2L5DA

Solution structures of human piwi-like 1 paz domain with ssrna (5'-pugaca)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
134
structure length
134
Chain Sequence
CTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Piwi-like protein 1
publication title Structural insights into piRNA recognition by the human PIWI-like 1 PAZ domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 21
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 2l5dA00
3QIRA 2XFMA 3MJ0A 2L5DA 5JS2A 4F3TA 5KI6A 1SI3A 4NGCA 1R6ZA 4W5TA 4NGGA 4NH5A 4NGDA 3O3IX 4Z4CA 4OLAA 5JS1A 2FFLA 4Z4IA 2L5CA 1T2SA 4OLBA 4Z4GA 4W5RA 2QVWA 4Z4FA 3O7XA 1R4KA 3O7VX 4NHAA 1VYNA 1T2RA 1SI2A 4W5QA 4KRFA 4Z4EA 4NGFA 4W5OA 4Z4HA 5T7BA 4NH6A 4NGBA 3O6EX 4KREA 4W5NA 4NH3A
chains in the Genus database with same CATH superfamily
3QIRA 2XFMA 4L1PA 3MJ0A 2L5DA 5JS2A 1U04A 4F3TA 5KI6A 1SI3A 4NGCA 3HVRA 1R6ZA 3DA5A 4W5TA 3HJFA 4NGGA 4NH5A 4NGDA 3O3IX 2DB9A 4Z4CA 4OLAA 5JS1A 2FFLA 4L1UA 4Z4IA 2L5CA 1T2SA 4OLBA 4Z4GA 3DLHA 3HM9A 3F73A 4W5RA 2QVWA 4Z4FA 3O7XA 1R4KA 3DLBA 3O7VX 4NHAA 1VYNA 1Z26A 3HO1A 1T2RA 1SI2A 4W5QA 4KRFA 4Z4EA 3U1UA 4NGFA 4W5OA 4Z4HA 5T7BA 1Z25A 2BZEA 4NGBA 3HK2A 4NH6A 3O6EX 4KREA 4W5NA 4NH3A
chains in the Genus database with same CATH topology
3QIRA 2XFMA 4L1PA 3MJ0A 2L5DA 5JS2A 1U04A 4F3TA 5KI6A 1SI3A 4NGCA 3HVRA 1R6ZA 3DA5A 4W5TA 3HJFA 4NGGA 4NH5A 4NGDA 3O3IX 2DB9A 4Z4CA 4OLAA 5JS1A 2FFLA 4L1UA 4Z4IA 2L5CA 1T2SA 4OLBA 4Z4GA 3DLHA 3HM9A 3F73A 4W5RA 2QVWA 4Z4FA 3O7XA 1R4KA 3DLBA 3O7VX 4NHAA 1VYNA 1Z26A 3HO1A 1T2RA 1SI2A 4W5QA 4KRFA 4Z4EA 3U1UA 4NGFA 4W5OA 4Z4HA 5T7BA 1Z25A 2BZEA 4NGBA 3HK2A 4NH6A 3O6EX 4KREA 4W5NA 4NH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIR A;  2XFM A;  3MJ0 A;  2L5D A;  5JS2 A;  4F3T A;  5KI6 A;  1SI3 A;  4NGC A;  1R6Z A;  4W5T A;  4NGG A;  4NH5 A;  4NGD A;  3O3I X;  4Z4C A;  4OLA A;  5JS1 A;  2FFL A;  4Z4I A;  2L5C A;  1T2S A;  4OLB A;  4Z4G A;  4W5R A;  2QVW A;  4Z4F A;  3O7X A;  1R4K A;  3O7V X;  4NHA A;  1VYN A;  1T2R A;  1SI2 A;  4W5Q A;  4KRF A;  4Z4E A;  4NGF A;  4W5O A;  4Z4H A;  5T7B A;  4NH6 A;  4NGB A;  3O6E X;  4KRE A;  4W5N A;  4NH3 A; 
#chains in the Genus database with same CATH topology
 3QIR A;  2XFM A;  4L1P A;  3MJ0 A;  2L5D A;  5JS2 A;  1U04 A;  4F3T A;  5KI6 A;  1SI3 A;  4NGC A;  3HVR A;  1R6Z A;  3DA5 A;  4W5T A;  3HJF A;  4NGG A;  4NH5 A;  4NGD A;  3O3I X;  2DB9 A;  4Z4C A;  4OLA A;  5JS1 A;  2FFL A;  4L1U A;  4Z4I A;  2L5C A;  1T2S A;  4OLB A;  4Z4G A;  3DLH A;  3HM9 A;  3F73 A;  4W5R A;  2QVW A;  4Z4F A;  3O7X A;  1R4K A;  3DLB A;  3O7V X;  4NHA A;  1VYN A;  1Z26 A;  3HO1 A;  1T2R A;  1SI2 A;  4W5Q A;  4KRF A;  4Z4E A;  3U1U A;  4NGF A;  4W5O A;  4Z4H A;  5T7B A;  1Z25 A;  2BZE A;  4NGB A;  3HK2 A;  4NH6 A;  3O6E X;  4KRE A;  4W5N A;  4NH3 A; 
#chains in the Genus database with same CATH homology
 3QIR A;  2XFM A;  4L1P A;  3MJ0 A;  2L5D A;  5JS2 A;  1U04 A;  4F3T A;  5KI6 A;  1SI3 A;  4NGC A;  3HVR A;  1R6Z A;  3DA5 A;  4W5T A;  3HJF A;  4NGG A;  4NH5 A;  4NGD A;  3O3I X;  2DB9 A;  4Z4C A;  4OLA A;  5JS1 A;  2FFL A;  4L1U A;  4Z4I A;  2L5C A;  1T2S A;  4OLB A;  4Z4G A;  3DLH A;  3HM9 A;  3F73 A;  4W5R A;  2QVW A;  4Z4F A;  3O7X A;  1R4K A;  3DLB A;  3O7V X;  4NHA A;  1VYN A;  1Z26 A;  3HO1 A;  1T2R A;  1SI2 A;  4W5Q A;  4KRF A;  4Z4E A;  3U1U A;  4NGF A;  4W5O A;  4Z4H A;  5T7B A;  1Z25 A;  2BZE A;  4NGB A;  3HK2 A;  4NH6 A;  3O6E X;  4KRE A;  4W5N A;  4NH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...