2L5LA

Solution structure of thioredoxin from bacteroides vulgatus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
b'MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Solution Structure of Thioredoxin from Bacteroides Vulgatus
rcsb
source organism Bacteroides vulgatus
molecule tags Transport protein
total genus 41
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2l5lA00
3I6AA 1FB6A 2R2JA 3KP9A 5EPFA 1ABAA 3C71A 4PQ1A 1GUHA 2AJQB 3TJFA 3FZAA 3DD3A 2E2GA 4MP4A 2P5QA 2FWHA 2HYXA 5D9WA 4EF0A 2NBSA 1NW2A 2YPMA 1TW9A 1FVJA 2WULA 3DXBA 2OBKA 4RI6A 1TXXA 2H74A 1SL0B 1O81A 5ELAA 5ECIB 2X99A 4K1FA 3S9FA 2V1MA 3F4SA 4Q5RA 4IP1A 2VL3A 3HZ8A 4IGJA 1AQXA 1B9YC 1UVZA 1SYRA 3KCMA 4QQ7A 4WR5A 4MJCA 3GIXA 4JRRA 3ZVJD 5IMVA 2IMEA 5B6NA 1XWGA 5J3RA 1GUKA 3C1RA 3G9BA 4MA9A 3FKFA 1OYJA 1SKRB 3TRPA 4PQIA 2K6VA 2O7KA 3QOUA 2RLIA 2IFQA 1IYHA 4NPBA 1HNAA 5HR0A 1JZWA 3VWWA 1ILOA 3HXSA 1YJ6A 2LRNA 5GZZB 3IA1A 5IMAA 2HZEB 2H01A 3W6GA 2A4VA 3HVSA 4JE1A 4O32A 3RAZA 3CRTA 3F3RA 1F9MA 5IMCA 4Z7XA 3L9SA 5ABRA 1OC3A 5IOXA 2YZHA 1SK2A 4HU7A 4EL1A 2IMDA 2I81A 1A8LA 2DJ2A 1ERWA 2BJXA 1TRSA 1EP8A 1VF3A 4DSQA 2K18A 1XPVA 2H0IA 4NXIA 3GL5A 4POBA 1YKAA 2TRCP 3UL3A 3KJYA 2I3YA 2OE3A 1I5GA 1DSBA 1W4VA 4DVCA 4CHSA 2M46A 2VLTA 3C73A 4MPGA 5CYYA 4XS6A 2B3SA 2XHFA 1PGTA 2LKUA 1SL2B 4YQUA 1NSWA 2CX4A 3H79A 1YKCA 1GP1A 2MMNA 4IJIA 2WFCA 4KDYA 2R4VA 4JZQA 6GSXA 2H30A 2EIOA 4BWQA 4GRFA 3ZMKA 2O89A 3L9VA 4TXVA 1YQ1A 4PGTA 3IBHA 1XWCA 2YOIA 4L0UA 1A2LA 1UA5A 5ECQB 4JBBA 2F9SA 2LQQA 1Y25A 2VUPA 1OC9A 3IC4A 3GV1A 3AY8A 3IAM2 3IV4A 5F05A 1OC8A 2F8AA 1SJ6A 1K3YA 2IMKA 1ZL9A 5IPHA 2IMIA 4I2TA 2P0GA 4DSSB 4PURA 5CO3A 1G7EA 2HSHA 3ZIJA 2C80A 4FYBA 3U6VA 3N5OA 1F3AA 4TR4A 2H19A 3ERFA 3TUEA 2DJ3A 3I9V2 2MBSA 4NHZA 2DMMA 1OKDA 5IM9A 2ES7A 1GSDA 5IO2A 2LTKA 1GSQA 2H6ZA 4O92A 3VK9A 3TJGA 4KE3A 3CSIA 1PL1A 2LS5A 2HRFA 1H75A 5C04A 2YJ7A 2N5FA 3VFIA 3APSA 3KTLA 3KP8A 4OCFA 3D6IA 2C4JA 5KN3A 1RW1A 5JCUA 3DVWA 2VM2A 1J08A 3W8SA 1T7PB 1GLPA 4GQCA 3PR8A 4IP6A 1BYEA 4WBRD 2G2QA 3LQ7A 4FIWA 3LGCA 3GX8A 2DJ1A 1U3IA 4PX1A 2V6OA 4XTSA 4J56E 4BPYA 2JADA 3QAGA 3DWVA 3ZLPA 2VL2A 5KEJA 4GWRA 5AISA 2JU5A 5J4UA 4L8EA 11GSA 1X0RA 5GAND 1PL2A 5CAXA 4RUVA 2EIQA 4BVXA 4AGSA 4K7NA 3BBYA 3C7MA 1EV9A 2GT6A 4LLRA 1SK0A 3FY7A 5G1KA 2YWIA 2FWFA 2OE0A 1G7OA 1PKWA 1O8WA 3KXOA 1R7HA 9GSSA 1F3BA 3FEUA 1TJDA 1Z9HA 3N9JA 1F2EA 2CV4A 4IBPA 3J7Yk 1K0DA 2HXKA 2PGTA 4XHMA 4AF2A 4BVYA 4YQMA 1WWJA 1X5DA 4V1Ag 4MF5A 3C8EA 2GT5A 4TOPA 3GX0A 3M3MA 2LNSA 4K8MA 4I8BA 1XW9A 5HQPA 1KNGA 1Y6EA 3TRQA 2H6XA 4N0ZA 1GTUA 1JZOA 1ACVA 1VF4A 2CX3A 3DKSA 2H72A 1FO5A 4TR3A 3TKSE 4HQSA 1GSSA 5G5FA 4ZB6A 3A2VA 3D4MA 3HA9A 3ZFBA 4HZ2A 3FZ4A 3UARA 5J41A 4DEJA 4G2EA 3DGQA 1DUGA 3M0FA 1S3CA 5G31A 2GQMA 3IK9A 3HJMA 2LSTA 3GN3A 4I2UA 5LNKe 3F3QA 1RK4A 1HNCA 2H70A 2WGRA 3L4NA 3EMPA 2OACA 5ECPB 3P90A 1MDJA 3EINA 2B5EA 4CW9A 1X5EA 5ECLB 2E2MA 2HZEA 3LWAA 6GSVA 3FK8A 5FHIA 1PX7A 18GSA 1LBKA 3HDCA 1Q98A 1Z5YE 2NVLA 1V2AA 1Z6MA 3P7XA 1YF1A 4ECIA 4MCUA 4LA1A 1NHOA 2C0GA 5DQYA 2AV4A 2FWGA 2E7PA 2O85A 1X9WB 1XWBA 4AJ7A 4MF7A 4ZB9A 3RHCA 1O7UA 5D73A 1A24A 4OWYA 5INYA 2QC7A 2YCDA 1M2DA 2AYTA 3KMOA 3D0ZA 3M9KA 4P3YB 2TRXA 5C00A 5G5EA 1FVKA 2FUG2 1JZRA 1OVNA 2YJHA 1IYIA 1DE1A 4KDXA 4RQRA 2IIYA 3M1GA 3ZVJA 2I9HA 1ZOFA 5HR3A 8GSSA 1FG4A 1YZXA 2GSQA 3I43A 4PUAA 3FR9A 1SKWB 4NHWA 3ZRDA 3TB2A 4HOJA 4EE0A 2I1UA 4X0XA 4E8HA 4XS4B 5JCGA 3NZNA 3LXTA 4GLTA 4F03A 3HJOA 3WGXA 3GYKA 1M99A 5D8IA 5IMDA 3E0UA 4AJ8A 3DEXA 3L9UA 2WB9A 4IS0A 2L57A 3WGDA 2JSYA 4XRAA 2FNOA 4L5LA 2ZUPA 3UIWA 3ZL5A 14GSA 2RIIA 1ON4A 5DAKB 3ZFLA 4OD7A 4MZCA 4N0VA 3GH9A 4FH8A 4DSSA 5HFIA 4G9HA 2NTOA 1B48A 2V6KA 4OO4A 4J2FA 4BL7A 3H1NA 2REMA 5F0GA 5A4VA 3CTFA 1FW1A 1GTIA 3OR5A 1Z6NA 3SWLA 5A4UA 1AIUA 3A2WA 3EC3A 1CQHA 3Q6OA 5KN2A 5H5SA 3ZTLA 2JACA 4HS1A 4KA0A 1EOHA 3PGTA 2DLXA 4WR4A 3GKKA 4ZIJA 1GTAA 2RM5A 3C1SA 3IE3A 1G6WA 1K3LA 4TR1B 3U5RE 1W89A 1XVQA 3IK7A 1CQGA 4ID0A 1HQOA 4V1Ap 3FRCA 5F07A 3EU4A 5DVBA 4WBJA 3TRXA 5D9TA 17GSA 2H73A 5DDLA 3FYGA 3VWVA 1TP9A 1THXA 4PNFA 3RHBA 2WRTA 4O5RA 1GWCA 2JZTA 4WF4A 5DJMA 4Q5FA 5IIZA 4HEA2 3MWHA 2A2SA 2OA7A 5D93A 5HR1A 1X9SB 3EVIA 3LYKA 1HNBA 5IPGA 5EVOA 4JU5A 4FYCA 2L4CA 5IO0A 1TU8A 3G7IA 3EU3A 2CAQA 4JR4A 2R6KA 2B6MA 1FOVA 1OE7A 2K8SA 2H66A 1ERVA 2LV3A 2HRNA 4QL7A 4YAVA 2L4QA 5CREA 1Z7PA 1TI1A 1SD9A 4GSTA 1SU9A 4KSMA 2C3QA 2PN8A 1BG5A 4RI7A 5A4WA 1XW5A 3GH6A 1DBYA 3FW2A 2F3MA 1B4QA 1TU7A 1I9DA 3GA4A 5G30A 1O6JA 3UBLA 1PMTA 3SBCA 1WE0A 2L6CA 4E8EA 5CRGA 3UOMA 1XCCA 4JEDA 2NDOA 2FCHA 3TKQA 2FGXA 1XZOA 3F6DA 2D2ZA 2X8GA 4JR6A 1PKZA 5DJLA 3CMIA 1J0FA 3CYNA 4MPFA 1TRVA 3GNJA 3HCZA 1WJKA 2CA8A 1A0RP 1AQVA 1MD4A 5J5NA 1LJRA 4MABA 2PMTA 1URMA 4TXOA 2WS2A 4N30A 2B1KA 4EDZA 1K0OA 2CZ3A 1JFUA 4POMA 4V2LA 1GRXA 2KP2A 4ML1A 4WXTA 1FAAA 5LCZA 4O7HA 1GSEA 3I69A 5CP1A 3UJ1A 3TKSC 3D4TA 1XOBA 4GSNA 5COHA 4TRXA 2LNTA 1GNWA 4L0WA 3RPNA 2QKEA 5D9VA 4OMVA 4IW9A 5JCWA 3LEFA 3QDNA 2FLSA 1M7TA 5ENUA 5ECRB 1GSUA 2L6DA 1HD2A 1T00A 5ECKB 6GSWA 2VOCA 1VF1A 3HY2A 4HZ4A 3F6FA 5CRDA 4F2IA 3W8JA 3IXRA 3LYPA 1PN9A 2LUSA 4HI7A 5B8AA 3TJBA 5FWGA 2C3TA 2H6YA 3QFBC 3GTUB 3P8WA 3EMXA 1AUCA 3FR6A 2V2GA 4MH2A 3CSJA 2IMFA 3G7YA 1O85A 2P31A 4HDEA 4GCIA 7GSSA 3EURA 3GHAA 2HNLA 4MK3A 4I97A 2KHPA 6GSYA 5JWQB 1ERTA 3ZIVA 1MDKA 4TW5A 4DSRA 2GZYA 1U3AA 1A0FA 4Q5NA 1WP0A 1ZYQB 2X8HA 5ECNB 1GNEA 1VF2A 2WCIA 1V9WA 4KUNA 3VLNA 4LMWA 1XXUA 4F0BA 3Q19A 1G0TA 4NV2A 3VI5A 3EE2A 2KP1A 2RM6A 3K8NA 2VD0A 1M2AA 4XS4A 1TK5B 5DALB 1GTBA 1USBA 1GULA 2RUFA 2LJAA 2YV7A 1JZDA 1M0UA 3O6TA 1A2MA 4TN8A 1XBSA 4PXOA 3ZYWA 4MJBA 4K7IA 4MZWA 5E59A 2HI7A 5F06A 5DAKA 3KGKA 2X64A 5KN0A 1JLVA 1TK0B 5F8BA 3RDWA 1JLWA 4ACSA 1YEXA 5FT3A 2H1DA 4GF0A 4GTUA 2GQLA 1TTZA 1DE2A 3F9UA 3ME8A 5G1LA 2FY6A 4LL4B 3J7Yb 4F0CA 4TR1A 2B5YA 3ISOA 3QAWA 4MJEA 5AIXA 1B4PA 1WMJA 2OADA 4OFMA 4WKWA 5IMFA 3UVHA 3D22A 3ERGA 3VPQA 16GSA 2KUCA 3QR6A 5J9BA 2BTOT 1QXHA 20GSA 2YNXA 1KBNA 1ML6A 5D9XA 4IQAA 1EP7A 1N8JA 3VWXA 1E6BA 1K0AA 4YQVA 1EEJA 4MDCA 4K0NA 1K0CA 2B7JA 1A2JA 4IVFA 3TJJA 3GFKA 3IDVA 3NOFA 4KDUA 1YEPA 4ECJA 4X43A 3DYRA 1G6YA 3BCKA 2FD3A 4KGIA 2LEGA 1T3BA 4FO5A 2K8VA 2HZFA 2MZCA 3JCML 1SL1B 4EXJA 5ELGA 2L5OA 3QAVA 3ED3A 3F4TA 3BCIA 1S3AA 3PINA 3KH7A 1NHYA 3A3TA 4YAPA 3HYPA 5B7CA 4PNGA 1SJZA 5B6MA 2P5RA 2VLUA 1SKSB 4KAEA 2GZZA 2PUKC 2GTUA 2IL3A 4HUAA 2GSTA 2O8VB 2H76A 4ML6A 4MZBA 2LJKA 5G2ZA 3VPTA 2L59A 3CSHA 2J9HA 2HE3A 3LSZA 4F82A 2AHEA 5ECHB 2PERA 2H75A 1SENA 2LQOA 4KSOA 3H8QA 3F4RA 2OE1A 2YN1A 4EUYA 1MD3A 3GL3A 4V2MA 3HHVA 4IHUA 3MAKA 3DVXA 2LRTA 1THOA 2VCQA 4YH2A 2R3XA 2HLSA 1TRWA 2H1BA 1XVWA 5H5QA 6GSSA 2Z9SA 1AAZA 2WZ9A 1A8YA 1PA3A 1V40A 2LJRA 3GUSA 4K2DA 3ZMLA 2C0EA 4ISDA 22GSA 2VCXA 1ZZYA 3CTGA 2VLVA 1H4OA 2B5XA 4IKHA 1NM3A 3CBUA 3TDGA 1A23A 2H8LA 3UMAA 5KN1A 4KCAA 2DIYA 3HVVA 1MDIA 2QGVA 2DIZA 5ID2B 4QL9A 1BJXA 4ZBBA 1BEDA 2DBCA 2C0FA 2OJLA 2DJ0A 1AXDA 3BJ5A 4K7OA 5ECOB 2DJJA 2HT9A 2O87A 2TIRA 5AN1A 1X5CA 2H0GA 3TKRA 3UEMA 3G7JA 3GTUA 2MYGA 2IN3A 4POLA 3IR4A 1R4WA 3KIJA 2GS3A 5H5RA 4RQXA 4EKZA 4GSSA 1ST9A 1XFLA 4PUFC 2XPEA 2VCVA 1QQ2A 2R5GA 1HYUA 1EGRA 3RBTA 1M9AA 1O8XA 4HJ2A 5EY6A 2H71A 2VM1A 1XW6A 4IQ1A 4WETA 1GL8A 3ZITA 1GSFA 4MF6A 5E4WA 3DRNA 2OBIA 2VIMA 4EC0A 3VI7A 4POKA 4G19A 2VCZA 4KW6A 2YP6A 2J23A 2L5LA 3APOA 1TDIA 3P2AA 3QPMA 1GLQA 2NPBA 2GSRA 3GKXA 3KM6A 2CZ2A 1U87A 4L5OA 5DALA 4ECCA 1QK8A 5ECMB 1SYXA 3KTBA 1EGOA 6GSTA 1TOFA 4K6XA 4FYUA 3IOSA 1F37A 4KCEA 4K0GA 2RUEA 1V98A 5AGYA 2K9FA 5GSTA 1XWKA 3NIVA 3E3EA 1VGLA 1YDKA 3TOUA 2VD1A 1MEKA 3RPPA 3QMXA 2C3NA 3WT1A 4G10A 2XC2A 3CRUA 4LL1B 4IELA 2EC4A 4EVMA 2DSAA 1GH2A 3HD5A 1J9BA 2FHEA 3V1WA 2N5BA 2GSSA 3HKRA 3DIEA 4XCSA 4HJMA 1K0MA 2C1YA 1OAZA 2LRCA 4IJ3A 5A5KA 2CQ9A 4D73B 2FA4A 1GSYA 1O73A 2AAWA 2F51A 1FHEA 2YWOA 4LMVA 2CT6A 1SD8A 3R2QA 3TGZA 3TCOA 3BOAA 2JZRA 2YWNA 1JHBA 2GQKA 2H0HA 1V58A 2QSIA 3E9JB 3UBKA 1ZYEA 3GKNA 2C8UA 1EEMA 1EV4A 3KZQA 2H1GA 1EOGA 3FHKA 5HR2A 1LU4A 3TJKA 2XBQA 2PBJA 4KB3A 3LJRA 4MH3A 2PPTA 1X9MB 1TK8B 2FA8A 3KH9A 1C72A 10GSA 4ILFA 1QMVA 1WRYA 1PSQA 1PD21 3FZ5A 3H93A 1FB0A 3FR3A 5HFGA 3O3TA 3US3A 5B8BA 2WJUA 3KEBA 3GKMA 2GLRA 3ERWA 5IOWA 4ECBA 2N5AA 1WIKA 3EYTA 5AIVA 3IPZA 3MNGA 4MMMA 3ZREA 1TI3A 5JWRB 1S3DA 4KX4A 2PVOC 3IAS2 2H1AA 3MDKA 3GURA 4OFTA 2VO4A 1M9BA 2E0QA 1N2AA 5CRHA 1PRXA 4NMUA 2IFQB 4XS1A 3LORA 2CVBA 3F0IA 3IHQA 1RQMA 3GSSA 4F9ZA 1Z3EA 2XBIA 1EZKA 4TR0A 2YANA 4AJ6A 5CNWA 2VCTA 4CDOA 1ERUA 5JWOB 3WD6A 4XIHA 2ZNMA 3TKPA 19GSA 4ULXA 2B7KA 1YY7A 4EDYA 2R37A 4XRDA 3A2XA 2GGTA 2PU9C 2MMAA 1V57A 1WPIA 1B8XA 2ON7A 1B9XC 3FZ9A 1BQ7A 2VL9A 1TKDB 1U6TA 4N11A 1K0BA 2ZCTA 2DJKA 1ZCPA 13GSA 4Q5QA 2IPAA 3Q74A 4ZL9A 2VAFA 3UAPA 2PWJA 3EWLA 3DMLA 1XWAA 3L0HA 3ME7A 1QFNA 1Q4JA 2JSZA 4MJAA 1AW9A 1BAYA 2PVQA 3WGEA 1SK1A 1ZGNA 6GSUA 4IN0A 3QCPA 3QFAC 1BX9A 12GSA 2GDRA 4NAXA 2AUVA 2FWEA 2IJYA 2G0FA 4GQFA 1ZMAA 5ID2A 1SJIA 4H86A 2GZPA 1QUWA 3ZZXA 1WOUA 3D5JA 3LFLA 5ECSA 1OC9B 3HJPA 1R5PA 2WDUA 2EIRA 2CVDA 3Q18A 2ON5A 4TXOB 4I5QA 2M80A 1M2BA 2MMOA 3BD2A 4BWSA 2JL4A 5IQYA 5D96A 3HZ4A 1QGVA 3PH9A 2V41A 3F8UA 5LD0A 1K3OA 4EO3A 4ZL7A 3M9JA 4KNDA 1OKTA 2AB6A 3KD0A 2HFDA 3TOTA 1PX6A 1MTCA 2KOKA 3F63A 2A2RA 2ALBA 4J57E 1KEBA 3WT2A 1GUMA 3UVTA 3VWUA 1PQNA 1OE8A 3M8NA 1U88A 4X1UA 1VRSD 2V32A 4OFNA 2YV9A 2I4AA 4ZBAA 5GSSA 5DQSA 3VURA 4OCEA 2DMLA 3IRAA 4WF5A 3LXZA 4HQZA 4ZILA 1T1VA 3O76A 4BA7A 1EWXA 5DCHA 1AC1A 5HFKA 3GSTA 3QD9A 4K9ZA 2C0DA 2JZSA 3H4KA 5CRWA 1UC7A 3L78A 4KH7A 3WYWA 3GRXA 2MBTA 1R26A 1KTEA 3D21A 2CVKA 4ZL8A 5J9CA 1T4YA 3A5WA 2OKAA 1AQWA 2XPDA 5DBQA 1XOAA 4NWYA 4WEYA 4NV5A 2VCWA 4TKYA 2IWTA 2HSYA 2F8FA 2CAIA 4OO5A 4ZBDA 1K0NA 2B1LA 1T4ZA 1T8EB 2GVPA 3MSZA 1R5AA 3APQA 2MMZA 1TRUA 4TVEA 4ZXGA 3TKSA 4ZB8A 5DCGA 4D73A 3KMNA 1XIYA 2X8CA 3LG6A 4I6XA 5EL8A 1E2YA 5IMZA 1F6MC 1UN2A 2DC5A 3GMFA 4V2NA 4GXZA 2KLXA 4PQHA 3CXGA 5GAPD 4MLYA 1YF0A 2YZUA 1Z7RA 4N10A 2BMXA 2VL2C 5L71A 3HVXA 2YWMA 2M72A 4HU9A
chains in the Genus database with same CATH superfamily
3I6AA 1FB6A 2R2JA 3KP9A 5EPFA 2DKIA 1ABAA 3C71A 4PQ1A 1GUHA 2AJQB 3TJFA 3FZAA 3DD3A 2E2GA 4MP4A 4BVYB 2P5QA 2FWHA 2HYXA 5D9WA 4EF0A 2NBSA 1NW2A 2YPMA 1TW9A 1FVJA 2WULA 3DXBA 2OBKA 4RI6A 1TXXA 1ZYNA 2H74A 1SL0B 1O81A 5ELAA 5ECIB 2X99A 4K1FA 3S9FA 2V1MA 3F4SA 4Q5RA 4IP1A 2VL3A 3HZ8A 4IGJA 1AQXA 1B9YC 1UVZA 1SYRA 3KCMA 4QQ7A 4WR5A 4MJCA 3GIXA 4JRRA 3ZVJD 5IMVA 2IMEA 5B6NA 1XWGA 5J3RA 1GUKA 3C1RA 3G9BA 4MA9A 3FKFA 1OYJA 1SKRB 3TRPA 4PQIA 2K6VA 2O7KA 3QOUA 2DKHA 2RLIA 2IFQA 1IYHA 4NPBA 1HNAA 5HR0A 1JZWA 3VWWA 1ILOA 3HXSA 1YJ6A 2LRNA 5GZZB 3IA1A 5IMAA 2HZEB 2H01A 3W6GA 2A4VA 3HVSA 4JE1A 4O32A 3RAZA 3CRTA 3F3RA 1F9MA 5IMCA 4Z7XA 3L9SA 5ABRA 1OC3A 4G0IA 5IOXA 2YZHA 1SK2A 4HU7A 4EL1A 2IMDA 2I81A 1A8LA 2DJ2A 1ERWA 2BJXA 1TRSA 1EP8A 1VF3A 4DSQA 2K18A 1XPVA 2H0IA 4NXIA 3GL5A 4POBA 1YKAA 2TRCP 3UL3A 3KJYA 2I3YA 2OE3A 1I5GA 1DSBA 1W4VA 4DVCA 4CHSA 2M46A 2VLTA 3C73A 4MPGA 5CYYA 4XS6A 2B3SA 2XHFA 1PGTA 2LKUA 1SL2B 4YQUA 4HSCX 1NSWA 2CX4A 3H79A 1YKCA 1GP1A 2MMNA 4IJIA 2WFCA 4KDYA 2R4VA 4JZQA 6GSXA 2H30A 2EIOA 4BWQA 4GRFA 3ZMKA 2O89A 3L9VA 4TXVA 4K5SA 1YQ1A 4PGTA 3IBHA 1XWCA 2YOIA 4L0UA 1A2LA 1UA5A 5ECQB 4JBBA 2A2PA 2F9SA 2LQQA 1Y25A 2VUPA 1OC9A 3IC4A 3GV1A 3AY8A 3IAM2 3IV4A 5F05A 1OC8A 2F8AA 1SJ6A 1K3YA 2IMKA 1ZL9A 5IPHA 2IMIA 4I2TA 2P0GA 4DSSB 4PURA 5CO3A 1G7EA 3MYDA 2HSHA 3ZIJA 2C80A 4BL7B 4FYBA 3U6VA 3N5OA 1F3AA 4TR4A 2H19A 3ERFA 3TUEA 2DJ3A 3I9V2 2MBSA 1PFOA 4NHZA 2DMMA 1OKDA 5BRTA 5IM9A 2ES7A 1GSDA 5IO2A 2LTKA 3R3EA 1GSQA 2H6ZA 4O92A 3VK9A 3TJGA 4KE3A 3CSIA 1PL1A 2LS5A 2HRFA 1H75A 5C04A 2YJ7A 2N5FA 3VFIA 3APSA 3KTLA 3KP8A 4OCFA 3D6IA 2C4JA 5KN3A 1RW1A 5JCUA 3DVWA 2VM2A 1J08A 3W8SA 1T7PB 1GLPA 4GQCA 3PR8A 4IP6A 1BYEA 4WBRD 2G2QA 3LQ7A 4FIWA 3LGCA 3GX8A 2DJ1A 1U3IA 4PX1A 2V6OA 4XTSA 4J56E 4BPYA 2JADA 3QAGA 3DWVA 4O5QA 3ZLPA 2VL2A 5KEJA 4GWRA 5AISA 2JU5A 5J4UA 4L8EA 11GSA 1X0RA 5GAND 1PL2A 5CAXA 4RUVA 2EIQA 4BVXA 4AGSA 4K7NA 3BBYA 3C7MA 1EV9A 2GT6A 4LLRA 1SK0A 3FY7A 5G1KA 1PN0A 2YWIA 2FWFA 2OE0A 1G7OA 1PKWA 1O8WA 3KXOA 1R7HA 9GSSA 1F3BA 3FEUA 1TJDA 1Z9HA 3N9JA 1F2EA 2CV4A 4IBPA 3J7Yk 1K0DA 2HXKA 3FMWA 2PGTA 4XHMA 4AF2A 4BVYA 4YQMA 1WWJA 1X5DA 4V1Ag 4MF5A 3C8EA 2GT5A 4TOPA 3GX0A 3M3MA 2LNSA 4K8MA 4I8BA 1XW9A 5HQPA 1KNGA 1Y6EA 3TRQA 2H6XA 4N0ZA 1GTUA 1JZOA 1ACVA 1VF4A 2CX3A 3MIXA 3DKSA 3A5IA 2H72A 1FO5A 4TR3A 3TKSE 4HQSA 1GSSA 5G5FA 4ZB6A 3A2VA 3D4MA 3HA9A 3ZFBA 4HZ2A 3FZ4A 3UARA 5J41A 4DEJA 4G2EA 3DGQA 1DUGA 3M0FA 1S3CA 5G31A 2GQMA 3IK9A 3HJMA 2LSTA 3GN3A 4I2UA 5LNKe 3F3QA 1RK4A 1HNCA 2H70A 2WGRA 3L4NA 3EMPA 2OACA 5ECPB 3P90A 1MDJA 3EINA 2B5EA 4CW9A 1X5EA 5ECLB 2E2MA 2HZEA 3LWAA 6GSVA 3FK8A 5FHIA 1PX7A 18GSA 1LBKA 3HDCA 1Q98A 1Z5YE 2NVLA 1V2AA 1Z6MA 4PTSA 4BIKA 3P7XA 1YF1A 4ECIA 4MCUA 4LA1A 1NHOA 2C0GA 5DQYA 2AV4A 2FWGA 2E7PA 2O85A 1X9WB 1XWBA 4AJ7A 4MF7A 4ZB9A 3RHCA 1O7UA 5D73A 1A24A 4OWYA 5INYA 2QC7A 2YCDA 1M2DA 2AYTA 3KMOA 3D0ZA 3M9KA 4P3YB 2TRXA 5C00A 5G5EA 1FVKA 2FUG2 4CY6A 1JZRA 1OVNA 2YJHA 1IYIA 1DE1A 4KDXA 3PPUA 4RQRA 2IIYA 3M1GA 3ZVJA 2I9HA 1ZOFA 5HR3A 8GSSA 1FG4A 1YZXA 2GSQA 3I43A 4PUAA 1FOHA 3FR9A 1SKWB 4NHWA 3ZRDA 3TB2A 4HOJA 4EE0A 2I1UA 4X0XA 4E8HA 4XS4B 5JCGA 3NZNA 3LXTA 4GLTA 4F03A 3HJOA 3WGXA 1ZYPA 3GYKA 1M99A 5D8IA 5IMDA 3E0UA 4AJ8A 3DEXA 3L9UA 2WB9A 4IS0A 2L57A 3WGDA 2JSYA 4XRAA 2FNOA 4L5LA 2ZUPA 3UIWA 3ZL5A 14GSA 2RIIA 1ON4A 5DAKB 3ZFLA 4OD7A 4MZCA 4N0VA 3GH9A 4FH8A 4DSSA 5HFIA 4G9HA 2NTOA 1B48A 2V6KA 4OO4A 4J2FA 4BL7A 3H1NA 2REMA 5F0GA 5A4VA 3CTFA 1FW1A 1GTIA 3OR5A 1Z6NA 3SWLA 5A4UA 1AIUA 3A2WA 3EC3A 1CQHA 3Q6OA 5KN2A 5H5SA 3ZTLA 2JACA 4HS1A 4KA0A 1EOHA 3PGTA 2DLXA 4WR4A 3GKKA 4ZIJA 1GTAA 2RM5A 3C1SA 3IE3A 1G6WA 1K3LA 4TR1B 3U5RE 1W89A 1XVQA 3IK7A 1CQGA 4ID0A 1HQOA 4V1Ap 3FRCA 4O5UA 5F07A 3EU4A 5DVBA 4WBJA 3TRXA 5D9TA 17GSA 2H73A 5DDLA 3FYGA 3VWVA 1TP9A 1THXA 4PNFA 3RHBA 2WRTA 3EPTA 4O5RA 1GWCA 2JZTA 4WF4A 5DJMA 4Q5FA 5IIZA 4HEA2 3MWHA 2A2SA 2OA7A 5D93A 5HR1A 1X9SB 3EVIA 3LYKA 1HNBA 5IPGA 5EVOA 4JU5A 4FYCA 2L4CA 5IO0A 1TU8A 3G7IA 3EU3A 2CAQA 4JR4A 2R6KA 2B6MA 1FOVA 1OE7A 1S3RA 2K8SA 2H66A 1ERVA 2LV3A 2HRNA 4QL7A 4YAVA 2L4QA 5CREA 1Z7PA 1TI1A 1SD9A 4GSTA 1SU9A 4KSMA 2C3QA 2PN8A 1BG5A 4RI7A 5A4WA 1XW5A 3GH6A 1DBYA 3FW2A 2F3MA 1B4QA 1TU7A 1I9DA 3IHGA 3GA4A 5G30A 1O6JA 3UBLA 1PMTA 3SBCA 1WE0A 2L6CA 4E8EA 5CRGA 3UOMA 1XCCA 4JEDA 2NDOA 2FCHA 3TKQA 2FGXA 1XZOA 3F6DA 2D2ZA 2X8GA 4JR6A 1PKZA 5DJLA 3CMIA 1J0FA 3CYNA 4MPFA 1TRVA 3GNJA 3HCZA 1WJKA 2CA8A 4G0KA 1A0RP 1AQVA 1MD4A 5J5NA 1LJRA 4MABA 2PMTA 1URMA 4TXOA 2WS2A 4N30A 2B1KA 4EDZA 1K0OA 2CZ3A 1JFUA 4POMA 4V2LA 1GRXA 2KP2A 4ML1A 4WXTA 1FAAA 5LCZA 4O7HA 1GSEA 3I69A 5CP1A 3UJ1A 3TKSC 3D4TA 1XOBA 4GSNA 5COHA 4TRXA 2LNTA 1GNWA 4L0WA 3RPNA 2QKEA 5KOXA 5D9VA 4OMVA 4IW9A 5JCWA 3LEFA 3QDNA 2FLSA 1M7TA 2UZ8A 5ENUA 5ECRB 1GSUA 2L6DA 1HD2A 1T00A 5ECKB 6GSWA 2VOCA 1VF1A 3HY2A 4HZ4A 4A5PA 4Z2RA 3F6FA 5CRDA 4F2IA 3W8JA 3IXRA 3LYPA 1PN9A 2LUSA 4HI7A 5B8AA 3TJBA 5FWGA 2C3TA 2H6YA 3QFBC 3GTUB 3P8WA 3EMXA 1AUCA 3FR6A 2V2GA 4MH2A 3CSJA 2IMFA 3G7YA 1O85A 2P31A 4HDEA 4GCIA 7GSSA 3EURA 3GHAA 2HNLA 4MK3A 4YKFA 4I97A 2KHPA 6GSYA 5JWQB 1ERTA 3ZIVA 1MDKA 4TW5A 4DSRA 2GZYA 1U3AA 1A0FA 4Q5NA 1WP0A 1ZYQB 2X8HA 5ECNB 1GNEA 1VF2A 2WCIA 1V9WA 4KUNA 3VLNA 4LMWA 1XXUA 4K5RA 3Q19A 1G0TA 4F0BA 4NV2A 3VI5A 3EE2A 2KP1A 2RM6A 3K8NA 2VD0A 1M2AA 4XS4A 1TK5B 5DALB 1GTBA 1USBA 1GULA 2RUFA 2LJAA 2YV7A 1JZDA 1M0UA 3O6TA 1A2MA 4TN8A 1XBSA 4PXOA 3ZYWA 4MJBA 4K7IA 4MZWA 5E59A 2HI7A 5F06A 5DAKA 3KGKA 2X64A 5KN0A 1JLVA 1TK0B 5F8BA 3RDWA 1JLWA 4ACSA 1YEXA 5FT3A 2H1DA 4GF0A 4GTUA 2GQLA 1TTZA 1DE2A 3F9UA 3ME8A 5G1LA 2FY6A 4LL4B 3J7Yb 4F0CA 4TR1A 2B5YA 3ISOA 3QAWA 4MJEA 5AIXA 1B4PA 1WMJA 2OADA 4OFMA 4WKWA 5IMFA 3UVHA 3D22A 3ERGA 3VPQA 16GSA 2KUCA 3QR6A 5J9BA 2BTOT 1QXHA 20GSA 2YNXA 1KBNA 1ML6A 5D9XA 4IQAA 1EP7A 1N8JA 3VWXA 1E6BA 1K0AA 4YQVA 1EEJA 4MDCA 4K0NA 1K0CA 2B7JA 1A2JA 4IVFA 3TJJA 3GFKA 3IDVA 3NOFA 4KDUA 1YEPA 4ECJA 4X43A 3DYRA 1G6YA 2HRKA 3BCKA 2FD3A 4KGIA 2LEGA 1T3BA 4FO5A 2K8VA 2HZFA 2MZCA 3JCML 1SL1B 4EXJA 5ELGA 2L5OA 3QAVA 3ED3A 3F4TA 3BCIA 1S3AA 3PINA 3KH7A 3IC8A 1NHYA 3A3TA 4YAPA 3HYPA 5B7CA 4PNGA 1SJZA 5B6MA 2P5RA 2VLUA 1SKSB 4KAEA 2GZZA 2PUKC 2GTUA 2IL3A 4HUAA 2GSTA 2O8VB 2H76A 4ML6A 4MZBA 2LJKA 5G2ZA 3VPTA 2L59A 3CSHA 2J9HA 2HE3A 3LSZA 4F82A 2AHEA 5ECHB 2PERA 2H75A 1SENA 2LQOA 4KSOA 3H8QA 3F4RA 2OE1A 2YN1A 4EUYA 1MD3A 3GL3A 4V2MA 3HHVA 4IHUA 3MAKA 3DVXA 2LRTA 1THOA 2VCQA 4YH2A 2R3XA 2HLSA 1TRWA 2H1BA 1XVWA 5H5QA 6GSSA 2Z9SA 1AAZA 2WZ9A 4X4JA 1A8YA 1PA3A 1V40A 2LJRA 3GUSA 4K2DA 3ZMLA 2C0EA 4ISDA 22GSA 2VCXA 1ZZYA 4YKGA 3CTGA 2VLVA 1H4OA 2B5XA 4IKHA 1NM3A 3CBUA 3TDGA 5KOWA 1A23A 2H8LA 3UMAA 5KN1A 4KCAA 2DIYA 3HVVA 1MDIA 2QGVA 2DIZA 5ID2B 4QL9A 1BJXA 4ZBBA 1BEDA 2DBCA 2C0FA 2OJLA 2DJ0A 1AXDA 3BJ5A 4K7OA 5ECOB 2DJJA 2HT9A 2O87A 2TIRA 3CQFA 5AN1A 1X5CA 2R0PA 5BMUA 2H0GA 3TKRA 3UEMA 4K2XA 3G7JA 3GTUA 4Z2TA 2MYGA 2IN3A 4POLA 3IR4A 1R4WA 3KIJA 2GS3A 5H5RA 4RQXA 4EKZA 4GSSA 1ST9A 1XFLA 4PUFC 2XPEA 2VCVA 1QQ2A 2R5GA 1HYUA 1EGRA 3RBTA 1M9AA 1O8XA 4HJ2A 5EY6A 2H71A 2VM1A 1XW6A 4IQ1A 4WETA 1GL8A 3ZITA 1GSFA 4MF6A 5E4WA 3DRNA 2OBIA 2VIMA 4EC0A 3VI7A 4POKA 4G19A 2QA1A 2VCZA 4KW6A 2YP6A 2J23A 2L5LA 3APOA 1TDIA 3P2AA 3QPMA 1GLQA 2NPBA 2GSRA 4FQUA 3GKXA 3KM6A 2CZ2A 1U87A 4L5OA 5DALA 4ECCA 1QK8A 5ECMB 1SYXA 3KTBA 1EGOA 6GSTA 1TOFA 4K6XA 4FYUA 3IOSA 1F37A 2X49A 4KCEA 4K0GA 2RUEA 1V98A 5AGYA 2K9FA 4USSA 5GSTA 1XWKA 3NIVA 3E3EA 1YDKA 1VGLA 3TOUA 2VD1A 1MEKA 3RPPA 3QMXA 2C3NA 3WT1A 4G10A 2XC2A 3CRUA 4LL1B 4IELA 2EC4A 4EVMA 2DSAA 1GH2A 3HD5A 1J9BA 2FHEA 3V1WA 2N5BA 2GSSA 3HKRA 4Z2UA 3DIEA 4XCSA 4HJMA 1K0MA 2C1YA 1OAZA 2LRCA 4IJ3A 5A5KA 2CQ9A 4D73B 2FA4A 1GSYA 1O73A 2AAWA 2F51A 1FHEA 4KF9A 2YWOA 4LMVA 2CT6A 1SD8A 2X4AA 3R2QA 3HVNA 1M3IA 3TGZA 3TCOA 3BOAA 2JZRA 2YWNA 1JHBA 2GQKA 2H0HA 1V58A 2QSIA 3E9JB 3UBKA 1ZYEA 3GKNA 2C8UA 1EEMA 1EV4A 3KZQA 2H1GA 1EOGA 3FHKA 5HR2A 1LU4A 3TJKA 2XBQA 2PBJA 4KB3A 3LJRA 4MH3A 2PPTA 1X9MB 1TK8B 2FA8A 3KH9A 1C72A 10GSA 4ILFA 1QMVA 1WRYA 1PSQA 1PD21 3FZ5A 3H93A 1FB0A 3FR3A 5HFGA 3O3TA 3US3A 5B8BA 2WJUA 3KEBA 3GKMA 2GLRA 3ERWA 5IOWA 4ECBA 2N5AA 1WIKA 3EYTA 5AIVA 3IPZA 3MNGA 4MMMA 3ZREA 1TI3A 5JWRB 1S3DA 4KX4A 2PVOC 3IAS2 4EIQA 2H1AA 3MDKA 3GURA 4OFTA 2VO4A 1M9BA 2E0QA 1N2AA 5CRHA 1PRXA 4NMUA 2IFQB 4CY8A 4XS1A 3LORA 2CVBA 3F0IA 3IHQA 1RQMA 3GSSA 4F9ZA 1Z3EA 2XBIA 1EZKA 4TR0A 2YANA 4AJ6A 5CNWA 2VCTA 4CDOA 1ERUA 5JWOB 3WD6A 4XIHA 2ZNMA 3TKPA 19GSA 4EIPA 4ULXA 2B7KA 1YY7A 4EDYA 2R37A 4XRDA 3A2XA 2GGTA 2PU9C 2MMAA 1V57A 1WPIA 1B8XA 2ON7A 1B9XC 3FZ9A 1BQ7A 2VL9A 2HSMA 1TKDB 1U6TA 4N11A 1K0BA 2ZCTA 2DJKA 1ZCPA 13GSA 4Q5QA 2IPAA 3Q74A 4ZL9A 2VAFA 3UAPA 2PWJA 3EWLA 3DMLA 1XWAA 4G0LA 3L0HA 3ME7A 1QFNA 1Q4JA 2JSZA 4MJAA 1AW9A 1BAYA 2PVQA 3WGEA 1SK1A 1ZGNA 6GSUA 4IN0A 3QCPA 2HRAA 3QFAC 1BX9A 12GSA 2GDRA 4NAXA 2AUVA 2FWEA 2IJYA 2G0FA 4GQFA 1ZMAA 5ID2A 1SJIA 4H86A 2GZPA 1QUWA 3ZZXA 1WOUA 3D5JA 3LFLA 5ECSA 1OC9B 3HJPA 1R5PA 2WDUA 1XG8A 2R0CA 2EIRA 2CVDA 3Q18A 2ON5A 4TXOB 4I5QA 2M80A 1M2BA 2MMOA 3BD2A 4BWSA 2JL4A 5IQYA 5D96A 2A4HA 3HZ4A 1QGVA 3PH9A 2R0GA 2V41A 3F8UA 5LD0A 1K3OA 4EO3A 4ZL7A 3M9JA 4KNDA 1OKTA 2AB6A 3KD0A 2HFDA 3TOTA 1PX6A 1MTCA 2KOKA 3F63A 2A2RA 2ALBA 4J57E 1KEBA 3WT2A 1GUMA 3UVTA 3VWUA 1PQNA 1OE8A 3M8NA 1U88A 4X1UA 2QA2A 1VRSD 2V32A 4OFNA 2YV9A 2I4AA 4ZBAA 5GSSA 5DQSA 3VURA 4OCEA 2DMLA 3IRAA 4WF5A 3LXZA 4HQZA 4ZILA 1T1VA 3O76A 4BA7A 1EWXA 5DCHA 1AC1A 5HFKA 3GSTA 3QD9A 4K9ZA 2C0DA 2JZSA 3H4KA 5CRWA 1UC7A 3L78A 4KH7A 3WYWA 3GRXA 2MBTA 1R26A 1KTEA 3D21A 2CVKA 4ZL8A 5J9CA 1T4YA 3A5WA 2OKAA 1AQWA 2XPDA 5DBQA 1XOAA 4NWYA 4WEYA 4NV5A 2VCWA 4TKYA 2IWTA 2HSYA 2F8FA 2CAIA 4OO5A 4ZBDA 1K0NA 2B1LA 1T4ZA 1T8EB 2GVPA 3MSZA 1R5AA 4ICYA 3APQA 2MMZA 1TRUA 4TVEA 4ZXGA 3TKSA 4ZB8A 5DCGA 4D73A 3KMNA 1XIYA 2X8CA 3LG6A 4I6XA 5EL8A 1M3JA 1E2YA 4BVXB 5IMZA 1F6MC 1UN2A 2DC5A 3GMFA 4V2NA 4GXZA 2KLXA 4PQHA 3CXGA 5GAPD 4MLYA 1YF0A 2YZUA 1Z7RA 4MNNA 4N10A 2BMXA 2VL2C 5L71A 3HVXA 2YWMA 2M72A 4HU9A 3LW9A
chains in the Genus database with same CATH topology
3I6AA 1FB6A 2R2JA 3KP9A 5EPFA 2DKIA 1ABAA 3C71A 4PQ1A 1GUHA 2AJQB 3TJFA 3FZAA 3DD3A 2E2GA 4MP4A 4BVYB 2P5QA 2FWHA 2HYXA 5D9WA 4EF0A 2NBSA 1NW2A 2YPMA 1TW9A 1FVJA 2WULA 3DXBA 2OBKA 4RI6A 1TXXA 1ZYNA 2H74A 1SL0B 1O81A 5ELAA 5ECIB 2X99A 4K1FA 3S9FA 2V1MA 3F4SA 4Q5RA 4IP1A 2VL3A 3HZ8A 4IGJA 1AQXA 1B9YC 1UVZA 1SYRA 3KCMA 4QQ7A 4WR5A 4MJCA 3GIXA 4JRRA 3ZVJD 5IMVA 2IMEA 5B6NA 1XWGA 5J3RA 1GUKA 3C1RA 3G9BA 4MA9A 3FKFA 1OYJA 1SKRB 3TRPA 4PQIA 2K6VA 2O7KA 3QOUA 2DKHA 2RLIA 2IFQA 1IYHA 4NPBA 1HNAA 5HR0A 1JZWA 3VWWA 1ILOA 3HXSA 1YJ6A 2LRNA 5GZZB 3IA1A 5IMAA 2HZEB 2H01A 3W6GA 2A4VA 3HVSA 4JE1A 4O32A 3RAZA 3CRTA 3F3RA 1F9MA 5IMCA 4Z7XA 3L9SA 5ABRA 1OC3A 4G0IA 5IOXA 2YZHA 1SK2A 4HU7A 4EL1A 2IMDA 2I81A 1A8LA 2DJ2A 1ERWA 2BJXA 1TRSA 1EP8A 1VF3A 4DSQA 2K18A 1XPVA 2H0IA 4NXIA 3GL5A 4POBA 1YKAA 2TRCP 3UL3A 3KJYA 2I3YA 2OE3A 1I5GA 1DSBA 1W4VA 4DVCA 4CHSA 2M46A 2VLTA 3C73A 4MPGA 5CYYA 4XS6A 2B3SA 2XHFA 1PGTA 2LKUA 1SL2B 4YQUA 1NSWA 2CX4A 3H79A 1YKCA 1GP1A 2MMNA 4IJIA 2WFCA 4KDYA 2R4VA 4JZQA 6GSXA 2H30A 2EIOA 4BWQA 4GRFA 3ZMKA 2O89A 3L9VA 4TXVA 4K5SA 1YQ1A 4PGTA 3IBHA 1XWCA 2YOIA 4L0UA 1A2LA 1UA5A 5ECQB 4JBBA 2A2PA 2F9SA 2LQQA 1Y25A 2VUPA 1OC9A 3IC4A 3GV1A 3AY8A 3IAM2 3IV4A 5F05A 1OC8A 2F8AA 1SJ6A 1K3YA 2IMKA 1ZL9A 5IPHA 2IMIA 4I2TA 2P0GA 4DSSB 4PURA 5CO3A 1G7EA 3MYDA 2HSHA 3ZIJA 2C80A 4BL7B 4FYBA 3U6VA 3N5OA 1F3AA 4TR4A 2H19A 3ERFA 3TUEA 2DJ3A 3I9V2 2MBSA 4NHZA 2DMMA 1OKDA 5BRTA 5IM9A 2ES7A 1GSDA 5IO2A 2LTKA 3R3EA 1GSQA 2H6ZA 4O92A 3VK9A 3TJGA 4KE3A 3CSIA 1PL1A 2LS5A 2HRFA 1H75A 5C04A 2YJ7A 2N5FA 3VFIA 3APSA 3KTLA 3KP8A 4OCFA 3D6IA 2C4JA 5KN3A 1RW1A 5JCUA 3DVWA 2VM2A 1J08A 3W8SA 1T7PB 1GLPA 4GQCA 3PR8A 4IP6A 1BYEA 4WBRD 2G2QA 3LQ7A 4FIWA 3LGCA 3GX8A 2DJ1A 1U3IA 4PX1A 2V6OA 4XTSA 4J56E 4BPYA 2JADA 3QAGA 3DWVA 4O5QA 3ZLPA 2VL2A 5KEJA 4GWRA 5AISA 2JU5A 5J4UA 4L8EA 11GSA 1X0RA 5GAND 1PL2A 5CAXA 4RUVA 2EIQA 4BVXA 4AGSA 4K7NA 3BBYA 3C7MA 1EV9A 2GT6A 4LLRA 1SK0A 3FY7A 5G1KA 1PN0A 2YWIA 2FWFA 2OE0A 1G7OA 1PKWA 1O8WA 3KXOA 1R7HA 9GSSA 1F3BA 3FEUA 1TJDA 1Z9HA 3N9JA 1F2EA 2CV4A 4IBPA 3J7Yk 1K0DA 2HXKA 3FMWA 2PGTA 4XHMA 4AF2A 4BVYA 4YQMA 1WWJA 1X5DA 4V1Ag 4MF5A 3C8EA 2GT5A 4TOPA 3GX0A 3M3MA 2LNSA 4K8MA 4I8BA 1XW9A 5HQPA 1KNGA 1Y6EA 3TRQA 2H6XA 4N0ZA 1GTUA 1JZOA 1ACVA 1VF4A 2CX3A 3MIXA 3DKSA 3A5IA 2H72A 1FO5A 4TR3A 3TKSE 4HQSA 1GSSA 5G5FA 4ZB6A 3A2VA 3D4MA 3HA9A 3ZFBA 4HZ2A 3FZ4A 3UARA 5J41A 4DEJA 4G2EA 3DGQA 1DUGA 3M0FA 1S3CA 5G31A 2GQMA 3IK9A 3HJMA 2LSTA 3GN3A 4I2UA 5LNKe 3F3QA 1RK4A 1HNCA 2H70A 2WGRA 3L4NA 3EMPA 2OACA 5ECPB 3P90A 1MDJA 3EINA 2B5EA 4CW9A 1X5EA 5ECLB 2E2MA 2HZEA 3LWAA 6GSVA 3FK8A 5FHIA 1PX7A 18GSA 1LBKA 3HDCA 1Q98A 1Z5YE 2NVLA 1V2AA 1Z6MA 4PTSA 3P7XA 1YF1A 4ECIA 4MCUA 4LA1A 1NHOA 2C0GA 5DQYA 2AV4A 2FWGA 2E7PA 2O85A 1X9WB 1XWBA 4AJ7A 4MF7A 4ZB9A 3RHCA 1O7UA 5D73A 1A24A 4OWYA 5INYA 2QC7A 2YCDA 1M2DA 2AYTA 3KMOA 3D0ZA 3M9KA 4P3YB 2TRXA 5C00A 5G5EA 1FVKA 2FUG2 4CY6A 1JZRA 1OVNA 2YJHA 1IYIA 1DE1A 4KDXA 3PPUA 4RQRA 2IIYA 3M1GA 3ZVJA 2I9HA 1ZOFA 5HR3A 8GSSA 1FG4A 1YZXA 2GSQA 3I43A 4PUAA 1FOHA 3FR9A 1SKWB 4NHWA 3ZRDA 3TB2A 4HOJA 4EE0A 2I1UA 4X0XA 4E8HA 4XS4B 5JCGA 3NZNA 3LXTA 4GLTA 4F03A 3HJOA 3WGXA 1ZYPA 3GYKA 1M99A 5D8IA 5IMDA 3E0UA 4AJ8A 3DEXA 3L9UA 2WB9A 4IS0A 2L57A 3WGDA 2JSYA 4XRAA 2FNOA 4L5LA 2ZUPA 3UIWA 3ZL5A 14GSA 2RIIA 1ON4A 5DAKB 3ZFLA 4OD7A 4MZCA 4N0VA 3GH9A 4FH8A 4DSSA 5HFIA 4G9HA 2NTOA 1B48A 2V6KA 4OO4A 4J2FA 4BL7A 3H1NA 2REMA 5F0GA 5A4VA 3CTFA 1FW1A 1GTIA 3OR5A 1Z6NA 3SWLA 5A4UA 1AIUA 3A2WA 3EC3A 1CQHA 3Q6OA 5KN2A 5H5SA 3ZTLA 2JACA 4HS1A 4KA0A 1EOHA 3PGTA 2DLXA 4WR4A 3GKKA 4ZIJA 1GTAA 2RM5A 3C1SA 3IE3A 1G6WA 1K3LA 4TR1B 3U5RE 1W89A 1XVQA 3IK7A 1CQGA 4ID0A 1HQOA 4V1Ap 3FRCA 4O5UA 5F07A 3EU4A 5DVBA 4WBJA 3TRXA 5D9TA 17GSA 2H73A 5DDLA 3FYGA 3VWVA 1TP9A 1THXA 4PNFA 3RHBA 2WRTA 3EPTA 4O5RA 1GWCA 2JZTA 4WF4A 5DJMA 4Q5FA 5IIZA 4HEA2 3MWHA 2A2SA 2OA7A 5D93A 5HR1A 1X9SB 3EVIA 3LYKA 1HNBA 5IPGA 5EVOA 4JU5A 4FYCA 2L4CA 5IO0A 1TU8A 3G7IA 3EU3A 2CAQA 4JR4A 2R6KA 2B6MA 1FOVA 1OE7A 2K8SA 2H66A 1ERVA 2LV3A 2HRNA 4QL7A 4YAVA 2L4QA 5CREA 1Z7PA 1TI1A 1SD9A 4GSTA 1SU9A 4KSMA 2C3QA 2PN8A 1BG5A 4RI7A 5A4WA 1XW5A 3GH6A 1DBYA 3FW2A 2F3MA 1B4QA 1TU7A 1I9DA 3IHGA 3GA4A 5G30A 1O6JA 3UBLA 1PMTA 3SBCA 1WE0A 2L6CA 4E8EA 5CRGA 3UOMA 1XCCA 4JEDA 2NDOA 2FCHA 3TKQA 2FGXA 1XZOA 3F6DA 2D2ZA 2X8GA 4JR6A 1PKZA 5DJLA 3CMIA 1J0FA 3CYNA 4MPFA 1TRVA 3GNJA 3HCZA 1WJKA 2CA8A 4G0KA 1A0RP 1AQVA 1MD4A 5J5NA 1LJRA 4MABA 2PMTA 1URMA 4TXOA 2WS2A 4N30A 2B1KA 4EDZA 1K0OA 2CZ3A 1JFUA 4POMA 4V2LA 1GRXA 2KP2A 4ML1A 4WXTA 1FAAA 5LCZA 4O7HA 1GSEA 3I69A 5CP1A 3UJ1A 3TKSC 3D4TA 1XOBA 4GSNA 5COHA 4TRXA 2LNTA 1GNWA 4L0WA 3RPNA 2QKEA 5KOXA 5D9VA 4OMVA 4IW9A 5JCWA 3LEFA 3QDNA 2FLSA 1M7TA 2UZ8A 5ENUA 5ECRB 1GSUA 2L6DA 1HD2A 1T00A 5ECKB 6GSWA 2VOCA 1VF1A 3HY2A 4HZ4A 4A5PA 4Z2RA 3F6FA 5CRDA 4F2IA 3W8JA 3IXRA 3LYPA 1PN9A 2LUSA 4HI7A 5B8AA 3TJBA 5FWGA 2C3TA 2H6YA 3QFBC 3GTUB 3P8WA 3EMXA 1AUCA 3FR6A 2V2GA 4MH2A 3CSJA 2IMFA 3G7YA 1O85A 2P31A 4HDEA 4GCIA 7GSSA 3EURA 3GHAA 2HNLA 4MK3A 4YKFA 4I97A 2KHPA 6GSYA 5JWQB 1ERTA 3ZIVA 1MDKA 4TW5A 4DSRA 2GZYA 1U3AA 1A0FA 4Q5NA 1WP0A 1ZYQB 2X8HA 5ECNB 1GNEA 1VF2A 2WCIA 1V9WA 4KUNA 3VLNA 4LMWA 1XXUA 4K5RA 3Q19A 1G0TA 4F0BA 4NV2A 3VI5A 3EE2A 2KP1A 2RM6A 3K8NA 2VD0A 1M2AA 4XS4A 1TK5B 5DALB 1GTBA 1USBA 1GULA 2RUFA 2LJAA 2YV7A 1JZDA 1M0UA 3O6TA 1A2MA 4TN8A 1XBSA 4PXOA 3ZYWA 4MJBA 4K7IA 4MZWA 5E59A 2HI7A 5F06A 5DAKA 3KGKA 2X64A 5KN0A 1JLVA 1TK0B 5F8BA 3RDWA 1JLWA 4ACSA 1YEXA 5FT3A 2H1DA 4GF0A 4GTUA 2GQLA 1TTZA 1DE2A 3F9UA 3ME8A 5G1LA 2FY6A 4LL4B 3J7Yb 4F0CA 4TR1A 2B5YA 3ISOA 3QAWA 4MJEA 5AIXA 1B4PA 1WMJA 2OADA 4OFMA 4WKWA 5IMFA 3UVHA 3D22A 3ERGA 3VPQA 16GSA 2KUCA 3QR6A 5J9BA 2BTOT 1QXHA 20GSA 2YNXA 1KBNA 1ML6A 5D9XA 4IQAA 1EP7A 1N8JA 3VWXA 1E6BA 1K0AA 4YQVA 1EEJA 4MDCA 4K0NA 1K0CA 2B7JA 1A2JA 4IVFA 3TJJA 3GFKA 3IDVA 3NOFA 4KDUA 1YEPA 4ECJA 4X43A 3DYRA 1G6YA 2HRKA 3BCKA 2FD3A 4KGIA 2LEGA 1T3BA 4FO5A 2K8VA 2HZFA 2MZCA 3JCML 1SL1B 4EXJA 5ELGA 2L5OA 3QAVA 3ED3A 3F4TA 3BCIA 1S3AA 3PINA 3KH7A 3IC8A 1NHYA 3A3TA 4YAPA 3HYPA 5B7CA 4PNGA 1SJZA 5B6MA 2P5RA 2VLUA 1SKSB 4KAEA 2GZZA 2PUKC 2GTUA 2IL3A 4HUAA 2GSTA 2O8VB 2H76A 4ML6A 4MZBA 2LJKA 5G2ZA 3VPTA 2L59A 3CSHA 2J9HA 2HE3A 3LSZA 4F82A 2AHEA 5ECHB 2PERA 2H75A 1SENA 2LQOA 4KSOA 3H8QA 3F4RA 2OE1A 2YN1A 4EUYA 1MD3A 3GL3A 4V2MA 3HHVA 4IHUA 3MAKA 3DVXA 2LRTA 1THOA 2VCQA 4YH2A 2R3XA 2HLSA 1TRWA 2H1BA 1XVWA 5H5QA 6GSSA 2Z9SA 1AAZA 2WZ9A 4X4JA 1A8YA 1PA3A 1V40A 2LJRA 3GUSA 4K2DA 3ZMLA 2C0EA 4ISDA 22GSA 2VCXA 1ZZYA 4YKGA 3CTGA 2VLVA 1H4OA 2B5XA 4IKHA 1NM3A 3CBUA 3TDGA 5KOWA 1A23A 2H8LA 3UMAA 5KN1A 4KCAA 2DIYA 3HVVA 1MDIA 2QGVA 2DIZA 5ID2B 4QL9A 1BJXA 4ZBBA 1BEDA 2DBCA 2C0FA 2OJLA 2DJ0A 1AXDA 3BJ5A 4K7OA 5ECOB 2DJJA 2HT9A 2O87A 2TIRA 5AN1A 1X5CA 2R0PA 5BMUA 2H0GA 3TKRA 3UEMA 4K2XA 3G7JA 3GTUA 4Z2TA 2MYGA 2IN3A 4POLA 3IR4A 1R4WA 3KIJA 2GS3A 5H5RA 4RQXA 4EKZA 4GSSA 1ST9A 1XFLA 4PUFC 2XPEA 2VCVA 1QQ2A 2R5GA 1HYUA 1EGRA 3RBTA 1M9AA 1O8XA 4HJ2A 5EY6A 2H71A 2VM1A 1XW6A 4IQ1A 4WETA 1GL8A 3ZITA 1GSFA 4MF6A 5E4WA 3DRNA 2OBIA 2VIMA 4EC0A 3VI7A 4POKA 4G19A 2QA1A 2VCZA 4KW6A 2YP6A 2J23A 2L5LA 3APOA 1TDIA 3P2AA 3QPMA 1GLQA 2NPBA 2GSRA 4FQUA 3GKXA 3KM6A 2CZ2A 1U87A 4L5OA 5DALA 4ECCA 1QK8A 5ECMB 1SYXA 3KTBA 1EGOA 6GSTA 1TOFA 4K6XA 4FYUA 3IOSA 1F37A 2X49A 4KCEA 4K0GA 2RUEA 1V98A 5AGYA 2K9FA 4USSA 5GSTA 1XWKA 3NIVA 3E3EA 1VGLA 1YDKA 3TOUA 2VD1A 1MEKA 3RPPA 3QMXA 2C3NA 3WT1A 4G10A 2XC2A 3CRUA 4LL1B 4IELA 2EC4A 4EVMA 2DSAA 1GH2A 3HD5A 1J9BA 2FHEA 3V1WA 2N5BA 2GSSA 3HKRA 4Z2UA 3DIEA 4XCSA 4HJMA 1K0MA 2C1YA 1OAZA 2LRCA 4IJ3A 5A5KA 2CQ9A 4D73B 2FA4A 1GSYA 1O73A 2AAWA 2F51A 1FHEA 4KF9A 2YWOA 4LMVA 2CT6A 1SD8A 2X4AA 3R2QA 3TGZA 3TCOA 3BOAA 2JZRA 2YWNA 1JHBA 2GQKA 2H0HA 1V58A 2QSIA 3E9JB 3UBKA 1ZYEA 3GKNA 2C8UA 1EEMA 1EV4A 3KZQA 2H1GA 1EOGA 3FHKA 5HR2A 1LU4A 3TJKA 2XBQA 2PBJA 4KB3A 3LJRA 4MH3A 2PPTA 1X9MB 1TK8B 2FA8A 3KH9A 1C72A 10GSA 4ILFA 1QMVA 1WRYA 1PSQA 1PD21 3FZ5A 3H93A 1FB0A 3FR3A 5HFGA 3O3TA 3US3A 5B8BA 2WJUA 3KEBA 3GKMA 2GLRA 3ERWA 5IOWA 4ECBA 2N5AA 1WIKA 3EYTA 5AIVA 3IPZA 3MNGA 4MMMA 3ZREA 1TI3A 5JWRB 1S3DA 4KX4A 2PVOC 3IAS2 4EIQA 2H1AA 3MDKA 3GURA 4OFTA 2VO4A 1M9BA 2E0QA 1N2AA 5CRHA 1PRXA 4NMUA 2IFQB 4CY8A 4XS1A 3LORA 2CVBA 3F0IA 3IHQA 1RQMA 3GSSA 4F9ZA 1Z3EA 2XBIA 1EZKA 4TR0A 2YANA 4AJ6A 5CNWA 2VCTA 4CDOA 1ERUA 5JWOB 3WD6A 4XIHA 2ZNMA 3TKPA 19GSA 4EIPA 4ULXA 2B7KA 1YY7A 4EDYA 2R37A 4XRDA 3A2XA 2GGTA 2PU9C 2MMAA 1V57A 1WPIA 1B8XA 2ON7A 1B9XC 3FZ9A 1BQ7A 2VL9A 2HSMA 1TKDB 1U6TA 4N11A 1K0BA 2ZCTA 2DJKA 1ZCPA 13GSA 4Q5QA 2IPAA 3Q74A 4ZL9A 2VAFA 3UAPA 2PWJA 3EWLA 3DMLA 1XWAA 4G0LA 3L0HA 3ME7A 1QFNA 1Q4JA 2JSZA 4MJAA 1AW9A 1BAYA 2PVQA 3WGEA 1SK1A 1ZGNA 6GSUA 4IN0A 3QCPA 2HRAA 3QFAC 1BX9A 12GSA 2GDRA 4NAXA 2AUVA 2FWEA 2IJYA 2G0FA 4GQFA 1ZMAA 5ID2A 1SJIA 4H86A 2GZPA 1QUWA 3ZZXA 1WOUA 3D5JA 3LFLA 5ECSA 1OC9B 3HJPA 1R5PA 2WDUA 2R0CA 2EIRA 2CVDA 3Q18A 2ON5A 4TXOB 4I5QA 2M80A 1M2BA 2MMOA 3BD2A 4BWSA 2JL4A 5IQYA 5D96A 2A4HA 3HZ4A 1QGVA 3PH9A 2R0GA 2V41A 3F8UA 5LD0A 1K3OA 4EO3A 4ZL7A 3M9JA 4KNDA 1OKTA 2AB6A 3KD0A 2HFDA 3TOTA 1PX6A 1MTCA 2KOKA 3F63A 2A2RA 2ALBA 4J57E 1KEBA 3WT2A 1GUMA 3UVTA 3VWUA 1PQNA 1OE8A 3M8NA 1U88A 4X1UA 2QA2A 1VRSD 2V32A 4OFNA 2YV9A 2I4AA 4ZBAA 5GSSA 5DQSA 3VURA 4OCEA 2DMLA 3IRAA 4WF5A 3LXZA 4HQZA 4ZILA 1T1VA 3O76A 4BA7A 1EWXA 5DCHA 1AC1A 5HFKA 3GSTA 3QD9A 4K9ZA 2C0DA 2JZSA 3H4KA 5CRWA 1UC7A 3L78A 4KH7A 3WYWA 3GRXA 2MBTA 1R26A 1KTEA 3D21A 2CVKA 4ZL8A 5J9CA 1T4YA 3A5WA 2OKAA 1AQWA 2XPDA 5DBQA 1XOAA 4NWYA 4WEYA 4NV5A 2VCWA 4TKYA 2IWTA 2HSYA 2F8FA 2CAIA 4OO5A 4ZBDA 1K0NA 2B1LA 1T4ZA 1T8EB 2GVPA 3MSZA 1R5AA 4ICYA 3APQA 2MMZA 1TRUA 4TVEA 4ZXGA 3TKSA 4ZB8A 5DCGA 4D73A 3KMNA 1XIYA 2X8CA 3LG6A 4I6XA 5EL8A 1E2YA 4BVXB 5IMZA 1F6MC 1UN2A 2DC5A 3GMFA 4V2NA 4GXZA 2KLXA 4PQHA 3CXGA 5GAPD 4MLYA 1YF0A 2YZUA 1Z7RA 4MNNA 4N10A 2BMXA 2VL2C 5L71A 3HVXA 2YWMA 2M72A 4HU9A 3LW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6A A;  1FB6 A;  2R2J A;  3KP9 A;  5EPF A;  1ABA A;  3C71 A;  4PQ1 A;  1GUH A;  2AJQ B;  3TJF A;  3FZA A;  3DD3 A;  2E2G A;  4MP4 A;  2P5Q A;  2FWH A;  2HYX A;  5D9W A;  4EF0 A;  2NBS A;  1NW2 A;  2YPM A;  1TW9 A;  1FVJ A;  2WUL A;  3DXB A;  2OBK A;  4RI6 A;  1TXX A;  2H74 A;  1SL0 B;  1O81 A;  5ELA A;  5ECI B;  2X99 A;  4K1F A;  3S9F A;  2V1M A;  3F4S A;  4Q5R A;  4IP1 A;  2VL3 A;  3HZ8 A;  4IGJ A;  1AQX A;  1B9Y C;  1UVZ A;  1SYR A;  3KCM A;  4QQ7 A;  4WR5 A;  4MJC A;  3GIX A;  4JRR A;  3ZVJ D;  5IMV A;  2IME A;  5B6N A;  1XWG A;  5J3R A;  1GUK A;  3C1R A;  3G9B A;  4MA9 A;  3FKF A;  1OYJ A;  1SKR B;  3TRP A;  4PQI A;  2K6V A;  2O7K A;  3QOU A;  2RLI A;  2IFQ A;  1IYH A;  4NPB A;  1HNA A;  5HR0 A;  1JZW A;  3VWW A;  1ILO A;  3HXS A;  1YJ6 A;  2LRN A;  5GZZ B;  3IA1 A;  5IMA A;  2HZE B;  2H01 A;  3W6G A;  2A4V A;  3HVS A;  4JE1 A;  4O32 A;  3RAZ A;  3CRT A;  3F3R A;  1F9M A;  5IMC A;  4Z7X A;  3L9S A;  5ABR A;  1OC3 A;  5IOX A;  2YZH A;  1SK2 A;  4HU7 A;  4EL1 A;  2IMD A;  2I81 A;  1A8L A;  2DJ2 A;  1ERW A;  2BJX A;  1TRS A;  1EP8 A;  1VF3 A;  4DSQ A;  2K18 A;  1XPV A;  2H0I A;  4NXI A;  3GL5 A;  4POB A;  1YKA A;  2TRC P;  3UL3 A;  3KJY A;  2I3Y A;  2OE3 A;  1I5G A;  1DSB A;  1W4V A;  4DVC A;  4CHS A;  2M46 A;  2VLT A;  3C73 A;  4MPG A;  5CYY A;  4XS6 A;  2B3S A;  2XHF A;  1PGT A;  2LKU A;  1SL2 B;  4YQU A;  1NSW A;  2CX4 A;  3H79 A;  1YKC A;  1GP1 A;  2MMN A;  4IJI A;  2WFC A;  4KDY A;  2R4V A;  4JZQ A;  6GSX A;  2H30 A;  2EIO A;  4BWQ A;  4GRF A;  3ZMK A;  2O89 A;  3L9V A;  4TXV A;  1YQ1 A;  4PGT A;  3IBH A;  1XWC A;  2YOI A;  4L0U A;  1A2L A;  1UA5 A;  5ECQ B;  4JBB A;  2F9S A;  2LQQ A;  1Y25 A;  2VUP A;  1OC9 A;  3IC4 A;  3GV1 A;  3AY8 A;  3IAM 2;  3IV4 A;  5F05 A;  1OC8 A;  2F8A A;  1SJ6 A;  1K3Y A;  2IMK A;  1ZL9 A;  5IPH A;  2IMI A;  4I2T A;  2P0G A;  4DSS B;  4PUR A;  5CO3 A;  1G7E A;  2HSH A;  3ZIJ A;  2C80 A;  4FYB A;  3U6V A;  3N5O A;  1F3A A;  4TR4 A;  2H19 A;  3ERF A;  3TUE A;  2DJ3 A;  3I9V 2;  2MBS A;  4NHZ A;  2DMM A;  1OKD A;  5IM9 A;  2ES7 A;  1GSD A;  5IO2 A;  2LTK A;  1GSQ A;  2H6Z A;  4O92 A;  3VK9 A;  3TJG A;  4KE3 A;  3CSI A;  1PL1 A;  2LS5 A;  2HRF A;  1H75 A;  5C04 A;  2YJ7 A;  2N5F A;  3VFI A;  3APS A;  3KTL A;  3KP8 A;  4OCF A;  3D6I A;  2C4J A;  5KN3 A;  1RW1 A;  5JCU A;  3DVW A;  2VM2 A;  1J08 A;  3W8S A;  1T7P B;  1GLP A;  4GQC A;  3PR8 A;  4IP6 A;  1BYE A;  4WBR D;  2G2Q A;  3LQ7 A;  4FIW A;  3LGC A;  3GX8 A;  2DJ1 A;  1U3I A;  4PX1 A;  2V6O A;  4XTS A;  4J56 E;  4BPY A;  2JAD A;  3QAG A;  3DWV A;  3ZLP A;  2VL2 A;  5KEJ A;  4GWR A;  5AIS A;  2JU5 A;  5J4U A;  4L8E A;  11GS A;  1X0R A;  5GAN D;  1PL2 A;  5CAX A;  4RUV A;  2EIQ A;  4BVX A;  4AGS A;  4K7N A;  3BBY A;  3C7M A;  1EV9 A;  2GT6 A;  4LLR A;  1SK0 A;  3FY7 A;  5G1K A;  2YWI A;  2FWF A;  2OE0 A;  1G7O A;  1PKW A;  1O8W A;  3KXO A;  1R7H A;  9GSS A;  1F3B A;  3FEU A;  1TJD A;  1Z9H A;  3N9J A;  1F2E A;  2CV4 A;  4IBP A;  3J7Y k;  1K0D A;  2HXK A;  2PGT A;  4XHM A;  4AF2 A;  4BVY A;  4YQM A;  1WWJ A;  1X5D A;  4V1A g;  4MF5 A;  3C8E A;  2GT5 A;  4TOP A;  3GX0 A;  3M3M A;  2LNS A;  4K8M A;  4I8B A;  1XW9 A;  5HQP A;  1KNG A;  1Y6E A;  3TRQ A;  2H6X A;  4N0Z A;  1GTU A;  1JZO A;  1ACV A;  1VF4 A;  2CX3 A;  3DKS A;  2H72 A;  1FO5 A;  4TR3 A;  3TKS E;  4HQS A;  1GSS A;  5G5F A;  4ZB6 A;  3A2V A;  3D4M A;  3HA9 A;  3ZFB A;  4HZ2 A;  3FZ4 A;  3UAR A;  5J41 A;  4DEJ A;  4G2E A;  3DGQ A;  1DUG A;  3M0F A;  1S3C A;  5G31 A;  2GQM A;  3IK9 A;  3HJM A;  2LST A;  3GN3 A;  4I2U A;  5LNK e;  3F3Q A;  1RK4 A;  1HNC A;  2H70 A;  2WGR A;  3L4N A;  3EMP A;  2OAC A;  5ECP B;  3P90 A;  1MDJ A;  3EIN A;  2B5E A;  4CW9 A;  1X5E A;  5ECL B;  2E2M A;  2HZE A;  3LWA A;  6GSV A;  3FK8 A;  5FHI A;  1PX7 A;  18GS A;  1LBK A;  3HDC A;  1Q98 A;  1Z5Y E;  2NVL A;  1V2A A;  1Z6M A;  3P7X A;  1YF1 A;  4ECI A;  4MCU A;  4LA1 A;  1NHO A;  2C0G A;  5DQY A;  2AV4 A;  2FWG A;  2E7P A;  2O85 A;  1X9W B;  1XWB A;  4AJ7 A;  4MF7 A;  4ZB9 A;  3RHC A;  1O7U A;  5D73 A;  1A24 A;  4OWY A;  5INY A;  2QC7 A;  2YCD A;  1M2D A;  2AYT A;  3KMO A;  3D0Z A;  3M9K A;  4P3Y B;  2TRX A;  5C00 A;  5G5E A;  1FVK A;  2FUG 2;  1JZR A;  1OVN A;  2YJH A;  1IYI A;  1DE1 A;  4KDX A;  4RQR A;  2IIY A;  3M1G A;  3ZVJ A;  2I9H A;  1ZOF A;  5HR3 A;  8GSS A;  1FG4 A;  1YZX A;  2GSQ A;  3I43 A;  4PUA A;  3FR9 A;  1SKW B;  4NHW A;  3ZRD A;  3TB2 A;  4HOJ A;  4EE0 A;  2I1U A;  4X0X A;  4E8H A;  4XS4 B;  5JCG A;  3NZN A;  3LXT A;  4GLT A;  4F03 A;  3HJO A;  3WGX A;  3GYK A;  1M99 A;  5D8I A;  5IMD A;  3E0U A;  4AJ8 A;  3DEX A;  3L9U A;  2WB9 A;  4IS0 A;  2L57 A;  3WGD A;  2JSY A;  4XRA A;  2FNO A;  4L5L A;  2ZUP A;  3UIW A;  3ZL5 A;  14GS A;  2RII A;  1ON4 A;  5DAK B;  3ZFL A;  4OD7 A;  4MZC A;  4N0V A;  3GH9 A;  4FH8 A;  4DSS A;  5HFI A;  4G9H A;  2NTO A;  1B48 A;  2V6K A;  4OO4 A;  4J2F A;  4BL7 A;  3H1N A;  2REM A;  5F0G A;  5A4V A;  3CTF A;  1FW1 A;  1GTI A;  3OR5 A;  1Z6N A;  3SWL A;  5A4U A;  1AIU A;  3A2W A;  3EC3 A;  1CQH A;  3Q6O A;  5KN2 A;  5H5S A;  3ZTL A;  2JAC A;  4HS1 A;  4KA0 A;  1EOH A;  3PGT A;  2DLX A;  4WR4 A;  3GKK A;  4ZIJ A;  1GTA A;  2RM5 A;  3C1S A;  3IE3 A;  1G6W A;  1K3L A;  4TR1 B;  3U5R E;  1W89 A;  1XVQ A;  3IK7 A;  1CQG A;  4ID0 A;  1HQO A;  4V1A p;  3FRC A;  5F07 A;  3EU4 A;  5DVB A;  4WBJ A;  3TRX A;  5D9T A;  17GS A;  2H73 A;  5DDL A;  3FYG A;  3VWV A;  1TP9 A;  1THX A;  4PNF A;  3RHB A;  2WRT A;  4O5R A;  1GWC A;  2JZT A;  4WF4 A;  5DJM A;  4Q5F A;  5IIZ A;  4HEA 2;  3MWH A;  2A2S A;  2OA7 A;  5D93 A;  5HR1 A;  1X9S B;  3EVI A;  3LYK A;  1HNB A;  5IPG A;  5EVO A;  4JU5 A;  4FYC A;  2L4C A;  5IO0 A;  1TU8 A;  3G7I A;  3EU3 A;  2CAQ A;  4JR4 A;  2R6K A;  2B6M A;  1FOV A;  1OE7 A;  2K8S A;  2H66 A;  1ERV A;  2LV3 A;  2HRN A;  4QL7 A;  4YAV A;  2L4Q A;  5CRE A;  1Z7P A;  1TI1 A;  1SD9 A;  4GST A;  1SU9 A;  4KSM A;  2C3Q A;  2PN8 A;  1BG5 A;  4RI7 A;  5A4W A;  1XW5 A;  3GH6 A;  1DBY A;  3FW2 A;  2F3M A;  1B4Q A;  1TU7 A;  1I9D A;  3GA4 A;  5G30 A;  1O6J A;  3UBL A;  1PMT A;  3SBC A;  1WE0 A;  2L6C A;  4E8E A;  5CRG A;  3UOM A;  1XCC A;  4JED A;  2NDO A;  2FCH A;  3TKQ A;  2FGX A;  1XZO A;  3F6D A;  2D2Z A;  2X8G A;  4JR6 A;  1PKZ A;  5DJL A;  3CMI A;  1J0F A;  3CYN A;  4MPF A;  1TRV A;  3GNJ A;  3HCZ A;  1WJK A;  2CA8 A;  1A0R P;  1AQV A;  1MD4 A;  5J5N A;  1LJR A;  4MAB A;  2PMT A;  1URM A;  4TXO A;  2WS2 A;  4N30 A;  2B1K A;  4EDZ A;  1K0O A;  2CZ3 A;  1JFU A;  4POM A;  4V2L A;  1GRX A;  2KP2 A;  4ML1 A;  4WXT A;  1FAA A;  5LCZ A;  4O7H A;  1GSE A;  3I69 A;  5CP1 A;  3UJ1 A;  3TKS C;  3D4T A;  1XOB A;  4GSN A;  5COH A;  4TRX A;  2LNT A;  1GNW A;  4L0W A;  3RPN A;  2QKE A;  5D9V A;  4OMV A;  4IW9 A;  5JCW A;  3LEF A;  3QDN A;  2FLS A;  1M7T A;  5ENU A;  5ECR B;  1GSU A;  2L6D A;  1HD2 A;  1T00 A;  5ECK B;  6GSW A;  2VOC A;  1VF1 A;  3HY2 A;  4HZ4 A;  3F6F A;  5CRD A;  4F2I A;  3W8J A;  3IXR A;  3LYP A;  1PN9 A;  2LUS A;  4HI7 A;  5B8A A;  3TJB A;  5FWG A;  2C3T A;  2H6Y A;  3QFB C;  3GTU B;  3P8W A;  3EMX A;  1AUC A;  3FR6 A;  2V2G A;  4MH2 A;  3CSJ A;  2IMF A;  3G7Y A;  1O85 A;  2P31 A;  4HDE A;  4GCI A;  7GSS A;  3EUR A;  3GHA A;  2HNL A;  4MK3 A;  4I97 A;  2KHP A;  6GSY A;  5JWQ B;  1ERT A;  3ZIV A;  1MDK A;  4TW5 A;  4DSR A;  2GZY A;  1U3A A;  1A0F A;  4Q5N A;  1WP0 A;  1ZYQ B;  2X8H A;  5ECN B;  1GNE A;  1VF2 A;  2WCI A;  1V9W A;  4KUN A;  3VLN A;  4LMW A;  1XXU A;  4F0B A;  3Q19 A;  1G0T A;  4NV2 A;  3VI5 A;  3EE2 A;  2KP1 A;  2RM6 A;  3K8N A;  2VD0 A;  1M2A A;  4XS4 A;  1TK5 B;  5DAL B;  1GTB A;  1USB A;  1GUL A;  2RUF A;  2LJA A;  2YV7 A;  1JZD A;  1M0U A;  3O6T A;  1A2M A;  4TN8 A;  1XBS A;  4PXO A;  3ZYW A;  4MJB A;  4K7I A;  4MZW A;  5E59 A;  2HI7 A;  5F06 A;  5DAK A;  3KGK A;  2X64 A;  5KN0 A;  1JLV A;  1TK0 B;  5F8B A;  3RDW A;  1JLW A;  4ACS A;  1YEX A;  5FT3 A;  2H1D A;  4GF0 A;  4GTU A;  2GQL A;  1TTZ A;  1DE2 A;  3F9U A;  3ME8 A;  5G1L A;  2FY6 A;  4LL4 B;  3J7Y b;  4F0C A;  4TR1 A;  2B5Y A;  3ISO A;  3QAW A;  4MJE A;  5AIX A;  1B4P A;  1WMJ A;  2OAD A;  4OFM A;  4WKW A;  5IMF A;  3UVH A;  3D22 A;  3ERG A;  3VPQ A;  16GS A;  2KUC A;  3QR6 A;  5J9B A;  2BTO T;  1QXH A;  20GS A;  2YNX A;  1KBN A;  1ML6 A;  5D9X A;  4IQA A;  1EP7 A;  1N8J A;  3VWX A;  1E6B A;  1K0A A;  4YQV A;  1EEJ A;  4MDC A;  4K0N A;  1K0C A;  2B7J A;  1A2J A;  4IVF A;  3TJJ A;  3GFK A;  3IDV A;  3NOF A;  4KDU A;  1YEP A;  4ECJ A;  4X43 A;  3DYR A;  1G6Y A;  3BCK A;  2FD3 A;  4KGI A;  2LEG A;  1T3B A;  4FO5 A;  2K8V A;  2HZF A;  2MZC A;  3JCM L;  1SL1 B;  4EXJ A;  5ELG A;  2L5O A;  3QAV A;  3ED3 A;  3F4T A;  3BCI A;  1S3A A;  3PIN A;  3KH7 A;  1NHY A;  3A3T A;  4YAP A;  3HYP A;  5B7C A;  4PNG A;  1SJZ A;  5B6M A;  2P5R A;  2VLU A;  1SKS B;  4KAE A;  2GZZ A;  2PUK C;  2GTU A;  2IL3 A;  4HUA A;  2GST A;  2O8V B;  2H76 A;  4ML6 A;  4MZB A;  2LJK A;  5G2Z A;  3VPT A;  2L59 A;  3CSH A;  2J9H A;  2HE3 A;  3LSZ A;  4F82 A;  2AHE A;  5ECH B;  2PER A;  2H75 A;  1SEN A;  2LQO A;  4KSO A;  3H8Q A;  3F4R A;  2OE1 A;  2YN1 A;  4EUY A;  1MD3 A;  3GL3 A;  4V2M A;  3HHV A;  4IHU A;  3MAK A;  3DVX A;  2LRT A;  1THO A;  2VCQ A;  4YH2 A;  2R3X A;  2HLS A;  1TRW A;  2H1B A;  1XVW A;  5H5Q A;  6GSS A;  2Z9S A;  1AAZ A;  2WZ9 A;  1A8Y A;  1PA3 A;  1V40 A;  2LJR A;  3GUS A;  4K2D A;  3ZML A;  2C0E A;  4ISD A;  22GS A;  2VCX A;  1ZZY A;  3CTG A;  2VLV A;  1H4O A;  2B5X A;  4IKH A;  1NM3 A;  3CBU A;  3TDG A;  1A23 A;  2H8L A;  3UMA A;  5KN1 A;  4KCA A;  2DIY A;  3HVV A;  1MDI A;  2QGV A;  2DIZ A;  5ID2 B;  4QL9 A;  1BJX A;  4ZBB A;  1BED A;  2DBC A;  2C0F A;  2OJL A;  2DJ0 A;  1AXD A;  3BJ5 A;  4K7O A;  5ECO B;  2DJJ A;  2HT9 A;  2O87 A;  2TIR A;  5AN1 A;  1X5C A;  2H0G A;  3TKR A;  3UEM A;  3G7J A;  3GTU A;  2MYG A;  2IN3 A;  4POL A;  3IR4 A;  1R4W A;  3KIJ A;  2GS3 A;  5H5R A;  4RQX A;  4EKZ A;  4GSS A;  1ST9 A;  1XFL A;  4PUF C;  2XPE A;  2VCV A;  1QQ2 A;  2R5G A;  1HYU A;  1EGR A;  3RBT A;  1M9A A;  1O8X A;  4HJ2 A;  5EY6 A;  2H71 A;  2VM1 A;  1XW6 A;  4IQ1 A;  4WET A;  1GL8 A;  3ZIT A;  1GSF A;  4MF6 A;  5E4W A;  3DRN A;  2OBI A;  2VIM A;  4EC0 A;  3VI7 A;  4POK A;  4G19 A;  2VCZ A;  4KW6 A;  2YP6 A;  2J23 A;  2L5L A;  3APO A;  1TDI A;  3P2A A;  3QPM A;  1GLQ A;  2NPB A;  2GSR A;  3GKX A;  3KM6 A;  2CZ2 A;  1U87 A;  4L5O A;  5DAL A;  4ECC A;  1QK8 A;  5ECM B;  1SYX A;  3KTB A;  1EGO A;  6GST A;  1TOF A;  4K6X A;  4FYU A;  3IOS A;  1F37 A;  4KCE A;  4K0G A;  2RUE A;  1V98 A;  5AGY A;  2K9F A;  5GST A;  1XWK A;  3NIV A;  3E3E A;  1VGL A;  1YDK A;  3TOU A;  2VD1 A;  1MEK A;  3RPP A;  3QMX A;  2C3N A;  3WT1 A;  4G10 A;  2XC2 A;  3CRU A;  4LL1 B;  4IEL A;  2EC4 A;  4EVM A;  2DSA A;  1GH2 A;  3HD5 A;  1J9B A;  2FHE A;  3V1W A;  2N5B A;  2GSS A;  3HKR A;  3DIE A;  4XCS A;  4HJM A;  1K0M A;  2C1Y A;  1OAZ A;  2LRC A;  4IJ3 A;  5A5K A;  2CQ9 A;  4D73 B;  2FA4 A;  1GSY A;  1O73 A;  2AAW A;  2F51 A;  1FHE A;  2YWO A;  4LMV A;  2CT6 A;  1SD8 A;  3R2Q A;  3TGZ A;  3TCO A;  3BOA A;  2JZR A;  2YWN A;  1JHB A;  2GQK A;  2H0H A;  1V58 A;  2QSI A;  3E9J B;  3UBK A;  1ZYE A;  3GKN A;  2C8U A;  1EEM A;  1EV4 A;  3KZQ A;  2H1G A;  1EOG A;  3FHK A;  5HR2 A;  1LU4 A;  3TJK A;  2XBQ A;  2PBJ A;  4KB3 A;  3LJR A;  4MH3 A;  2PPT A;  1X9M B;  1TK8 B;  2FA8 A;  3KH9 A;  1C72 A;  10GS A;  4ILF A;  1QMV A;  1WRY A;  1PSQ A;  1PD2 1;  3FZ5 A;  3H93 A;  1FB0 A;  3FR3 A;  5HFG A;  3O3T A;  3US3 A;  5B8B A;  2WJU A;  3KEB A;  3GKM A;  2GLR A;  3ERW A;  5IOW A;  4ECB A;  2N5A A;  1WIK A;  3EYT A;  5AIV A;  3IPZ A;  3MNG A;  4MMM A;  3ZRE A;  1TI3 A;  5JWR B;  1S3D A;  4KX4 A;  2PVO C;  3IAS 2;  2H1A A;  3MDK A;  3GUR A;  4OFT A;  2VO4 A;  1M9B A;  2E0Q A;  1N2A A;  5CRH A;  1PRX A;  4NMU A;  2IFQ B;  4XS1 A;  3LOR A;  2CVB A;  3F0I A;  3IHQ A;  1RQM A;  3GSS A;  4F9Z A;  1Z3E A;  2XBI A;  1EZK A;  4TR0 A;  2YAN A;  4AJ6 A;  5CNW A;  2VCT A;  4CDO A;  1ERU A;  5JWO B;  3WD6 A;  4XIH A;  2ZNM A;  3TKP A;  19GS A;  4ULX A;  2B7K A;  1YY7 A;  4EDY A;  2R37 A;  4XRD A;  3A2X A;  2GGT A;  2PU9 C;  2MMA A;  1V57 A;  1WPI A;  1B8X A;  2ON7 A;  1B9X C;  3FZ9 A;  1BQ7 A;  2VL9 A;  1TKD B;  1U6T A;  4N11 A;  1K0B A;  2ZCT A;  2DJK A;  1ZCP A;  13GS A;  4Q5Q A;  2IPA A;  3Q74 A;  4ZL9 A;  2VAF A;  3UAP A;  2PWJ A;  3EWL A;  3DML A;  1XWA A;  3L0H A;  3ME7 A;  1QFN A;  1Q4J A;  2JSZ A;  4MJA A;  1AW9 A;  1BAY A;  2PVQ A;  3WGE A;  1SK1 A;  1ZGN A;  6GSU A;  4IN0 A;  3QCP A;  3QFA C;  1BX9 A;  12GS A;  2GDR A;  4NAX A;  2AUV A;  2FWE A;  2IJY A;  2G0F A;  4GQF A;  1ZMA A;  5ID2 A;  1SJI A;  4H86 A;  2GZP A;  1QUW A;  3ZZX A;  1WOU A;  3D5J A;  3LFL A;  5ECS A;  1OC9 B;  3HJP A;  1R5P A;  2WDU A;  2EIR A;  2CVD A;  3Q18 A;  2ON5 A;  4TXO B;  4I5Q A;  2M80 A;  1M2B A;  2MMO A;  3BD2 A;  4BWS A;  2JL4 A;  5IQY A;  5D96 A;  3HZ4 A;  1QGV A;  3PH9 A;  2V41 A;  3F8U A;  5LD0 A;  1K3O A;  4EO3 A;  4ZL7 A;  3M9J A;  4KND A;  1OKT A;  2AB6 A;  3KD0 A;  2HFD A;  3TOT A;  1PX6 A;  1MTC A;  2KOK A;  3F63 A;  2A2R A;  2ALB A;  4J57 E;  1KEB A;  3WT2 A;  1GUM A;  3UVT A;  3VWU A;  1PQN A;  1OE8 A;  3M8N A;  1U88 A;  4X1U A;  1VRS D;  2V32 A;  4OFN A;  2YV9 A;  2I4A A;  4ZBA A;  5GSS A;  5DQS A;  3VUR A;  4OCE A;  2DML A;  3IRA A;  4WF5 A;  3LXZ A;  4HQZ A;  4ZIL A;  1T1V A;  3O76 A;  4BA7 A;  1EWX A;  5DCH A;  1AC1 A;  5HFK A;  3GST A;  3QD9 A;  4K9Z A;  2C0D A;  2JZS A;  3H4K A;  5CRW A;  1UC7 A;  3L78 A;  4KH7 A;  3WYW A;  3GRX A;  2MBT A;  1R26 A;  1KTE A;  3D21 A;  2CVK A;  4ZL8 A;  5J9C A;  1T4Y A;  3A5W A;  2OKA A;  1AQW A;  2XPD A;  5DBQ A;  1XOA A;  4NWY A;  4WEY A;  4NV5 A;  2VCW A;  4TKY A;  2IWT A;  2HSY A;  2F8F A;  2CAI A;  4OO5 A;  4ZBD A;  1K0N A;  2B1L A;  1T4Z A;  1T8E B;  2GVP A;  3MSZ A;  1R5A A;  3APQ A;  2MMZ A;  1TRU A;  4TVE A;  4ZXG A;  3TKS A;  4ZB8 A;  5DCG A;  4D73 A;  3KMN A;  1XIY A;  2X8C A;  3LG6 A;  4I6X A;  5EL8 A;  1E2Y A;  5IMZ A;  1F6M C;  1UN2 A;  2DC5 A;  3GMF A;  4V2N A;  4GXZ A;  2KLX A;  4PQH A;  3CXG A;  5GAP D;  4MLY A;  1YF0 A;  2YZU A;  1Z7R A;  4N10 A;  2BMX A;  2VL2 C;  5L71 A;  3HVX A;  2YWM A;  2M72 A;  4HU9 A; 
#chains in the Genus database with same CATH topology
 3I6A A;  1FB6 A;  2R2J A;  3KP9 A;  5EPF A;  2DKI A;  1ABA A;  3C71 A;  4PQ1 A;  1GUH A;  2AJQ B;  3TJF A;  3FZA A;  3DD3 A;  2E2G A;  4MP4 A;  4BVY B;  2P5Q A;  2FWH A;  2HYX A;  5D9W A;  4EF0 A;  2NBS A;  1NW2 A;  2YPM A;  1TW9 A;  1FVJ A;  2WUL A;  3DXB A;  2OBK A;  4RI6 A;  1TXX A;  1ZYN A;  2H74 A;  1SL0 B;  1O81 A;  5ELA A;  5ECI B;  2X99 A;  4K1F A;  3S9F A;  2V1M A;  3F4S A;  4Q5R A;  4IP1 A;  2VL3 A;  3HZ8 A;  4IGJ A;  1AQX A;  1B9Y C;  1UVZ A;  1SYR A;  3KCM A;  4QQ7 A;  4WR5 A;  4MJC A;  3GIX A;  4JRR A;  3ZVJ D;  5IMV A;  2IME A;  5B6N A;  1XWG A;  5J3R A;  1GUK A;  3C1R A;  3G9B A;  4MA9 A;  3FKF A;  1OYJ A;  1SKR B;  3TRP A;  4PQI A;  2K6V A;  2O7K A;  3QOU A;  2DKH A;  2RLI A;  2IFQ A;  1IYH A;  4NPB A;  1HNA A;  5HR0 A;  1JZW A;  3VWW A;  1ILO A;  3HXS A;  1YJ6 A;  2LRN A;  5GZZ B;  3IA1 A;  5IMA A;  2HZE B;  2H01 A;  3W6G A;  2A4V A;  3HVS A;  4JE1 A;  4O32 A;  3RAZ A;  3CRT A;  3F3R A;  1F9M A;  5IMC A;  4Z7X A;  3L9S A;  5ABR A;  1OC3 A;  4G0I A;  5IOX A;  2YZH A;  1SK2 A;  4HU7 A;  4EL1 A;  2IMD A;  2I81 A;  1A8L A;  2DJ2 A;  1ERW A;  2BJX A;  1TRS A;  1EP8 A;  1VF3 A;  4DSQ A;  2K18 A;  1XPV A;  2H0I A;  4NXI A;  3GL5 A;  4POB A;  1YKA A;  2TRC P;  3UL3 A;  3KJY A;  2I3Y A;  2OE3 A;  1I5G A;  1DSB A;  1W4V A;  4DVC A;  4CHS A;  2M46 A;  2VLT A;  3C73 A;  4MPG A;  5CYY A;  4XS6 A;  2B3S A;  2XHF A;  1PGT A;  2LKU A;  1SL2 B;  4YQU A;  4HSC X;  1NSW A;  2CX4 A;  3H79 A;  1YKC A;  1GP1 A;  2MMN A;  4IJI A;  2WFC A;  4KDY A;  2R4V A;  4JZQ A;  6GSX A;  2H30 A;  2EIO A;  4BWQ A;  4GRF A;  3ZMK A;  2O89 A;  3L9V A;  4TXV A;  4K5S A;  1YQ1 A;  4PGT A;  3IBH A;  1XWC A;  2YOI A;  4L0U A;  1A2L A;  1UA5 A;  5ECQ B;  4JBB A;  2A2P A;  2F9S A;  2LQQ A;  1Y25 A;  2VUP A;  1OC9 A;  3IC4 A;  3GV1 A;  3AY8 A;  3IAM 2;  3IV4 A;  5F05 A;  1OC8 A;  2F8A A;  1SJ6 A;  1K3Y A;  2IMK A;  1ZL9 A;  5IPH A;  2IMI A;  4I2T A;  2P0G A;  4DSS B;  4PUR A;  5CO3 A;  1G7E A;  3MYD A;  2HSH A;  3ZIJ A;  2C80 A;  4BL7 B;  4FYB A;  3U6V A;  3N5O A;  1F3A A;  4TR4 A;  2H19 A;  3ERF A;  3TUE A;  2DJ3 A;  3I9V 2;  2MBS A;  1PFO A;  4NHZ A;  2DMM A;  1OKD A;  5BRT A;  5IM9 A;  2ES7 A;  1GSD A;  5IO2 A;  2LTK A;  3R3E A;  1GSQ A;  2H6Z A;  4O92 A;  3VK9 A;  3TJG A;  4KE3 A;  3CSI A;  1PL1 A;  2LS5 A;  2HRF A;  1H75 A;  5C04 A;  2YJ7 A;  2N5F A;  3VFI A;  3APS A;  3KTL A;  3KP8 A;  4OCF A;  3D6I A;  2C4J A;  5KN3 A;  1RW1 A;  5JCU A;  3DVW A;  2VM2 A;  1J08 A;  3W8S A;  1T7P B;  1GLP A;  4GQC A;  3PR8 A;  4IP6 A;  1BYE A;  4WBR D;  2G2Q A;  3LQ7 A;  4FIW A;  3LGC A;  3GX8 A;  2DJ1 A;  1U3I A;  4PX1 A;  2V6O A;  4XTS A;  4J56 E;  4BPY A;  2JAD A;  3QAG A;  3DWV A;  4O5Q A;  3ZLP A;  2VL2 A;  5KEJ A;  4GWR A;  5AIS A;  2JU5 A;  5J4U A;  4L8E A;  11GS A;  1X0R A;  5GAN D;  1PL2 A;  5CAX A;  4RUV A;  2EIQ A;  4BVX A;  4AGS A;  4K7N A;  3BBY A;  3C7M A;  1EV9 A;  2GT6 A;  4LLR A;  1SK0 A;  3FY7 A;  5G1K A;  1PN0 A;  2YWI A;  2FWF A;  2OE0 A;  1G7O A;  1PKW A;  1O8W A;  3KXO A;  1R7H A;  9GSS A;  1F3B A;  3FEU A;  1TJD A;  1Z9H A;  3N9J A;  1F2E A;  2CV4 A;  4IBP A;  3J7Y k;  1K0D A;  2HXK A;  3FMW A;  2PGT A;  4XHM A;  4AF2 A;  4BVY A;  4YQM A;  1WWJ A;  1X5D A;  4V1A g;  4MF5 A;  3C8E A;  2GT5 A;  4TOP A;  3GX0 A;  3M3M A;  2LNS A;  4K8M A;  4I8B A;  1XW9 A;  5HQP A;  1KNG A;  1Y6E A;  3TRQ A;  2H6X A;  4N0Z A;  1GTU A;  1JZO A;  1ACV A;  1VF4 A;  2CX3 A;  3MIX A;  3DKS A;  3A5I A;  2H72 A;  1FO5 A;  4TR3 A;  3TKS E;  4HQS A;  1GSS A;  5G5F A;  4ZB6 A;  3A2V A;  3D4M A;  3HA9 A;  3ZFB A;  4HZ2 A;  3FZ4 A;  3UAR A;  5J41 A;  4DEJ A;  4G2E A;  3DGQ A;  1DUG A;  3M0F A;  1S3C A;  5G31 A;  2GQM A;  3IK9 A;  3HJM A;  2LST A;  3GN3 A;  4I2U A;  5LNK e;  3F3Q A;  1RK4 A;  1HNC A;  2H70 A;  2WGR A;  3L4N A;  3EMP A;  2OAC A;  5ECP B;  3P90 A;  1MDJ A;  3EIN A;  2B5E A;  4CW9 A;  1X5E A;  5ECL B;  2E2M A;  2HZE A;  3LWA A;  6GSV A;  3FK8 A;  5FHI A;  1PX7 A;  18GS A;  1LBK A;  3HDC A;  1Q98 A;  1Z5Y E;  2NVL A;  1V2A A;  1Z6M A;  4PTS A;  4BIK A;  3P7X A;  1YF1 A;  4ECI A;  4MCU A;  4LA1 A;  1NHO A;  2C0G A;  5DQY A;  2AV4 A;  2FWG A;  2E7P A;  2O85 A;  1X9W B;  1XWB A;  4AJ7 A;  4MF7 A;  4ZB9 A;  3RHC A;  1O7U A;  5D73 A;  1A24 A;  4OWY A;  5INY A;  2QC7 A;  2YCD A;  1M2D A;  2AYT A;  3KMO A;  3D0Z A;  3M9K A;  4P3Y B;  2TRX A;  5C00 A;  5G5E A;  1FVK A;  2FUG 2;  4CY6 A;  1JZR A;  1OVN A;  2YJH A;  1IYI A;  1DE1 A;  4KDX A;  3PPU A;  4RQR A;  2IIY A;  3M1G A;  3ZVJ A;  2I9H A;  1ZOF A;  5HR3 A;  8GSS A;  1FG4 A;  1YZX A;  2GSQ A;  3I43 A;  4PUA A;  1FOH A;  3FR9 A;  1SKW B;  4NHW A;  3ZRD A;  3TB2 A;  4HOJ A;  4EE0 A;  2I1U A;  4X0X A;  4E8H A;  4XS4 B;  5JCG A;  3NZN A;  3LXT A;  4GLT A;  4F03 A;  3HJO A;  3WGX A;  1ZYP A;  3GYK A;  1M99 A;  5D8I A;  5IMD A;  3E0U A;  4AJ8 A;  3DEX A;  3L9U A;  2WB9 A;  4IS0 A;  2L57 A;  3WGD A;  2JSY A;  4XRA A;  2FNO A;  4L5L A;  2ZUP A;  3UIW A;  3ZL5 A;  14GS A;  2RII A;  1ON4 A;  5DAK B;  3ZFL A;  4OD7 A;  4MZC A;  4N0V A;  3GH9 A;  4FH8 A;  4DSS A;  5HFI A;  4G9H A;  2NTO A;  1B48 A;  2V6K A;  4OO4 A;  4J2F A;  4BL7 A;  3H1N A;  2REM A;  5F0G A;  5A4V A;  3CTF A;  1FW1 A;  1GTI A;  3OR5 A;  1Z6N A;  3SWL A;  5A4U A;  1AIU A;  3A2W A;  3EC3 A;  1CQH A;  3Q6O A;  5KN2 A;  5H5S A;  3ZTL A;  2JAC A;  4HS1 A;  4KA0 A;  1EOH A;  3PGT A;  2DLX A;  4WR4 A;  3GKK A;  4ZIJ A;  1GTA A;  2RM5 A;  3C1S A;  3IE3 A;  1G6W A;  1K3L A;  4TR1 B;  3U5R E;  1W89 A;  1XVQ A;  3IK7 A;  1CQG A;  4ID0 A;  1HQO A;  4V1A p;  3FRC A;  4O5U A;  5F07 A;  3EU4 A;  5DVB A;  4WBJ A;  3TRX A;  5D9T A;  17GS A;  2H73 A;  5DDL A;  3FYG A;  3VWV A;  1TP9 A;  1THX A;  4PNF A;  3RHB A;  2WRT A;  3EPT A;  4O5R A;  1GWC A;  2JZT A;  4WF4 A;  5DJM A;  4Q5F A;  5IIZ A;  4HEA 2;  3MWH A;  2A2S A;  2OA7 A;  5D93 A;  5HR1 A;  1X9S B;  3EVI A;  3LYK A;  1HNB A;  5IPG A;  5EVO A;  4JU5 A;  4FYC A;  2L4C A;  5IO0 A;  1TU8 A;  3G7I A;  3EU3 A;  2CAQ A;  4JR4 A;  2R6K A;  2B6M A;  1FOV A;  1OE7 A;  1S3R A;  2K8S A;  2H66 A;  1ERV A;  2LV3 A;  2HRN A;  4QL7 A;  4YAV A;  2L4Q A;  5CRE A;  1Z7P A;  1TI1 A;  1SD9 A;  4GST A;  1SU9 A;  4KSM A;  2C3Q A;  2PN8 A;  1BG5 A;  4RI7 A;  5A4W A;  1XW5 A;  3GH6 A;  1DBY A;  3FW2 A;  2F3M A;  1B4Q A;  1TU7 A;  1I9D A;  3IHG A;  3GA4 A;  5G30 A;  1O6J A;  3UBL A;  1PMT A;  3SBC A;  1WE0 A;  2L6C A;  4E8E A;  5CRG A;  3UOM A;  1XCC A;  4JED A;  2NDO A;  2FCH A;  3TKQ A;  2FGX A;  1XZO A;  3F6D A;  2D2Z A;  2X8G A;  4JR6 A;  1PKZ A;  5DJL A;  3CMI A;  1J0F A;  3CYN A;  4MPF A;  1TRV A;  3GNJ A;  3HCZ A;  1WJK A;  2CA8 A;  4G0K A;  1A0R P;  1AQV A;  1MD4 A;  5J5N A;  1LJR A;  4MAB A;  2PMT A;  1URM A;  4TXO A;  2WS2 A;  4N30 A;  2B1K A;  4EDZ A;  1K0O A;  2CZ3 A;  1JFU A;  4POM A;  4V2L A;  1GRX A;  2KP2 A;  4ML1 A;  4WXT A;  1FAA A;  5LCZ A;  4O7H A;  1GSE A;  3I69 A;  5CP1 A;  3UJ1 A;  3TKS C;  3D4T A;  1XOB A;  4GSN A;  5COH A;  4TRX A;  2LNT A;  1GNW A;  4L0W A;  3RPN A;  2QKE A;  5KOX A;  5D9V A;  4OMV A;  4IW9 A;  5JCW A;  3LEF A;  3QDN A;  2FLS A;  1M7T A;  2UZ8 A;  5ENU A;  5ECR B;  1GSU A;  2L6D A;  1HD2 A;  1T00 A;  5ECK B;  6GSW A;  2VOC A;  1VF1 A;  3HY2 A;  4HZ4 A;  4A5P A;  4Z2R A;  3F6F A;  5CRD A;  4F2I A;  3W8J A;  3IXR A;  3LYP A;  1PN9 A;  2LUS A;  4HI7 A;  5B8A A;  3TJB A;  5FWG A;  2C3T A;  2H6Y A;  3QFB C;  3GTU B;  3P8W A;  3EMX A;  1AUC A;  3FR6 A;  2V2G A;  4MH2 A;  3CSJ A;  2IMF A;  3G7Y A;  1O85 A;  2P31 A;  4HDE A;  4GCI A;  7GSS A;  3EUR A;  3GHA A;  2HNL A;  4MK3 A;  4YKF A;  4I97 A;  2KHP A;  6GSY A;  5JWQ B;  1ERT A;  3ZIV A;  1MDK A;  4TW5 A;  4DSR A;  2GZY A;  1U3A A;  1A0F A;  4Q5N A;  1WP0 A;  1ZYQ B;  2X8H A;  5ECN B;  1GNE A;  1VF2 A;  2WCI A;  1V9W A;  4KUN A;  3VLN A;  4LMW A;  1XXU A;  4K5R A;  3Q19 A;  1G0T A;  4F0B A;  4NV2 A;  3VI5 A;  3EE2 A;  2KP1 A;  2RM6 A;  3K8N A;  2VD0 A;  1M2A A;  4XS4 A;  1TK5 B;  5DAL B;  1GTB A;  1USB A;  1GUL A;  2RUF A;  2LJA A;  2YV7 A;  1JZD A;  1M0U A;  3O6T A;  1A2M A;  4TN8 A;  1XBS A;  4PXO A;  3ZYW A;  4MJB A;  4K7I A;  4MZW A;  5E59 A;  2HI7 A;  5F06 A;  5DAK A;  3KGK A;  2X64 A;  5KN0 A;  1JLV A;  1TK0 B;  5F8B A;  3RDW A;  1JLW A;  4ACS A;  1YEX A;  5FT3 A;  2H1D A;  4GF0 A;  4GTU A;  2GQL A;  1TTZ A;  1DE2 A;  3F9U A;  3ME8 A;  5G1L A;  2FY6 A;  4LL4 B;  3J7Y b;  4F0C A;  4TR1 A;  2B5Y A;  3ISO A;  3QAW A;  4MJE A;  5AIX A;  1B4P A;  1WMJ A;  2OAD A;  4OFM A;  4WKW A;  5IMF A;  3UVH A;  3D22 A;  3ERG A;  3VPQ A;  16GS A;  2KUC A;  3QR6 A;  5J9B A;  2BTO T;  1QXH A;  20GS A;  2YNX A;  1KBN A;  1ML6 A;  5D9X A;  4IQA A;  1EP7 A;  1N8J A;  3VWX A;  1E6B A;  1K0A A;  4YQV A;  1EEJ A;  4MDC A;  4K0N A;  1K0C A;  2B7J A;  1A2J A;  4IVF A;  3TJJ A;  3GFK A;  3IDV A;  3NOF A;  4KDU A;  1YEP A;  4ECJ A;  4X43 A;  3DYR A;  1G6Y A;  2HRK A;  3BCK A;  2FD3 A;  4KGI A;  2LEG A;  1T3B A;  4FO5 A;  2K8V A;  2HZF A;  2MZC A;  3JCM L;  1SL1 B;  4EXJ A;  5ELG A;  2L5O A;  3QAV A;  3ED3 A;  3F4T A;  3BCI A;  1S3A A;  3PIN A;  3KH7 A;  3IC8 A;  1NHY A;  3A3T A;  4YAP A;  3HYP A;  5B7C A;  4PNG A;  1SJZ A;  5B6M A;  2P5R A;  2VLU A;  1SKS B;  4KAE A;  2GZZ A;  2PUK C;  2GTU A;  2IL3 A;  4HUA A;  2GST A;  2O8V B;  2H76 A;  4ML6 A;  4MZB A;  2LJK A;  5G2Z A;  3VPT A;  2L59 A;  3CSH A;  2J9H A;  2HE3 A;  3LSZ A;  4F82 A;  2AHE A;  5ECH B;  2PER A;  2H75 A;  1SEN A;  2LQO A;  4KSO A;  3H8Q A;  3F4R A;  2OE1 A;  2YN1 A;  4EUY A;  1MD3 A;  3GL3 A;  4V2M A;  3HHV A;  4IHU A;  3MAK A;  3DVX A;  2LRT A;  1THO A;  2VCQ A;  4YH2 A;  2R3X A;  2HLS A;  1TRW A;  2H1B A;  1XVW A;  5H5Q A;  6GSS A;  2Z9S A;  1AAZ A;  2WZ9 A;  4X4J A;  1A8Y A;  1PA3 A;  1V40 A;  2LJR A;  3GUS A;  4K2D A;  3ZML A;  2C0E A;  4ISD A;  22GS A;  2VCX A;  1ZZY A;  4YKG A;  3CTG A;  2VLV A;  1H4O A;  2B5X A;  4IKH A;  1NM3 A;  3CBU A;  3TDG A;  5KOW A;  1A23 A;  2H8L A;  3UMA A;  5KN1 A;  4KCA A;  2DIY A;  3HVV A;  1MDI A;  2QGV A;  2DIZ A;  5ID2 B;  4QL9 A;  1BJX A;  4ZBB A;  1BED A;  2DBC A;  2C0F A;  2OJL A;  2DJ0 A;  1AXD A;  3BJ5 A;  4K7O A;  5ECO B;  2DJJ A;  2HT9 A;  2O87 A;  2TIR A;  3CQF A;  5AN1 A;  1X5C A;  2R0P A;  5BMU A;  2H0G A;  3TKR A;  3UEM A;  4K2X A;  3G7J A;  3GTU A;  4Z2T A;  2MYG A;  2IN3 A;  4POL A;  3IR4 A;  1R4W A;  3KIJ A;  2GS3 A;  5H5R A;  4RQX A;  4EKZ A;  4GSS A;  1ST9 A;  1XFL A;  4PUF C;  2XPE A;  2VCV A;  1QQ2 A;  2R5G A;  1HYU A;  1EGR A;  3RBT A;  1M9A A;  1O8X A;  4HJ2 A;  5EY6 A;  2H71 A;  2VM1 A;  1XW6 A;  4IQ1 A;  4WET A;  1GL8 A;  3ZIT A;  1GSF A;  4MF6 A;  5E4W A;  3DRN A;  2OBI A;  2VIM A;  4EC0 A;  3VI7 A;  4POK A;  4G19 A;  2QA1 A;  2VCZ A;  4KW6 A;  2YP6 A;  2J23 A;  2L5L A;  3APO A;  1TDI A;  3P2A A;  3QPM A;  1GLQ A;  2NPB A;  2GSR A;  4FQU A;  3GKX A;  3KM6 A;  2CZ2 A;  1U87 A;  4L5O A;  5DAL A;  4ECC A;  1QK8 A;  5ECM B;  1SYX A;  3KTB A;  1EGO A;  6GST A;  1TOF A;  4K6X A;  4FYU A;  3IOS A;  1F37 A;  2X49 A;  4KCE A;  4K0G A;  2RUE A;  1V98 A;  5AGY A;  2K9F A;  4USS A;  5GST A;  1XWK A;  3NIV A;  3E3E A;  1YDK A;  1VGL A;  3TOU A;  2VD1 A;  1MEK A;  3RPP A;  3QMX A;  2C3N A;  3WT1 A;  4G10 A;  2XC2 A;  3CRU A;  4LL1 B;  4IEL A;  2EC4 A;  4EVM A;  2DSA A;  1GH2 A;  3HD5 A;  1J9B A;  2FHE A;  3V1W A;  2N5B A;  2GSS A;  3HKR A;  4Z2U A;  3DIE A;  4XCS A;  4HJM A;  1K0M A;  2C1Y A;  1OAZ A;  2LRC A;  4IJ3 A;  5A5K A;  2CQ9 A;  4D73 B;  2FA4 A;  1GSY A;  1O73 A;  2AAW A;  2F51 A;  1FHE A;  4KF9 A;  2YWO A;  4LMV A;  2CT6 A;  1SD8 A;  2X4A A;  3R2Q A;  3HVN A;  1M3I A;  3TGZ A;  3TCO A;  3BOA A;  2JZR A;  2YWN A;  1JHB A;  2GQK A;  2H0H A;  1V58 A;  2QSI A;  3E9J B;  3UBK A;  1ZYE A;  3GKN A;  2C8U A;  1EEM A;  1EV4 A;  3KZQ A;  2H1G A;  1EOG A;  3FHK A;  5HR2 A;  1LU4 A;  3TJK A;  2XBQ A;  2PBJ A;  4KB3 A;  3LJR A;  4MH3 A;  2PPT A;  1X9M B;  1TK8 B;  2FA8 A;  3KH9 A;  1C72 A;  10GS A;  4ILF A;  1QMV A;  1WRY A;  1PSQ A;  1PD2 1;  3FZ5 A;  3H93 A;  1FB0 A;  3FR3 A;  5HFG A;  3O3T A;  3US3 A;  5B8B A;  2WJU A;  3KEB A;  3GKM A;  2GLR A;  3ERW A;  5IOW A;  4ECB A;  2N5A A;  1WIK A;  3EYT A;  5AIV A;  3IPZ A;  3MNG A;  4MMM A;  3ZRE A;  1TI3 A;  5JWR B;  1S3D A;  4KX4 A;  2PVO C;  3IAS 2;  4EIQ A;  2H1A A;  3MDK A;  3GUR A;  4OFT A;  2VO4 A;  1M9B A;  2E0Q A;  1N2A A;  5CRH A;  1PRX A;  4NMU A;  2IFQ B;  4CY8 A;  4XS1 A;  3LOR A;  2CVB A;  3F0I A;  3IHQ A;  1RQM A;  3GSS A;  4F9Z A;  1Z3E A;  2XBI A;  1EZK A;  4TR0 A;  2YAN A;  4AJ6 A;  5CNW A;  2VCT A;  4CDO A;  1ERU A;  5JWO B;  3WD6 A;  4XIH A;  2ZNM A;  3TKP A;  19GS A;  4EIP A;  4ULX A;  2B7K A;  1YY7 A;  4EDY A;  2R37 A;  4XRD A;  3A2X A;  2GGT A;  2PU9 C;  2MMA A;  1V57 A;  1WPI A;  1B8X A;  2ON7 A;  1B9X C;  3FZ9 A;  1BQ7 A;  2VL9 A;  2HSM A;  1TKD B;  1U6T A;  4N11 A;  1K0B A;  2ZCT A;  2DJK A;  1ZCP A;  13GS A;  4Q5Q A;  2IPA A;  3Q74 A;  4ZL9 A;  2VAF A;  3UAP A;  2PWJ A;  3EWL A;  3DML A;  1XWA A;  4G0L A;  3L0H A;  3ME7 A;  1QFN A;  1Q4J A;  2JSZ A;  4MJA A;  1AW9 A;  1BAY A;  2PVQ A;  3WGE A;  1SK1 A;  1ZGN A;  6GSU A;  4IN0 A;  3QCP A;  2HRA A;  3QFA C;  1BX9 A;  12GS A;  2GDR A;  4NAX A;  2AUV A;  2FWE A;  2IJY A;  2G0F A;  4GQF A;  1ZMA A;  5ID2 A;  1SJI A;  4H86 A;  2GZP A;  1QUW A;  3ZZX A;  1WOU A;  3D5J A;  3LFL A;  5ECS A;  1OC9 B;  3HJP A;  1R5P A;  2WDU A;  1XG8 A;  2R0C A;  2EIR A;  2CVD A;  3Q18 A;  2ON5 A;  4TXO B;  4I5Q A;  2M80 A;  1M2B A;  2MMO A;  3BD2 A;  4BWS A;  2JL4 A;  5IQY A;  5D96 A;  2A4H A;  3HZ4 A;  1QGV A;  3PH9 A;  2R0G A;  2V41 A;  3F8U A;  5LD0 A;  1K3O A;  4EO3 A;  4ZL7 A;  3M9J A;  4KND A;  1OKT A;  2AB6 A;  3KD0 A;  2HFD A;  3TOT A;  1PX6 A;  1MTC A;  2KOK A;  3F63 A;  2A2R A;  2ALB A;  4J57 E;  1KEB A;  3WT2 A;  1GUM A;  3UVT A;  3VWU A;  1PQN A;  1OE8 A;  3M8N A;  1U88 A;  4X1U A;  2QA2 A;  1VRS D;  2V32 A;  4OFN A;  2YV9 A;  2I4A A;  4ZBA A;  5GSS A;  5DQS A;  3VUR A;  4OCE A;  2DML A;  3IRA A;  4WF5 A;  3LXZ A;  4HQZ A;  4ZIL A;  1T1V A;  3O76 A;  4BA7 A;  1EWX A;  5DCH A;  1AC1 A;  5HFK A;  3GST A;  3QD9 A;  4K9Z A;  2C0D A;  2JZS A;  3H4K A;  5CRW A;  1UC7 A;  3L78 A;  4KH7 A;  3WYW A;  3GRX A;  2MBT A;  1R26 A;  1KTE A;  3D21 A;  2CVK A;  4ZL8 A;  5J9C A;  1T4Y A;  3A5W A;  2OKA A;  1AQW A;  2XPD A;  5DBQ A;  1XOA A;  4NWY A;  4WEY A;  4NV5 A;  2VCW A;  4TKY A;  2IWT A;  2HSY A;  2F8F A;  2CAI A;  4OO5 A;  4ZBD A;  1K0N A;  2B1L A;  1T4Z A;  1T8E B;  2GVP A;  3MSZ A;  1R5A A;  4ICY A;  3APQ A;  2MMZ A;  1TRU A;  4TVE A;  4ZXG A;  3TKS A;  4ZB8 A;  5DCG A;  4D73 A;  3KMN A;  1XIY A;  2X8C A;  3LG6 A;  4I6X A;  5EL8 A;  1M3J A;  1E2Y A;  4BVX B;  5IMZ A;  1F6M C;  1UN2 A;  2DC5 A;  3GMF A;  4V2N A;  4GXZ A;  2KLX A;  4PQH A;  3CXG A;  5GAP D;  4MLY A;  1YF0 A;  2YZU A;  1Z7R A;  4MNN A;  4N10 A;  2BMX A;  2VL2 C;  5L71 A;  3HVX A;  2YWM A;  2M72 A;  4HU9 A;  3LW9 A; 
#chains in the Genus database with same CATH homology
 3I6A A;  1FB6 A;  2R2J A;  3KP9 A;  5EPF A;  2DKI A;  1ABA A;  3C71 A;  4PQ1 A;  1GUH A;  2AJQ B;  3TJF A;  3FZA A;  3DD3 A;  2E2G A;  4MP4 A;  4BVY B;  2P5Q A;  2FWH A;  2HYX A;  5D9W A;  4EF0 A;  2NBS A;  1NW2 A;  2YPM A;  1TW9 A;  1FVJ A;  2WUL A;  3DXB A;  2OBK A;  4RI6 A;  1TXX A;  1ZYN A;  2H74 A;  1SL0 B;  1O81 A;  5ELA A;  5ECI B;  2X99 A;  4K1F A;  3S9F A;  2V1M A;  3F4S A;  4Q5R A;  4IP1 A;  2VL3 A;  3HZ8 A;  4IGJ A;  1AQX A;  1B9Y C;  1UVZ A;  1SYR A;  3KCM A;  4QQ7 A;  4WR5 A;  4MJC A;  3GIX A;  4JRR A;  3ZVJ D;  5IMV A;  2IME A;  5B6N A;  1XWG A;  5J3R A;  1GUK A;  3C1R A;  3G9B A;  4MA9 A;  3FKF A;  1OYJ A;  1SKR B;  3TRP A;  4PQI A;  2K6V A;  2O7K A;  3QOU A;  2DKH A;  2RLI A;  2IFQ A;  1IYH A;  4NPB A;  1HNA A;  5HR0 A;  1JZW A;  3VWW A;  1ILO A;  3HXS A;  1YJ6 A;  2LRN A;  5GZZ B;  3IA1 A;  5IMA A;  2HZE B;  2H01 A;  3W6G A;  2A4V A;  3HVS A;  4JE1 A;  4O32 A;  3RAZ A;  3CRT A;  3F3R A;  1F9M A;  5IMC A;  4Z7X A;  3L9S A;  5ABR A;  1OC3 A;  4G0I A;  5IOX A;  2YZH A;  1SK2 A;  4HU7 A;  4EL1 A;  2IMD A;  2I81 A;  1A8L A;  2DJ2 A;  1ERW A;  2BJX A;  1TRS A;  1EP8 A;  1VF3 A;  4DSQ A;  2K18 A;  1XPV A;  2H0I A;  4NXI A;  3GL5 A;  4POB A;  1YKA A;  2TRC P;  3UL3 A;  3KJY A;  2I3Y A;  2OE3 A;  1I5G A;  1DSB A;  1W4V A;  4DVC A;  4CHS A;  2M46 A;  2VLT A;  3C73 A;  4MPG A;  5CYY A;  4XS6 A;  2B3S A;  2XHF A;  1PGT A;  2LKU A;  1SL2 B;  4YQU A;  1NSW A;  2CX4 A;  3H79 A;  1YKC A;  1GP1 A;  2MMN A;  4IJI A;  2WFC A;  4KDY A;  2R4V A;  4JZQ A;  6GSX A;  2H30 A;  2EIO A;  4BWQ A;  4GRF A;  3ZMK A;  2O89 A;  3L9V A;  4TXV A;  4K5S A;  1YQ1 A;  4PGT A;  3IBH A;  1XWC A;  2YOI A;  4L0U A;  1A2L A;  1UA5 A;  5ECQ B;  4JBB A;  2A2P A;  2F9S A;  2LQQ A;  1Y25 A;  2VUP A;  1OC9 A;  3IC4 A;  3GV1 A;  3AY8 A;  3IAM 2;  3IV4 A;  5F05 A;  1OC8 A;  2F8A A;  1SJ6 A;  1K3Y A;  2IMK A;  1ZL9 A;  5IPH A;  2IMI A;  4I2T A;  2P0G A;  4DSS B;  4PUR A;  5CO3 A;  1G7E A;  3MYD A;  2HSH A;  3ZIJ A;  2C80 A;  4BL7 B;  4FYB A;  3U6V A;  3N5O A;  1F3A A;  4TR4 A;  2H19 A;  3ERF A;  3TUE A;  2DJ3 A;  3I9V 2;  2MBS A;  4NHZ A;  2DMM A;  1OKD A;  5BRT A;  5IM9 A;  2ES7 A;  1GSD A;  5IO2 A;  2LTK A;  3R3E A;  1GSQ A;  2H6Z A;  4O92 A;  3VK9 A;  3TJG A;  4KE3 A;  3CSI A;  1PL1 A;  2LS5 A;  2HRF A;  1H75 A;  5C04 A;  2YJ7 A;  2N5F A;  3VFI A;  3APS A;  3KTL A;  3KP8 A;  4OCF A;  3D6I A;  2C4J A;  5KN3 A;  1RW1 A;  5JCU A;  3DVW A;  2VM2 A;  1J08 A;  3W8S A;  1T7P B;  1GLP A;  4GQC A;  3PR8 A;  4IP6 A;  1BYE A;  4WBR D;  2G2Q A;  3LQ7 A;  4FIW A;  3LGC A;  3GX8 A;  2DJ1 A;  1U3I A;  4PX1 A;  2V6O A;  4XTS A;  4J56 E;  4BPY A;  2JAD A;  3QAG A;  3DWV A;  4O5Q A;  3ZLP A;  2VL2 A;  5KEJ A;  4GWR A;  5AIS A;  2JU5 A;  5J4U A;  4L8E A;  11GS A;  1X0R A;  5GAN D;  1PL2 A;  5CAX A;  4RUV A;  2EIQ A;  4BVX A;  4AGS A;  4K7N A;  3BBY A;  3C7M A;  1EV9 A;  2GT6 A;  4LLR A;  1SK0 A;  3FY7 A;  5G1K A;  1PN0 A;  2YWI A;  2FWF A;  2OE0 A;  1G7O A;  1PKW A;  1O8W A;  3KXO A;  1R7H A;  9GSS A;  1F3B A;  3FEU A;  1TJD A;  1Z9H A;  3N9J A;  1F2E A;  2CV4 A;  4IBP A;  3J7Y k;  1K0D A;  2HXK A;  3FMW A;  2PGT A;  4XHM A;  4AF2 A;  4BVY A;  4YQM A;  1WWJ A;  1X5D A;  4V1A g;  4MF5 A;  3C8E A;  2GT5 A;  4TOP A;  3GX0 A;  3M3M A;  2LNS A;  4K8M A;  4I8B A;  1XW9 A;  5HQP A;  1KNG A;  1Y6E A;  3TRQ A;  2H6X A;  4N0Z A;  1GTU A;  1JZO A;  1ACV A;  1VF4 A;  2CX3 A;  3MIX A;  3DKS A;  3A5I A;  2H72 A;  1FO5 A;  4TR3 A;  3TKS E;  4HQS A;  1GSS A;  5G5F A;  4ZB6 A;  3A2V A;  3D4M A;  3HA9 A;  3ZFB A;  4HZ2 A;  3FZ4 A;  3UAR A;  5J41 A;  4DEJ A;  4G2E A;  3DGQ A;  1DUG A;  3M0F A;  1S3C A;  5G31 A;  2GQM A;  3IK9 A;  3HJM A;  2LST A;  3GN3 A;  4I2U A;  5LNK e;  3F3Q A;  1RK4 A;  1HNC A;  2H70 A;  2WGR A;  3L4N A;  3EMP A;  2OAC A;  5ECP B;  3P90 A;  1MDJ A;  3EIN A;  2B5E A;  4CW9 A;  1X5E A;  5ECL B;  2E2M A;  2HZE A;  3LWA A;  6GSV A;  3FK8 A;  5FHI A;  1PX7 A;  18GS A;  1LBK A;  3HDC A;  1Q98 A;  1Z5Y E;  2NVL A;  1V2A A;  1Z6M A;  4PTS A;  3P7X A;  1YF1 A;  4ECI A;  4MCU A;  4LA1 A;  1NHO A;  2C0G A;  5DQY A;  2AV4 A;  2FWG A;  2E7P A;  2O85 A;  1X9W B;  1XWB A;  4AJ7 A;  4MF7 A;  4ZB9 A;  3RHC A;  1O7U A;  5D73 A;  1A24 A;  4OWY A;  5INY A;  2QC7 A;  2YCD A;  1M2D A;  2AYT A;  3KMO A;  3D0Z A;  3M9K A;  4P3Y B;  2TRX A;  5C00 A;  5G5E A;  1FVK A;  2FUG 2;  4CY6 A;  1JZR A;  1OVN A;  2YJH A;  1IYI A;  1DE1 A;  4KDX A;  3PPU A;  4RQR A;  2IIY A;  3M1G A;  3ZVJ A;  2I9H A;  1ZOF A;  5HR3 A;  8GSS A;  1FG4 A;  1YZX A;  2GSQ A;  3I43 A;  4PUA A;  1FOH A;  3FR9 A;  1SKW B;  4NHW A;  3ZRD A;  3TB2 A;  4HOJ A;  4EE0 A;  2I1U A;  4X0X A;  4E8H A;  4XS4 B;  5JCG A;  3NZN A;  3LXT A;  4GLT A;  4F03 A;  3HJO A;  3WGX A;  1ZYP A;  3GYK A;  1M99 A;  5D8I A;  5IMD A;  3E0U A;  4AJ8 A;  3DEX A;  3L9U A;  2WB9 A;  4IS0 A;  2L57 A;  3WGD A;  2JSY A;  4XRA A;  2FNO A;  4L5L A;  2ZUP A;  3UIW A;  3ZL5 A;  14GS A;  2RII A;  1ON4 A;  5DAK B;  3ZFL A;  4OD7 A;  4MZC A;  4N0V A;  3GH9 A;  4FH8 A;  4DSS A;  5HFI A;  4G9H A;  2NTO A;  1B48 A;  2V6K A;  4OO4 A;  4J2F A;  4BL7 A;  3H1N A;  2REM A;  5F0G A;  5A4V A;  3CTF A;  1FW1 A;  1GTI A;  3OR5 A;  1Z6N A;  3SWL A;  5A4U A;  1AIU A;  3A2W A;  3EC3 A;  1CQH A;  3Q6O A;  5KN2 A;  5H5S A;  3ZTL A;  2JAC A;  4HS1 A;  4KA0 A;  1EOH A;  3PGT A;  2DLX A;  4WR4 A;  3GKK A;  4ZIJ A;  1GTA A;  2RM5 A;  3C1S A;  3IE3 A;  1G6W A;  1K3L A;  4TR1 B;  3U5R E;  1W89 A;  1XVQ A;  3IK7 A;  1CQG A;  4ID0 A;  1HQO A;  4V1A p;  3FRC A;  4O5U A;  5F07 A;  3EU4 A;  5DVB A;  4WBJ A;  3TRX A;  5D9T A;  17GS A;  2H73 A;  5DDL A;  3FYG A;  3VWV A;  1TP9 A;  1THX A;  4PNF A;  3RHB A;  2WRT A;  3EPT A;  4O5R A;  1GWC A;  2JZT A;  4WF4 A;  5DJM A;  4Q5F A;  5IIZ A;  4HEA 2;  3MWH A;  2A2S A;  2OA7 A;  5D93 A;  5HR1 A;  1X9S B;  3EVI A;  3LYK A;  1HNB A;  5IPG A;  5EVO A;  4JU5 A;  4FYC A;  2L4C A;  5IO0 A;  1TU8 A;  3G7I A;  3EU3 A;  2CAQ A;  4JR4 A;  2R6K A;  2B6M A;  1FOV A;  1OE7 A;  2K8S A;  2H66 A;  1ERV A;  2LV3 A;  2HRN A;  4QL7 A;  4YAV A;  2L4Q A;  5CRE A;  1Z7P A;  1TI1 A;  1SD9 A;  4GST A;  1SU9 A;  4KSM A;  2C3Q A;  2PN8 A;  1BG5 A;  4RI7 A;  5A4W A;  1XW5 A;  3GH6 A;  1DBY A;  3FW2 A;  2F3M A;  1B4Q A;  1TU7 A;  1I9D A;  3IHG A;  3GA4 A;  5G30 A;  1O6J A;  3UBL A;  1PMT A;  3SBC A;  1WE0 A;  2L6C A;  4E8E A;  5CRG A;  3UOM A;  1XCC A;  4JED A;  2NDO A;  2FCH A;  3TKQ A;  2FGX A;  1XZO A;  3F6D A;  2D2Z A;  2X8G A;  4JR6 A;  1PKZ A;  5DJL A;  3CMI A;  1J0F A;  3CYN A;  4MPF A;  1TRV A;  3GNJ A;  3HCZ A;  1WJK A;  2CA8 A;  4G0K A;  1A0R P;  1AQV A;  1MD4 A;  5J5N A;  1LJR A;  4MAB A;  2PMT A;  1URM A;  4TXO A;  2WS2 A;  4N30 A;  2B1K A;  4EDZ A;  1K0O A;  2CZ3 A;  1JFU A;  4POM A;  4V2L A;  1GRX A;  2KP2 A;  4ML1 A;  4WXT A;  1FAA A;  5LCZ A;  4O7H A;  1GSE A;  3I69 A;  5CP1 A;  3UJ1 A;  3TKS C;  3D4T A;  1XOB A;  4GSN A;  5COH A;  4TRX A;  2LNT A;  1GNW A;  4L0W A;  3RPN A;  2QKE A;  5KOX A;  5D9V A;  4OMV A;  4IW9 A;  5JCW A;  3LEF A;  3QDN A;  2FLS A;  1M7T A;  2UZ8 A;  5ENU A;  5ECR B;  1GSU A;  2L6D A;  1HD2 A;  1T00 A;  5ECK B;  6GSW A;  2VOC A;  1VF1 A;  3HY2 A;  4HZ4 A;  4A5P A;  4Z2R A;  3F6F A;  5CRD A;  4F2I A;  3W8J A;  3IXR A;  3LYP A;  1PN9 A;  2LUS A;  4HI7 A;  5B8A A;  3TJB A;  5FWG A;  2C3T A;  2H6Y A;  3QFB C;  3GTU B;  3P8W A;  3EMX A;  1AUC A;  3FR6 A;  2V2G A;  4MH2 A;  3CSJ A;  2IMF A;  3G7Y A;  1O85 A;  2P31 A;  4HDE A;  4GCI A;  7GSS A;  3EUR A;  3GHA A;  2HNL A;  4MK3 A;  4YKF A;  4I97 A;  2KHP A;  6GSY A;  5JWQ B;  1ERT A;  3ZIV A;  1MDK A;  4TW5 A;  4DSR A;  2GZY A;  1U3A A;  1A0F A;  4Q5N A;  1WP0 A;  1ZYQ B;  2X8H A;  5ECN B;  1GNE A;  1VF2 A;  2WCI A;  1V9W A;  4KUN A;  3VLN A;  4LMW A;  1XXU A;  4K5R A;  3Q19 A;  1G0T A;  4F0B A;  4NV2 A;  3VI5 A;  3EE2 A;  2KP1 A;  2RM6 A;  3K8N A;  2VD0 A;  1M2A A;  4XS4 A;  1TK5 B;  5DAL B;  1GTB A;  1USB A;  1GUL A;  2RUF A;  2LJA A;  2YV7 A;  1JZD A;  1M0U A;  3O6T A;  1A2M A;  4TN8 A;  1XBS A;  4PXO A;  3ZYW A;  4MJB A;  4K7I A;  4MZW A;  5E59 A;  2HI7 A;  5F06 A;  5DAK A;  3KGK A;  2X64 A;  5KN0 A;  1JLV A;  1TK0 B;  5F8B A;  3RDW A;  1JLW A;  4ACS A;  1YEX A;  5FT3 A;  2H1D A;  4GF0 A;  4GTU A;  2GQL A;  1TTZ A;  1DE2 A;  3F9U A;  3ME8 A;  5G1L A;  2FY6 A;  4LL4 B;  3J7Y b;  4F0C A;  4TR1 A;  2B5Y A;  3ISO A;  3QAW A;  4MJE A;  5AIX A;  1B4P A;  1WMJ A;  2OAD A;  4OFM A;  4WKW A;  5IMF A;  3UVH A;  3D22 A;  3ERG A;  3VPQ A;  16GS A;  2KUC A;  3QR6 A;  5J9B A;  2BTO T;  1QXH A;  20GS A;  2YNX A;  1KBN A;  1ML6 A;  5D9X A;  4IQA A;  1EP7 A;  1N8J A;  3VWX A;  1E6B A;  1K0A A;  4YQV A;  1EEJ A;  4MDC A;  4K0N A;  1K0C A;  2B7J A;  1A2J A;  4IVF A;  3TJJ A;  3GFK A;  3IDV A;  3NOF A;  4KDU A;  1YEP A;  4ECJ A;  4X43 A;  3DYR A;  1G6Y A;  2HRK A;  3BCK A;  2FD3 A;  4KGI A;  2LEG A;  1T3B A;  4FO5 A;  2K8V A;  2HZF A;  2MZC A;  3JCM L;  1SL1 B;  4EXJ A;  5ELG A;  2L5O A;  3QAV A;  3ED3 A;  3F4T A;  3BCI A;  1S3A A;  3PIN A;  3KH7 A;  3IC8 A;  1NHY A;  3A3T A;  4YAP A;  3HYP A;  5B7C A;  4PNG A;  1SJZ A;  5B6M A;  2P5R A;  2VLU A;  1SKS B;  4KAE A;  2GZZ A;  2PUK C;  2GTU A;  2IL3 A;  4HUA A;  2GST A;  2O8V B;  2H76 A;  4ML6 A;  4MZB A;  2LJK A;  5G2Z A;  3VPT A;  2L59 A;  3CSH A;  2J9H A;  2HE3 A;  3LSZ A;  4F82 A;  2AHE A;  5ECH B;  2PER A;  2H75 A;  1SEN A;  2LQO A;  4KSO A;  3H8Q A;  3F4R A;  2OE1 A;  2YN1 A;  4EUY A;  1MD3 A;  3GL3 A;  4V2M A;  3HHV A;  4IHU A;  3MAK A;  3DVX A;  2LRT A;  1THO A;  2VCQ A;  4YH2 A;  2R3X A;  2HLS A;  1TRW A;  2H1B A;  1XVW A;  5H5Q A;  6GSS A;  2Z9S A;  1AAZ A;  2WZ9 A;  4X4J A;  1A8Y A;  1PA3 A;  1V40 A;  2LJR A;  3GUS A;  4K2D A;  3ZML A;  2C0E A;  4ISD A;  22GS A;  2VCX A;  1ZZY A;  4YKG A;  3CTG A;  2VLV A;  1H4O A;  2B5X A;  4IKH A;  1NM3 A;  3CBU A;  3TDG A;  5KOW A;  1A23 A;  2H8L A;  3UMA A;  5KN1 A;  4KCA A;  2DIY A;  3HVV A;  1MDI A;  2QGV A;  2DIZ A;  5ID2 B;  4QL9 A;  1BJX A;  4ZBB A;  1BED A;  2DBC A;  2C0F A;  2OJL A;  2DJ0 A;  1AXD A;  3BJ5 A;  4K7O A;  5ECO B;  2DJJ A;  2HT9 A;  2O87 A;  2TIR A;  5AN1 A;  1X5C A;  2R0P A;  5BMU A;  2H0G A;  3TKR A;  3UEM A;  4K2X A;  3G7J A;  3GTU A;  4Z2T A;  2MYG A;  2IN3 A;  4POL A;  3IR4 A;  1R4W A;  3KIJ A;  2GS3 A;  5H5R A;  4RQX A;  4EKZ A;  4GSS A;  1ST9 A;  1XFL A;  4PUF C;  2XPE A;  2VCV A;  1QQ2 A;  2R5G A;  1HYU A;  1EGR A;  3RBT A;  1M9A A;  1O8X A;  4HJ2 A;  5EY6 A;  2H71 A;  2VM1 A;  1XW6 A;  4IQ1 A;  4WET A;  1GL8 A;  3ZIT A;  1GSF A;  4MF6 A;  5E4W A;  3DRN A;  2OBI A;  2VIM A;  4EC0 A;  3VI7 A;  4POK A;  4G19 A;  2QA1 A;  2VCZ A;  4KW6 A;  2YP6 A;  2J23 A;  2L5L A;  3APO A;  1TDI A;  3P2A A;  3QPM A;  1GLQ A;  2NPB A;  2GSR A;  4FQU A;  3GKX A;  3KM6 A;  2CZ2 A;  1U87 A;  4L5O A;  5DAL A;  4ECC A;  1QK8 A;  5ECM B;  1SYX A;  3KTB A;  1EGO A;  6GST A;  1TOF A;  4K6X A;  4FYU A;  3IOS A;  1F37 A;  2X49 A;  4KCE A;  4K0G A;  2RUE A;  1V98 A;  5AGY A;  2K9F A;  4USS A;  5GST A;  1XWK A;  3NIV A;  3E3E A;  1VGL A;  1YDK A;  3TOU A;  2VD1 A;  1MEK A;  3RPP A;  3QMX A;  2C3N A;  3WT1 A;  4G10 A;  2XC2 A;  3CRU A;  4LL1 B;  4IEL A;  2EC4 A;  4EVM A;  2DSA A;  1GH2 A;  3HD5 A;  1J9B A;  2FHE A;  3V1W A;  2N5B A;  2GSS A;  3HKR A;  4Z2U A;  3DIE A;  4XCS A;  4HJM A;  1K0M A;  2C1Y A;  1OAZ A;  2LRC A;  4IJ3 A;  5A5K A;  2CQ9 A;  4D73 B;  2FA4 A;  1GSY A;  1O73 A;  2AAW A;  2F51 A;  1FHE A;  4KF9 A;  2YWO A;  4LMV A;  2CT6 A;  1SD8 A;  2X4A A;  3R2Q A;  3TGZ A;  3TCO A;  3BOA A;  2JZR A;  2YWN A;  1JHB A;  2GQK A;  2H0H A;  1V58 A;  2QSI A;  3E9J B;  3UBK A;  1ZYE A;  3GKN A;  2C8U A;  1EEM A;  1EV4 A;  3KZQ A;  2H1G A;  1EOG A;  3FHK A;  5HR2 A;  1LU4 A;  3TJK A;  2XBQ A;  2PBJ A;  4KB3 A;  3LJR A;  4MH3 A;  2PPT A;  1X9M B;  1TK8 B;  2FA8 A;  3KH9 A;  1C72 A;  10GS A;  4ILF A;  1QMV A;  1WRY A;  1PSQ A;  1PD2 1;  3FZ5 A;  3H93 A;  1FB0 A;  3FR3 A;  5HFG A;  3O3T A;  3US3 A;  5B8B A;  2WJU A;  3KEB A;  3GKM A;  2GLR A;  3ERW A;  5IOW A;  4ECB A;  2N5A A;  1WIK A;  3EYT A;  5AIV A;  3IPZ A;  3MNG A;  4MMM A;  3ZRE A;  1TI3 A;  5JWR B;  1S3D A;  4KX4 A;  2PVO C;  3IAS 2;  4EIQ A;  2H1A A;  3MDK A;  3GUR A;  4OFT A;  2VO4 A;  1M9B A;  2E0Q A;  1N2A A;  5CRH A;  1PRX A;  4NMU A;  2IFQ B;  4CY8 A;  4XS1 A;  3LOR A;  2CVB A;  3F0I A;  3IHQ A;  1RQM A;  3GSS A;  4F9Z A;  1Z3E A;  2XBI A;  1EZK A;  4TR0 A;  2YAN A;  4AJ6 A;  5CNW A;  2VCT A;  4CDO A;  1ERU A;  5JWO B;  3WD6 A;  4XIH A;  2ZNM A;  3TKP A;  19GS A;  4EIP A;  4ULX A;  2B7K A;  1YY7 A;  4EDY A;  2R37 A;  4XRD A;  3A2X A;  2GGT A;  2PU9 C;  2MMA A;  1V57 A;  1WPI A;  1B8X A;  2ON7 A;  1B9X C;  3FZ9 A;  1BQ7 A;  2VL9 A;  2HSM A;  1TKD B;  1U6T A;  4N11 A;  1K0B A;  2ZCT A;  2DJK A;  1ZCP A;  13GS A;  4Q5Q A;  2IPA A;  3Q74 A;  4ZL9 A;  2VAF A;  3UAP A;  2PWJ A;  3EWL A;  3DML A;  1XWA A;  4G0L A;  3L0H A;  3ME7 A;  1QFN A;  1Q4J A;  2JSZ A;  4MJA A;  1AW9 A;  1BAY A;  2PVQ A;  3WGE A;  1SK1 A;  1ZGN A;  6GSU A;  4IN0 A;  3QCP A;  2HRA A;  3QFA C;  1BX9 A;  12GS A;  2GDR A;  4NAX A;  2AUV A;  2FWE A;  2IJY A;  2G0F A;  4GQF A;  1ZMA A;  5ID2 A;  1SJI A;  4H86 A;  2GZP A;  1QUW A;  3ZZX A;  1WOU A;  3D5J A;  3LFL A;  5ECS A;  1OC9 B;  3HJP A;  1R5P A;  2WDU A;  2R0C A;  2EIR A;  2CVD A;  3Q18 A;  2ON5 A;  4TXO B;  4I5Q A;  2M80 A;  1M2B A;  2MMO A;  3BD2 A;  4BWS A;  2JL4 A;  5IQY A;  5D96 A;  2A4H A;  3HZ4 A;  1QGV A;  3PH9 A;  2R0G A;  2V41 A;  3F8U A;  5LD0 A;  1K3O A;  4EO3 A;  4ZL7 A;  3M9J A;  4KND A;  1OKT A;  2AB6 A;  3KD0 A;  2HFD A;  3TOT A;  1PX6 A;  1MTC A;  2KOK A;  3F63 A;  2A2R A;  2ALB A;  4J57 E;  1KEB A;  3WT2 A;  1GUM A;  3UVT A;  3VWU A;  1PQN A;  1OE8 A;  3M8N A;  1U88 A;  4X1U A;  2QA2 A;  1VRS D;  2V32 A;  4OFN A;  2YV9 A;  2I4A A;  4ZBA A;  5GSS A;  5DQS A;  3VUR A;  4OCE A;  2DML A;  3IRA A;  4WF5 A;  3LXZ A;  4HQZ A;  4ZIL A;  1T1V A;  3O76 A;  4BA7 A;  1EWX A;  5DCH A;  1AC1 A;  5HFK A;  3GST A;  3QD9 A;  4K9Z A;  2C0D A;  2JZS A;  3H4K A;  5CRW A;  1UC7 A;  3L78 A;  4KH7 A;  3WYW A;  3GRX A;  2MBT A;  1R26 A;  1KTE A;  3D21 A;  2CVK A;  4ZL8 A;  5J9C A;  1T4Y A;  3A5W A;  2OKA A;  1AQW A;  2XPD A;  5DBQ A;  1XOA A;  4NWY A;  4WEY A;  4NV5 A;  2VCW A;  4TKY A;  2IWT A;  2HSY A;  2F8F A;  2CAI A;  4OO5 A;  4ZBD A;  1K0N A;  2B1L A;  1T4Z A;  1T8E B;  2GVP A;  3MSZ A;  1R5A A;  4ICY A;  3APQ A;  2MMZ A;  1TRU A;  4TVE A;  4ZXG A;  3TKS A;  4ZB8 A;  5DCG A;  4D73 A;  3KMN A;  1XIY A;  2X8C A;  3LG6 A;  4I6X A;  5EL8 A;  1E2Y A;  4BVX B;  5IMZ A;  1F6M C;  1UN2 A;  2DC5 A;  3GMF A;  4V2N A;  4GXZ A;  2KLX A;  4PQH A;  3CXG A;  5GAP D;  4MLY A;  1YF0 A;  2YZU A;  1Z7R A;  4MNN A;  4N10 A;  2BMX A;  2VL2 C;  5L71 A;  3HVX A;  2YWM A;  2M72 A;  4HU9 A;  3LW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...