YZXA 1AXDA 2ZNMA 1PKWA 2VLUA 1X0RA 5G5FA 3L9SA 5GSSA 4K2DA 4X0XA 3WGXA 1F37A 1ERVA 1VF2A 4JR4A 2O89A 4ZBDA 4ZL7A 1J08A 2NTOA 3NOFA 3LFLA 1FVKA 3DVWA 4BA7A 3P2AA 4TR1B 1ST9A 2N5BA 2V1MA 2PERA 3HKRA 2PWJA 4BVYB 5ECIB 5GSTA 4TR1A 4YQVA 4O5QA 1YF0A 2YN1A 4BVYA 1KEBA 3QAWA 2B5YA 2WJUA 2VO4A 1XCCA 1T1VA 6GSTA 2C3TA 2ZCTA 3VI5A 3IHQA 3HY2A 3KJYA 4KB3A 5EY6A 3UMAA 2RM5A 5H5QA 4ML6A 1M9AA 4X1UA 3CTFA 2H1GA 2JZRA 3BBYA 4XHMA 2L4QA 3GHAA 4MF5A 3O76A 4KW6A 5KOWA 2H19A 3CRTA 1TK0B 4XCSA 4WXTA 4N10A 3US3A 1SJ6A 1U6TA 2AUVA 2P5RA 1MDKA 4H86A 4JE1A 5EPFA 4GSNA 1EOHA 1FAAA 2EIOA 1DUGA 3A2VA 4DSSB 3ZMKA 3GH6A 5ECSA 1AW9A 1AQWA 1KNGA 4DSRA 4NHWA 5J9BA 3FRCA 4DSSA 1ZYNA 2QA2A 1GSYA 5E59A 5J9CA 3D4TA 3PR8A 4L5OA 5F0GA 2X99A 3SWLA 1MEKA 5JCUA 1XPVA 2V2GA 3RPNA 3G7IA 2K9FA 2VD1A 3GMFA 4X4JA 2O8VB 1TP9A 2O85A 3F6DA 3GH9A 1XBSA 3UARA 1EGOA 5IMZA 2DIZA 3IRAA 5D96A 1T4ZA 4F2IA 4TXOB 5F05A 1VF4A 2TIRA 3ZTLA 4POMA 4TXOA 4TN8A 3FZAA 5AIVA 4O7HA 3U6VA 2WGRA 2YNXA 5FHIA 3GSSA 4RQRA 5BRTA 1LJRA 2R3XA 5C04A 1XWCA 3ME8A 3L9VA 4HQZA 5ABRA 5G1LA 2FWFA 2E0QA 10GSA 4KSOA 3A2XA 3TKSA 2X4AA 3DGQA 4K2XA 4GXZA 1XWAA 4MZWA 2GZZA 1SENA 4ILFA 2H6YA 2R0PA 1NHOA 3EMXA 3VPQA 1Y25A 4N0ZA 4MH2A 2GQKA 1G6WA 3O3TA 2C3NA 2GZPA 3CYNA 4HDEA 1YEXA 2VCXA 4USSA 1GNEA 1V9WA 5GAND 1O85A 2C1YA 5ECLB 4ICYA 3MWHA 3KP8A 3HJOA 4MJAA 1HNCA 2XBIA 3UVTA 3WGEA 4TKYA 3VWXA 3FW2A 2E2MA 1EEJA 5JWOB 4ZBBA 1PA3A 5D9VA 1PN0A 3F3QA 2A2SA 4MF7A 5G2ZA 3HJPA 1Z7RA 2YJ7A 3QMXA 1YQ1A 3GYKA 4G10A 4K7NA 1GLQA 1NW2A 1J0FA 1T00A 5ECOB 1K0MA 3D6IA 5J3RA 3TKSC 2B5EA 2CV4A 2M46A 1PGTA 4RUVA 5HFIA 5H5RA 5IPGA 4ULXA 2ON5A 1FW1A 5L71A 1U87A 4X43A 3CTGA 4PURA 2DC5A 1M3IA 3WYWA 3UVHA 1MDIA 1XVWA 1TJDA 2KHPA 3TJFA 2HI7A 4OCFA 4KF9A 1GTIA 4ACSA 4WETA 4YH2A 2GT6A 3EU4A 2V32A 2L6DA 1F6MC 1TK8B 1FHEA 1OKDA 2LJRA 4PX1A 1X9SB 1X5DA 1GLPA 3L9UA 4WR5A 1SKRB 2AB6A 2FWGA 3GKMA 2WS2A 3TJGA 5IO0A 2MMAA 2RM6A 3APSA 1Y6EA 4HJMA 5LD0A 3GX0A 3AY8A 4TR3A 2YWMA 4HQSA 4YAVA 1FOHA 4V2MA 3UIWA 2LNSA 1T7PB 3GUSA 3F9UA 4DEJA 4N30A 2B1LA 4YAPA 4BVXB 2FWHA 4ZXGA 5JCGA 1N8JA 5FT3A 4O92A 2IL3A 4AGSA 3IE3A 4Z2TA 3BD2A 3P7XA 4WBJA 4MPFA 4XRAA 2CAIA 1THXA 3V1WA 4PNGA 4J56E 2B3SA 3M1GA 3BJ5A 1S3RA 6GSVA 2CA8A 1YKAA 1BYEA 3ED3A 4HEA2 22GSA 1ABAA 4JU5A 2VM1A 4FYUA 2YWIA 1K3OA 4MF6A 1KBNA 4YQUA 2RIIA 2LKUA 2LJAA 3RHCA 4KE3A 3FY7A 4HI7A 1TDIA 4G0IA 2P0GA 4IN0A 2CVBA 2CZ3A 3ZYWA 1WMJA 1SL2B 3DKSA 4OFMA 1W89A 3IC4A 3TJKA 1ZYQB 1JFUA 3FR6A 2V41A 2JZTA 2L4CA 5B8BA 2YP6A 3VI7A 3R3EA 5HFGA 1G6YA 4MLYA 2QGVA 2IMEA 2FWEA 2MBSA 1M9BA 4I2TA 2GVPA 2OA7A 2TRXA 3D5JA 3W6GA 4EF0A 1SL1B 3EC3A 5ENUA 2PU9C 1USBA 2X64A 4LL1B 2RLIA 3HYPA 1ERWA 5DCHA 3ME7A 1E6BA 17GSA 4GQCA 4K8MA 1QK8A 1GSSA 1TOFA 4PQIA 5ECRB 1B8XA 4EDYA 1G0TA 3CQFA 2B1KA 1BJXA 2VIMA 4POLA 2DLXA 1V98A 3GA4A 1A2JA 2J23A 2FNOA 5J4UA 4EIPA 4MZBA 2YOIA 3UBLA 4GLTA 3KH7A 2GQMA 1SD9A 3EINA 1U3IA 1SD8A 3D22A 6GSUA 2R5GA 1YKCA 3M0FA 4IVFA 4I5QA 1M2AA 3PPUA 1OE8A 4JRRA 4L8EA 3CSIA 4OO5A 2GSRA 1GWCA 4EE0A 1ZMAA 4QQ7A 1AQVA 3IR4A 5D8IA 4YQMA 2H71A 3HHVA 3QR6A 1PRXA 4CDOA 2WRTA 1BX9A 3QD9A 3ZIVA 4MDCA 4E8HA 9GSSA 2O87A 1VF3A 4FH8A 4ZBAA 4XS6A 5KN0A 2IMDA 3BOAA 4OD7A 5ELAA 3QOUA 4POKA 4I6XA 4TR0A 5KN3A 1HD2A 4CY6A 4ECJA 4EO3A 3Q6OA 1A2LA 1OC8A 2FGXA 2IMIA 1SK1A 3UJ1A 1GTBA 1O6JA 3TCOA 5IMAA 5B6MA 1DBYA 1WOUA 2FHEA 4TW5A 2Z9SA 3P90A 2H75A 1GSEA 3WT2A 3TJJA 4BIKA 2VM2A 2JSZA 1V57A 3IHGA 1DSBA 1OKTA 2VUPA 3GNJA 4J2FA 3L78A 3KP9A 5F8BA 1B48A 1O81A 4KNDA 3GL3A 3IA1A 3VPTA 3MSZA 4IP6A 2H72A 3SBCA 3A2WA 5B6NA 4K0GA 4NHZA 13GSA 2XBQA 1PKZA 3P8WA 1M0UA 2KP1A 2OJLA 3CRUA 2FUG2 4XS4B 1R4WA 2OADA 2H73A 2MYGA 4JEDA 3TRQA 4XS4A 3ERWA 3Q18A 4GQFA 4HUAA 3LYKA 1M99A 1LBKA 1XVQA 1PN9A 1SK0A 1ZYEA 2TRCP 4NPBA 2H01A 4Z2UA 2GT5A 3PINA 1SJIA 3QCPA 4HS1A 2HLSA 1S3CA 1XW6A 2C3QA 4KGIA 4FIWA 1GH2A 1A0FA 4AJ8A 8GSSA 3CSHA 4K7OA 3TKRA 4F0CA 4L5LA 4IJ3A 4F0BA 1WP0A 2CX4A 4PNFA 5KN1A 1FB6A 1XFLA 1EOGA 1EEMA 1V2AA 4LLRA 2ZUPA 4GCIA 2MMZA 2OBIA 1QGVA 1EGRA 4DSQA 1IYIA 3HVXA 5A5KA 3GV1A 1URMA 4IBPA 4K1FA 2AHEA 2L57A 2J9HA 2H0HA 2DJJA 4NXIA 3MAKA 4V1Ap 3HA9A 5LNKe 1R5AA 1XIYA 2L5OA 2PN8A 4O5RA 1NM3A 3IK9A 1GUHA 1SYRA 1Z7PA 1XW9A 2H0IA 1Z9HA 1YDKA 2FLSA 2WZ9A 3TUEA 5CREA 2R6KA 3IAS2 5CRWA 1X9WB 1PX7A 1VF1A 2DMMA 5G1KA 5HFKA 3TRPA 3QFBC 3WGDA 4QL7A 5D93A 1GTAA 3HZ4A 4CHSA 2XHFA 4K5SA 5FWGA 2GS3A 4OFTA 2KLXA 1SU9A 1NHYA 1OC9B 2F8FA 1XWGA 5ECNB 3L4NA 1WWJA 1PD21 1OC9A 4ECIA 2AJQB 2EIRA 2WFCA 3GIXA 3GKXA 1M2DA 19GSA 2HRKA 4IJIA 4FO5A 4MCUA 2JL4A 2DBCA 2V6KA 3FZ9A 3IC8A 2OE1A 1RW1A 3H8QA 1GP1A 1FO5A 5AN1A 5B8AA 1R7HA 1UA5A 5GAPD 1ZCPA 4F9ZA 2OE0A 3TKPA 1QMVA 2DIYA 3W8SA 1JZOA 2E7PA 7GSSA 3A3TA 4ECCA 3IPZA 2C0FA 3FKFA 1CQHA 4WEYA 1XOBA 3NIVA 1YF1A 5JCWA 1KTEA 4Q5RA 5EL8A 1GTUA 2HSMA 2L59A 1QUWA 2GSQA 2GLRA 2DJ0A 3K8NA 4KCAA 3C8EA 2H70A 5COHA 5D9TA 4KDYA 2H30A 2HRNA 1EV4A 2H6XA 2N5AA 3LORA 4XS1A 3FHKA 2HNLA 3I43A 1AQXA 1TTZA 1QFNA 4MZCA 3MDKA 5CO3A 2HE3A 2FA8A 2WULA 2C0EA 4EUYA 4WF5A 5G30A 5JWQB 1WIKA 1HNBA 2LS5A 4MJEA 2YV9A 2I4AA 3KZQA 5F07A 1XZOA 1EP8A 2KP2A 3EWLA 1OC3A 3OR5A 1GSQA 4HZ4A 1DE2A 5IMFA 2AYTA 3ZITA 5AIXA 2JZSA 1Z5YE 5HR0A 2P31A 1FG4A 2G0FA 3QFAC 3RBTA 3CXGA 3E3EA 4HZ2A 3TKSE 1B9YC 3ZREA 4PUAA 1JZDA 2KUCA 4HU7A 4HJ2A 3FZ4A 4MABA 4MP4A 5ELGA 3M9KA 5A4VA 2H74A 20GSA 5AGYA 3U5RE 4PQ1A 1NSWA 4FYCA 3TB2A 1F9MA 1TRSA 1K0CA 2X8HA 2I9HA 2M80A 1TRUA 3HD5A 3IK7A 2NBSA 2DKIA 3HVVA 3LSZA 3KD0A 2C0GA 4I97A 1X9MB 4FYBA 3F6FA 4LL4B 4JBBA 2NVLA 5IOXA 2WCIA 3LQ7A 4KUNA 1TKDB 4WF4A 2VCTA 3HZ8A 2PBJA 3WD6A 1YEPA 11GSA 2X8CA 4ZB8A 2DKHA 3UAPA 3C73A 1A0RP 3EMPA 12GSA 4EL1A 3VWWA 5LCZA 3MNGA 4L0WA 3KTLA 3GN3A 1H4OA 3ISOA 4ID0A 3TJBA 4OWYA 4AJ7A 2BJXA 4KSMA 5ECMB 5C00A 3KH9A 4ECBA 1ZOFA 2EC4A 4NWYA 3TRXA 2PVQA 3VURA 2L6CA 1GULA 1YJ6A 5ID2A 2R2JA 2HSHA 2IFQB 1WJKA 1BG5A 3LWAA 3KTBA 3M3MA 1U88A 1MD4A 2IFQA 2L5LA 2ON7A 3LW9A 3FR3A 4WR4A
chains in the Genus database with same CATH topology
1Z3EA 1DE1A 2LUSA 5HR2A 1ZYPA 1FVJA 2GSSA 4G19A 1TI1A 2REMA 1ZZYA 2HYXA 1HQOA 4NAXA 3IAM2 3TGZA 2VL2A 1RK4A 4F82A 1JHBA 3FK8A 4TOPA 1K3YA 2AAWA 2JACA 3C71A 2RUFA 4I2UA 4ZL9A 4MK3A 4LMVA 2JSYA 3TKQA 1EP7A 3F8UA 5HR3A 2A4VA 4P3YB 1K0BA 4XIHA 4PGTA 2CZ2A 1XOAA 1N2AA 3H79A 4JZQA 1TRWA 4EXJA 2LV3A 2M72A 3UEMA 3VWUA 2H1AA 2E2GA 2IIYA 1GSDA 4AJ6A 2LQOA 2FY6A 4KDUA 2VAFA 2ALBA 5AISA 3GRXA 4MPGA 3Q74A 1GUMA 4JR6A 3KGKA 4Q5NA 4GRFA 3H93A 1PMTA 1TI3A 1GL8A 3LG6A 4LMWA 2VL2C 4EDZA 4BWSA 4NV2A 4POBA 2B7KA 3D0ZA 4IHUA 1K0OA 5G31A 3GL5A 3GURA 2H0GA 2C80A 1PL2A 5CRDA 1K0DA 5A4UA 1HYUA 1GRXA 1F3AA 2N5FA 2VL9A 2XPDA 2I81A 2MMNA 5IIZA 2X49A 4KH7A 5E4WA 1VGLA 2QC7A 3ZLPA 4D73B 2R0GA 3BCKA 4IGJA 1Z6NA 1E2YA 4D73A 3FZ5A 3EPTA 2OE3A 4IP1A 3ZVJD 2YWNA 3A5IA 2YZUA 3GFKA 3N9JA 3H1NA 5DDLA 1TW9A 1I5GA 1SKSB 4TR4A 3ZIJA 2G2QA 4RI6A 5IMDA 3LEFA 3LGCA 2K8VA 1ML6A 2DSAA 5H5SA 4OCEA 3DEXA 2IMFA 1A23A 3DD3A 4G9HA 2CX3A 5CRHA 3RHBA 1LU4A 1K3LA 4EC0A 3DVXA 2K6VA 5G5EA 3HCZA 1AIUA 3EURA 3KMOA 1PL1A 3KIJA 1JLWA 5KN2A 4LA1A 5DALB 3QDNA 3KXOA 1X5EA 1EWXA 2MMOA 1AAZA 5DALA 4CW9A 2PMTA 3MIXA 3ZZXA 2P5QA 4KAEA 3DWVA 2H8LA 1TXXA 4G2EA 1PX6A 1A2MA 1ACVA 2HRFA 2CAQA 2JU5A 2F8AA 1G7EA 1XWKA 2VCWA 2PGTA 3M8NA 3ERFA 3GX8A 2VCZA 4MJCA 1EV9A 2DJ3A 2PUKC 4YKFA 3KM6A 1ERUA 2DJKA 1SK2A 2EIQA 5IMCA 1MTCA 4RI7A 5DJLA 1FOVA 4BWQA 2WB9A 1OE7A 3DRNA 2GQLA 5IOWA 1CQGA 1PQNA 2LSTA 3RPPA 1X5CA 3KMNA 2VL3A 2YANA 3NZNA 2K18A 3HVSA 4O32A 1C72A 1BEDA 2GSTA 3EVIA 3G9BA 3KEBA 4K0NA 2F3MA 2IN3A 2X8GA 5HR1A 2VCVA 1BAYA 2B6MA 5F06A 2C0DA 2YJHA 2QA1A 1A24A 2IMKA 4N0VA 4NV5A 2LJKA 1S3AA 2C4JA 5CNWA 4XRDA 1ON4A 2O7KA 4KDXA 3IV4A 4G0LA 1WPIA 3R2QA 5D9XA 3ZRDA 3C1SA 3QPMA 4ZB9A 3I9V2 2H1BA 2PPTA 2OACA 2LQQA 1M7TA 5DAKB 3EYTA 3FMWA 4OFNA 1TU7A 4ML1A 3QAGA 3VLNA 2VOCA 5DAKA 3LJRA 3HXSA 2CVKA 4YKGA 2FD3A 6GSXA 1AC1A 6GSWA 2AV4A 4IS0A 2KOKA 1TRVA 3ERGA 2YV7A 1F2EA 2ES7A 3TOUA 1SKWB 4TRXA 3F63A 2F9SA 4ZB6A 2R37A 1XWBA 3M9JA 2LRNA 1V58A 1B4QA 4Q5QA 1UC7A 2DJ1A 2HT9A 3ZFBA 4N11A 5INYA 4AF2A 1ERTA 3DXBA 3ZL5A 4IQ1A 4MA9A 1G7OA 3CSJA 4TVEA 2NDOA 4WKWA 2LRCA 3PH9A 4I8BA 3GTUB 2YWOA 3LXZA 4FQUA 2B5XA 3GTUA 2HXKA 1K0AA 3HDCA 2YPMA 4V1Ag 2GGTA 2FCHA 4BL7B 3UOMA 3F4SA 5IQYA 1XW5A 1K0NA 3D21A 3D4MA 4BL7A 3J7Yb 4ZL8A 3I6AA 5KOXA 3HJMA 1THOA 2CT6A 3TOTA 2LTKA 2NPBA 5IO2A 2I1UA 3EU3A 4IW9A 3RDWA 2QSIA 2XPEA 4L0UA 2V6OA 1GSUA 3QAVA 4HU9A 1ILOA 3TDGA 3C1RA 2VLVA 4KX4A 5CP1A 2HFDA 2HSYA 5HQPA 3A5WA 16GSA 3E9JB 5GZZB 5IM9A 2MBTA 5D73A 2HZEB 3F4TA 4BVXA 3J7Yk 2H76A 5CAXA 2HZEA 4RQXA 3VK9A 2YCDA 2I3YA 3FYGA 1R5PA 1T3BA 1EZKA 4KCEA 2H1DA 4GSSA 3ZVJA 4ZIJA 4PQHA 2K8SA 4K5RA 5EVOA 1Z6MA 1A8YA 1S3DA 2H66A 4V2NA 2GZYA 4ZILA 3UBKA 1JZWA 1GNWA 4GTUA 3KCMA 1BQ7A 2BTOT 5DQSA 18GSA 2YZHA 1O8WA 1Q4JA 3G7JA 2BMXA 3F0IA 1U3AA 4TXVA 2OKAA 2HZFA 2R0CA 3E0UA 1A8LA 3IXRA 2IWTA 5D9WA 3APQA 4NMUA 1VRSD 4PTSA 2PVOC 4PXOA 2DMLA 4ISDA 3ZFLA 1SL0B 1MD3A 2B7JA 1GSFA 5CYYA 2VCQA 4EKZA 1O7UA 1JLVA 3LXTA 4PUFC 4HOJA 4IKHA 3ZMLA 2A2RA 4V2LA 1W4VA 5DQYA 5ID2B 5ECKB 3Q19A 4IQAA 3MYDA 1XXUA 3RAZA 5J5NA 4MH3A 5BMUA 5JWRB 4Z7XA 2FA4A 1R26A 4OO4A 4QL9A 1IYHA 2R4VA 4K6XA 1OYJA 5DBQA 6GSYA 5IMVA 3WT1A 4G0KA 1V40A 1TU8A 3VWVA 4DVCA 2XC2A 1TK5B 2QKEA 4EIQA 5J41A 5IPHA 3S9FA 2GDRA 3O6TA 3PGTA 4A5PA 6GSSA 1PSQA 2F51A 3F4RA 1M2BA 1H75A 4J57E 2CQ9A 3CBUA 5ECPB 4F03A 2H6ZA 2CVDA 2A4HA 3UL3A 5A4WA 2IPAA 2RUEA 2MZCA 1ZL9A 1HNAA 5B7CA 1B9XC 5DVBA 3DIEA 4GSTA 4Z2RA 4GF0A 2C8UA 1B4PA 2D2ZA 4KA0A 2DJ2A 3H4KA 4CY8A 4E8EA 1SYXA 4BPYA 2WDUA 3CMIA 1MDJA 3BCIA 3IDVA 3I69A 1YY7A 3IOSA 3LYPA 1T4YA 1AUCA 1SJZA 1OVNA 3N5OA 3GKKA 1UN2A 3C7MA 1OAZA 2GTUA 2IJYA 3EE2A 4MNNA 4IELA 2VD0A 2HRAA 3GSTA 3APOA 4Q5FA 1ZGNA 3DYRA 5DJMA 3W8JA 3G7YA 2LNTA 3DMLA 3GKNA 1RQMA 4MMMA 3JCML 1UVZA 4MJBA 5ECHB 2OBKA 1O73A 2VLTA 4K9ZA 1FB0A 1Q98A 5KEJA 5DCGA 4K7IA 2LRTA 2UZ8A 1JZRA 2LEGA 14GSA 4O5UA 4EVMA 4GWRA 1F3BA 3IBHA 1QQ2A 1WRYA 3VFIA 3FR9A 1O8XA 4WBRD 3FEUA 3F3RA 1T8EB 5CRGA 2A2PA 1J9BA 1GUKA 1I9DA 5ECQB 1QXHA 1WE0A 3L0HA 4OMVA 4XTSA 2JADA 1YZXA 1AXDA 2ZNMA 1PKWA 2VLUA 1X0RA 5G5FA 3L9SA 5GSSA 4K2DA 4X0XA 3WGXA 1F37A 1ERVA 1VF2A 4JR4A 2O89A 4ZBDA 4ZL7A 1J08A 2NTOA 3NOFA 3LFLA 1FVKA 3DVWA 4BA7A 3P2AA 4TR1B 1ST9A 2N5BA 2V1MA 2PERA 3HKRA 2PWJA 4BVYB 5ECIB 5GSTA 4TR1A 4YQVA 4O5QA 1YF0A 2YN1A 4BVYA 1KEBA 3QAWA 2B5YA 2WJUA 2VO4A 1XCCA 1T1VA 6GSTA 2C3TA 2ZCTA 3VI5A 3IHQA 3HY2A 3KJYA 4KB3A 5EY6A 3UMAA 2RM5A 5H5QA 4ML6A 1M9AA 4X1UA 3CTFA 2H1GA 2JZRA 3BBYA 4XHMA 2L4QA 3GHAA 4MF5A 3O76A 4KW6A 5KOWA 2H19A 3CRTA 1TK0B 4XCSA 4WXTA 4N10A 3US3A 1SJ6A 1U6TA 2AUVA 2P5RA 1MDKA 4H86A 4JE1A 5EPFA 4GSNA 1EOHA 1FAAA 2EIOA 1DUGA 3A2VA 4DSSB 3ZMKA 3GH6A 5ECSA 1AW9A 1AQWA 1KNGA 4DSRA 4NHWA 5J9BA 3FRCA 4DSSA 1ZYNA 2QA2A 1GSYA 5E59A 5J9CA 3D4TA 3PR8A 4L5OA 5F0GA 2X99A 3SWLA 1MEKA 5JCUA 1XPVA 2V2GA 3RPNA 3G7IA 2K9FA 2VD1A 3GMFA 4X4JA 2O8VB 1TP9A 2O85A 3F6DA 3GH9A 1XBSA 3UARA 1EGOA 5IMZA 2DIZA 3IRAA 5D96A 1T4ZA 4F2IA 4TXOB 5F05A 1VF4A 2TIRA 3ZTLA 4POMA 4TXOA 4TN8A 3FZAA 5AIVA 4O7HA 3U6VA 2WGRA 2YNXA 5FHIA 3GSSA 4RQRA 5BRTA 1LJRA 2R3XA 5C04A 1XWCA 3ME8A 3L9VA 4HQZA 5ABRA 5G1LA 2FWFA 2E0QA 10GSA 4KSOA 3A2XA 3TKSA 2X4AA 3DGQA 4K2XA 4GXZA 1XWAA 4MZWA 2GZZA 1SENA 4ILFA 2H6YA 2R0PA 1NHOA 3EMXA 3VPQA 1Y25A 4N0ZA 4MH2A 2GQKA 1G6WA 3O3TA 2C3NA 2GZPA 3CYNA 4HDEA 1YEXA 2VCXA 4USSA 1GNEA 1V9WA 5GAND 1O85A 2C1YA 5ECLB 4ICYA 3MWHA 3KP8A 3HJOA 4MJAA 1HNCA 2XBIA 3UVTA 3WGEA 4TKYA 3VWXA 3FW2A 2E2MA 1EEJA 5JWOB 4ZBBA 1PA3A 5D9VA 1PN0A 3F3QA 2A2SA 4MF7A 5G2ZA 3HJPA 1Z7RA 2YJ7A 3QMXA 1YQ1A 3GYKA 4G10A 4K7NA 1GLQA 1NW2A 1J0FA 1T00A 5ECOB 1K0MA 3D6IA 5J3RA 3TKSC 2B5EA 2CV4A 2M46A 1PGTA 4RUVA 5HFIA 5H5RA 5IPGA 4ULXA 2ON5A 1FW1A 5L71A 1U87A 4X43A 3CTGA 4PURA 2DC5A 3WYWA 3UVHA 1MDIA 1XVWA 1TJDA 2KHPA 3TJFA 2HI7A 4OCFA 4KF9A 1GTIA 4ACSA 4WETA 4YH2A 2GT6A 3EU4A 2V32A 2L6DA 1F6MC 1TK8B 1FHEA 1OKDA 2LJRA 4PX1A 1X9SB 1X5DA 1GLPA 3L9UA 4WR5A 1SKRB 2AB6A 2FWGA 3GKMA 2WS2A 3TJGA 5IO0A 2MMAA 2RM6A 3APSA 1Y6EA 4HJMA 5LD0A 3GX0A 3AY8A 4TR3A 2YWMA 4HQSA 4YAVA 1FOHA 4V2MA 3UIWA 2LNSA 1T7PB 3GUSA 3F9UA 4DEJA 4N30A 2B1LA 4YAPA 4BVXB 2FWHA 4ZXGA 5JCGA 1N8JA 5FT3A 4O92A 2IL3A 4AGSA 3IE3A 4Z2TA 3BD2A 3P7XA 4WBJA 4MPFA 4XRAA 2CAIA 1THXA 3V1WA 4PNGA 4J56E 2B3SA 3M1GA 3BJ5A 6GSVA 2CA8A 1YKAA 1BYEA 3ED3A 4HEA2 22GSA 1ABAA 4JU5A 2VM1A 4FYUA 2YWIA 1K3OA 4MF6A 1KBNA 4YQUA 2RIIA 2LKUA 2LJAA 3RHCA 4KE3A 3FY7A 4HI7A 1TDIA 4G0IA 2P0GA 4IN0A 2CVBA 2CZ3A 3ZYWA 1WMJA 1SL2B 3DKSA 4OFMA 1W89A 3IC4A 3TJKA 1ZYQB 1JFUA 3FR6A 2V41A 2JZTA 2L4CA 5B8BA 2YP6A 3VI7A 3R3EA 5HFGA 1G6YA 4MLYA 2QGVA 2IMEA 2FWEA 2MBSA 1M9BA 4I2TA 2GVPA 2OA7A 2TRXA 3D5JA 3W6GA 4EF0A 1SL1B 3EC3A 5ENUA 2PU9C 1USBA 2X64A 4LL1B 2RLIA 3HYPA 1ERWA 5DCHA 3ME7A 1E6BA 17GSA 4GQCA 4K8MA 1QK8A 1GSSA 1TOFA 4PQIA 5ECRB 1B8XA 4EDYA 1G0TA 2B1KA 1BJXA 2VIMA 4POLA 2DLXA 1V98A 3GA4A 1A2JA 2J23A 2FNOA 5J4UA 4EIPA 4MZBA 2YOIA 3UBLA 4GLTA 3KH7A 2GQMA 1SD9A 3EINA 1U3IA 1SD8A 3D22A 6GSUA 2R5GA 1YKCA 3M0FA 4IVFA 4I5QA 1M2AA 3PPUA 1OE8A 4JRRA 4L8EA 3CSIA 4OO5A 2GSRA 1GWCA 4EE0A 1ZMAA 4QQ7A 1AQVA 3IR4A 5D8IA 4YQMA 2H71A 3HHVA 3QR6A 1PRXA 4CDOA 2WRTA 1BX9A 3QD9A 3ZIVA 4MDCA 4E8HA 9GSSA 2O87A 1VF3A 4FH8A 4ZBAA 4XS6A 5KN0A 2IMDA 3BOAA 4OD7A 5ELAA 3QOUA 4POKA 4I6XA 4TR0A 5KN3A 1HD2A 4CY6A 4ECJA 4EO3A 3Q6OA 1A2LA 1OC8A 2FGXA 2IMIA 1SK1A 3UJ1A 1GTBA 1O6JA 3TCOA 5IMAA 5B6MA 1DBYA 1WOUA 2FHEA 4TW5A 2Z9SA 3P90A 2H75A 1GSEA 3WT2A 3TJJA 2VM2A 2JSZA 1V57A 3IHGA 1DSBA 1OKTA 2VUPA 3GNJA 4J2FA 3L78A 3KP9A 5F8BA 1B48A 1O81A 4KNDA 3GL3A 3IA1A 3VPTA 3MSZA 4IP6A 2H72A 3SBCA 3A2WA 5B6NA 4K0GA 4NHZA 13GSA 2XBQA 1PKZA 3P8WA 1M0UA 2KP1A 2OJLA 3CRUA 2FUG2 4XS4B 1R4WA 2OADA 2H73A 2MYGA 4JEDA 3TRQA 4XS4A 3ERWA 3Q18A 4GQFA 4HUAA 3LYKA 1M99A 1LBKA 1XVQA 1PN9A 1SK0A 1ZYEA 2TRCP 4NPBA 2H01A 4Z2UA 2GT5A 3PINA 1SJIA 3QCPA 4HS1A 2HLSA 1S3CA 1XW6A 2C3QA 4KGIA 4FIWA 1GH2A 1A0FA 4AJ8A 8GSSA 3CSHA 4K7OA 3TKRA 4F0CA 4L5LA 4IJ3A 4F0BA 1WP0A 2CX4A 4PNFA 5KN1A 1FB6A 1XFLA 1EOGA 1EEMA 1V2AA 4LLRA 2ZUPA 4GCIA 2MMZA 2OBIA 1QGVA 1EGRA 4DSQA 1IYIA 3HVXA 5A5KA 3GV1A 1URMA 4IBPA 4K1FA 2AHEA 2L57A 2J9HA 2H0HA 2DJJA 4NXIA 3MAKA 4V1Ap 3HA9A 5LNKe 1R5AA 1XIYA 2L5OA 2PN8A 4O5RA 1NM3A 3IK9A 1GUHA 1SYRA 1Z7PA 1XW9A 2H0IA 1Z9HA 1YDKA 2FLSA 2WZ9A 3TUEA 5CREA 2R6KA 3IAS2 5CRWA 1X9WB 1PX7A 1VF1A 2DMMA 5G1KA 5HFKA 3TRPA 3QFBC 3WGDA 4QL7A 5D93A 1GTAA 3HZ4A 4CHSA 2XHFA 4K5SA 5FWGA 2GS3A 4OFTA 2KLXA 1SU9A 1NHYA 1OC9B 2F8FA 1XWGA 5ECNB 3L4NA 1WWJA 1PD21 1OC9A 4ECIA 2AJQB 2EIRA 2WFCA 3GIXA 3GKXA 1M2DA 19GSA 2HRKA 4IJIA 4FO5A 4MCUA 2JL4A 2DBCA 2V6KA 3FZ9A 3IC8A 2OE1A 1RW1A 3H8QA 1GP1A 1FO5A 5AN1A 5B8AA 1R7HA 1UA5A 5GAPD 1ZCPA 4F9ZA 2OE0A 3TKPA 1QMVA 2DIYA 3W8SA 1JZOA 2E7PA 7GSSA 3A3TA 4ECCA 3IPZA 2C0FA 3FKFA 1CQHA 4WEYA 1XOBA 3NIVA 1YF1A 5JCWA 1KTEA 4Q5RA 5EL8A 1GTUA 2HSMA 2L59A 1QUWA 2GSQA 2GLRA 2DJ0A 3K8NA 4KCAA 3C8EA 2H70A 5COHA 5D9TA 4KDYA 2H30A 2HRNA 1EV4A 2H6XA 2N5AA 3LORA 4XS1A 3FHKA 2HNLA 3I43A 1AQXA 1TTZA 1QFNA 4MZCA 3MDKA 5CO3A 2HE3A 2FA8A 2WULA 2C0EA 4EUYA 4WF5A 5G30A 5JWQB 1WIKA 1HNBA 2LS5A 4MJEA 2YV9A 2I4AA 3KZQA 5F07A 1XZOA 1EP8A 2KP2A 3EWLA 1OC3A 3OR5A 1GSQA 4HZ4A 1DE2A 5IMFA 2AYTA 3ZITA 5AIXA 2JZSA 1Z5YE 5HR0A 2P31A 1FG4A 2G0FA 3QFAC 3RBTA 3CXGA 3E3EA 4HZ2A 3TKSE 1B9YC 3ZREA 4PUAA 1JZDA 2KUCA 4HU7A 4HJ2A 3FZ4A 4MABA 4MP4A 5ELGA 3M9KA 5A4VA 2H74A 20GSA 5AGYA 3U5RE 4PQ1A 1NSWA 4FYCA 3TB2A 1F9MA 1TRSA 1K0CA 2X8HA 2I9HA 2M80A 1TRUA 3HD5A 3IK7A 2NBSA 2DKIA 3HVVA 3LSZA 3KD0A 2C0GA 4I97A 1X9MB 4FYBA 3F6FA 4LL4B 4JBBA 2NVLA 5IOXA 2WCIA 3LQ7A 4KUNA 1TKDB 4WF4A 2VCTA 3HZ8A 2PBJA 3WD6A 1YEPA 11GSA 2X8CA 4ZB8A 2DKHA 3UAPA 3C73A 1A0RP 3EMPA 12GSA 4EL1A 3VWWA 5LCZA 3MNGA 4L0WA 3KTLA 3GN3A 1H4OA 3ISOA 4ID0A 3TJBA 4OWYA 4AJ7A 2BJXA 4KSMA 5ECMB 5C00A 3KH9A 4ECBA 1ZOFA 2EC4A 4NWYA 3TRXA 2PVQA 3VURA 2L6CA 1GULA 1YJ6A 5ID2A 2R2JA 2HSHA 2IFQB 1WJKA 1BG5A 3LWAA 3KTBA 3M3MA 1U88A 1MD4A 2IFQA 2L5LA 2ON7A 3LW9A 3FR3A 4WR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z3E A;  1DE1 A;  2LUS A;  5HR2 A;  1FVJ A;  2GSS A;  4G19 A;  1TI1 A;  2REM A;  1ZZY A;  2HYX A;  1HQO A;  4NAX A;  3IAM 2;  3TGZ A;  2VL2 A;  1RK4 A;  4F82 A;  1JHB A;  3FK8 A;  4TOP A;  1K3Y A;  2AAW A;  2JAC A;  3C71 A;  2RUF A;  4I2U A;  4ZL9 A;  4MK3 A;  4LMV A;  2JSY A;  3TKQ A;  1EP7 A;  3F8U A;  5HR3 A;  2A4V A;  4P3Y B;  1K0B A;  4XIH A;  4PGT A;  2CZ2 A;  1XOA A;  1N2A A;  3H79 A;  4JZQ A;  1TRW A;  4EXJ A;  2LV3 A;  2M72 A;  3UEM A;  3VWU A;  2H1A A;  2E2G A;  2IIY A;  1GSD A;  4AJ6 A;  2LQO A;  2FY6 A;  4KDU A;  2VAF A;  2ALB A;  5AIS A;  3GRX A;  4MPG A;  3Q74 A;  1GUM A;  4JR6 A;  3KGK A;  4Q5N A;  4GRF A;  3H93 A;  1PMT A;  1TI3 A;  1GL8 A;  3LG6 A;  4LMW A;  2VL2 C;  4EDZ A;  4BWS A;  4NV2 A;  4POB A;  2B7K A;  3D0Z A;  4IHU A;  1K0O A;  5G31 A;  3GL5 A;  3GUR A;  2H0G A;  2C80 A;  1PL2 A;  5CRD A;  1K0D A;  5A4U A;  1HYU A;  1GRX A;  1F3A A;  2N5F A;  2VL9 A;  2XPD A;  2I81 A;  2MMN A;  5IIZ A;  4KH7 A;  5E4W A;  1VGL A;  2QC7 A;  3ZLP A;  4D73 B;  3BCK A;  4IGJ A;  1Z6N A;  1E2Y A;  4D73 A;  3FZ5 A;  2OE3 A;  4IP1 A;  3ZVJ D;  2YWN A;  2YZU A;  3GFK A;  3N9J A;  3H1N A;  5DDL A;  1TW9 A;  1I5G A;  1SKS B;  4TR4 A;  3ZIJ A;  2G2Q A;  4RI6 A;  5IMD A;  3LEF A;  3LGC A;  2K8V A;  1ML6 A;  2DSA A;  5H5S A;  4OCE A;  3DEX A;  2IMF A;  1A23 A;  3DD3 A;  4G9H A;  2CX3 A;  5CRH A;  3RHB A;  1LU4 A;  1K3L A;  4EC0 A;  3DVX A;  2K6V A;  5G5E A;  3HCZ A;  1AIU A;  3EUR A;  3KMO A;  1PL1 A;  3KIJ A;  1JLW A;  5KN2 A;  4LA1 A;  5DAL B;  3QDN A;  3KXO A;  1X5E A;  1EWX A;  2MMO A;  1AAZ A;  5DAL A;  4CW9 A;  2PMT A;  3ZZX A;  2P5Q A;  4KAE A;  3DWV A;  2H8L A;  1TXX A;  4G2E A;  1PX6 A;  1A2M A;  1ACV A;  2HRF A;  2CAQ A;  2JU5 A;  2F8A A;  1G7E A;  1XWK A;  2VCW A;  2PGT A;  3M8N A;  3ERF A;  3GX8 A;  2VCZ A;  4MJC A;  1EV9 A;  2DJ3 A;  2PUK C;  3KM6 A;  1ERU A;  2DJK A;  1SK2 A;  2EIQ A;  5IMC A;  1MTC A;  4RI7 A;  5DJL A;  1FOV A;  4BWQ A;  2WB9 A;  1OE7 A;  3DRN A;  2GQL A;  5IOW A;  1CQG A;  1PQN A;  2LST A;  3RPP A;  1X5C A;  3KMN A;  2VL3 A;  2YAN A;  3NZN A;  2K18 A;  3HVS A;  4O32 A;  1C72 A;  1BED A;  2GST A;  3EVI A;  3G9B A;  3KEB A;  4K0N A;  2F3M A;  2IN3 A;  2X8G A;  5HR1 A;  2VCV A;  1BAY A;  2B6M A;  5F06 A;  2C0D A;  2YJH A;  1A24 A;  2IMK A;  4N0V A;  4NV5 A;  2LJK A;  1S3A A;  2C4J A;  5CNW A;  4XRD A;  1ON4 A;  2O7K A;  4KDX A;  3IV4 A;  1WPI A;  3R2Q A;  5D9X A;  3ZRD A;  3C1S A;  3QPM A;  4ZB9 A;  3I9V 2;  2H1B A;  2PPT A;  2OAC A;  2LQQ A;  1M7T A;  5DAK B;  3EYT A;  4OFN A;  1TU7 A;  4ML1 A;  3QAG A;  3VLN A;  2VOC A;  5DAK A;  3LJR A;  3HXS A;  2CVK A;  2FD3 A;  6GSX A;  1AC1 A;  6GSW A;  2AV4 A;  4IS0 A;  2KOK A;  1TRV A;  3ERG A;  2YV7 A;  1F2E A;  2ES7 A;  3TOU A;  1SKW B;  4TRX A;  3F63 A;  2F9S A;  4ZB6 A;  2R37 A;  1XWB A;  3M9J A;  2LRN A;  1V58 A;  1B4Q A;  4Q5Q A;  1UC7 A;  2DJ1 A;  2HT9 A;  3ZFB A;  4N11 A;  5INY A;  4AF2 A;  1ERT A;  3DXB A;  3ZL5 A;  4IQ1 A;  4MA9 A;  1G7O A;  3CSJ A;  4TVE A;  2NDO A;  4WKW A;  2LRC A;  3PH9 A;  4I8B A;  3GTU B;  2YWO A;  3LXZ A;  2B5X A;  3GTU A;  2HXK A;  1K0A A;  3HDC A;  2YPM A;  4V1A g;  2GGT A;  2FCH A;  3UOM A;  3F4S A;  5IQY A;  1XW5 A;  1K0N A;  3D21 A;  3D4M A;  4BL7 A;  3J7Y b;  4ZL8 A;  3I6A A;  3HJM A;  1THO A;  2CT6 A;  3TOT A;  2LTK A;  2NPB A;  5IO2 A;  2I1U A;  3EU3 A;  4IW9 A;  3RDW A;  2QSI A;  2XPE A;  4L0U A;  2V6O A;  1GSU A;  3QAV A;  4HU9 A;  1ILO A;  3TDG A;  3C1R A;  2VLV A;  4KX4 A;  5CP1 A;  2HFD A;  2HSY A;  5HQP A;  3A5W A;  16GS A;  3E9J B;  5GZZ B;  5IM9 A;  2MBT A;  5D73 A;  2HZE B;  3F4T A;  4BVX A;  3J7Y k;  2H76 A;  5CAX A;  2HZE A;  4RQX A;  3VK9 A;  2YCD A;  2I3Y A;  3FYG A;  1R5P A;  1T3B A;  1EZK A;  4KCE A;  2H1D A;  4GSS A;  3ZVJ A;  4ZIJ A;  4PQH A;  2K8S A;  5EVO A;  1Z6M A;  1A8Y A;  1S3D A;  2H66 A;  4V2N A;  2GZY A;  4ZIL A;  3UBK A;  1JZW A;  1GNW A;  4GTU A;  3KCM A;  1BQ7 A;  2BTO T;  5DQS A;  18GS A;  2YZH A;  1O8W A;  1Q4J A;  3G7J A;  2BMX A;  3F0I A;  1U3A A;  4TXV A;  2OKA A;  2HZF A;  3E0U A;  1A8L A;  3IXR A;  2IWT A;  5D9W A;  3APQ A;  4NMU A;  1VRS D;  2PVO C;  4PXO A;  2DML A;  4ISD A;  3ZFL A;  1SL0 B;  1MD3 A;  2B7J A;  1GSF A;  5CYY A;  2VCQ A;  4EKZ A;  1O7U A;  1JLV A;  3LXT A;  4PUF C;  4HOJ A;  4IKH A;  3ZML A;  2A2R A;  4V2L A;  1W4V A;  5DQY A;  5ID2 B;  5ECK B;  3Q19 A;  4IQA A;  1XXU A;  3RAZ A;  5J5N A;  4MH3 A;  5JWR B;  4Z7X A;  2FA4 A;  1R26 A;  4OO4 A;  4QL9 A;  1IYH A;  2R4V A;  4K6X A;  1OYJ A;  5DBQ A;  6GSY A;  5IMV A;  3WT1 A;  1V40 A;  1TU8 A;  3VWV A;  4DVC A;  2XC2 A;  1TK5 B;  2QKE A;  5J41 A;  5IPH A;  3S9F A;  2GDR A;  3O6T A;  3PGT A;  6GSS A;  1PSQ A;  2F51 A;  3F4R A;  1M2B A;  1H75 A;  4J57 E;  2CQ9 A;  3CBU A;  5ECP B;  4F03 A;  2H6Z A;  2CVD A;  3UL3 A;  5A4W A;  2IPA A;  2RUE A;  2MZC A;  1ZL9 A;  1HNA A;  5B7C A;  1B9X C;  5DVB A;  3DIE A;  4GST A;  4GF0 A;  2C8U A;  1B4P A;  2D2Z A;  4KA0 A;  2DJ2 A;  3H4K A;  4E8E A;  1SYX A;  4BPY A;  2WDU A;  3CMI A;  1MDJ A;  3BCI A;  3IDV A;  3I69 A;  1YY7 A;  3IOS A;  3LYP A;  1T4Y A;  1AUC A;  1SJZ A;  1OVN A;  3N5O A;  3GKK A;  1UN2 A;  3C7M A;  1OAZ A;  2GTU A;  2IJY A;  3EE2 A;  4IEL A;  2VD0 A;  3GST A;  3APO A;  4Q5F A;  1ZGN A;  3DYR A;  5DJM A;  3W8J A;  3G7Y A;  2LNT A;  3DML A;  3GKN A;  1RQM A;  4MMM A;  3JCM L;  1UVZ A;  4MJB A;  5ECH B;  2OBK A;  1O73 A;  2VLT A;  4K9Z A;  1FB0 A;  1Q98 A;  5KEJ A;  5DCG A;  4K7I A;  2LRT A;  1JZR A;  2LEG A;  14GS A;  4EVM A;  4GWR A;  1F3B A;  3IBH A;  1QQ2 A;  1WRY A;  3VFI A;  3FR9 A;  1O8X A;  4WBR D;  3FEU A;  3F3R A;  1T8E B;  5CRG A;  1J9B A;  1GUK A;  1I9D A;  5ECQ B;  1QXH A;  1WE0 A;  3L0H A;  4OMV A;  4XTS A;  2JAD A;  1YZX A;  1AXD A;  2ZNM A;  1PKW A;  2VLU A;  1X0R A;  5G5F A;  3L9S A;  5GSS A;  4K2D A;  4X0X A;  3WGX A;  1F37 A;  1ERV A;  1VF2 A;  4JR4 A;  2O89 A;  4ZBD A;  4ZL7 A;  1J08 A;  2NTO A;  3NOF A;  3LFL A;  1FVK A;  3DVW A;  4BA7 A;  3P2A A;  4TR1 B;  1ST9 A;  2N5B A;  2V1M A;  2PER A;  3HKR A;  2PWJ A;  5ECI B;  5GST A;  4TR1 A;  4YQV A;  1YF0 A;  2YN1 A;  4BVY A;  1KEB A;  3QAW A;  2B5Y A;  2WJU A;  2VO4 A;  1XCC A;  1T1V A;  6GST A;  2C3T A;  2ZCT A;  3VI5 A;  3IHQ A;  3HY2 A;  3KJY A;  4KB3 A;  5EY6 A;  3UMA A;  2RM5 A;  5H5Q A;  4ML6 A;  1M9A A;  4X1U A;  3CTF A;  2H1G A;  2JZR A;  3BBY A;  4XHM A;  2L4Q A;  3GHA A;  4MF5 A;  3O76 A;  4KW6 A;  2H19 A;  3CRT A;  1TK0 B;  4XCS A;  4WXT A;  4N10 A;  3US3 A;  1SJ6 A;  1U6T A;  2AUV A;  2P5R A;  1MDK A;  4H86 A;  4JE1 A;  5EPF A;  4GSN A;  1EOH A;  1FAA A;  2EIO A;  1DUG A;  3A2V A;  4DSS B;  3ZMK A;  3GH6 A;  5ECS A;  1AW9 A;  1AQW A;  1KNG A;  4DSR A;  4NHW A;  5J9B A;  3FRC A;  4DSS A;  5E59 A;  1GSY A;  5J9C A;  3D4T A;  3PR8 A;  4L5O A;  5F0G A;  2X99 A;  3SWL A;  1MEK A;  5JCU A;  1XPV A;  2V2G A;  3RPN A;  3G7I A;  2K9F A;  2VD1 A;  3GMF A;  2O8V B;  1TP9 A;  2O85 A;  3F6D A;  3GH9 A;  1XBS A;  3UAR A;  1EGO A;  5IMZ A;  2DIZ A;  3IRA A;  5D96 A;  1T4Z A;  4F2I A;  4TXO B;  5F05 A;  1VF4 A;  2TIR A;  3ZTL A;  4POM A;  4TXO A;  4TN8 A;  3FZA A;  5AIV A;  4O7H A;  3U6V A;  2WGR A;  2YNX A;  5FHI A;  3GSS A;  4RQR A;  1LJR A;  2R3X A;  5C04 A;  1XWC A;  3ME8 A;  3L9V A;  4HQZ A;  5ABR A;  5G1L A;  2FWF A;  2E0Q A;  10GS A;  4KSO A;  3A2X A;  3TKS A;  3DGQ A;  4GXZ A;  1XWA A;  4MZW A;  2GZZ A;  1SEN A;  4ILF A;  2H6Y A;  3EMX A;  1NHO A;  3VPQ A;  1Y25 A;  4N0Z A;  4MH2 A;  2GQK A;  1G6W A;  3O3T A;  2C3N A;  2GZP A;  3CYN A;  4HDE A;  1YEX A;  2VCX A;  1GNE A;  1V9W A;  5GAN D;  1O85 A;  2C1Y A;  5ECL B;  3MWH A;  3KP8 A;  3HJO A;  4MJA A;  1HNC A;  2XBI A;  3UVT A;  3WGE A;  4TKY A;  3VWX A;  3FW2 A;  2E2M A;  1EEJ A;  5JWO B;  4ZBB A;  1PA3 A;  5D9V A;  3F3Q A;  2A2S A;  4MF7 A;  5G2Z A;  3HJP A;  1Z7R A;  2YJ7 A;  3QMX A;  1YQ1 A;  3GYK A;  4G10 A;  4K7N A;  1GLQ A;  1NW2 A;  1J0F A;  1T00 A;  5ECO B;  1K0M A;  3D6I A;  5J3R A;  3TKS C;  2B5E A;  2CV4 A;  2M46 A;  1PGT A;  4RUV A;  5HFI A;  5H5R A;  5IPG A;  4ULX A;  2ON5 A;  1FW1 A;  5L71 A;  1U87 A;  4X43 A;  3CTG A;  4PUR A;  2DC5 A;  3WYW A;  3UVH A;  1MDI A;  1XVW A;  1TJD A;  2KHP A;  3TJF A;  2HI7 A;  4OCF A;  1GTI A;  4ACS A;  4WET A;  4YH2 A;  2GT6 A;  3EU4 A;  2V32 A;  2L6D A;  1F6M C;  1TK8 B;  1FHE A;  1OKD A;  2LJR A;  4PX1 A;  1X9S B;  1X5D A;  1GLP A;  3L9U A;  4WR5 A;  1SKR B;  2AB6 A;  2FWG A;  3GKM A;  2WS2 A;  3TJG A;  5IO0 A;  2MMA A;  2RM6 A;  3APS A;  1Y6E A;  4HJM A;  5LD0 A;  3GX0 A;  3AY8 A;  4TR3 A;  2YWM A;  4HQS A;  4YAV A;  4V2M A;  3UIW A;  2LNS A;  1T7P B;  3GUS A;  3F9U A;  4DEJ A;  4N30 A;  2B1L A;  4YAP A;  2FWH A;  4ZXG A;  5JCG A;  1N8J A;  5FT3 A;  4O92 A;  2IL3 A;  4AGS A;  3IE3 A;  3BD2 A;  3P7X A;  4WBJ A;  4MPF A;  4XRA A;  2CAI A;  1THX A;  3V1W A;  4PNG A;  4J56 E;  2B3S A;  3M1G A;  3BJ5 A;  6GSV A;  2CA8 A;  1YKA A;  1BYE A;  3ED3 A;  4HEA 2;  22GS A;  1ABA A;  4JU5 A;  2VM1 A;  4FYU A;  2YWI A;  1K3O A;  4MF6 A;  1KBN A;  4YQU A;  2RII A;  2LKU A;  2LJA A;  3RHC A;  4KE3 A;  3FY7 A;  4HI7 A;  1TDI A;  2P0G A;  4IN0 A;  2CVB A;  2CZ3 A;  3ZYW A;  1WMJ A;  1SL2 B;  3DKS A;  4OFM A;  1W89 A;  3IC4 A;  3TJK A;  1ZYQ B;  1JFU A;  3FR6 A;  2V41 A;  2JZT A;  2L4C A;  5B8B A;  2YP6 A;  3VI7 A;  5HFG A;  1G6Y A;  4MLY A;  2QGV A;  2IME A;  2FWE A;  2MBS A;  1M9B A;  4I2T A;  2GVP A;  2OA7 A;  2TRX A;  3D5J A;  3W6G A;  4EF0 A;  1SL1 B;  3EC3 A;  5ENU A;  2PU9 C;  1USB A;  2X64 A;  4LL1 B;  2RLI A;  3HYP A;  1ERW A;  5DCH A;  3ME7 A;  1E6B A;  17GS A;  4GQC A;  4K8M A;  1QK8 A;  1GSS A;  1TOF A;  4PQI A;  5ECR B;  1B8X A;  4EDY A;  1G0T A;  2B1K A;  1BJX A;  2VIM A;  4POL A;  2DLX A;  1V98 A;  3GA4 A;  1A2J A;  2J23 A;  2FNO A;  5J4U A;  4MZB A;  2YOI A;  3UBL A;  4GLT A;  3KH7 A;  2GQM A;  1SD9 A;  3EIN A;  1U3I A;  1SD8 A;  3D22 A;  6GSU A;  2R5G A;  1YKC A;  3M0F A;  4IVF A;  4I5Q A;  1M2A A;  1OE8 A;  4JRR A;  4L8E A;  3CSI A;  4OO5 A;  2GSR A;  1GWC A;  4EE0 A;  1ZMA A;  4QQ7 A;  1AQV A;  3IR4 A;  5D8I A;  4YQM A;  2H71 A;  3HHV A;  3QR6 A;  1PRX A;  4CDO A;  2WRT A;  1BX9 A;  3QD9 A;  3ZIV A;  4MDC A;  4E8H A;  9GSS A;  2O87 A;  1VF3 A;  4FH8 A;  4ZBA A;  4XS6 A;  5KN0 A;  2IMD A;  3BOA A;  4OD7 A;  5ELA A;  3QOU A;  4POK A;  4I6X A;  4TR0 A;  5KN3 A;  1HD2 A;  4ECJ A;  4EO3 A;  3Q6O A;  1A2L A;  1OC8 A;  2FGX A;  2IMI A;  1SK1 A;  3UJ1 A;  1GTB A;  1O6J A;  3TCO A;  5IMA A;  5B6M A;  1DBY A;  1WOU A;  2FHE A;  4TW5 A;  2Z9S A;  3P90 A;  2H75 A;  1GSE A;  3WT2 A;  3TJJ A;  2VM2 A;  2JSZ A;  1V57 A;  1DSB A;  1OKT A;  2VUP A;  3GNJ A;  4J2F A;  3L78 A;  3KP9 A;  5F8B A;  1B48 A;  1O81 A;  4KND A;  3GL3 A;  3IA1 A;  3VPT A;  3MSZ A;  4IP6 A;  2H72 A;  3SBC A;  3A2W A;  5B6N A;  4K0G A;  4NHZ A;  13GS A;  2XBQ A;  1PKZ A;  3P8W A;  1M0U A;  2KP1 A;  2OJL A;  3CRU A;  2FUG 2;  4XS4 B;  1R4W A;  2OAD A;  2H73 A;  2MYG A;  4JED A;  3TRQ A;  4XS4 A;  3ERW A;  3Q18 A;  4GQF A;  4HUA A;  3LYK A;  1M99 A;  1LBK A;  1XVQ A;  1PN9 A;  1SK0 A;  1ZYE A;  2TRC P;  4NPB A;  2H01 A;  2GT5 A;  3PIN A;  1SJI A;  3QCP A;  4HS1 A;  2HLS A;  1S3C A;  1XW6 A;  2C3Q A;  4KGI A;  4FIW A;  1GH2 A;  1A0F A;  4AJ8 A;  8GSS A;  3CSH A;  4K7O A;  3TKR A;  4F0C A;  4L5L A;  4IJ3 A;  4F0B A;  1WP0 A;  2CX4 A;  4PNF A;  5KN1 A;  1FB6 A;  1XFL A;  1EOG A;  1EEM A;  1V2A A;  4LLR A;  2ZUP A;  4GCI A;  2MMZ A;  2OBI A;  1QGV A;  1EGR A;  4DSQ A;  1IYI A;  3HVX A;  5A5K A;  3GV1 A;  1URM A;  4IBP A;  4K1F A;  2AHE A;  2L57 A;  2J9H A;  2H0H A;  2DJJ A;  4NXI A;  3MAK A;  4V1A p;  3HA9 A;  5LNK e;  1R5A A;  1XIY A;  2L5O A;  2PN8 A;  4O5R A;  1NM3 A;  3IK9 A;  1GUH A;  1SYR A;  1Z7P A;  1XW9 A;  2H0I A;  1Z9H A;  1YDK A;  2FLS A;  2WZ9 A;  3TUE A;  5CRE A;  2R6K A;  3IAS 2;  5CRW A;  1X9W B;  1PX7 A;  1VF1 A;  2DMM A;  5G1K A;  5HFK A;  3TRP A;  3QFB C;  3WGD A;  4QL7 A;  5D93 A;  1GTA A;  3HZ4 A;  4CHS A;  2XHF A;  5FWG A;  2GS3 A;  4OFT A;  2KLX A;  1SU9 A;  1NHY A;  1OC9 B;  2F8F A;  1XWG A;  5ECN B;  3L4N A;  1WWJ A;  1PD2 1;  1OC9 A;  4ECI A;  2AJQ B;  2EIR A;  2WFC A;  3GIX A;  3GKX A;  1M2D A;  19GS A;  4IJI A;  4FO5 A;  4MCU A;  2JL4 A;  2DBC A;  2V6K A;  3FZ9 A;  2OE1 A;  1RW1 A;  3H8Q A;  1GP1 A;  1FO5 A;  5AN1 A;  5B8A A;  1R7H A;  1UA5 A;  5GAP D;  1ZCP A;  4F9Z A;  2OE0 A;  3TKP A;  1QMV A;  2DIY A;  3W8S A;  1JZO A;  2E7P A;  7GSS A;  3A3T A;  4ECC A;  3IPZ A;  2C0F A;  3FKF A;  1CQH A;  4WEY A;  1XOB A;  3NIV A;  1YF1 A;  5JCW A;  1KTE A;  4Q5R A;  5EL8 A;  1GTU A;  2L59 A;  1QUW A;  2GSQ A;  2GLR A;  2DJ0 A;  3K8N A;  4KCA A;  3C8E A;  2H70 A;  5COH A;  5D9T A;  4KDY A;  2H30 A;  2HRN A;  1EV4 A;  2H6X A;  2N5A A;  3LOR A;  4XS1 A;  3FHK A;  2HNL A;  3I43 A;  1AQX A;  1TTZ A;  1QFN A;  4MZC A;  3MDK A;  5CO3 A;  2HE3 A;  2FA8 A;  2WUL A;  2C0E A;  4EUY A;  4WF5 A;  5G30 A;  5JWQ B;  1WIK A;  1HNB A;  2LS5 A;  4MJE A;  2YV9 A;  2I4A A;  3KZQ A;  5F07 A;  1XZO A;  1EP8 A;  2KP2 A;  3EWL A;  1OC3 A;  3OR5 A;  1GSQ A;  4HZ4 A;  1DE2 A;  5IMF A;  2AYT A;  3ZIT A;  5AIX A;  2JZS A;  1Z5Y E;  5HR0 A;  2P31 A;  1FG4 A;  2G0F A;  3QFA C;  3RBT A;  3CXG A;  3E3E A;  4HZ2 A;  3TKS E;  1B9Y C;  3ZRE A;  4PUA A;  1JZD A;  2KUC A;  4HU7 A;  4HJ2 A;  3FZ4 A;  4MAB A;  4MP4 A;  5ELG A;  3M9K A;  5A4V A;  2H74 A;  20GS A;  5AGY A;  3U5R E;  4PQ1 A;  1NSW A;  4FYC A;  3TB2 A;  1F9M A;  1TRS A;  1K0C A;  2X8H A;  2I9H A;  2M80 A;  1TRU A;  3HD5 A;  3IK7 A;  2NBS A;  3HVV A;  3LSZ A;  3KD0 A;  2C0G A;  4I97 A;  1X9M B;  4FYB A;  3F6F A;  4LL4 B;  4JBB A;  2NVL A;  5IOX A;  2WCI A;  3LQ7 A;  4KUN A;  1TKD B;  4WF4 A;  2VCT A;  3HZ8 A;  2PBJ A;  3WD6 A;  1YEP A;  11GS A;  2X8C A;  4ZB8 A;  3UAP A;  3C73 A;  1A0R P;  3EMP A;  12GS A;  4EL1 A;  3VWW A;  5LCZ A;  3MNG A;  4L0W A;  3KTL A;  3GN3 A;  1H4O A;  3ISO A;  4ID0 A;  3TJB A;  4OWY A;  4AJ7 A;  2BJX A;  4KSM A;  5ECM B;  5C00 A;  3KH9 A;  4ECB A;  1ZOF A;  2EC4 A;  4NWY A;  3TRX A;  2PVQ A;  3VUR A;  2L6C A;  1GUL A;  1YJ6 A;  5ID2 A;  2R2J A;  2HSH A;  2IFQ B;  1WJK A;  1BG5 A;  3LWA A;  3KTB A;  3M3M A;  1U88 A;  1MD4 A;  2IFQ A;  2L5L A;  2ON7 A;  3FR3 A;  4WR4 A; 
#chains in the Genus database with same CATH topology
 1Z3E A;  1DE1 A;  2LUS A;  5HR2 A;  1ZYP A;  1FVJ A;  2GSS A;  4G19 A;  1TI1 A;  2REM A;  1ZZY A;  2HYX A;  1HQO A;  4NAX A;  3IAM 2;  3TGZ A;  2VL2 A;  1RK4 A;  4F82 A;  1JHB A;  3FK8 A;  4TOP A;  1K3Y A;  2AAW A;  2JAC A;  3C71 A;  1XG8 A;  2RUF A;  4I2U A;  4ZL9 A;  4MK3 A;  4LMV A;  2JSY A;  3TKQ A;  1EP7 A;  3F8U A;  5HR3 A;  2A4V A;  4P3Y B;  1K0B A;  4XIH A;  4PGT A;  2CZ2 A;  1XOA A;  1N2A A;  3H79 A;  4JZQ A;  1TRW A;  4EXJ A;  2LV3 A;  2M72 A;  3UEM A;  3VWU A;  2H1A A;  2E2G A;  2IIY A;  1GSD A;  4AJ6 A;  2LQO A;  2FY6 A;  4KDU A;  2VAF A;  2ALB A;  5AIS A;  3GRX A;  4MPG A;  3Q74 A;  1GUM A;  4JR6 A;  3KGK A;  4Q5N A;  4GRF A;  3H93 A;  1PMT A;  1TI3 A;  1GL8 A;  3LG6 A;  4LMW A;  2VL2 C;  4EDZ A;  4BWS A;  4NV2 A;  4POB A;  2B7K A;  3D0Z A;  4IHU A;  1K0O A;  5G31 A;  3GL5 A;  3GUR A;  2H0G A;  2C80 A;  1PL2 A;  5CRD A;  1K0D A;  5A4U A;  1HYU A;  1GRX A;  1F3A A;  2N5F A;  2VL9 A;  2XPD A;  2I81 A;  2MMN A;  5IIZ A;  2X49 A;  4KH7 A;  5E4W A;  1VGL A;  2QC7 A;  3ZLP A;  4D73 B;  2R0G A;  3BCK A;  4IGJ A;  1Z6N A;  1E2Y A;  4D73 A;  3FZ5 A;  3EPT A;  2OE3 A;  4IP1 A;  3ZVJ D;  2YWN A;  3A5I A;  2YZU A;  3GFK A;  3N9J A;  3H1N A;  5DDL A;  1TW9 A;  1I5G A;  1SKS B;  4TR4 A;  3ZIJ A;  2G2Q A;  4RI6 A;  5IMD A;  3LEF A;  3LGC A;  2K8V A;  1ML6 A;  2DSA A;  5H5S A;  4OCE A;  3DEX A;  2IMF A;  1A23 A;  3DD3 A;  4G9H A;  2CX3 A;  5CRH A;  3RHB A;  1LU4 A;  1K3L A;  4HSC X;  4EC0 A;  3DVX A;  2K6V A;  5G5E A;  3HCZ A;  1AIU A;  3EUR A;  3KMO A;  1PL1 A;  3KIJ A;  1JLW A;  5KN2 A;  4LA1 A;  5DAL B;  3QDN A;  3KXO A;  1X5E A;  1EWX A;  2MMO A;  1AAZ A;  5DAL A;  4CW9 A;  2PMT A;  3HVN A;  3MIX A;  3ZZX A;  2P5Q A;  4KAE A;  3DWV A;  2H8L A;  1TXX A;  4G2E A;  1PX6 A;  1A2M A;  1ACV A;  2HRF A;  2CAQ A;  2JU5 A;  2F8A A;  1G7E A;  1XWK A;  2VCW A;  2PGT A;  3M8N A;  3ERF A;  3GX8 A;  2VCZ A;  4MJC A;  1EV9 A;  2DJ3 A;  2PUK C;  4YKF A;  3KM6 A;  1ERU A;  2DJK A;  1SK2 A;  2EIQ A;  5IMC A;  1MTC A;  1PFO A;  4RI7 A;  5DJL A;  1FOV A;  4BWQ A;  2WB9 A;  1OE7 A;  3DRN A;  2GQL A;  5IOW A;  1CQG A;  1PQN A;  2LST A;  3RPP A;  1X5C A;  3KMN A;  2VL3 A;  2YAN A;  3NZN A;  2K18 A;  3HVS A;  4O32 A;  1C72 A;  1BED A;  2GST A;  3EVI A;  3G9B A;  3KEB A;  4K0N A;  2F3M A;  2IN3 A;  2X8G A;  5HR1 A;  2VCV A;  1BAY A;  2B6M A;  5F06 A;  2C0D A;  2YJH A;  2QA1 A;  1A24 A;  2IMK A;  4N0V A;  4NV5 A;  2LJK A;  1S3A A;  2C4J A;  5CNW A;  4XRD A;  1ON4 A;  2O7K A;  4KDX A;  3IV4 A;  4G0L A;  1WPI A;  3R2Q A;  5D9X A;  3ZRD A;  3C1S A;  3QPM A;  4ZB9 A;  3I9V 2;  2H1B A;  2PPT A;  1M3J A;  2OAC A;  2LQQ A;  1M7T A;  5DAK B;  3EYT A;  3FMW A;  4OFN A;  1TU7 A;  4ML1 A;  3QAG A;  3VLN A;  2VOC A;  5DAK A;  3LJR A;  3HXS A;  2CVK A;  4YKG A;  2FD3 A;  6GSX A;  1AC1 A;  6GSW A;  2AV4 A;  4IS0 A;  2KOK A;  1TRV A;  3ERG A;  2YV7 A;  1F2E A;  2ES7 A;  3TOU A;  1SKW B;  4TRX A;  3F63 A;  2F9S A;  4ZB6 A;  2R37 A;  1XWB A;  3M9J A;  2LRN A;  1V58 A;  1B4Q A;  4Q5Q A;  1UC7 A;  2DJ1 A;  2HT9 A;  3ZFB A;  4N11 A;  5INY A;  4AF2 A;  1ERT A;  3DXB A;  3ZL5 A;  4IQ1 A;  4MA9 A;  1G7O A;  3CSJ A;  4TVE A;  2NDO A;  4WKW A;  2LRC A;  3PH9 A;  4I8B A;  3GTU B;  2YWO A;  3LXZ A;  4FQU A;  2B5X A;  3GTU A;  2HXK A;  1K0A A;  3HDC A;  2YPM A;  4V1A g;  2GGT A;  2FCH A;  4BL7 B;  3UOM A;  3F4S A;  5IQY A;  1XW5 A;  1K0N A;  3D21 A;  3D4M A;  4BL7 A;  3J7Y b;  4ZL8 A;  3I6A A;  5KOX A;  3HJM A;  1THO A;  2CT6 A;  3TOT A;  2LTK A;  2NPB A;  5IO2 A;  2I1U A;  3EU3 A;  4IW9 A;  3RDW A;  2QSI A;  2XPE A;  4L0U A;  2V6O A;  1GSU A;  3QAV A;  4HU9 A;  1ILO A;  3TDG A;  3C1R A;  2VLV A;  4KX4 A;  5CP1 A;  2HFD A;  2HSY A;  5HQP A;  3A5W A;  16GS A;  3E9J B;  5GZZ B;  5IM9 A;  2MBT A;  5D73 A;  2HZE B;  3F4T A;  4BVX A;  3J7Y k;  2H76 A;  5CAX A;  2HZE A;  4RQX A;  3VK9 A;  2YCD A;  2I3Y A;  3FYG A;  1R5P A;  1T3B A;  1EZK A;  4KCE A;  2H1D A;  4GSS A;  3ZVJ A;  4ZIJ A;  4PQH A;  2K8S A;  4K5R A;  5EVO A;  1Z6M A;  1A8Y A;  1S3D A;  2H66 A;  4V2N A;  2GZY A;  4ZIL A;  3UBK A;  1JZW A;  1GNW A;  4GTU A;  3KCM A;  1BQ7 A;  2BTO T;  5DQS A;  18GS A;  2YZH A;  1O8W A;  1Q4J A;  3G7J A;  2BMX A;  3F0I A;  1U3A A;  4TXV A;  2OKA A;  2HZF A;  2R0C A;  3E0U A;  1A8L A;  3IXR A;  2IWT A;  5D9W A;  3APQ A;  4NMU A;  1VRS D;  4PTS A;  2PVO C;  4PXO A;  2DML A;  4ISD A;  3ZFL A;  1SL0 B;  1MD3 A;  2B7J A;  1GSF A;  5CYY A;  2VCQ A;  4EKZ A;  1O7U A;  1JLV A;  3LXT A;  4PUF C;  4HOJ A;  4IKH A;  3ZML A;  2A2R A;  4V2L A;  1W4V A;  5DQY A;  5ID2 B;  5ECK B;  3Q19 A;  4IQA A;  3MYD A;  1XXU A;  3RAZ A;  5J5N A;  4MH3 A;  5BMU A;  5JWR B;  4Z7X A;  2FA4 A;  1R26 A;  4OO4 A;  4QL9 A;  1IYH A;  2R4V A;  4K6X A;  1OYJ A;  5DBQ A;  6GSY A;  5IMV A;  3WT1 A;  4G0K A;  1V40 A;  1TU8 A;  3VWV A;  4DVC A;  2XC2 A;  1TK5 B;  2QKE A;  4EIQ A;  5J41 A;  5IPH A;  3S9F A;  2GDR A;  3O6T A;  3PGT A;  4A5P A;  6GSS A;  1PSQ A;  2F51 A;  3F4R A;  1M2B A;  1H75 A;  4J57 E;  2CQ9 A;  3CBU A;  5ECP B;  4F03 A;  2H6Z A;  2CVD A;  2A4H A;  3UL3 A;  5A4W A;  2IPA A;  2RUE A;  2MZC A;  1ZL9 A;  1HNA A;  5B7C A;  1B9X C;  5DVB A;  3DIE A;  4GST A;  4Z2R A;  4GF0 A;  2C8U A;  1B4P A;  2D2Z A;  4KA0 A;  2DJ2 A;  3H4K A;  4CY8 A;  4E8E A;  1SYX A;  4BPY A;  2WDU A;  3CMI A;  1MDJ A;  3BCI A;  3IDV A;  3I69 A;  1YY7 A;  3IOS A;  3LYP A;  1T4Y A;  1AUC A;  1SJZ A;  1OVN A;  3N5O A;  3GKK A;  1UN2 A;  3C7M A;  1OAZ A;  2GTU A;  2IJY A;  3EE2 A;  4MNN A;  4IEL A;  2VD0 A;  2HRA A;  3GST A;  3APO A;  4Q5F A;  1ZGN A;  3DYR A;  5DJM A;  3W8J A;  3G7Y A;  2LNT A;  3DML A;  3GKN A;  1RQM A;  4MMM A;  3JCM L;  1UVZ A;  4MJB A;  5ECH B;  2OBK A;  1O73 A;  2VLT A;  4K9Z A;  1FB0 A;  1Q98 A;  5KEJ A;  5DCG A;  4K7I A;  2LRT A;  2UZ8 A;  1JZR A;  2LEG A;  14GS A;  4O5U A;  4EVM A;  4GWR A;  1F3B A;  3IBH A;  1QQ2 A;  1WRY A;  3VFI A;  3FR9 A;  1O8X A;  4WBR D;  3FEU A;  3F3R A;  1T8E B;  5CRG A;  2A2P A;  1J9B A;  1GUK A;  1I9D A;  5ECQ B;  1QXH A;  1WE0 A;  3L0H A;  4OMV A;  4XTS A;  2JAD A;  1YZX A;  1AXD A;  2ZNM A;  1PKW A;  2VLU A;  1X0R A;  5G5F A;  3L9S A;  5GSS A;  4K2D A;  4X0X A;  3WGX A;  1F37 A;  1ERV A;  1VF2 A;  4JR4 A;  2O89 A;  4ZBD A;  4ZL7 A;  1J08 A;  2NTO A;  3NOF A;  3LFL A;  1FVK A;  3DVW A;  4BA7 A;  3P2A A;  4TR1 B;  1ST9 A;  2N5B A;  2V1M A;  2PER A;  3HKR A;  2PWJ A;  4BVY B;  5ECI B;  5GST A;  4TR1 A;  4YQV A;  4O5Q A;  1YF0 A;  2YN1 A;  4BVY A;  1KEB A;  3QAW A;  2B5Y A;  2WJU A;  2VO4 A;  1XCC A;  1T1V A;  6GST A;  2C3T A;  2ZCT A;  3VI5 A;  3IHQ A;  3HY2 A;  3KJY A;  4KB3 A;  5EY6 A;  3UMA A;  2RM5 A;  5H5Q A;  4ML6 A;  1M9A A;  4X1U A;  3CTF A;  2H1G A;  2JZR A;  3BBY A;  4XHM A;  2L4Q A;  3GHA A;  4MF5 A;  3O76 A;  4KW6 A;  5KOW A;  2H19 A;  3CRT A;  1TK0 B;  4XCS A;  4WXT A;  4N10 A;  3US3 A;  1SJ6 A;  1U6T A;  2AUV A;  2P5R A;  1MDK A;  4H86 A;  4JE1 A;  5EPF A;  4GSN A;  1EOH A;  1FAA A;  2EIO A;  1DUG A;  3A2V A;  4DSS B;  3ZMK A;  3GH6 A;  5ECS A;  1AW9 A;  1AQW A;  1KNG A;  4DSR A;  4NHW A;  5J9B A;  3FRC A;  4DSS A;  1ZYN A;  2QA2 A;  1GSY A;  5E59 A;  5J9C A;  3D4T A;  3PR8 A;  4L5O A;  5F0G A;  2X99 A;  3SWL A;  1MEK A;  5JCU A;  1XPV A;  2V2G A;  3RPN A;  3G7I A;  2K9F A;  2VD1 A;  3GMF A;  4X4J A;  2O8V B;  1TP9 A;  2O85 A;  3F6D A;  3GH9 A;  1XBS A;  3UAR A;  1EGO A;  5IMZ A;  2DIZ A;  3IRA A;  5D96 A;  1T4Z A;  4F2I A;  4TXO B;  5F05 A;  1VF4 A;  2TIR A;  3ZTL A;  4POM A;  4TXO A;  4TN8 A;  3FZA A;  5AIV A;  4O7H A;  3U6V A;  2WGR A;  2YNX A;  5FHI A;  3GSS A;  4RQR A;  5BRT A;  1LJR A;  2R3X A;  5C04 A;  1XWC A;  3ME8 A;  3L9V A;  4HQZ A;  5ABR A;  5G1L A;  2FWF A;  2E0Q A;  10GS A;  4KSO A;  3A2X A;  3TKS A;  2X4A A;  3DGQ A;  4K2X A;  4GXZ A;  1XWA A;  4MZW A;  2GZZ A;  1SEN A;  4ILF A;  2H6Y A;  2R0P A;  1NHO A;  3EMX A;  3VPQ A;  1Y25 A;  4N0Z A;  4MH2 A;  2GQK A;  1G6W A;  3O3T A;  2C3N A;  2GZP A;  3CYN A;  4HDE A;  1YEX A;  2VCX A;  4USS A;  1GNE A;  1V9W A;  5GAN D;  1O85 A;  2C1Y A;  5ECL B;  4ICY A;  3MWH A;  3KP8 A;  3HJO A;  4MJA A;  1HNC A;  2XBI A;  3UVT A;  3WGE A;  4TKY A;  3VWX A;  3FW2 A;  2E2M A;  1EEJ A;  5JWO B;  4ZBB A;  1PA3 A;  5D9V A;  1PN0 A;  3F3Q A;  2A2S A;  4MF7 A;  5G2Z A;  3HJP A;  1Z7R A;  2YJ7 A;  3QMX A;  1YQ1 A;  3GYK A;  4G10 A;  4K7N A;  1GLQ A;  1NW2 A;  1J0F A;  1T00 A;  5ECO B;  1K0M A;  3D6I A;  5J3R A;  3TKS C;  2B5E A;  2CV4 A;  2M46 A;  1PGT A;  4RUV A;  5HFI A;  5H5R A;  5IPG A;  4ULX A;  2ON5 A;  1FW1 A;  5L71 A;  1U87 A;  4X43 A;  3CTG A;  4PUR A;  2DC5 A;  1M3I A;  3WYW A;  3UVH A;  1MDI A;  1XVW A;  1TJD A;  2KHP A;  3TJF A;  2HI7 A;  4OCF A;  4KF9 A;  1GTI A;  4ACS A;  4WET A;  4YH2 A;  2GT6 A;  3EU4 A;  2V32 A;  2L6D A;  1F6M C;  1TK8 B;  1FHE A;  1OKD A;  2LJR A;  4PX1 A;  1X9S B;  1X5D A;  1GLP A;  3L9U A;  4WR5 A;  1SKR B;  2AB6 A;  2FWG A;  3GKM A;  2WS2 A;  3TJG A;  5IO0 A;  2MMA A;  2RM6 A;  3APS A;  1Y6E A;  4HJM A;  5LD0 A;  3GX0 A;  3AY8 A;  4TR3 A;  2YWM A;  4HQS A;  4YAV A;  1FOH A;  4V2M A;  3UIW A;  2LNS A;  1T7P B;  3GUS A;  3F9U A;  4DEJ A;  4N30 A;  2B1L A;  4YAP A;  4BVX B;  2FWH A;  4ZXG A;  5JCG A;  1N8J A;  5FT3 A;  4O92 A;  2IL3 A;  4AGS A;  3IE3 A;  4Z2T A;  3BD2 A;  3P7X A;  4WBJ A;  4MPF A;  4XRA A;  2CAI A;  1THX A;  3V1W A;  4PNG A;  4J56 E;  2B3S A;  3M1G A;  3BJ5 A;  1S3R A;  6GSV A;  2CA8 A;  1YKA A;  1BYE A;  3ED3 A;  4HEA 2;  22GS A;  1ABA A;  4JU5 A;  2VM1 A;  4FYU A;  2YWI A;  1K3O A;  4MF6 A;  1KBN A;  4YQU A;  2RII A;  2LKU A;  2LJA A;  3RHC A;  4KE3 A;  3FY7 A;  4HI7 A;  1TDI A;  4G0I A;  2P0G A;  4IN0 A;  2CVB A;  2CZ3 A;  3ZYW A;  1WMJ A;  1SL2 B;  3DKS A;  4OFM A;  1W89 A;  3IC4 A;  3TJK A;  1ZYQ B;  1JFU A;  3FR6 A;  2V41 A;  2JZT A;  2L4C A;  5B8B A;  2YP6 A;  3VI7 A;  3R3E A;  5HFG A;  1G6Y A;  4MLY A;  2QGV A;  2IME A;  2FWE A;  2MBS A;  1M9B A;  4I2T A;  2GVP A;  2OA7 A;  2TRX A;  3D5J A;  3W6G A;  4EF0 A;  1SL1 B;  3EC3 A;  5ENU A;  2PU9 C;  1USB A;  2X64 A;  4LL1 B;  2RLI A;  3HYP A;  1ERW A;  5DCH A;  3ME7 A;  1E6B A;  17GS A;  4GQC A;  4K8M A;  1QK8 A;  1GSS A;  1TOF A;  4PQI A;  5ECR B;  1B8X A;  4EDY A;  1G0T A;  3CQF A;  2B1K A;  1BJX A;  2VIM A;  4POL A;  2DLX A;  1V98 A;  3GA4 A;  1A2J A;  2J23 A;  2FNO A;  5J4U A;  4EIP A;  4MZB A;  2YOI A;  3UBL A;  4GLT A;  3KH7 A;  2GQM A;  1SD9 A;  3EIN A;  1U3I A;  1SD8 A;  3D22 A;  6GSU A;  2R5G A;  1YKC A;  3M0F A;  4IVF A;  4I5Q A;  1M2A A;  3PPU A;  1OE8 A;  4JRR A;  4L8E A;  3CSI A;  4OO5 A;  2GSR A;  1GWC A;  4EE0 A;  1ZMA A;  4QQ7 A;  1AQV A;  3IR4 A;  5D8I A;  4YQM A;  2H71 A;  3HHV A;  3QR6 A;  1PRX A;  4CDO A;  2WRT A;  1BX9 A;  3QD9 A;  3ZIV A;  4MDC A;  4E8H A;  9GSS A;  2O87 A;  1VF3 A;  4FH8 A;  4ZBA A;  4XS6 A;  5KN0 A;  2IMD A;  3BOA A;  4OD7 A;  5ELA A;  3QOU A;  4POK A;  4I6X A;  4TR0 A;  5KN3 A;  1HD2 A;  4CY6 A;  4ECJ A;  4EO3 A;  3Q6O A;  1A2L A;  1OC8 A;  2FGX A;  2IMI A;  1SK1 A;  3UJ1 A;  1GTB A;  1O6J A;  3TCO A;  5IMA A;  5B6M A;  1DBY A;  1WOU A;  2FHE A;  4TW5 A;  2Z9S A;  3P90 A;  2H75 A;  1GSE A;  3WT2 A;  3TJJ A;  4BIK A;  2VM2 A;  2JSZ A;  1V57 A;  3IHG A;  1DSB A;  1OKT A;  2VUP A;  3GNJ A;  4J2F A;  3L78 A;  3KP9 A;  5F8B A;  1B48 A;  1O81 A;  4KND A;  3GL3 A;  3IA1 A;  3VPT A;  3MSZ A;  4IP6 A;  2H72 A;  3SBC A;  3A2W A;  5B6N A;  4K0G A;  4NHZ A;  13GS A;  2XBQ A;  1PKZ A;  3P8W A;  1M0U A;  2KP1 A;  2OJL A;  3CRU A;  2FUG 2;  4XS4 B;  1R4W A;  2OAD A;  2H73 A;  2MYG A;  4JED A;  3TRQ A;  4XS4 A;  3ERW A;  3Q18 A;  4GQF A;  4HUA A;  3LYK A;  1M99 A;  1LBK A;  1XVQ A;  1PN9 A;  1SK0 A;  1ZYE A;  2TRC P;  4NPB A;  2H01 A;  4Z2U A;  2GT5 A;  3PIN A;  1SJI A;  3QCP A;  4HS1 A;  2HLS A;  1S3C A;  1XW6 A;  2C3Q A;  4KGI A;  4FIW A;  1GH2 A;  1A0F A;  4AJ8 A;  8GSS A;  3CSH A;  4K7O A;  3TKR A;  4F0C A;  4L5L A;  4IJ3 A;  4F0B A;  1WP0 A;  2CX4 A;  4PNF A;  5KN1 A;  1FB6 A;  1XFL A;  1EOG A;  1EEM A;  1V2A A;  4LLR A;  2ZUP A;  4GCI A;  2MMZ A;  2OBI A;  1QGV A;  1EGR A;  4DSQ A;  1IYI A;  3HVX A;  5A5K A;  3GV1 A;  1URM A;  4IBP A;  4K1F A;  2AHE A;  2L57 A;  2J9H A;  2H0H A;  2DJJ A;  4NXI A;  3MAK A;  4V1A p;  3HA9 A;  5LNK e;  1R5A A;  1XIY A;  2L5O A;  2PN8 A;  4O5R A;  1NM3 A;  3IK9 A;  1GUH A;  1SYR A;  1Z7P A;  1XW9 A;  2H0I A;  1Z9H A;  1YDK A;  2FLS A;  2WZ9 A;  3TUE A;  5CRE A;  2R6K A;  3IAS 2;  5CRW A;  1X9W B;  1PX7 A;  1VF1 A;  2DMM A;  5G1K A;  5HFK A;  3TRP A;  3QFB C;  3WGD A;  4QL7 A;  5D93 A;  1GTA A;  3HZ4 A;  4CHS A;  2XHF A;  4K5S A;  5FWG A;  2GS3 A;  4OFT A;  2KLX A;  1SU9 A;  1NHY A;  1OC9 B;  2F8F A;  1XWG A;  5ECN B;  3L4N A;  1WWJ A;  1PD2 1;  1OC9 A;  4ECI A;  2AJQ B;  2EIR A;  2WFC A;  3GIX A;  3GKX A;  1M2D A;  19GS A;  2HRK A;  4IJI A;  4FO5 A;  4MCU A;  2JL4 A;  2DBC A;  2V6K A;  3FZ9 A;  3IC8 A;  2OE1 A;  1RW1 A;  3H8Q A;  1GP1 A;  1FO5 A;  5AN1 A;  5B8A A;  1R7H A;  1UA5 A;  5GAP D;  1ZCP A;  4F9Z A;  2OE0 A;  3TKP A;  1QMV A;  2DIY A;  3W8S A;  1JZO A;  2E7P A;  7GSS A;  3A3T A;  4ECC A;  3IPZ A;  2C0F A;  3FKF A;  1CQH A;  4WEY A;  1XOB A;  3NIV A;  1YF1 A;  5JCW A;  1KTE A;  4Q5R A;  5EL8 A;  1GTU A;  2HSM A;  2L59 A;  1QUW A;  2GSQ A;  2GLR A;  2DJ0 A;  3K8N A;  4KCA A;  3C8E A;  2H70 A;  5COH A;  5D9T A;  4KDY A;  2H30 A;  2HRN A;  1EV4 A;  2H6X A;  2N5A A;  3LOR A;  4XS1 A;  3FHK A;  2HNL A;  3I43 A;  1AQX A;  1TTZ A;  1QFN A;  4MZC A;  3MDK A;  5CO3 A;  2HE3 A;  2FA8 A;  2WUL A;  2C0E A;  4EUY A;  4WF5 A;  5G30 A;  5JWQ B;  1WIK A;  1HNB A;  2LS5 A;  4MJE A;  2YV9 A;  2I4A A;  3KZQ A;  5F07 A;  1XZO A;  1EP8 A;  2KP2 A;  3EWL A;  1OC3 A;  3OR5 A;  1GSQ A;  4HZ4 A;  1DE2 A;  5IMF A;  2AYT A;  3ZIT A;  5AIX A;  2JZS A;  1Z5Y E;  5HR0 A;  2P31 A;  1FG4 A;  2G0F A;  3QFA C;  3RBT A;  3CXG A;  3E3E A;  4HZ2 A;  3TKS E;  1B9Y C;  3ZRE A;  4PUA A;  1JZD A;  2KUC A;  4HU7 A;  4HJ2 A;  3FZ4 A;  4MAB A;  4MP4 A;  5ELG A;  3M9K A;  5A4V A;  2H74 A;  20GS A;  5AGY A;  3U5R E;  4PQ1 A;  1NSW A;  4FYC A;  3TB2 A;  1F9M A;  1TRS A;  1K0C A;  2X8H A;  2I9H A;  2M80 A;  1TRU A;  3HD5 A;  3IK7 A;  2NBS A;  2DKI A;  3HVV A;  3LSZ A;  3KD0 A;  2C0G A;  4I97 A;  1X9M B;  4FYB A;  3F6F A;  4LL4 B;  4JBB A;  2NVL A;  5IOX A;  2WCI A;  3LQ7 A;  4KUN A;  1TKD B;  4WF4 A;  2VCT A;  3HZ8 A;  2PBJ A;  3WD6 A;  1YEP A;  11GS A;  2X8C A;  4ZB8 A;  2DKH A;  3UAP A;  3C73 A;  1A0R P;  3EMP A;  12GS A;  4EL1 A;  3VWW A;  5LCZ A;  3MNG A;  4L0W A;  3KTL A;  3GN3 A;  1H4O A;  3ISO A;  4ID0 A;  3TJB A;  4OWY A;  4AJ7 A;  2BJX A;  4KSM A;  5ECM B;  5C00 A;  3KH9 A;  4ECB A;  1ZOF A;  2EC4 A;  4NWY A;  3TRX A;  2PVQ A;  3VUR A;  2L6C A;  1GUL A;  1YJ6 A;  5ID2 A;  2R2J A;  2HSH A;  2IFQ B;  1WJK A;  1BG5 A;  3LWA A;  3KTB A;  3M3M A;  1U88 A;  1MD4 A;  2IFQ A;  2L5L A;  2ON7 A;  3LW9 A;  3FR3 A;  4WR4 A; 
#chains in the Genus database with same CATH homology
 1Z3E A;  1DE1 A;  2LUS A;  5HR2 A;  1ZYP A;  1FVJ A;  2GSS A;  4G19 A;  1TI1 A;  2REM A;  1ZZY A;  2HYX A;  1HQO A;  4NAX A;  3IAM 2;  3TGZ A;  2VL2 A;  1RK4 A;  4F82 A;  1JHB A;  3FK8 A;  4TOP A;  1K3Y A;  2AAW A;  2JAC A;  3C71 A;  2RUF A;  4I2U A;  4ZL9 A;  4MK3 A;  4LMV A;  2JSY A;  3TKQ A;  1EP7 A;  3F8U A;  5HR3 A;  2A4V A;  4P3Y B;  1K0B A;  4XIH A;  4PGT A;  2CZ2 A;  1XOA A;  1N2A A;  3H79 A;  4JZQ A;  1TRW A;  4EXJ A;  2LV3 A;  2M72 A;  3UEM A;  3VWU A;  2H1A A;  2E2G A;  2IIY A;  1GSD A;  4AJ6 A;  2LQO A;  2FY6 A;  4KDU A;  2VAF A;  2ALB A;  5AIS A;  3GRX A;  4MPG A;  3Q74 A;  1GUM A;  4JR6 A;  3KGK A;  4Q5N A;  4GRF A;  3H93 A;  1PMT A;  1TI3 A;  1GL8 A;  3LG6 A;  4LMW A;  2VL2 C;  4EDZ A;  4BWS A;  4NV2 A;  4POB A;  2B7K A;  3D0Z A;  4IHU A;  1K0O A;  5G31 A;  3GL5 A;  3GUR A;  2H0G A;  2C80 A;  1PL2 A;  5CRD A;  1K0D A;  5A4U A;  1HYU A;  1GRX A;  1F3A A;  2N5F A;  2VL9 A;  2XPD A;  2I81 A;  2MMN A;  5IIZ A;  2X49 A;  4KH7 A;  5E4W A;  1VGL A;  2QC7 A;  3ZLP A;  4D73 B;  2R0G A;  3BCK A;  4IGJ A;  1Z6N A;  1E2Y A;  4D73 A;  3FZ5 A;  3EPT A;  2OE3 A;  4IP1 A;  3ZVJ D;  2YWN A;  3A5I A;  2YZU A;  3GFK A;  3N9J A;  3H1N A;  5DDL A;  1TW9 A;  1I5G A;  1SKS B;  4TR4 A;  3ZIJ A;  2G2Q A;  4RI6 A;  5IMD A;  3LEF A;  3LGC A;  2K8V A;  1ML6 A;  2DSA A;  5H5S A;  4OCE A;  3DEX A;  2IMF A;  1A23 A;  3DD3 A;  4G9H A;  2CX3 A;  5CRH A;  3RHB A;  1LU4 A;  1K3L A;  4EC0 A;  3DVX A;  2K6V A;  5G5E A;  3HCZ A;  1AIU A;  3EUR A;  3KMO A;  1PL1 A;  3KIJ A;  1JLW A;  5KN2 A;  4LA1 A;  5DAL B;  3QDN A;  3KXO A;  1X5E A;  1EWX A;  2MMO A;  1AAZ A;  5DAL A;  4CW9 A;  2PMT A;  3MIX A;  3ZZX A;  2P5Q A;  4KAE A;  3DWV A;  2H8L A;  1TXX A;  4G2E A;  1PX6 A;  1A2M A;  1ACV A;  2HRF A;  2CAQ A;  2JU5 A;  2F8A A;  1G7E A;  1XWK A;  2VCW A;  2PGT A;  3M8N A;  3ERF A;  3GX8 A;  2VCZ A;  4MJC A;  1EV9 A;  2DJ3 A;  2PUK C;  4YKF A;  3KM6 A;  1ERU A;  2DJK A;  1SK2 A;  2EIQ A;  5IMC A;  1MTC A;  4RI7 A;  5DJL A;  1FOV A;  4BWQ A;  2WB9 A;  1OE7 A;  3DRN A;  2GQL A;  5IOW A;  1CQG A;  1PQN A;  2LST A;  3RPP A;  1X5C A;  3KMN A;  2VL3 A;  2YAN A;  3NZN A;  2K18 A;  3HVS A;  4O32 A;  1C72 A;  1BED A;  2GST A;  3EVI A;  3G9B A;  3KEB A;  4K0N A;  2F3M A;  2IN3 A;  2X8G A;  5HR1 A;  2VCV A;  1BAY A;  2B6M A;  5F06 A;  2C0D A;  2YJH A;  2QA1 A;  1A24 A;  2IMK A;  4N0V A;  4NV5 A;  2LJK A;  1S3A A;  2C4J A;  5CNW A;  4XRD A;  1ON4 A;  2O7K A;  4KDX A;  3IV4 A;  4G0L A;  1WPI A;  3R2Q A;  5D9X A;  3ZRD A;  3C1S A;  3QPM A;  4ZB9 A;  3I9V 2;  2H1B A;  2PPT A;  2OAC A;  2LQQ A;  1M7T A;  5DAK B;  3EYT A;  3FMW A;  4OFN A;  1TU7 A;  4ML1 A;  3QAG A;  3VLN A;  2VOC A;  5DAK A;  3LJR A;  3HXS A;  2CVK A;  4YKG A;  2FD3 A;  6GSX A;  1AC1 A;  6GSW A;  2AV4 A;  4IS0 A;  2KOK A;  1TRV A;  3ERG A;  2YV7 A;  1F2E A;  2ES7 A;  3TOU A;  1SKW B;  4TRX A;  3F63 A;  2F9S A;  4ZB6 A;  2R37 A;  1XWB A;  3M9J A;  2LRN A;  1V58 A;  1B4Q A;  4Q5Q A;  1UC7 A;  2DJ1 A;  2HT9 A;  3ZFB A;  4N11 A;  5INY A;  4AF2 A;  1ERT A;  3DXB A;  3ZL5 A;  4IQ1 A;  4MA9 A;  1G7O A;  3CSJ A;  4TVE A;  2NDO A;  4WKW A;  2LRC A;  3PH9 A;  4I8B A;  3GTU B;  2YWO A;  3LXZ A;  4FQU A;  2B5X A;  3GTU A;  2HXK A;  1K0A A;  3HDC A;  2YPM A;  4V1A g;  2GGT A;  2FCH A;  4BL7 B;  3UOM A;  3F4S A;  5IQY A;  1XW5 A;  1K0N A;  3D21 A;  3D4M A;  4BL7 A;  3J7Y b;  4ZL8 A;  3I6A A;  5KOX A;  3HJM A;  1THO A;  2CT6 A;  3TOT A;  2LTK A;  2NPB A;  5IO2 A;  2I1U A;  3EU3 A;  4IW9 A;  3RDW A;  2QSI A;  2XPE A;  4L0U A;  2V6O A;  1GSU A;  3QAV A;  4HU9 A;  1ILO A;  3TDG A;  3C1R A;  2VLV A;  4KX4 A;  5CP1 A;  2HFD A;  2HSY A;  5HQP A;  3A5W A;  16GS A;  3E9J B;  5GZZ B;  5IM9 A;  2MBT A;  5D73 A;  2HZE B;  3F4T A;  4BVX A;  3J7Y k;  2H76 A;  5CAX A;  2HZE A;  4RQX A;  3VK9 A;  2YCD A;  2I3Y A;  3FYG A;  1R5P A;  1T3B A;  1EZK A;  4KCE A;  2H1D A;  4GSS A;  3ZVJ A;  4ZIJ A;  4PQH A;  2K8S A;  4K5R A;  5EVO A;  1Z6M A;  1A8Y A;  1S3D A;  2H66 A;  4V2N A;  2GZY A;  4ZIL A;  3UBK A;  1JZW A;  1GNW A;  4GTU A;  3KCM A;  1BQ7 A;  2BTO T;  5DQS A;  18GS A;  2YZH A;  1O8W A;  1Q4J A;  3G7J A;  2BMX A;  3F0I A;  1U3A A;  4TXV A;  2OKA A;  2HZF A;  2R0C A;  3E0U A;  1A8L A;  3IXR A;  2IWT A;  5D9W A;  3APQ A;  4NMU A;  1VRS D;  4PTS A;  2PVO C;  4PXO A;  2DML A;  4ISD A;  3ZFL A;  1SL0 B;  1MD3 A;  2B7J A;  1GSF A;  5CYY A;  2VCQ A;  4EKZ A;  1O7U A;  1JLV A;  3LXT A;  4PUF C;  4HOJ A;  4IKH A;  3ZML A;  2A2R A;  4V2L A;  1W4V A;  5DQY A;  5ID2 B;  5ECK B;  3Q19 A;  4IQA A;  3MYD A;  1XXU A;  3RAZ A;  5J5N A;  4MH3 A;  5BMU A;  5JWR B;  4Z7X A;  2FA4 A;  1R26 A;  4OO4 A;  4QL9 A;  1IYH A;  2R4V A;  4K6X A;  1OYJ A;  5DBQ A;  6GSY A;  5IMV A;  3WT1 A;  4G0K A;  1V40 A;  1TU8 A;  3VWV A;  4DVC A;  2XC2 A;  1TK5 B;  2QKE A;  4EIQ A;  5J41 A;  5IPH A;  3S9F A;  2GDR A;  3O6T A;  3PGT A;  4A5P A;  6GSS A;  1PSQ A;  2F51 A;  3F4R A;  1M2B A;  1H75 A;  4J57 E;  2CQ9 A;  3CBU A;  5ECP B;  4F03 A;  2H6Z A;  2CVD A;  2A4H A;  3UL3 A;  5A4W A;  2IPA A;  2RUE A;  2MZC A;  1ZL9 A;  1HNA A;  5B7C A;  1B9X C;  5DVB A;  3DIE A;  4GST A;  4Z2R A;  4GF0 A;  2C8U A;  1B4P A;  2D2Z A;  4KA0 A;  2DJ2 A;  3H4K A;  4CY8 A;  4E8E A;  1SYX A;  4BPY A;  2WDU A;  3CMI A;  1MDJ A;  3BCI A;  3IDV A;  3I69 A;  1YY7 A;  3IOS A;  3LYP A;  1T4Y A;  1AUC A;  1SJZ A;  1OVN A;  3N5O A;  3GKK A;  1UN2 A;  3C7M A;  1OAZ A;  2GTU A;  2IJY A;  3EE2 A;  4MNN A;  4IEL A;  2VD0 A;  2HRA A;  3GST A;  3APO A;  4Q5F A;  1ZGN A;  3DYR A;  5DJM A;  3W8J A;  3G7Y A;  2LNT A;  3DML A;  3GKN A;  1RQM A;  4MMM A;  3JCM L;  1UVZ A;  4MJB A;  5ECH B;  2OBK A;  1O73 A;  2VLT A;  4K9Z A;  1FB0 A;  1Q98 A;  5KEJ A;  5DCG A;  4K7I A;  2LRT A;  2UZ8 A;  1JZR A;  2LEG A;  14GS A;  4O5U A;  4EVM A;  4GWR A;  1F3B A;  3IBH A;  1QQ2 A;  1WRY A;  3VFI A;  3FR9 A;  1O8X A;  4WBR D;  3FEU A;  3F3R A;  1T8E B;  5CRG A;  2A2P A;  1J9B A;  1GUK A;  1I9D A;  5ECQ B;  1QXH A;  1WE0 A;  3L0H A;  4OMV A;  4XTS A;  2JAD A;  1YZX A;  1AXD A;  2ZNM A;  1PKW A;  2VLU A;  1X0R A;  5G5F A;  3L9S A;  5GSS A;  4K2D A;  4X0X A;  3WGX A;  1F37 A;  1ERV A;  1VF2 A;  4JR4 A;  2O89 A;  4ZBD A;  4ZL7 A;  1J08 A;  2NTO A;  3NOF A;  3LFL A;  1FVK A;  3DVW A;  4BA7 A;  3P2A A;  4TR1 B;  1ST9 A;  2N5B A;  2V1M A;  2PER A;  3HKR A;  2PWJ A;  4BVY B;  5ECI B;  5GST A;  4TR1 A;  4YQV A;  4O5Q A;  1YF0 A;  2YN1 A;  4BVY A;  1KEB A;  3QAW A;  2B5Y A;  2WJU A;  2VO4 A;  1XCC A;  1T1V A;  6GST A;  2C3T A;  2ZCT A;  3VI5 A;  3IHQ A;  3HY2 A;  3KJY A;  4KB3 A;  5EY6 A;  3UMA A;  2RM5 A;  5H5Q A;  4ML6 A;  1M9A A;  4X1U A;  3CTF A;  2H1G A;  2JZR A;  3BBY A;  4XHM A;  2L4Q A;  3GHA A;  4MF5 A;  3O76 A;  4KW6 A;  5KOW A;  2H19 A;  3CRT A;  1TK0 B;  4XCS A;  4WXT A;  4N10 A;  3US3 A;  1SJ6 A;  1U6T A;  2AUV A;  2P5R A;  1MDK A;  4H86 A;  4JE1 A;  5EPF A;  4GSN A;  1EOH A;  1FAA A;  2EIO A;  1DUG A;  3A2V A;  4DSS B;  3ZMK A;  3GH6 A;  5ECS A;  1AW9 A;  1AQW A;  1KNG A;  4DSR A;  4NHW A;  5J9B A;  3FRC A;  4DSS A;  1ZYN A;  2QA2 A;  1GSY A;  5E59 A;  5J9C A;  3D4T A;  3PR8 A;  4L5O A;  5F0G A;  2X99 A;  3SWL A;  1MEK A;  5JCU A;  1XPV A;  2V2G A;  3RPN A;  3G7I A;  2K9F A;  2VD1 A;  3GMF A;  4X4J A;  2O8V B;  1TP9 A;  2O85 A;  3F6D A;  3GH9 A;  1XBS A;  3UAR A;  1EGO A;  5IMZ A;  2DIZ A;  3IRA A;  5D96 A;  1T4Z A;  4F2I A;  4TXO B;  5F05 A;  1VF4 A;  2TIR A;  3ZTL A;  4POM A;  4TXO A;  4TN8 A;  3FZA A;  5AIV A;  4O7H A;  3U6V A;  2WGR A;  2YNX A;  5FHI A;  3GSS A;  4RQR A;  5BRT A;  1LJR A;  2R3X A;  5C04 A;  1XWC A;  3ME8 A;  3L9V A;  4HQZ A;  5ABR A;  5G1L A;  2FWF A;  2E0Q A;  10GS A;  4KSO A;  3A2X A;  3TKS A;  2X4A A;  3DGQ A;  4K2X A;  4GXZ A;  1XWA A;  4MZW A;  2GZZ A;  1SEN A;  4ILF A;  2H6Y A;  2R0P A;  1NHO A;  3EMX A;  3VPQ A;  1Y25 A;  4N0Z A;  4MH2 A;  2GQK A;  1G6W A;  3O3T A;  2C3N A;  2GZP A;  3CYN A;  4HDE A;  1YEX A;  2VCX A;  4USS A;  1GNE A;  1V9W A;  5GAN D;  1O85 A;  2C1Y A;  5ECL B;  4ICY A;  3MWH A;  3KP8 A;  3HJO A;  4MJA A;  1HNC A;  2XBI A;  3UVT A;  3WGE A;  4TKY A;  3VWX A;  3FW2 A;  2E2M A;  1EEJ A;  5JWO B;  4ZBB A;  1PA3 A;  5D9V A;  1PN0 A;  3F3Q A;  2A2S A;  4MF7 A;  5G2Z A;  3HJP A;  1Z7R A;  2YJ7 A;  3QMX A;  1YQ1 A;  3GYK A;  4G10 A;  4K7N A;  1GLQ A;  1NW2 A;  1J0F A;  1T00 A;  5ECO B;  1K0M A;  3D6I A;  5J3R A;  3TKS C;  2B5E A;  2CV4 A;  2M46 A;  1PGT A;  4RUV A;  5HFI A;  5H5R A;  5IPG A;  4ULX A;  2ON5 A;  1FW1 A;  5L71 A;  1U87 A;  4X43 A;  3CTG A;  4PUR A;  2DC5 A;  3WYW A;  3UVH A;  1MDI A;  1XVW A;  1TJD A;  2KHP A;  3TJF A;  2HI7 A;  4OCF A;  4KF9 A;  1GTI A;  4ACS A;  4WET A;  4YH2 A;  2GT6 A;  3EU4 A;  2V32 A;  2L6D A;  1F6M C;  1TK8 B;  1FHE A;  1OKD A;  2LJR A;  4PX1 A;  1X9S B;  1X5D A;  1GLP A;  3L9U A;  4WR5 A;  1SKR B;  2AB6 A;  2FWG A;  3GKM A;  2WS2 A;  3TJG A;  5IO0 A;  2MMA A;  2RM6 A;  3APS A;  1Y6E A;  4HJM A;  5LD0 A;  3GX0 A;  3AY8 A;  4TR3 A;  2YWM A;  4HQS A;  4YAV A;  1FOH A;  4V2M A;  3UIW A;  2LNS A;  1T7P B;  3GUS A;  3F9U A;  4DEJ A;  4N30 A;  2B1L A;  4YAP A;  4BVX B;  2FWH A;  4ZXG A;  5JCG A;  1N8J A;  5FT3 A;  4O92 A;  2IL3 A;  4AGS A;  3IE3 A;  4Z2T A;  3BD2 A;  3P7X A;  4WBJ A;  4MPF A;  4XRA A;  2CAI A;  1THX A;  3V1W A;  4PNG A;  4J56 E;  2B3S A;  3M1G A;  3BJ5 A;  6GSV A;  2CA8 A;  1YKA A;  1BYE A;  3ED3 A;  4HEA 2;  22GS A;  1ABA A;  4JU5 A;  2VM1 A;  4FYU A;  2YWI A;  1K3O A;  4MF6 A;  1KBN A;  4YQU A;  2RII A;  2LKU A;  2LJA A;  3RHC A;  4KE3 A;  3FY7 A;  4HI7 A;  1TDI A;  4G0I A;  2P0G A;  4IN0 A;  2CVB A;  2CZ3 A;  3ZYW A;  1WMJ A;  1SL2 B;  3DKS A;  4OFM A;  1W89 A;  3IC4 A;  3TJK A;  1ZYQ B;  1JFU A;  3FR6 A;  2V41 A;  2JZT A;  2L4C A;  5B8B A;  2YP6 A;  3VI7 A;  3R3E A;  5HFG A;  1G6Y A;  4MLY A;  2QGV A;  2IME A;  2FWE A;  2MBS A;  1M9B A;  4I2T A;  2GVP A;  2OA7 A;  2TRX A;  3D5J A;  3W6G A;  4EF0 A;  1SL1 B;  3EC3 A;  5ENU A;  2PU9 C;  1USB A;  2X64 A;  4LL1 B;  2RLI A;  3HYP A;  1ERW A;  5DCH A;  3ME7 A;  1E6B A;  17GS A;  4GQC A;  4K8M A;  1QK8 A;  1GSS A;  1TOF A;  4PQI A;  5ECR B;  1B8X A;  4EDY A;  1G0T A;  2B1K A;  1BJX A;  2VIM A;  4POL A;  2DLX A;  1V98 A;  3GA4 A;  1A2J A;  2J23 A;  2FNO A;  5J4U A;  4EIP A;  4MZB A;  2YOI A;  3UBL A;  4GLT A;  3KH7 A;  2GQM A;  1SD9 A;  3EIN A;  1U3I A;  1SD8 A;  3D22 A;  6GSU A;  2R5G A;  1YKC A;  3M0F A;  4IVF A;  4I5Q A;  1M2A A;  3PPU A;  1OE8 A;  4JRR A;  4L8E A;  3CSI A;  4OO5 A;  2GSR A;  1GWC A;  4EE0 A;  1ZMA A;  4QQ7 A;  1AQV A;  3IR4 A;  5D8I A;  4YQM A;  2H71 A;  3HHV A;  3QR6 A;  1PRX A;  4CDO A;  2WRT A;  1BX9 A;  3QD9 A;  3ZIV A;  4MDC A;  4E8H A;  9GSS A;  2O87 A;  1VF3 A;  4FH8 A;  4ZBA A;  4XS6 A;  5KN0 A;  2IMD A;  3BOA A;  4OD7 A;  5ELA A;  3QOU A;  4POK A;  4I6X A;  4TR0 A;  5KN3 A;  1HD2 A;  4CY6 A;  4ECJ A;  4EO3 A;  3Q6O A;  1A2L A;  1OC8 A;  2FGX A;  2IMI A;  1SK1 A;  3UJ1 A;  1GTB A;  1O6J A;  3TCO A;  5IMA A;  5B6M A;  1DBY A;  1WOU A;  2FHE A;  4TW5 A;  2Z9S A;  3P90 A;  2H75 A;  1GSE A;  3WT2 A;  3TJJ A;  2VM2 A;  2JSZ A;  1V57 A;  3IHG A;  1DSB A;  1OKT A;  2VUP A;  3GNJ A;  4J2F A;  3L78 A;  3KP9 A;  5F8B A;  1B48 A;  1O81 A;  4KND A;  3GL3 A;  3IA1 A;  3VPT A;  3MSZ A;  4IP6 A;  2H72 A;  3SBC A;  3A2W A;  5B6N A;  4K0G A;  4NHZ A;  13GS A;  2XBQ A;  1PKZ A;  3P8W A;  1M0U A;  2KP1 A;  2OJL A;  3CRU A;  2FUG 2;  4XS4 B;  1R4W A;  2OAD A;  2H73 A;  2MYG A;  4JED A;  3TRQ A;  4XS4 A;  3ERW A;  3Q18 A;  4GQF A;  4HUA A;  3LYK A;  1M99 A;  1LBK A;  1XVQ A;  1PN9 A;  1SK0 A;  1ZYE A;  2TRC P;  4NPB A;  2H01 A;  4Z2U A;  2GT5 A;  3PIN A;  1SJI A;  3QCP A;  4HS1 A;  2HLS A;  1S3C A;  1XW6 A;  2C3Q A;  4KGI A;  4FIW A;  1GH2 A;  1A0F A;  4AJ8 A;  8GSS A;  3CSH A;  4K7O A;  3TKR A;  4F0C A;  4L5L A;  4IJ3 A;  4F0B A;  1WP0 A;  2CX4 A;  4PNF A;  5KN1 A;  1FB6 A;  1XFL A;  1EOG A;  1EEM A;  1V2A A;  4LLR A;  2ZUP A;  4GCI A;  2MMZ A;  2OBI A;  1QGV A;  1EGR A;  4DSQ A;  1IYI A;  3HVX A;  5A5K A;  3GV1 A;  1URM A;  4IBP A;  4K1F A;  2AHE A;  2L57 A;  2J9H A;  2H0H A;  2DJJ A;  4NXI A;  3MAK A;  4V1A p;  3HA9 A;  5LNK e;  1R5A A;  1XIY A;  2L5O A;  2PN8 A;  4O5R A;  1NM3 A;  3IK9 A;  1GUH A;  1SYR A;  1Z7P A;  1XW9 A;  2H0I A;  1Z9H A;  1YDK A;  2FLS A;  2WZ9 A;  3TUE A;  5CRE A;  2R6K A;  3IAS 2;  5CRW A;  1X9W B;  1PX7 A;  1VF1 A;  2DMM A;  5G1K A;  5HFK A;  3TRP A;  3QFB C;  3WGD A;  4QL7 A;  5D93 A;  1GTA A;  3HZ4 A;  4CHS A;  2XHF A;  4K5S A;  5FWG A;  2GS3 A;  4OFT A;  2KLX A;  1SU9 A;  1NHY A;  1OC9 B;  2F8F A;  1XWG A;  5ECN B;  3L4N A;  1WWJ A;  1PD2 1;  1OC9 A;  4ECI A;  2AJQ B;  2EIR A;  2WFC A;  3GIX A;  3GKX A;  1M2D A;  19GS A;  2HRK A;  4IJI A;  4FO5 A;  4MCU A;  2JL4 A;  2DBC A;  2V6K A;  3FZ9 A;  3IC8 A;  2OE1 A;  1RW1 A;  3H8Q A;  1GP1 A;  1FO5 A;  5AN1 A;  5B8A A;  1R7H A;  1UA5 A;  5GAP D;  1ZCP A;  4F9Z A;  2OE0 A;  3TKP A;  1QMV A;  2DIY A;  3W8S A;  1JZO A;  2E7P A;  7GSS A;  3A3T A;  4ECC A;  3IPZ A;  2C0F A;  3FKF A;  1CQH A;  4WEY A;  1XOB A;  3NIV A;  1YF1 A;  5JCW A;  1KTE A;  4Q5R A;  5EL8 A;  1GTU A;  2HSM A;  2L59 A;  1QUW A;  2GSQ A;  2GLR A;  2DJ0 A;  3K8N A;  4KCA A;  3C8E A;  2H70 A;  5COH A;  5D9T A;  4KDY A;  2H30 A;  2HRN A;  1EV4 A;  2H6X A;  2N5A A;  3LOR A;  4XS1 A;  3FHK A;  2HNL A;  3I43 A;  1AQX A;  1TTZ A;  1QFN A;  4MZC A;  3MDK A;  5CO3 A;  2HE3 A;  2FA8 A;  2WUL A;  2C0E A;  4EUY A;  4WF5 A;  5G30 A;  5JWQ B;  1WIK A;  1HNB A;  2LS5 A;  4MJE A;  2YV9 A;  2I4A A;  3KZQ A;  5F07 A;  1XZO A;  1EP8 A;  2KP2 A;  3EWL A;  1OC3 A;  3OR5 A;  1GSQ A;  4HZ4 A;  1DE2 A;  5IMF A;  2AYT A;  3ZIT A;  5AIX A;  2JZS A;  1Z5Y E;  5HR0 A;  2P31 A;  1FG4 A;  2G0F A;  3QFA C;  3RBT A;  3CXG A;  3E3E A;  4HZ2 A;  3TKS E;  1B9Y C;  3ZRE A;  4PUA A;  1JZD A;  2KUC A;  4HU7 A;  4HJ2 A;  3FZ4 A;  4MAB A;  4MP4 A;  5ELG A;  3M9K A;  5A4V A;  2H74 A;  20GS A;  5AGY A;  3U5R E;  4PQ1 A;  1NSW A;  4FYC A;  3TB2 A;  1F9M A;  1TRS A;  1K0C A;  2X8H A;  2I9H A;  2M80 A;  1TRU A;  3HD5 A;  3IK7 A;  2NBS A;  2DKI A;  3HVV A;  3LSZ A;  3KD0 A;  2C0G A;  4I97 A;  1X9M B;  4FYB A;  3F6F A;  4LL4 B;  4JBB A;  2NVL A;  5IOX A;  2WCI A;  3LQ7 A;  4KUN A;  1TKD B;  4WF4 A;  2VCT A;  3HZ8 A;  2PBJ A;  3WD6 A;  1YEP A;  11GS A;  2X8C A;  4ZB8 A;  2DKH A;  3UAP A;  3C73 A;  1A0R P;  3EMP A;  12GS A;  4EL1 A;  3VWW A;  5LCZ A;  3MNG A;  4L0W A;  3KTL A;  3GN3 A;  1H4O A;  3ISO A;  4ID0 A;  3TJB A;  4OWY A;  4AJ7 A;  2BJX A;  4KSM A;  5ECM B;  5C00 A;  3KH9 A;  4ECB A;  1ZOF A;  2EC4 A;  4NWY A;  3TRX A;  2PVQ A;  3VUR A;  2L6C A;  1GUL A;  1YJ6 A;  5ID2 A;  2R2J A;  2HSH A;  2IFQ B;  1WJK A;  1BG5 A;  3LWA A;  3KTB A;  3M3M A;  1U88 A;  1MD4 A;  2IFQ A;  2L5L A;  2ON7 A;  3LW9 A;  3FR3 A;  4WR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...