2L5CA

Solution structures of human piwi-like 1 paz domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
134
structure length
134
Chain Sequence
CTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Piwi-like protein 1
publication title Structural insights into piRNA recognition by the human PIWI-like 1 PAZ domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 22
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 2l5cA00
4NH6A 1T2SA 1VYNA 3O7VX 5KI6A 2L5DA 4W5RA 4KRFA 5JS2A 4W5TA 4NH3A 4OLAA 4NGCA 5JS1A 3QIRA 4Z4HA 4NHAA 4NGBA 1R6ZA 4KREA 4Z4EA 3O3IX 4W5NA 1SI3A 1SI2A 4OLBA 3O7XA 3O6EX 4F3TA 1R4KA 5T7BA 2L5CA 2XFMA 4Z4FA 4NH5A 4Z4IA 4Z4GA 4W5QA 4W5OA 1T2RA 4NGGA 2FFLA 2QVWA 3MJ0A 4NGFA 4NGDA 4Z4CA
chains in the Genus database with same CATH superfamily
4NH6A 1T2SA 1VYNA 3O7VX 5KI6A 2L5DA 4W5RA 3HVRA 1Z26A 4KRFA 2DB9A 3DA5A 5JS2A 4W5TA 3F73A 4NH3A 4OLAA 4NGCA 3HO1A 5JS1A 3QIRA 4Z4HA 3HM9A 4NHAA 4NGBA 1R6ZA 4KREA 3HK2A 4Z4EA 1Z25A 3O3IX 1SI3A 1SI2A 4W5NA 4L1UA 4OLBA 3O7XA 3O6EX 4F3TA 1R4KA 5T7BA 3U1UA 2L5CA 2XFMA 4Z4FA 4L1PA 4NH5A 4Z4IA 4Z4GA 4W5QA 4W5OA 1T2RA 3HJFA 4NGGA 2BZEA 2FFLA 3DLHA 2QVWA 3DLBA 3MJ0A 4NGFA 4NGDA 4Z4CA 1U04A
chains in the Genus database with same CATH topology
4NH6A 1T2SA 1VYNA 3O7VX 5KI6A 2L5DA 4W5RA 3HVRA 1Z26A 4KRFA 2DB9A 3DA5A 5JS2A 4W5TA 3F73A 4NH3A 4OLAA 4NGCA 3HO1A 5JS1A 3QIRA 4Z4HA 3HM9A 4NHAA 4NGBA 1R6ZA 4KREA 3HK2A 4Z4EA 1Z25A 3O3IX 1SI3A 1SI2A 4W5NA 4L1UA 4OLBA 3O7XA 3O6EX 4F3TA 1R4KA 5T7BA 3U1UA 2L5CA 2XFMA 4Z4FA 4L1PA 4NH5A 4Z4IA 4Z4GA 4W5QA 4W5OA 1T2RA 3HJFA 4NGGA 2BZEA 2FFLA 3DLHA 2QVWA 3DLBA 3MJ0A 4NGFA 4NGDA 4Z4CA 1U04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NH6 A;  1T2S A;  1VYN A;  3O7V X;  5KI6 A;  2L5D A;  4W5R A;  4KRF A;  5JS2 A;  4W5T A;  4NH3 A;  4OLA A;  4NGC A;  5JS1 A;  3QIR A;  4Z4H A;  4NHA A;  4NGB A;  1R6Z A;  4KRE A;  4Z4E A;  3O3I X;  4W5N A;  1SI3 A;  1SI2 A;  4OLB A;  3O7X A;  3O6E X;  4F3T A;  1R4K A;  5T7B A;  2L5C A;  2XFM A;  4Z4F A;  4NH5 A;  4Z4I A;  4Z4G A;  4W5Q A;  4W5O A;  1T2R A;  4NGG A;  2FFL A;  2QVW A;  3MJ0 A;  4NGF A;  4NGD A;  4Z4C A; 
#chains in the Genus database with same CATH topology
 4NH6 A;  1T2S A;  1VYN A;  3O7V X;  5KI6 A;  2L5D A;  4W5R A;  3HVR A;  1Z26 A;  4KRF A;  2DB9 A;  3DA5 A;  5JS2 A;  4W5T A;  3F73 A;  4NH3 A;  4OLA A;  4NGC A;  3HO1 A;  5JS1 A;  3QIR A;  4Z4H A;  3HM9 A;  4NHA A;  4NGB A;  1R6Z A;  4KRE A;  3HK2 A;  4Z4E A;  1Z25 A;  3O3I X;  1SI3 A;  1SI2 A;  4W5N A;  4L1U A;  4OLB A;  3O7X A;  3O6E X;  4F3T A;  1R4K A;  5T7B A;  3U1U A;  2L5C A;  2XFM A;  4Z4F A;  4L1P A;  4NH5 A;  4Z4I A;  4Z4G A;  4W5Q A;  4W5O A;  1T2R A;  3HJF A;  4NGG A;  2BZE A;  2FFL A;  3DLH A;  2QVW A;  3DLB A;  3MJ0 A;  4NGF A;  4NGD A;  4Z4C A;  1U04 A; 
#chains in the Genus database with same CATH homology
 4NH6 A;  1T2S A;  1VYN A;  3O7V X;  5KI6 A;  2L5D A;  4W5R A;  3HVR A;  1Z26 A;  4KRF A;  2DB9 A;  3DA5 A;  5JS2 A;  4W5T A;  3F73 A;  4NH3 A;  4OLA A;  4NGC A;  3HO1 A;  5JS1 A;  3QIR A;  4Z4H A;  3HM9 A;  4NHA A;  4NGB A;  1R6Z A;  4KRE A;  3HK2 A;  4Z4E A;  1Z25 A;  3O3I X;  1SI3 A;  1SI2 A;  4W5N A;  4L1U A;  4OLB A;  3O7X A;  3O6E X;  4F3T A;  1R4K A;  5T7B A;  3U1U A;  2L5C A;  2XFM A;  4Z4F A;  4L1P A;  4NH5 A;  4Z4I A;  4Z4G A;  4W5Q A;  4W5O A;  1T2R A;  3HJF A;  4NGG A;  2BZE A;  2FFL A;  3DLH A;  2QVW A;  3DLB A;  3MJ0 A;  4NGF A;  4NGD A;  4Z4C A;  1U04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...