2L5LA

Solution structure of thioredoxin from bacteroides vulgatus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Solution Structure of Thioredoxin from Bacteroides Vulgatus
rcsb
source organism Bacteroides vulgatus
molecule tags Transport protein
total genus 41
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2l5lA00
2V41A 4POKA 1GUHA 5F06A 4TXVA 1X9SB 4BVXA 2BTOT 6GSUA 4XS1A 4O32A 1O7UA 3H4KA 2RLIA 2YWNA 4WXTA 3UBLA 1N2AA 3D5JA 2QC7A 2JSYA 2V2GA 3DMLA 18GSA 4OWYA 1S3AA 2F51A 2PUKC 3KH9A 1DE1A 3FY7A 4TR3A 2B5EA 1TXXA 1GLPA 3GH9A 2LJKA 3RHBA 4KNDA 2VUPA 1UVZA 2BMXA 3BBYA 4X43A 3NOFA 3QAGA 5A4WA 4PQ1A 4ID0A 2K6VA 2VCVA 4RI7A 4K0NA 4MA9A 4I8BA 1YJ6A 3KGKA 2L4QA 9GSSA 1PA3A 4YQVA 3GUSA 1R5AA 4MZBA 1F37A 4CHSA 3SBCA 2ALBA 3KEBA 1CQHA 1EEJA 4H86A 3M9KA 3WGXA 4ZILA 4TW5A 4LLRA 3US3A 2VL9A 1M9AA 2HFDA 2RIIA 3FKFA 4YH2A 4N0ZA 4ZBDA 1F6MC 1F3BA 1Z3EA 4IP6A 1K0MA 3UL3A 4KA0A 3CRTA 1YEPA 4MDCA 4TRXA 4OO5A 1XWCA 1ON4A 5IO0A 1GWCA 1OVNA 2HSYA 4ECBA 1M0UA 5B8AA 1SK0A 2R37A 4K7OA 4Q5FA 4K0GA 2EIRA 2DLXA 4IQ1A 4EXJA 1MDJA 1QK8A 3EMXA 4V1Ap 2FWHA 4PX1A 3APQA 5AIVA 1ZYQB 3TKPA 5DDLA 1O8WA 2VL2A 2CX3A 3ZTLA 2GQLA 5DBQA 4MP4A 5D8IA 3ZREA 3ZIVA 4IQAA 1FG4A 3J7Yb 1T4YA 5KEJA 1W4VA 1F9MA 2RUFA 1RQMA 2ON5A 4JR4A 4XS6A 2IIYA 2L4CA 3L9UA 4L0UA 4Q5NA 4WR5A 5HFKA 5GAND 4L5OA 3RAZA 3ZZXA 14GSA 2EC4A 3FZ5A 2HYXA 1ZYEA 4F0BA 4GSSA 4HZ4A 3H1NA 4V2MA 1M2DA 4IGJA 2H74A 1Q4JA 3HHVA 2J23A 1PKWA 16GSA 3TRQA 3CBUA 2FA4A 3TJJA 1U3AA 1QFNA 4X0XA 1VF1A 3D4MA 5G30A 2YJ7A 2GT5A 3ME8A 1GRXA 4EKZA 2GVPA 5FHIA 2C0FA 1SU9A 3GA4A 1IYIA 1X0RA 1GNWA 4LMWA 2EIOA 1Z6NA 1A2JA 1XVQA 4TN8A 1X5DA 2WRTA 4YQMA 3E0UA 2R2JA 1FB6A 5D9VA 4EL1A 5B6MA 3IAM2 1PQNA 2YN1A 4IS0A 3IDVA 4OO4A 1RK4A 3TUEA 3MSZA 2G0FA 2N5FA 4POMA 3L4NA 3GN3A 2AV4A 4IBPA 2PVQA 1K0AA 2YOIA 3LSZA 3VLNA 3WT1A 1R5PA 3NIVA 2IFQB 1YF1A 3VI7A 2M72A 1HQOA 3C1RA 1BJXA 2QSIA 1XBSA 2GQMA 2IFQA 2YNXA 5ABRA 2CX4A 2K18A 3KJYA 4OCFA 2H73A 5B8BA 1KNGA 3Q18A 4MPFA 1JZDA 4KUNA 3EE2A 3G7JA 4PQHA 2FD3A 4K7IA 1NM3A 2LEGA 2H1AA 1KTEA 4WBRD 5KN0A 2VCTA 2B5YA 2VCXA 3EYTA 3FR3A 3KMNA 2FLSA 1HNBA 1URMA 2OE1A 2OBKA 5IPGA 1K0DA 4OD7A 1KBNA 3UVHA 4HU7A 3WYWA 1MEKA 2YANA 3R2QA 6GSXA 1TK8B 4KE3A 1YY7A 5G5EA 2HI7A 3QDNA 4ZL9A 1FVKA 2M46A 1SL0B 3F4SA 1GTBA 3F63A 5G5FA 4WR4A 4LL1B 4NV2A 3ZVJD 3EMPA 3CMIA 4HOJA 1Y25A 2CVKA 1GSDA 2VOCA 4WEYA 4EDYA 2F3MA 1TDIA 3I6AA 3ZFLA 4G10A 2H0GA 2YWOA 2GT6A 1O73A 1WWJA 4MPGA 6GSYA 6GSVA 4PXOA 1PKZA 3LFLA 3KTBA 3HXSA 2OA7A 4K6XA 5HFGA 2I4AA 1MD4A 1GL8A 4ZXGA 2I81A 3EURA 3Q6OA 3TKQA 1AQVA 1WP0A 4PNGA 4EUYA 1M99A 2IMIA 1FO5A 1HYUA 2VCQA 3LQ7A 2IMDA 3BJ5A 3DKSA 5ECNB 4QL9A 1ERVA 4MMMA 3Q19A 3KMOA 3EWLA 2JACA 5JWOB 2JZRA 3FZAA 4AJ6A 4OFNA 3KP9A 3DGQA 2YWIA 1TI3A 2H76A 5DVBA 3TJKA 4LA1A 2QGVA 5E59A 3CSJA 22GSA 2LNTA 2CQ9A 1SL1B 1EEMA 2CV4A 3LGCA 2B3SA 2H6XA 4MH2A 4GLTA 4G9HA 2LRNA 5IOWA 2VLUA 3HJMA 2E2GA 2R3XA 1EZKA 3GL3A 4NV5A 3P8WA 2GDRA 2VAFA 1BX9A 4G19A 4MZCA 2RM5A 5J5NA 4TOPA 4KAEA 4I6XA 3IRAA 4KCAA 4KDYA 4YAVA 3KXOA 4AF2A 3DYRA 4BWSA 3F0IA 2NBSA 1ZCPA 8GSSA 1PMTA 1B9XC 4DSSB 5ECMB 1UN2A 5G2ZA 3HYPA 5DALB 3QAWA 1ZOFA 3M0FA 3IK7A 4EE0A 5HR2A 5CO3A 4MF7A 1G0TA 1FVJA 1O8XA 3UEMA 3QFBC 4DSSA 1F2EA 2HRNA 5DALA 4ZB9A 1FW1A 3TRXA 2C0EA 2N5AA 3W8JA 3LYKA 1G6WA 2XPDA 3FYGA 4KH7A 4OFTA 1MDKA 2B1KA 3QCPA 5GSTA 1T4ZA 1S3CA 3FRCA 3GKKA 5C00A 3CXGA 2QKEA 2WB9A 5DCGA 2B1LA 3TOTA 2O8VB 3D21A 4O92A 5COHA 1GSUA 1TRSA 2E7PA 1GSFA 3J7Yk 4MJBA 4MJCA 1AQWA 4XRDA 3FZ4A 2A4VA 1B8XA 1WRYA 2WS2A 3IE3A 12GSA 2KLXA 3LG6A 3UAPA 2H0HA 5IPHA 4ZL8A 1QMVA 4XHMA 3VK9A 2VIMA 2AB6A 3L78A 4N30A 3DWVA 4F82A 1ABAA 5IMDA 2P31A 2L5LA 1TOFA 3P90A 3QMXA 2L6DA 5HR1A 1MDIA 1TKDB 1XWKA 1Z9HA 4PUFC 1USBA 3CSHA 3LXZA 4ZB6A 4MH3A 5ECIB 2NVLA 4BVYA 3F6FA 5INYA 2H6YA 1JLVA 3OR5A 5KN2A 3ZMLA 4I97A 4J57E 3ZFBA 4CW9A 2FUG2 4EO3A 3MAKA 3ZITA 2GTUA 2OACA 2PPTA 3TKSA 2IWTA 4IHUA 3G7IA 4GQCA 4WBJA 2HZFA 3FR9A 3F3RA 4KDUA 4L8EA 1X9WB 1RW1A 3QPMA 1BAYA 3FEUA 1ML6A 1XPVA 4DSRA 4MF6A 3TJBA 4HI7A 1YZXA 2X8HA 5D96A 3RDWA 1EP7A 3GRXA 3QAVA 1J9BA 1XWGA 4MK3A 3LYPA 2FGXA 5IO2A 3IV4A 3DVXA 4I5QA 3NZNA 2PVOC 4F2IA 1KEBA 4N0VA 2LRCA 4EC0A 2E2MA 3F4TA 3UMAA 2H1GA 1M2AA 1QQ2A 3HJPA 4FO5A 4HDEA 1K0OA 1ZZYA 3DIEA 4ML1A 1U87A 2DIZA 2VLVA 3PINA 4V1Ag 1V57A 2KP1A 4D73B 2V6KA 5IMVA 2VD0A 1TJDA 2LS5A 4HU9A 3A2WA 1TTZA 3VWVA 4TKYA 5IMFA 1H75A 1EGOA 5KN1A 5F05A 4D73A 4MCUA 2MMAA 1M9BA 4L0WA 1GULA 1TK5B 1AAZA 2R5GA 2PERA 2C1YA 3LWAA 4GWRA 1W89A 3DXBA 10GSA 1E6BA 1JFUA 2H8LA 1N8JA 2WULA 2V1MA 4WF4A 3A2VA 3C1SA 3N9JA 1AXDA 2X99A 1TRVA 1XOBA 4KB3A 4HJMA 3TB2A 1ZGNA 1PL2A 3U5RE 4TR1B 2IL3A 4DVCA 1WIKA 2VM1A 4IP1A 2CZ2A 4HQZA 4LMVA 3ZRDA 3ZL5A 2GSTA 4KDXA 3IBHA 4ECIA 4TR1A 1JZOA 5JCUA 3MNGA 2PN8A 1V98A 1B4PA 2HE3A 1T7PB 5F8BA 1XFLA 4XRAA 2ZUPA 1HD2A 2KUCA 4NMUA 1XIYA 3IA1A 5DAKB 5AN1A 1OE7A 1B48A 5B7CA 3GX0A 1T8EB 4N10A 5B6NA 1T1VA 3PR8A 2LKUA 2WZ9A 5DAKA 2DJ3A 1DUGA 4NAXA 1AUCA 2I9HA 3F6DA 5ECSA 1PRXA 3O76A 2HT9A 1FOVA 20GSA 4IJ3A 3RHCA 4JBBA 1XZOA 1FAAA 3C73A 4LL4B 2C3NA 5J9CA 1G6YA 1TI1A 1WMJA 2HSHA 4GQFA 1OYJA 1THOA 2B7KA 3MDKA 4AJ7A 4BPYA 3IK9A 2JSZA 1THXA 2H72A 1NHYA 4I2TA 3L9VA 2HNLA 3GMFA 2LRTA 2H1BA 1A2MA 5EPFA 3H79A 1SENA 2PMTA 4JU5A 2F9SA 17GSA 5H5QA 1V58A 1SJ6A 1NW2A 3S9FA 1PL1A 2H70A 5ECOB 2F8AA 3BCKA 2IN3A 4IVFA 1JZRA 5ECHB 2I1UA 2LJAA 2O87A 2X64A 5CYYA 2FA8A 2FWGA 2GGTA 3BCIA 2PU9C 4RUVA 1QGVA 2ZNMA 4ECCA 4V2NA 3AY8A 5J4UA 4YQUA 1QUWA 2DIYA 2H6ZA 4K7NA 4MJAA 4V2LA 5AGYA 1PN9A 4NHWA 3UARA 4KW6A 1YKAA 2ZCTA 1EWXA 3GKXA 4K1FA 3GFKA 2B5XA 1WOUA 3UJ1A 4IJIA 5A4VA 2K8SA 5CRGA 4OMVA 3DD3A 4FYUA 5CNWA 2DC5A 3I69A 3KTLA 5E4WA 2CAQA 1F3AA 2DJ0A 2EIQA 3HD5A 4E8EA 2HLSA 3E3EA 3MWHA 5AISA 3C71A 2IPAA 1ILOA 1B9YC 2O89A 4P3YB 5FT3A 1EGRA 2NTOA 1XVWA 3GIXA 3ISOA 2H30A 3CTFA 1VGLA 2GSRA 1PX7A 3G9BA 1S3DA 3TKRA 4RI6A 4IN0A 1K3YA 1K0CA 1ERTA 3KM6A 1M7TA 1EV9A 2C0GA 2HZEB 5KN3A 2IJYA 2K9FA 1TRWA 2YP6A 3LXTA 4XCSA 1OC3A 4J56E 3E9JB 3ZYWA 5HR3A 2HZEA 2LJRA 4PNFA 1YDKA 1SKRB 4OFMA 4ZL7A 1B4QA 3TGZA 5CRWA 4BA7A 1UA5A 4YAPA 3HZ4A 2B6MA 1WJKA 1XCCA 1A8YA 3VWWA 2WJUA 4RQXA 4ECJA 5L71A 2H19A 1IYHA 6GSSA 4HQSA 1Z7RA 5LCZA 3GSSA 2FHEA 3ME7A 3ZMKA 2MMZA 3M9JA 2HXKA 1SKWB 2Z9SA 3L9SA 5ECRB 2MBTA 2XPEA 5ECQB 3KP8A 4EF0A 1FB0A 4KSMA 3TOUA 5ECKB 2DJKA 1CQGA 2G2QA 2JADA 2C3TA 3Q74A 2E0QA 5IMZA 2LV3A 3UIWA 3GKNA 4IW9A 5D9TA 5DQYA 5DQSA 2LTKA 1O85A 1OC9B 3APSA 4MLYA 4O7HA 5D93A 1SK1A 2YCDA 1EOHA 2MMNA 5DJLA 2GSSA 3HA9A 3TJFA 1OE8A 2K8VA 4G2EA 4ZB8A 3IPZA 5H5SA 1WPIA 5FWGA 1OC9A 3WGEA 2IMEA 2CVBA 5J3RA 3O3TA 2VCZA 4BL7A 11GSA 3KZQA 4JE1A 5CRHA 3FHKA 4EVMA 1ZMAA 2OE3A 3UVTA 4FYBA 2XBIA 4POBA 4HJ2A 2C0DA 2XBQA 2BJXA 2JL4A 2CT6A 4PGTA 2H71A 4DEJA 1SJZA 1GLQA 1K3OA 1WE0A 4KGIA 1YQ1A 1XW6A 2RUEA 2KHPA 3QFAC 4XIHA 1GSEA 3ZIJA 1X5EA 2FY6A 5G31A 3H93A 4TXOB 2DBCA 1MTCA 5IIZA 5AIXA 1Q98A 1UC7A 2L6CA 4HS1A 4MZWA 3C7MA 5HR0A 1X9MB 3HDCA 2MBSA 2YV9A 2GZPA 4TXOA 3WD6A 3CSIA 1T3BA 1I9DA 3WT2A 1I5GA 4ISDA 4FIWA 3N5OA 2GSQA 4IELA 4K2DA 3H8QA 3F8UA 3ZLPA 1PX6A 3ERGA 3D6IA 2GLRA 4KX4A 1NHOA 5GZZB 2H01A 5LD0A 1XW9A 2YV7A 4WF5A 1OAZA 2DMLA 1G7OA 5EL8A 4HUAA 3TJGA 3G7YA 2B7JA 4E8HA 3EINA 1U88A 1GNEA 1A23A 3W6GA 1OKTA 1XWBA 5IOXA 4JZQA 3DVWA 1GH2A 3GSTA 3TCOA 2YZHA 1A24A 3CRUA 4GXZA 1XW5A 2C4JA 2MZCA 3A5WA 1GTUA 2GQKA 5G1KA 6GSTA 1LU4A 3UOMA 1MD3A 2DJ2A 2OKAA 2XHFA 3L0HA 1SK2A 1YEXA 1Z6MA 1GTIA 5ELGA 3VFIA 2JZTA 5CREA 5EVOA 1M2BA 5LNKe 1Y6EA 3ZVJA 4Q5RA 3TDGA 2PWJA 5ID2B 4J2FA 1SKSB 2GZYA 5HFIA 1GUKA 2L59A 4MABA 2IMFA 1VF4A 2X8CA 3VWUA 5ID2A 4Z7XA 4N11A 3IXRA 2FWEA 3C8EA 2DJ1A 3BD2A 3HVVA 1O81A 1J08A 1U3IA 1EV4A 2LSTA 5D9WA 3VURA 2CVDA 4EDZA 3WGDA 3CYNA 2PGTA 5JCWA 1C72A 2YZUA 1ST9A 2AAWA 5CP1A 2X8GA 2OE0A 3FW2A 4NHZA 3TKSE 1V40A 4F9ZA 2NDOA 7GSSA 3F4RA 3D4TA 2L5OA 2WCIA 3HJOA 1GSQA 1K0NA 1OKDA 4ILFA 2A2RA 1PGTA 1ERWA 4PURA 2KP2A 2ES7A 1R7HA 5JWRB 2KOKA 2JU5A 1SYXA 1H4OA 1VRSD 1HNCA 4AJ8A 4JRRA 3FR6A 1E2YA 5ENUA 1YKCA 3A2XA 4TVEA 3F9UA 4F03A 2C8UA 3VPTA 2FNOA 3HVSA 5GSSA 2REMA 1TU7A 1VF3A 1JLWA 1O6JA 5F0GA 2LQOA 2J9HA 3RBTA 2OBIA 3LEFA 5DJMA 2M80A 4I2UA 1K0BA 3ED3A 4CDOA 3EU4A 3BOAA 3HCZA 2GZZA 2TRCP 3PH9A 6GSWA 4XTSA 3VWXA 2DMMA 2LUSA 1BG5A 4PQIA 5IMCA 5ELAA 3GH6A 1FHEA 3VI5A 3EU3A 1A0RP 3LORA 3M3MA 1AW9A 1SYRA 2R6KA 3HY2A 5IQYA 1AIUA 1BQ7A 1TP9A 3W8SA 4KCEA 3RPNA 5ECLB 3GYKA 2XC2A 2VD1A 2P5RA 4QQ7A 5H5RA 2LQQA 2L57A 3LJRA 2TIRA 13GSA 4NWYA 4JEDA 1GSSA 2V32A 5J41A 5C04A 4MJEA 5A4UA 2CAIA 2C80A 2RM6A 4XS4B 3A3TA 4WETA 3GNJA 2JZSA 2H66A 5J9BA 4GTUA 4HEA2 2D2ZA 4HZ2A 1BYEA 3KIJA 4KSOA 1X5CA 1R26A 3D22A 1DE2A 3F3QA 3I9V2 1YF0A 4XS4A 3DEXA 2R4VA 4MF5A 1A8LA 3KH7A 1JHBA 1AQXA 1TU8A 3PGTA 1VF2A 4O5RA 2MYGA 5DCHA 1V2AA 2O85A 3EVIA 1A2LA 3QOUA 1DSBA 1Z7PA 4GSTA 3K8NA 4TR4A 4GRFA 3GURA 2YJHA 2CZ3A 3V1WA 1EOGA 1GUMA 3KD0A 1A0FA 1XWAA 5D73A 3APOA 1TK0B 1G7EA 5CAXA 2OJLA 4IKHA 2P0GA 1T00A 2VL3A 2FWFA 2N5BA 1HNAA 1LJRA 1QXHA 5GAPD 2WDUA 1LBKA 2VM2A 4F0CA 2WGRA 3QR6A 5ECPB 2V6OA 4NPBA 4RQRA 1ACVA 1K3LA 4ZIJA 5CRDA 1DBYA 4OCEA 4JR6A 2O7KA 2TRXA 3SWLA 1GSYA 2YWMA 5IM9A 2H0IA 3O6TA 2OADA 4K8MA 3DRNA 1BEDA 2H1DA 3UBKA 1XOAA 5F07A 5G1LA 2DSAA 4ULXA 4GCIA 3EC3A 3I43A 1PSQA 4FH8A 3GHAA 1J0FA 3D0ZA 3GTUB 2GS3A 3KCMA 4AGSA 2CA8A 2AUVA 4BWQA 2VCWA 2H75A 1V9WA 3GTUA 2HRFA 1GP1A 2YPMA 19GSA 2DJJA 2I3YA 3VPQA 4DSQA 1SL2B 2P5QA 1TW9A 2LNSA 2MMOA 2WFCA 2FCHA 3IR4A 4PUAA 3HZ8A 3P7XA 5JWQB 1NSWA 3IAS2 1R4WA 1GTAA 1SD8A 2NPBA 1JZWA 5A5KA 3GX8A 3GKMA 3TRPA 2VLTA 2AYTA 3TKSC 5D9XA 2AJQB 1SJIA 3M8NA 1ZL9A 3QD9A 4QL7A 3P2AA 1EP8A 5EY6A 2C3QA 3HVXA 4TR0A 4ML6A 2IMKA 3GL5A 5JCGA 4NXIA 1Z5YE 3JCML 3CTGA 4GSNA 1AC1A 1TRUA 1XXUA 4Q5QA 4POLA 4K9ZA 4FYCA 5IMAA 2PBJA 4ZBBA 3FZ9A 4WKWA 3IOSA 1U6TA 2A2SA 1OC8A 3ERFA 2VO4A 4ZBAA 5HQPA 2AHEA 3M1GA 3IHQA 3GV1A 3U6VA 3FK8A 4GF0A 2F8FA 3HKRA 2ON7A 4X1UA 4ACSA 1SD9A 1PD21 1ERUA 2VL2C 4L5LA 3ERWA 3IC4A 3RPPA
chains in the Genus database with same CATH superfamily
2V41A 4POKA 1GUHA 5F06A 4TXVA 1X9SB 4BVXA 2BTOT 6GSUA 4XS1A 4O32A 1O7UA 3H4KA 2RLIA 2YWNA 4WXTA 3UBLA 1N2AA 3D5JA 2QC7A 2JSYA 2V2GA 3DMLA 1S3RA 18GSA 4OWYA 1S3AA 2F51A 2PUKC 3KH9A 1DE1A 3FY7A 4TR3A 2B5EA 1TXXA 1GLPA 3GH9A 2LJKA 3RHBA 4KNDA 2VUPA 1UVZA 2BMXA 3BBYA 4X43A 3NOFA 3QAGA 5A4WA 4PQ1A 4ID0A 2K6VA 2VCVA 4RI7A 4K0NA 4MA9A 3A5IA 4I8BA 1YJ6A 3KGKA 2L4QA 9GSSA 1PA3A 4YQVA 3GUSA 1R5AA 4MZBA 1F37A 4CHSA 3SBCA 2ALBA 3KEBA 1CQHA 1EEJA 4H86A 3M9KA 3WGXA 4ZILA 4TW5A 4LLRA 3US3A 2VL9A 1M9AA 2HFDA 2RIIA 3FKFA 4YH2A 4N0ZA 4ZBDA 1F6MC 1F3BA 1Z3EA 4IP6A 1K0MA 3UL3A 4KA0A 3CRTA 1YEPA 4MDCA 4TRXA 4OO5A 1XWCA 1ON4A 5IO0A 1GWCA 1OVNA 2HSYA 4ECBA 1M0UA 5B8AA 1SK0A 2R37A 4K7OA 4Q5FA 4K0GA 2EIRA 2DLXA 4IQ1A 4EXJA 1MDJA 1QK8A 3EMXA 4V1Ap 2FWHA 4PX1A 3APQA 4X4JA 5AIVA 1ZYQB 3TKPA 5DDLA 1O8WA 2VL2A 2CX3A 3ZTLA 2GQLA 5DBQA 4MP4A 5D8IA 3ZREA 3ZIVA 4IQAA 1FG4A 3J7Yb 1T4YA 5KEJA 1W4VA 1F9MA 2RUFA 1RQMA 2ON5A 4JR4A 4XS6A 2IIYA 2L4CA 3L9UA 4L0UA 4Q5NA 4WR5A 5HFKA 5GAND 4L5OA 3RAZA 3ZZXA 14GSA 2EC4A 3FZ5A 2HYXA 4PTSA 1ZYEA 4F0BA 4GSSA 4HZ4A 3H1NA 4V2MA 1M2DA 4IGJA 2H74A 1Q4JA 3HHVA 2J23A 1PKWA 16GSA 3TRQA 3CBUA 2FA4A 3TJJA 1U3AA 1QFNA 4X0XA 1VF1A 3D4MA 5G30A 2YJ7A 2GT5A 3ME8A 1GRXA 4EKZA 2GVPA 5FHIA 2C0FA 1SU9A 3GA4A 1IYIA 1X0RA 1GNWA 3LW9A 4LMWA 2EIOA 1Z6NA 1A2JA 1XVQA 4TN8A 1X5DA 2WRTA 4YQMA 3E0UA 2R2JA 1FB6A 5D9VA 4EL1A 5B6MA 3IAM2 1PQNA 2YN1A 4IS0A 3IDVA 4OO4A 1RK4A 3TUEA 3MSZA 2G0FA 2N5FA 4POMA 3L4NA 3GN3A 2AV4A 4IBPA 2PVQA 1K0AA 1ZYNA 2YOIA 3LSZA 3VLNA 3WT1A 1R5PA 3NIVA 2IFQB 1YF1A 3VI7A 2M72A 1HQOA 3C1RA 1BJXA 2QSIA 1XBSA 2GQMA 2IFQA 2YNXA 5ABRA 2CX4A 2K18A 3KJYA 4OCFA 2H73A 5B8BA 1KNGA 3Q18A 4MPFA 1JZDA 2HRAA 4KUNA 3EE2A 3G7JA 5KOXA 4PQHA 2FD3A 4K7IA 1NM3A 2LEGA 2H1AA 1KTEA 4WBRD 5KN0A 2VCTA 2B5YA 2VCXA 3EYTA 3FR3A 3KMNA 2FLSA 1HNBA 1URMA 2OE1A 2OBKA 5IPGA 1K0DA 4OD7A 1KBNA 3UVHA 4HU7A 3WYWA 1MEKA 2YANA 3R2QA 6GSXA 1TK8B 4KE3A 4YKFA 1YY7A 5G5EA 2HI7A 3QDNA 4ZL9A 1FVKA 2M46A 1SL0B 3F4SA 1GTBA 3F63A 5G5FA 1PFOA 4WR4A 4LL1B 4NV2A 3ZVJD 3EMPA 3CMIA 4G0LA 4HOJA 1Y25A 2CVKA 1GSDA 2VOCA 4WEYA 4EDYA 2F3MA 1TDIA 3I6AA 3ZFLA 4G10A 2H0GA 2YWOA 2GT6A 1O73A 1WWJA 4MPGA 6GSYA 6GSVA 4PXOA 1PKZA 3LFLA 3KTBA 3HXSA 2OA7A 4K6XA 5HFGA 2I4AA 1MD4A 1GL8A 4ZXGA 2I81A 3EURA 3Q6OA 4G0IA 3TKQA 1AQVA 1WP0A 4PNGA 4EUYA 1M99A 2IMIA 1FO5A 1HYUA 2VCQA 3LQ7A 2IMDA 3BJ5A 3DKSA 5ECNB 4QL9A 1ERVA 4MMMA 3Q19A 3KMOA 3EWLA 2JACA 5JWOB 2JZRA 3FZAA 4AJ6A 4OFNA 3KP9A 3DGQA 2YWIA 1TI3A 2H76A 5DVBA 3TJKA 4LA1A 2QGVA 5E59A 3CSJA 22GSA 2LNTA 2CQ9A 1SL1B 1EEMA 2CV4A 3LGCA 2B3SA 2H6XA 4MH2A 4GLTA 4G9HA 2LRNA 5IOWA 2VLUA 3HJMA 2E2GA 2R3XA 1EZKA 3GL3A 4NV5A 3P8WA 2GDRA 2VAFA 1BX9A 4G19A 4MZCA 2RM5A 5J5NA 4TOPA 4KAEA 4K5SA 4I6XA 4Z2TA 3IRAA 4KCAA 4KDYA 4YAVA 3KXOA 4AF2A 3DYRA 4BWSA 3F0IA 2NBSA 1ZCPA 8GSSA 1PMTA 1B9XC 4DSSB 5ECMB 1UN2A 5G2ZA 3HYPA 5DALB 3QAWA 1ZOFA 3M0FA 3IK7A 4EE0A 5HR2A 5CO3A 4MF7A 1G0TA 1FVJA 1O8XA 3UEMA 3QFBC 4DSSA 1F2EA 2HRNA 5DALA 4ZB9A 1FW1A 3TRXA 2C0EA 2N5AA 3W8JA 3LYKA 1G6WA 2XPDA 3FYGA 4KH7A 4OFTA 1MDKA 2B1KA 4CY6A 3QCPA 5GSTA 1T4ZA 1S3CA 3FRCA 3GKKA 5C00A 3CXGA 2QKEA 2WB9A 5DCGA 2B1LA 3TOTA 2O8VB 3D21A 4O92A 5COHA 1GSUA 2X4AA 1TRSA 2E7PA 1GSFA 3J7Yk 3CQFA 4MJBA 4MJCA 1AQWA 4XRDA 3FZ4A 2A4VA 1B8XA 1WRYA 2WS2A 3IE3A 12GSA 2KLXA 3LG6A 3UAPA 2H0HA 5IPHA 4ZL8A 1QMVA 4XHMA 3VK9A 2VIMA 2AB6A 3L78A 2X49A 4N30A 3DWVA 4F82A 1ABAA 5IMDA 2P31A 2DKIA 2L5LA 1TOFA 3P90A 3QMXA 2L6DA 4BVYB 5HR1A 3FMWA 1MDIA 1TKDB 1XWKA 1Z9HA 4PUFC 1USBA 3CSHA 3LXZA 4ZB6A 4MH3A 5ECIB 2NVLA 4BVYA 3F6FA 5INYA 2H6YA 1JLVA 3OR5A 5KN2A 3ZMLA 4I97A 4J57E 3ZFBA 4CW9A 2FUG2 4EO3A 3MAKA 3ZITA 2GTUA 2OACA 2PPTA 3TKSA 2IWTA 4IHUA 3G7IA 4GQCA 4WBJA 2HZFA 3FR9A 3F3RA 4KDUA 4L8EA 1X9WB 1RW1A 3QPMA 1BAYA 3FEUA 4O5QA 1ML6A 1XPVA 4DSRA 4MF6A 3TJBA 4HI7A 1YZXA 2X8HA 5D96A 3RDWA 1EP7A 3GRXA 3QAVA 1J9BA 1XWGA 4MK3A 3LYPA 2FGXA 5IO2A 3IV4A 3DVXA 4I5QA 3NZNA 2PVOC 4F2IA 1KEBA 4N0VA 2LRCA 4EC0A 2E2MA 3F4TA 3UMAA 2H1GA 1M2AA 1QQ2A 3HJPA 4FO5A 4HDEA 1K0OA 1ZZYA 3DIEA 4ML1A 1U87A 2DIZA 2VLVA 3PINA 4V1Ag 1V57A 2KP1A 4D73B 2V6KA 5IMVA 2VD0A 1TJDA 2LS5A 4HU9A 3A2WA 1TTZA 3VWVA 4TKYA 5IMFA 1H75A 1EGOA 5KN1A 5F05A 4D73A 4MCUA 2MMAA 1M9BA 4L0WA 1GULA 1TK5B 1AAZA 2R5GA 2PERA 2C1YA 3LWAA 4FQUA 4GWRA 4Z2UA 1W89A 3DXBA 10GSA 1E6BA 1JFUA 2H8LA 1N8JA 2WULA 2V1MA 4WF4A 3A2VA 3C1SA 3N9JA 1AXDA 2X99A 1TRVA 1XOBA 4KB3A 4HJMA 3TB2A 1ZGNA 1PL2A 3U5RE 4TR1B 2IL3A 4DVCA 1WIKA 2VM1A 4IP1A 2CZ2A 4HQZA 4LMVA 3ZRDA 3ZL5A 2GSTA 4KDXA 3IBHA 4ECIA 4TR1A 1JZOA 5JCUA 3MNGA 2PN8A 1V98A 1B4PA 2HE3A 1T7PB 5F8BA 1XFLA 4XRAA 2ZUPA 1HD2A 2KUCA 4NMUA 1XIYA 3IA1A 5DAKB 5AN1A 1OE7A 1B48A 5B7CA 3GX0A 1T8EB 4CY8A 1M3JA 4N10A 5B6NA 1T1VA 3PR8A 2LKUA 2WZ9A 5DAKA 2DJ3A 1DUGA 4NAXA 1AUCA 2I9HA 3F6DA 5ECSA 1PRXA 3O76A 2HT9A 1FOVA 20GSA 4IJ3A 3RHCA 4JBBA 1XZOA 1FAAA 3C73A 3IHGA 4LL4B 2C3NA 5J9CA 1G6YA 1TI1A 1WMJA 2HSHA 4GQFA 1OYJA 1THOA 2B7KA 3MDKA 4AJ7A 4BPYA 3IK9A 2JSZA 1THXA 2H72A 1NHYA 4I2TA 3L9VA 2HNLA 3GMFA 2LRTA 2R0GA 2H1BA 1A2MA 5EPFA 3H79A 1SENA 2PMTA 4JU5A 2F9SA 17GSA 5H5QA 1V58A 1SJ6A 1NW2A 3S9FA 1PL1A 2H70A 5ECOB 2F8AA 3BCKA 2IN3A 1FOHA 4IVFA 1JZRA 4G0KA 5ECHB 2I1UA 2LJAA 2O87A 2X64A 5CYYA 2FA8A 2FWGA 2GGTA 3BCIA 2PU9C 4RUVA 1QGVA 2ZNMA 4ECCA 4V2NA 3AY8A 5J4UA 4YQUA 1QUWA 2DIYA 2H6ZA 4K7NA 4MJAA 4V2LA 5AGYA 1PN9A 4NHWA 3UARA 4KW6A 1YKAA 2ZCTA 1EWXA 3GKXA 4K1FA 3GFKA 2B5XA 1WOUA 3UJ1A 3MIXA 4IJIA 5A4VA 2K8SA 5CRGA 4OMVA 3DD3A 4FYUA 5CNWA 2DC5A 3I69A 3KTLA 5E4WA 2CAQA 1F3AA 2DJ0A 2EIQA 3HD5A 4E8EA 2HLSA 3E3EA 3MWHA 5AISA 3C71A 2IPAA 1ILOA 1B9YC 2O89A 4P3YB 5FT3A 1EGRA 2NTOA 1XVWA 3GIXA 3ISOA 2H30A 3CTFA 1VGLA 2GSRA 1PX7A 3G9BA 1S3DA 3TKRA 4RI6A 4IN0A 1K3YA 1K0CA 1ERTA 3KM6A 1M7TA 1EV9A 2C0GA 2HZEB 5KN3A 2IJYA 2K9FA 1TRWA 4EIQA 2YP6A 3LXTA 4XCSA 1OC3A 4J56E 3E9JB 3ZYWA 5HR3A 2HZEA 2LJRA 4PNFA 1YDKA 1SKRB 4OFMA 4ZL7A 1B4QA 3TGZA 2R0PA 5CRWA 4BA7A 1M3IA 4YAPA 1UA5A 3HZ4A 2B6MA 1WJKA 1XCCA 1A8YA 3VWWA 3MYDA 2WJUA 4RQXA 4ECJA 5BMUA 5L71A 2H19A 1IYHA 6GSSA 4HQSA 1Z7RA 1ZYPA 5LCZA 3GSSA 2FHEA 4KF9A 3ME7A 3R3EA 3ZMKA 2MMZA 3M9JA 2HXKA 1SKWB 2Z9SA 3L9SA 5ECRB 2MBTA 2XPEA 5ECQB 3KP8A 4EF0A 1FB0A 4KSMA 3TOUA 5ECKB 2DJKA 1CQGA 2G2QA 2JADA 2C3TA 3Q74A 2E0QA 3PPUA 5IMZA 2LV3A 3UIWA 3GKNA 4IW9A 5D9TA 5DQYA 5DQSA 2LTKA 1O85A 1OC9B 3APSA 4MLYA 4O7HA 5D93A 1SK1A 2YCDA 1EOHA 2MMNA 5DJLA 2GSSA 3HA9A 3TJFA 1OE8A 4BL7B 2K8VA 4G2EA 4ZB8A 3IPZA 5H5SA 1WPIA 5FWGA 1OC9A 3WGEA 2IMEA 2CVBA 5J3RA 3O3TA 2VCZA 4BL7A 11GSA 3KZQA 4JE1A 5CRHA 3FHKA 4EVMA 1ZMAA 2OE3A 3UVTA 4FYBA 2XBIA 1XG8A 4POBA 4HJ2A 2C0DA 2XBQA 2BJXA 2JL4A 2CT6A 4PGTA 2H71A 4DEJA 1SJZA 1GLQA 1K3OA 1WE0A 4KGIA 1PN0A 1YQ1A 1XW6A 2RUEA 3IC8A 2KHPA 3QFAC 4XIHA 1GSEA 3ZIJA 1X5EA 2FY6A 5G31A 3H93A 4EIPA 4TXOB 2DBCA 1MTCA 5IIZA 5AIXA 1Q98A 1UC7A 2L6CA 4HS1A 4MZWA 3C7MA 5HR0A 1X9MB 3HDCA 2MBSA 2YV9A 2GZPA 4TXOA 3WD6A 3CSIA 1T3BA 1I9DA 3WT2A 1I5GA 4A5PA 4ISDA 4FIWA 3N5OA 2GSQA 4IELA 4K2DA 3H8QA 3F8UA 3ZLPA 1PX6A 2A4HA 3ERGA 3D6IA 2GLRA 2HRKA 4KX4A 1NHOA 5GZZB 2H01A 5LD0A 1XW9A 2YV7A 4WF5A 1OAZA 2DMLA 1G7OA 5EL8A 4HUAA 3TJGA 3G7YA 2B7JA 2HSMA 4E8HA 3EINA 1U88A 4YKGA 4K2XA 1GNEA 1A23A 3W6GA 1OKTA 1XWBA 5IOXA 4JZQA 3DVWA 1GH2A 3GSTA 3TCOA 2YZHA 1A24A 3CRUA 4GXZA 1XW5A 2C4JA 2MZCA 3A5WA 1GTUA 2GQKA 5G1KA 6GSTA 1LU4A 3UOMA 1MD3A 2DJ2A 2OKAA 2XHFA 3L0HA 1SK2A 1YEXA 1Z6MA 1GTIA 5ELGA 3VFIA 2JZTA 5CREA 5EVOA 1M2BA 5LNKe 1Y6EA 3ZVJA 4Q5RA 3TDGA 2PWJA 5ID2B 4J2FA 1SKSB 2GZYA 5HFIA 1GUKA 2L59A 4MABA 2IMFA 1VF4A 2X8CA 3VWUA 5ID2A 4Z7XA 4N11A 3IXRA 2FWEA 3C8EA 2DJ1A 3BD2A 5KOWA 3HVVA 1O81A 1J08A 1U3IA 1EV4A 2LSTA 5D9WA 3VURA 2CVDA 4EDZA 3WGDA 3CYNA 2PGTA 5JCWA 1C72A 2YZUA 1ST9A 2AAWA 4USSA 5CP1A 2X8GA 2OE0A 3FW2A 4NHZA 3TKSE 1V40A 4F9ZA 2NDOA 7GSSA 3F4RA 3D4TA 2L5OA 2WCIA 3HJOA 1GSQA 1K0NA 1OKDA 4ILFA 2A2RA 1PGTA 1ERWA 4PURA 2KP2A 2ES7A 1R7HA 5JWRB 2KOKA 2JU5A 1SYXA 1H4OA 1VRSD 1HNCA 4AJ8A 4JRRA 3EPTA 3HVNA 3FR6A 1E2YA 2R0CA 5ENUA 1YKCA 3A2XA 4TVEA 3F9UA 4F03A 2C8UA 3VPTA 2FNOA 3HVSA 5GSSA 4ICYA 2REMA 5BRTA 1TU7A 1VF3A 1JLWA 1O6JA 5F0GA 2LQOA 2J9HA 3RBTA 2OBIA 3LEFA 5DJMA 2M80A 4I2UA 1K0BA 3ED3A 4CDOA 3EU4A 3BOAA 3HCZA 2GZZA 2TRCP 3PH9A 6GSWA 4XTSA 3VWXA 2DMMA 2LUSA 1BG5A 4PQIA 5IMCA 5ELAA 3GH6A 1FHEA 3VI5A 3EU3A 4HSCX 1A0RP 3LORA 3M3MA 1AW9A 1SYRA 2R6KA 4K5RA 3HY2A 5IQYA 1AIUA 1BQ7A 4MNNA 1TP9A 3W8SA 4KCEA 3RPNA 5ECLB 3GYKA 2XC2A 2VD1A 2P5RA 4QQ7A 5H5RA 2LQQA 2L57A 3LJRA 2TIRA 13GSA 4NWYA 4JEDA 1GSSA 2V32A 5J41A 5C04A 4MJEA 5A4UA 2CAIA 2C80A 4Z2RA 2RM6A 4XS4B 3A3TA 4WETA 3GNJA 2JZSA 2H66A 5J9BA 4GTUA 4HEA2 2D2ZA 4HZ2A 1BYEA 3KIJA 4KSOA 1X5CA 1R26A 3D22A 1DE2A 3F3QA 3I9V2 1YF0A 4XS4A 3DEXA 2R4VA 4MF5A 1A8LA 3KH7A 1JHBA 1AQXA 1TU8A 3PGTA 1VF2A 4O5RA 2MYGA 5DCHA 1V2AA 4BIKA 2O85A 3EVIA 1A2LA 3QOUA 1DSBA 1Z7PA 4GSTA 3K8NA 4TR4A 4GRFA 3GURA 2YJHA 2CZ3A 3V1WA 1EOGA 1GUMA 3KD0A 1A0FA 1XWAA 5D73A 3APOA 1TK0B 1G7EA 5CAXA 2OJLA 4IKHA 2P0GA 1T00A 2VL3A 2FWFA 2N5BA 1HNAA 1LJRA 1QXHA 5GAPD 2WDUA 1LBKA 2VM2A 4F0CA 2WGRA 4O5UA 3QR6A 5ECPB 2V6OA 4NPBA 4RQRA 1ACVA 1K3LA 4ZIJA 5CRDA 1DBYA 4OCEA 4JR6A 2O7KA 2TRXA 3SWLA 1GSYA 2YWMA 5IM9A 2H0IA 3O6TA 2OADA 4K8MA 2QA2A 3DRNA 1BEDA 2H1DA 3UBKA 1XOAA 5F07A 5G1LA 2DSAA 4ULXA 4GCIA 3EC3A 3I43A 1PSQA 4FH8A 3GHAA 1J0FA 3D0ZA 3GTUB 2GS3A 3KCMA 4AGSA 2UZ8A 2CA8A 2AUVA 4BWQA 2VCWA 2H75A 1V9WA 3GTUA 2HRFA 1GP1A 2YPMA 19GSA 2DJJA 2I3YA 3VPQA 4DSQA 1SL2B 2P5QA 1TW9A 2LNSA 2MMOA 2WFCA 2FCHA 3IR4A 4PUAA 3HZ8A 3P7XA 5JWQB 1NSWA 3IAS2 1R4WA 2DKHA 1GTAA 1SD8A 2NPBA 1JZWA 5A5KA 3GX8A 3GKMA 3TRPA 2VLTA 2AYTA 3TKSC 5D9XA 2AJQB 2QA1A 1SJIA 3M8NA 2A2PA 1ZL9A 3QD9A 4QL7A 3P2AA 1EP8A 5EY6A 2C3QA 3HVXA 4TR0A 4ML6A 2IMKA 3GL5A 5JCGA 4NXIA 1Z5YE 3JCML 3CTGA 4GSNA 1AC1A 1TRUA 1XXUA 4Q5QA 4POLA 4K9ZA 4FYCA 5IMAA 2PBJA 4ZBBA 3FZ9A 4WKWA 3IOSA 1U6TA 2A2SA 1OC8A 3ERFA 2VO4A 4ZBAA 5HQPA 2AHEA 3M1GA 3IHQA 3GV1A 3U6VA 3FK8A 4GF0A 2F8FA 4BVXB 3HKRA 2ON7A 4X1UA 4ACSA 1SD9A 1PD21 1ERUA 2VL2C 4L5LA 3ERWA 3IC4A 3RPPA
chains in the Genus database with same CATH topology
2V41A 4POKA 1GUHA 5F06A 4TXVA 1X9SB 4BVXA 2BTOT 6GSUA 4XS1A 4O32A 1O7UA 3H4KA 2RLIA 2YWNA 4WXTA 3UBLA 1N2AA 3D5JA 2QC7A 2JSYA 2V2GA 3DMLA 18GSA 4OWYA 1S3AA 2F51A 2PUKC 3KH9A 1DE1A 3FY7A 4TR3A 2B5EA 1TXXA 1GLPA 3GH9A 2LJKA 3RHBA 4KNDA 2VUPA 1UVZA 2BMXA 3BBYA 4X43A 3NOFA 3QAGA 5A4WA 4PQ1A 4ID0A 2K6VA 2VCVA 4RI7A 4K0NA 4MA9A 3A5IA 4I8BA 1YJ6A 3KGKA 2L4QA 9GSSA 1PA3A 4YQVA 3GUSA 1R5AA 4MZBA 1F37A 4CHSA 3SBCA 2ALBA 3KEBA 1CQHA 1EEJA 4H86A 3M9KA 3WGXA 4ZILA 4TW5A 4LLRA 3US3A 2VL9A 1M9AA 2HFDA 2RIIA 3FKFA 4YH2A 4N0ZA 4ZBDA 1F6MC 1F3BA 1Z3EA 4IP6A 1K0MA 3UL3A 4KA0A 3CRTA 1YEPA 4MDCA 4TRXA 4OO5A 1XWCA 1ON4A 5IO0A 1GWCA 1OVNA 2HSYA 4ECBA 1M0UA 5B8AA 1SK0A 2R37A 4K7OA 4Q5FA 4K0GA 2EIRA 2DLXA 4IQ1A 4EXJA 1MDJA 1QK8A 3EMXA 4V1Ap 2FWHA 4PX1A 3APQA 4X4JA 5AIVA 1ZYQB 3TKPA 5DDLA 1O8WA 2VL2A 2CX3A 3ZTLA 2GQLA 5DBQA 4MP4A 5D8IA 3ZREA 3ZIVA 4IQAA 1FG4A 3J7Yb 1T4YA 5KEJA 1W4VA 1F9MA 2RUFA 1RQMA 2ON5A 4JR4A 4XS6A 2IIYA 2L4CA 3L9UA 4L0UA 4Q5NA 4WR5A 5HFKA 5GAND 4L5OA 3RAZA 3ZZXA 14GSA 2EC4A 3FZ5A 2HYXA 4PTSA 1ZYEA 4F0BA 4GSSA 4HZ4A 3H1NA 4V2MA 1M2DA 4IGJA 2H74A 1Q4JA 3HHVA 2J23A 1PKWA 16GSA 3TRQA 3CBUA 2FA4A 3TJJA 1U3AA 1QFNA 4X0XA 1VF1A 3D4MA 5G30A 2YJ7A 2GT5A 3ME8A 1GRXA 4EKZA 2GVPA 5FHIA 2C0FA 1SU9A 3GA4A 1IYIA 1X0RA 1GNWA 3LW9A 4LMWA 2EIOA 1Z6NA 1A2JA 1XVQA 4TN8A 1X5DA 2WRTA 4YQMA 3E0UA 2R2JA 1FB6A 5D9VA 4EL1A 5B6MA 3IAM2 1PQNA 2YN1A 4IS0A 3IDVA 4OO4A 1RK4A 3TUEA 3MSZA 2G0FA 2N5FA 4POMA 3L4NA 3GN3A 2AV4A 4IBPA 2PVQA 1K0AA 1ZYNA 2YOIA 3LSZA 3VLNA 3WT1A 1R5PA 3NIVA 2IFQB 1YF1A 3VI7A 2M72A 1HQOA 3C1RA 1BJXA 2QSIA 1XBSA 2GQMA 2IFQA 2YNXA 5ABRA 2CX4A 2K18A 3KJYA 4OCFA 2H73A 5B8BA 1KNGA 3Q18A 4MPFA 1JZDA 2HRAA 4KUNA 3EE2A 3G7JA 5KOXA 4PQHA 2FD3A 4K7IA 1NM3A 2LEGA 2H1AA 1KTEA 4WBRD 5KN0A 2VCTA 2B5YA 2VCXA 3EYTA 3FR3A 3KMNA 2FLSA 1HNBA 1URMA 2OE1A 2OBKA 5IPGA 1K0DA 4OD7A 1KBNA 3UVHA 4HU7A 3WYWA 1MEKA 2YANA 3R2QA 6GSXA 1TK8B 4KE3A 4YKFA 1YY7A 5G5EA 2HI7A 3QDNA 4ZL9A 1FVKA 2M46A 1SL0B 3F4SA 1GTBA 3F63A 5G5FA 4WR4A 4LL1B 4NV2A 3ZVJD 3EMPA 3CMIA 4G0LA 4HOJA 1Y25A 2CVKA 1GSDA 2VOCA 4WEYA 4EDYA 2F3MA 1TDIA 3I6AA 3ZFLA 4G10A 2H0GA 2YWOA 2GT6A 1O73A 1WWJA 4MPGA 6GSYA 6GSVA 4PXOA 1PKZA 3LFLA 3KTBA 3HXSA 2OA7A 4K6XA 5HFGA 2I4AA 1MD4A 1GL8A 4ZXGA 2I81A 3EURA 3Q6OA 4G0IA 3TKQA 1AQVA 1WP0A 4PNGA 4EUYA 1M99A 2IMIA 1FO5A 1HYUA 2VCQA 3LQ7A 2IMDA 3BJ5A 3DKSA 5ECNB 4QL9A 1ERVA 4MMMA 3Q19A 3KMOA 3EWLA 2JACA 5JWOB 2JZRA 3FZAA 4AJ6A 4OFNA 3KP9A 3DGQA 2YWIA 1TI3A 2H76A 5DVBA 3TJKA 4LA1A 2QGVA 5E59A 3CSJA 22GSA 2LNTA 2CQ9A 1SL1B 1EEMA 2CV4A 3LGCA 2B3SA 2H6XA 4MH2A 4GLTA 4G9HA 2LRNA 5IOWA 2VLUA 3HJMA 2E2GA 2R3XA 1EZKA 3GL3A 4NV5A 3P8WA 2GDRA 2VAFA 1BX9A 4G19A 4MZCA 2RM5A 5J5NA 4TOPA 4KAEA 4K5SA 4I6XA 4Z2TA 3IRAA 4KCAA 4KDYA 4YAVA 3KXOA 4AF2A 3DYRA 4BWSA 3F0IA 2NBSA 1ZCPA 8GSSA 1PMTA 1B9XC 4DSSB 5ECMB 1UN2A 5G2ZA 3HYPA 5DALB 3QAWA 1ZOFA 3M0FA 3IK7A 4EE0A 5HR2A 5CO3A 4MF7A 1G0TA 1FVJA 1O8XA 3UEMA 3QFBC 4DSSA 1F2EA 2HRNA 5DALA 4ZB9A 1FW1A 3TRXA 2C0EA 2N5AA 3W8JA 3LYKA 1G6WA 2XPDA 3FYGA 4KH7A 4OFTA 1MDKA 2B1KA 4CY6A 3QCPA 5GSTA 1T4ZA 1S3CA 3FRCA 3GKKA 5C00A 3CXGA 2QKEA 2WB9A 5DCGA 2B1LA 3TOTA 2O8VB 3D21A 4O92A 5COHA 1GSUA 2X4AA 1TRSA 2E7PA 1GSFA 3J7Yk 4MJBA 4MJCA 1AQWA 4XRDA 3FZ4A 2A4VA 1B8XA 1WRYA 2WS2A 3IE3A 12GSA 2KLXA 3LG6A 3UAPA 2H0HA 5IPHA 4ZL8A 1QMVA 4XHMA 3VK9A 2VIMA 2AB6A 3L78A 2X49A 4N30A 3DWVA 4F82A 1ABAA 5IMDA 2P31A 2DKIA 2L5LA 1TOFA 3P90A 3QMXA 2L6DA 4BVYB 5HR1A 3FMWA 1MDIA 1TKDB 1XWKA 1Z9HA 4PUFC 1USBA 3CSHA 3LXZA 4ZB6A 4MH3A 5ECIB 2NVLA 4BVYA 3F6FA 5INYA 2H6YA 1JLVA 3OR5A 5KN2A 3ZMLA 4I97A 4J57E 3ZFBA 4CW9A 2FUG2 4EO3A 3MAKA 3ZITA 2GTUA 2OACA 2PPTA 3TKSA 2IWTA 4IHUA 3G7IA 4GQCA 4WBJA 2HZFA 3FR9A 3F3RA 4KDUA 4L8EA 1X9WB 1RW1A 3QPMA 1BAYA 3FEUA 4O5QA 1ML6A 1XPVA 4DSRA 4MF6A 3TJBA 4HI7A 1YZXA 2X8HA 5D96A 3RDWA 1EP7A 3GRXA 3QAVA 1J9BA 1XWGA 4MK3A 3LYPA 2FGXA 5IO2A 3IV4A 3DVXA 4I5QA 3NZNA 2PVOC 4F2IA 1KEBA 4N0VA 2LRCA 4EC0A 2E2MA 3F4TA 3UMAA 2H1GA 1M2AA 1QQ2A 3HJPA 4FO5A 4HDEA 1K0OA 1ZZYA 3DIEA 4ML1A 1U87A 2DIZA 2VLVA 3PINA 4V1Ag 1V57A 2KP1A 4D73B 2V6KA 5IMVA 2VD0A 1TJDA 2LS5A 4HU9A 3A2WA 1TTZA 3VWVA 4TKYA 5IMFA 1H75A 1EGOA 5KN1A 5F05A 4D73A 4MCUA 2MMAA 1M9BA 4L0WA 1GULA 1TK5B 1AAZA 2R5GA 2PERA 2C1YA 3LWAA 4FQUA 4GWRA 4Z2UA 1W89A 3DXBA 10GSA 1E6BA 1JFUA 2H8LA 1N8JA 2WULA 2V1MA 4WF4A 3A2VA 3C1SA 3N9JA 1AXDA 2X99A 1TRVA 1XOBA 4KB3A 4HJMA 3TB2A 1ZGNA 1PL2A 3U5RE 4TR1B 2IL3A 4DVCA 1WIKA 2VM1A 4IP1A 2CZ2A 4HQZA 4LMVA 3ZRDA 3ZL5A 2GSTA 4KDXA 3IBHA 4ECIA 4TR1A 1JZOA 5JCUA 3MNGA 2PN8A 1V98A 1B4PA 2HE3A 1T7PB 5F8BA 1XFLA 4XRAA 2ZUPA 1HD2A 2KUCA 4NMUA 1XIYA 3IA1A 5DAKB 5AN1A 1OE7A 1B48A 5B7CA 3GX0A 1T8EB 4CY8A 4N10A 5B6NA 1T1VA 3PR8A 2LKUA 2WZ9A 5DAKA 2DJ3A 1DUGA 4NAXA 1AUCA 2I9HA 3F6DA 5ECSA 1PRXA 3O76A 2HT9A 1FOVA 20GSA 4IJ3A 3RHCA 4JBBA 1XZOA 1FAAA 3C73A 3IHGA 4LL4B 2C3NA 5J9CA 1G6YA 1TI1A 1WMJA 2HSHA 4GQFA 1OYJA 1THOA 2B7KA 3MDKA 4AJ7A 4BPYA 3IK9A 2JSZA 1THXA 2H72A 1NHYA 4I2TA 3L9VA 2HNLA 3GMFA 2LRTA 2R0GA 2H1BA 1A2MA 5EPFA 3H79A 1SENA 2PMTA 4JU5A 2F9SA 17GSA 5H5QA 1V58A 1SJ6A 1NW2A 3S9FA 1PL1A 2H70A 5ECOB 2F8AA 3BCKA 2IN3A 1FOHA 4IVFA 1JZRA 4G0KA 5ECHB 2I1UA 2LJAA 2O87A 2X64A 5CYYA 2FA8A 2FWGA 2GGTA 3BCIA 2PU9C 4RUVA 1QGVA 2ZNMA 4ECCA 4V2NA 3AY8A 5J4UA 4YQUA 1QUWA 2DIYA 2H6ZA 4K7NA 4MJAA 4V2LA 5AGYA 1PN9A 4NHWA 3UARA 4KW6A 1YKAA 2ZCTA 1EWXA 3GKXA 4K1FA 3GFKA 2B5XA 1WOUA 3UJ1A 3MIXA 4IJIA 5A4VA 2K8SA 5CRGA 4OMVA 3DD3A 4FYUA 5CNWA 2DC5A 3I69A 3KTLA 5E4WA 2CAQA 1F3AA 2DJ0A 2EIQA 3HD5A 4E8EA 2HLSA 3E3EA 3MWHA 5AISA 3C71A 2IPAA 1ILOA 1B9YC 2O89A 4P3YB 5FT3A 1EGRA 2NTOA 1XVWA 3GIXA 3ISOA 2H30A 3CTFA 1VGLA 2GSRA 1PX7A 3G9BA 1S3DA 3TKRA 4RI6A 4IN0A 1K3YA 1K0CA 1ERTA 3KM6A 1M7TA 1EV9A 2C0GA 2HZEB 5KN3A 2IJYA 2K9FA 1TRWA 4EIQA 2YP6A 3LXTA 4XCSA 1OC3A 4J56E 3E9JB 3ZYWA 5HR3A 2HZEA 2LJRA 4PNFA 1YDKA 1SKRB 4OFMA 4ZL7A 1B4QA 3TGZA 2R0PA 5CRWA 4BA7A 4YAPA 1UA5A 3HZ4A 2B6MA 1WJKA 1XCCA 1A8YA 3VWWA 3MYDA 2WJUA 4RQXA 4ECJA 5BMUA 5L71A 2H19A 1IYHA 6GSSA 4HQSA 1Z7RA 1ZYPA 5LCZA 3GSSA 2FHEA 4KF9A 3ME7A 3R3EA 3ZMKA 2MMZA 3M9JA 2HXKA 1SKWB 2Z9SA 3L9SA 5ECRB 2MBTA 2XPEA 5ECQB 3KP8A 4EF0A 1FB0A 4KSMA 3TOUA 5ECKB 2DJKA 1CQGA 2G2QA 2JADA 2C3TA 3Q74A 2E0QA 3PPUA 5IMZA 2LV3A 3UIWA 3GKNA 4IW9A 5D9TA 5DQYA 5DQSA 2LTKA 1O85A 1OC9B 3APSA 4MLYA 4O7HA 5D93A 1SK1A 2YCDA 1EOHA 2MMNA 5DJLA 2GSSA 3HA9A 3TJFA 1OE8A 4BL7B 2K8VA 4G2EA 4ZB8A 3IPZA 5H5SA 1WPIA 5FWGA 1OC9A 3WGEA 2IMEA 2CVBA 5J3RA 3O3TA 2VCZA 4BL7A 11GSA 3KZQA 4JE1A 5CRHA 3FHKA 4EVMA 1ZMAA 2OE3A 3UVTA 4FYBA 2XBIA 4POBA 4HJ2A 2C0DA 2XBQA 2BJXA 2JL4A 2CT6A 4PGTA 2H71A 4DEJA 1SJZA 1GLQA 1K3OA 1WE0A 4KGIA 1PN0A 1YQ1A 1XW6A 2RUEA 3IC8A 2KHPA 3QFAC 4XIHA 1GSEA 3ZIJA 1X5EA 2FY6A 5G31A 3H93A 4EIPA 4TXOB 2DBCA 1MTCA 5IIZA 5AIXA 1Q98A 1UC7A 2L6CA 4HS1A 4MZWA 3C7MA 5HR0A 1X9MB 3HDCA 2MBSA 2YV9A 2GZPA 4TXOA 3WD6A 3CSIA 1T3BA 1I9DA 3WT2A 1I5GA 4A5PA 4ISDA 4FIWA 3N5OA 2GSQA 4IELA 4K2DA 3H8QA 3F8UA 3ZLPA 1PX6A 2A4HA 3ERGA 3D6IA 2GLRA 2HRKA 4KX4A 1NHOA 5GZZB 2H01A 5LD0A 1XW9A 2YV7A 4WF5A 1OAZA 2DMLA 1G7OA 5EL8A 4HUAA 3TJGA 3G7YA 2B7JA 2HSMA 4E8HA 3EINA 1U88A 4YKGA 4K2XA 1GNEA 1A23A 3W6GA 1OKTA 1XWBA 5IOXA 4JZQA 3DVWA 1GH2A 3GSTA 3TCOA 2YZHA 1A24A 3CRUA 4GXZA 1XW5A 2C4JA 2MZCA 3A5WA 1GTUA 2GQKA 5G1KA 6GSTA 1LU4A 3UOMA 1MD3A 2DJ2A 2OKAA 2XHFA 3L0HA 1SK2A 1YEXA 1Z6MA 1GTIA 5ELGA 3VFIA 2JZTA 5CREA 5EVOA 1M2BA 5LNKe 1Y6EA 3ZVJA 4Q5RA 3TDGA 2PWJA 5ID2B 4J2FA 1SKSB 2GZYA 5HFIA 1GUKA 2L59A 4MABA 2IMFA 1VF4A 2X8CA 3VWUA 5ID2A 4Z7XA 4N11A 3IXRA 2FWEA 3C8EA 2DJ1A 3BD2A 5KOWA 3HVVA 1O81A 1J08A 1U3IA 1EV4A 2LSTA 5D9WA 3VURA 2CVDA 4EDZA 3WGDA 3CYNA 2PGTA 5JCWA 1C72A 2YZUA 1ST9A 2AAWA 4USSA 5CP1A 2X8GA 2OE0A 3FW2A 4NHZA 3TKSE 1V40A 4F9ZA 2NDOA 7GSSA 3F4RA 3D4TA 2L5OA 2WCIA 3HJOA 1GSQA 1K0NA 1OKDA 4ILFA 2A2RA 1PGTA 1ERWA 4PURA 2KP2A 2ES7A 1R7HA 5JWRB 2KOKA 2JU5A 1SYXA 1H4OA 1VRSD 1HNCA 4AJ8A 4JRRA 3EPTA 3FR6A 1E2YA 2R0CA 5ENUA 1YKCA 3A2XA 4TVEA 3F9UA 4F03A 2C8UA 3VPTA 2FNOA 3HVSA 5GSSA 4ICYA 2REMA 5BRTA 1TU7A 1VF3A 1JLWA 1O6JA 5F0GA 2LQOA 2J9HA 3RBTA 2OBIA 3LEFA 5DJMA 2M80A 4I2UA 1K0BA 3ED3A 4CDOA 3EU4A 3BOAA 3HCZA 2GZZA 2TRCP 3PH9A 6GSWA 4XTSA 3VWXA 2DMMA 2LUSA 1BG5A 4PQIA 5IMCA 5ELAA 3GH6A 1FHEA 3VI5A 3EU3A 1A0RP 3LORA 3M3MA 1AW9A 1SYRA 2R6KA 4K5RA 3HY2A 5IQYA 1AIUA 1BQ7A 4MNNA 1TP9A 3W8SA 4KCEA 3RPNA 5ECLB 3GYKA 2XC2A 2VD1A 2P5RA 4QQ7A 5H5RA 2LQQA 2L57A 3LJRA 2TIRA 13GSA 4NWYA 4JEDA 1GSSA 2V32A 5J41A 5C04A 4MJEA 5A4UA 2CAIA 2C80A 4Z2RA 2RM6A 4XS4B 3A3TA 4WETA 3GNJA 2JZSA 2H66A 5J9BA 4GTUA 4HEA2 2D2ZA 4HZ2A 1BYEA 3KIJA 4KSOA 1X5CA 1R26A 3D22A 1DE2A 3F3QA 3I9V2 1YF0A 4XS4A 3DEXA 2R4VA 4MF5A 1A8LA 3KH7A 1JHBA 1AQXA 1TU8A 3PGTA 1VF2A 4O5RA 2MYGA 5DCHA 1V2AA 2O85A 3EVIA 1A2LA 3QOUA 1DSBA 1Z7PA 4GSTA 3K8NA 4TR4A 4GRFA 3GURA 2YJHA 2CZ3A 3V1WA 1EOGA 1GUMA 3KD0A 1A0FA 1XWAA 5D73A 3APOA 1TK0B 1G7EA 5CAXA 2OJLA 4IKHA 2P0GA 1T00A 2VL3A 2FWFA 2N5BA 1HNAA 1LJRA 1QXHA 5GAPD 2WDUA 1LBKA 2VM2A 4F0CA 2WGRA 4O5UA 3QR6A 5ECPB 2V6OA 4NPBA 4RQRA 1ACVA 1K3LA 4ZIJA 5CRDA 1DBYA 4OCEA 4JR6A 2O7KA 2TRXA 3SWLA 1GSYA 2YWMA 5IM9A 2H0IA 3O6TA 2OADA 4K8MA 2QA2A 3DRNA 1BEDA 2H1DA 3UBKA 1XOAA 5F07A 5G1LA 2DSAA 4ULXA 4GCIA 3EC3A 3I43A 1PSQA 4FH8A 3GHAA 1J0FA 3D0ZA 3GTUB 2GS3A 3KCMA 4AGSA 2UZ8A 2CA8A 2AUVA 4BWQA 2VCWA 2H75A 1V9WA 3GTUA 2HRFA 1GP1A 2YPMA 19GSA 2DJJA 2I3YA 3VPQA 4DSQA 1SL2B 2P5QA 1TW9A 2LNSA 2MMOA 2WFCA 2FCHA 3IR4A 4PUAA 3HZ8A 3P7XA 5JWQB 1NSWA 3IAS2 1R4WA 2DKHA 1GTAA 1SD8A 2NPBA 1JZWA 5A5KA 3GX8A 3GKMA 3TRPA 2VLTA 2AYTA 3TKSC 5D9XA 2AJQB 2QA1A 1SJIA 3M8NA 2A2PA 1ZL9A 3QD9A 4QL7A 3P2AA 1EP8A 5EY6A 2C3QA 3HVXA 4TR0A 4ML6A 2IMKA 3GL5A 5JCGA 4NXIA 1Z5YE 3JCML 3CTGA 4GSNA 1AC1A 1TRUA 1XXUA 4Q5QA 4POLA 4K9ZA 4FYCA 5IMAA 2PBJA 4ZBBA 3FZ9A 4WKWA 3IOSA 1U6TA 2A2SA 1OC8A 3ERFA 2VO4A 4ZBAA 5HQPA 2AHEA 3M1GA 3IHQA 3GV1A 3U6VA 3FK8A 4GF0A 2F8FA 4BVXB 3HKRA 2ON7A 4X1UA 4ACSA 1SD9A 1PD21 1ERUA 2VL2C 4L5LA 3ERWA 3IC4A 3RPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V41 A;  4POK A;  1GUH A;  5F06 A;  4TXV A;  1X9S B;  4BVX A;  2BTO T;  6GSU A;  4XS1 A;  4O32 A;  1O7U A;  3H4K A;  2RLI A;  2YWN A;  4WXT A;  3UBL A;  1N2A A;  3D5J A;  2QC7 A;  2JSY A;  2V2G A;  3DML A;  18GS A;  4OWY A;  1S3A A;  2F51 A;  2PUK C;  3KH9 A;  1DE1 A;  3FY7 A;  4TR3 A;  2B5E A;  1TXX A;  1GLP A;  3GH9 A;  2LJK A;  3RHB A;  4KND A;  2VUP A;  1UVZ A;  2BMX A;  3BBY A;  4X43 A;  3NOF A;  3QAG A;  5A4W A;  4PQ1 A;  4ID0 A;  2K6V A;  2VCV A;  4RI7 A;  4K0N A;  4MA9 A;  4I8B A;  1YJ6 A;  3KGK A;  2L4Q A;  9GSS A;  1PA3 A;  4YQV A;  3GUS A;  1R5A A;  4MZB A;  1F37 A;  4CHS A;  3SBC A;  2ALB A;  3KEB A;  1CQH A;  1EEJ A;  4H86 A;  3M9K A;  3WGX A;  4ZIL A;  4TW5 A;  4LLR A;  3US3 A;  2VL9 A;  1M9A A;  2HFD A;  2RII A;  3FKF A;  4YH2 A;  4N0Z A;  4ZBD A;  1F6M C;  1F3B A;  1Z3E A;  4IP6 A;  1K0M A;  3UL3 A;  4KA0 A;  3CRT A;  1YEP A;  4MDC A;  4TRX A;  4OO5 A;  1XWC A;  1ON4 A;  5IO0 A;  1GWC A;  1OVN A;  2HSY A;  4ECB A;  1M0U A;  5B8A A;  1SK0 A;  2R37 A;  4K7O A;  4Q5F A;  4K0G A;  2EIR A;  2DLX A;  4IQ1 A;  4EXJ A;  1MDJ A;  1QK8 A;  3EMX A;  4V1A p;  2FWH A;  4PX1 A;  3APQ A;  5AIV A;  1ZYQ B;  3TKP A;  5DDL A;  1O8W A;  2VL2 A;  2CX3 A;  3ZTL A;  2GQL A;  5DBQ A;  4MP4 A;  5D8I A;  3ZRE A;  3ZIV A;  4IQA A;  1FG4 A;  3J7Y b;  1T4Y A;  5KEJ A;  1W4V A;  1F9M A;  2RUF A;  1RQM A;  2ON5 A;  4JR4 A;  4XS6 A;  2IIY A;  2L4C A;  3L9U A;  4L0U A;  4Q5N A;  4WR5 A;  5HFK A;  5GAN D;  4L5O A;  3RAZ A;  3ZZX A;  14GS A;  2EC4 A;  3FZ5 A;  2HYX A;  1ZYE A;  4F0B A;  4GSS A;  4HZ4 A;  3H1N A;  4V2M A;  1M2D A;  4IGJ A;  2H74 A;  1Q4J A;  3HHV A;  2J23 A;  1PKW A;  16GS A;  3TRQ A;  3CBU A;  2FA4 A;  3TJJ A;  1U3A A;  1QFN A;  4X0X A;  1VF1 A;  3D4M A;  5G30 A;  2YJ7 A;  2GT5 A;  3ME8 A;  1GRX A;  4EKZ A;  2GVP A;  5FHI A;  2C0F A;  1SU9 A;  3GA4 A;  1IYI A;  1X0R A;  1GNW A;  4LMW A;  2EIO A;  1Z6N A;  1A2J A;  1XVQ A;  4TN8 A;  1X5D A;  2WRT A;  4YQM A;  3E0U A;  2R2J A;  1FB6 A;  5D9V A;  4EL1 A;  5B6M A;  3IAM 2;  1PQN A;  2YN1 A;  4IS0 A;  3IDV A;  4OO4 A;  1RK4 A;  3TUE A;  3MSZ A;  2G0F A;  2N5F A;  4POM A;  3L4N A;  3GN3 A;  2AV4 A;  4IBP A;  2PVQ A;  1K0A A;  2YOI A;  3LSZ A;  3VLN A;  3WT1 A;  1R5P A;  3NIV A;  2IFQ B;  1YF1 A;  3VI7 A;  2M72 A;  1HQO A;  3C1R A;  1BJX A;  2QSI A;  1XBS A;  2GQM A;  2IFQ A;  2YNX A;  5ABR A;  2CX4 A;  2K18 A;  3KJY A;  4OCF A;  2H73 A;  5B8B A;  1KNG A;  3Q18 A;  4MPF A;  1JZD A;  4KUN A;  3EE2 A;  3G7J A;  4PQH A;  2FD3 A;  4K7I A;  1NM3 A;  2LEG A;  2H1A A;  1KTE A;  4WBR D;  5KN0 A;  2VCT A;  2B5Y A;  2VCX A;  3EYT A;  3FR3 A;  3KMN A;  2FLS A;  1HNB A;  1URM A;  2OE1 A;  2OBK A;  5IPG A;  1K0D A;  4OD7 A;  1KBN A;  3UVH A;  4HU7 A;  3WYW A;  1MEK A;  2YAN A;  3R2Q A;  6GSX A;  1TK8 B;  4KE3 A;  1YY7 A;  5G5E A;  2HI7 A;  3QDN A;  4ZL9 A;  1FVK A;  2M46 A;  1SL0 B;  3F4S A;  1GTB A;  3F63 A;  5G5F A;  4WR4 A;  4LL1 B;  4NV2 A;  3ZVJ D;  3EMP A;  3CMI A;  4HOJ A;  1Y25 A;  2CVK A;  1GSD A;  2VOC A;  4WEY A;  4EDY A;  2F3M A;  1TDI A;  3I6A A;  3ZFL A;  4G10 A;  2H0G A;  2YWO A;  2GT6 A;  1O73 A;  1WWJ A;  4MPG A;  6GSY A;  6GSV A;  4PXO A;  1PKZ A;  3LFL A;  3KTB A;  3HXS A;  2OA7 A;  4K6X A;  5HFG A;  2I4A A;  1MD4 A;  1GL8 A;  4ZXG A;  2I81 A;  3EUR A;  3Q6O A;  3TKQ A;  1AQV A;  1WP0 A;  4PNG A;  4EUY A;  1M99 A;  2IMI A;  1FO5 A;  1HYU A;  2VCQ A;  3LQ7 A;  2IMD A;  3BJ5 A;  3DKS A;  5ECN B;  4QL9 A;  1ERV A;  4MMM A;  3Q19 A;  3KMO A;  3EWL A;  2JAC A;  5JWO B;  2JZR A;  3FZA A;  4AJ6 A;  4OFN A;  3KP9 A;  3DGQ A;  2YWI A;  1TI3 A;  2H76 A;  5DVB A;  3TJK A;  4LA1 A;  2QGV A;  5E59 A;  3CSJ A;  22GS A;  2LNT A;  2CQ9 A;  1SL1 B;  1EEM A;  2CV4 A;  3LGC A;  2B3S A;  2H6X A;  4MH2 A;  4GLT A;  4G9H A;  2LRN A;  5IOW A;  2VLU A;  3HJM A;  2E2G A;  2R3X A;  1EZK A;  3GL3 A;  4NV5 A;  3P8W A;  2GDR A;  2VAF A;  1BX9 A;  4G19 A;  4MZC A;  2RM5 A;  5J5N A;  4TOP A;  4KAE A;  4I6X A;  3IRA A;  4KCA A;  4KDY A;  4YAV A;  3KXO A;  4AF2 A;  3DYR A;  4BWS A;  3F0I A;  2NBS A;  1ZCP A;  8GSS A;  1PMT A;  1B9X C;  4DSS B;  5ECM B;  1UN2 A;  5G2Z A;  3HYP A;  5DAL B;  3QAW A;  1ZOF A;  3M0F A;  3IK7 A;  4EE0 A;  5HR2 A;  5CO3 A;  4MF7 A;  1G0T A;  1FVJ A;  1O8X A;  3UEM A;  3QFB C;  4DSS A;  1F2E A;  2HRN A;  5DAL A;  4ZB9 A;  1FW1 A;  3TRX A;  2C0E A;  2N5A A;  3W8J A;  3LYK A;  1G6W A;  2XPD A;  3FYG A;  4KH7 A;  4OFT A;  1MDK A;  2B1K A;  3QCP A;  5GST A;  1T4Z A;  1S3C A;  3FRC A;  3GKK A;  5C00 A;  3CXG A;  2QKE A;  2WB9 A;  5DCG A;  2B1L A;  3TOT A;  2O8V B;  3D21 A;  4O92 A;  5COH A;  1GSU A;  1TRS A;  2E7P A;  1GSF A;  3J7Y k;  4MJB A;  4MJC A;  1AQW A;  4XRD A;  3FZ4 A;  2A4V A;  1B8X A;  1WRY A;  2WS2 A;  3IE3 A;  12GS A;  2KLX A;  3LG6 A;  3UAP A;  2H0H A;  5IPH A;  4ZL8 A;  1QMV A;  4XHM A;  3VK9 A;  2VIM A;  2AB6 A;  3L78 A;  4N30 A;  3DWV A;  4F82 A;  1ABA A;  5IMD A;  2P31 A;  2L5L A;  1TOF A;  3P90 A;  3QMX A;  2L6D A;  5HR1 A;  1MDI A;  1TKD B;  1XWK A;  1Z9H A;  4PUF C;  1USB A;  3CSH A;  3LXZ A;  4ZB6 A;  4MH3 A;  5ECI B;  2NVL A;  4BVY A;  3F6F A;  5INY A;  2H6Y A;  1JLV A;  3OR5 A;  5KN2 A;  3ZML A;  4I97 A;  4J57 E;  3ZFB A;  4CW9 A;  2FUG 2;  4EO3 A;  3MAK A;  3ZIT A;  2GTU A;  2OAC A;  2PPT A;  3TKS A;  2IWT A;  4IHU A;  3G7I A;  4GQC A;  4WBJ A;  2HZF A;  3FR9 A;  3F3R A;  4KDU A;  4L8E A;  1X9W B;  1RW1 A;  3QPM A;  1BAY A;  3FEU A;  1ML6 A;  1XPV A;  4DSR A;  4MF6 A;  3TJB A;  4HI7 A;  1YZX A;  2X8H A;  5D96 A;  3RDW A;  1EP7 A;  3GRX A;  3QAV A;  1J9B A;  1XWG A;  4MK3 A;  3LYP A;  2FGX A;  5IO2 A;  3IV4 A;  3DVX A;  4I5Q A;  3NZN A;  2PVO C;  4F2I A;  1KEB A;  4N0V A;  2LRC A;  4EC0 A;  2E2M A;  3F4T A;  3UMA A;  2H1G A;  1M2A A;  1QQ2 A;  3HJP A;  4FO5 A;  4HDE A;  1K0O A;  1ZZY A;  3DIE A;  4ML1 A;  1U87 A;  2DIZ A;  2VLV A;  3PIN A;  4V1A g;  1V57 A;  2KP1 A;  4D73 B;  2V6K A;  5IMV A;  2VD0 A;  1TJD A;  2LS5 A;  4HU9 A;  3A2W A;  1TTZ A;  3VWV A;  4TKY A;  5IMF A;  1H75 A;  1EGO A;  5KN1 A;  5F05 A;  4D73 A;  4MCU A;  2MMA A;  1M9B A;  4L0W A;  1GUL A;  1TK5 B;  1AAZ A;  2R5G A;  2PER A;  2C1Y A;  3LWA A;  4GWR A;  1W89 A;  3DXB A;  10GS A;  1E6B A;  1JFU A;  2H8L A;  1N8J A;  2WUL A;  2V1M A;  4WF4 A;  3A2V A;  3C1S A;  3N9J A;  1AXD A;  2X99 A;  1TRV A;  1XOB A;  4KB3 A;  4HJM A;  3TB2 A;  1ZGN A;  1PL2 A;  3U5R E;  4TR1 B;  2IL3 A;  4DVC A;  1WIK A;  2VM1 A;  4IP1 A;  2CZ2 A;  4HQZ A;  4LMV A;  3ZRD A;  3ZL5 A;  2GST A;  4KDX A;  3IBH A;  4ECI A;  4TR1 A;  1JZO A;  5JCU A;  3MNG A;  2PN8 A;  1V98 A;  1B4P A;  2HE3 A;  1T7P B;  5F8B A;  1XFL A;  4XRA A;  2ZUP A;  1HD2 A;  2KUC A;  4NMU A;  1XIY A;  3IA1 A;  5DAK B;  5AN1 A;  1OE7 A;  1B48 A;  5B7C A;  3GX0 A;  1T8E B;  4N10 A;  5B6N A;  1T1V A;  3PR8 A;  2LKU A;  2WZ9 A;  5DAK A;  2DJ3 A;  1DUG A;  4NAX A;  1AUC A;  2I9H A;  3F6D A;  5ECS A;  1PRX A;  3O76 A;  2HT9 A;  1FOV A;  20GS A;  4IJ3 A;  3RHC A;  4JBB A;  1XZO A;  1FAA A;  3C73 A;  4LL4 B;  2C3N A;  5J9C A;  1G6Y A;  1TI1 A;  1WMJ A;  2HSH A;  4GQF A;  1OYJ A;  1THO A;  2B7K A;  3MDK A;  4AJ7 A;  4BPY A;  3IK9 A;  2JSZ A;  1THX A;  2H72 A;  1NHY A;  4I2T A;  3L9V A;  2HNL A;  3GMF A;  2LRT A;  2H1B A;  1A2M A;  5EPF A;  3H79 A;  1SEN A;  2PMT A;  4JU5 A;  2F9S A;  17GS A;  5H5Q A;  1V58 A;  1SJ6 A;  1NW2 A;  3S9F A;  1PL1 A;  2H70 A;  5ECO B;  2F8A A;  3BCK A;  2IN3 A;  4IVF A;  1JZR A;  5ECH B;  2I1U A;  2LJA A;  2O87 A;  2X64 A;  5CYY A;  2FA8 A;  2FWG A;  2GGT A;  3BCI A;  2PU9 C;  4RUV A;  1QGV A;  2ZNM A;  4ECC A;  4V2N A;  3AY8 A;  5J4U A;  4YQU A;  1QUW A;  2DIY A;  2H6Z A;  4K7N A;  4MJA A;  4V2L A;  5AGY A;  1PN9 A;  4NHW A;  3UAR A;  4KW6 A;  1YKA A;  2ZCT A;  1EWX A;  3GKX A;  4K1F A;  3GFK A;  2B5X A;  1WOU A;  3UJ1 A;  4IJI A;  5A4V A;  2K8S A;  5CRG A;  4OMV A;  3DD3 A;  4FYU A;  5CNW A;  2DC5 A;  3I69 A;  3KTL A;  5E4W A;  2CAQ A;  1F3A A;  2DJ0 A;  2EIQ A;  3HD5 A;  4E8E A;  2HLS A;  3E3E A;  3MWH A;  5AIS A;  3C71 A;  2IPA A;  1ILO A;  1B9Y C;  2O89 A;  4P3Y B;  5FT3 A;  1EGR A;  2NTO A;  1XVW A;  3GIX A;  3ISO A;  2H30 A;  3CTF A;  1VGL A;  2GSR A;  1PX7 A;  3G9B A;  1S3D A;  3TKR A;  4RI6 A;  4IN0 A;  1K3Y A;  1K0C A;  1ERT A;  3KM6 A;  1M7T A;  1EV9 A;  2C0G A;  2HZE B;  5KN3 A;  2IJY A;  2K9F A;  1TRW A;  2YP6 A;  3LXT A;  4XCS A;  1OC3 A;  4J56 E;  3E9J B;  3ZYW A;  5HR3 A;  2HZE A;  2LJR A;  4PNF A;  1YDK A;  1SKR B;  4OFM A;  4ZL7 A;  1B4Q A;  3TGZ A;  5CRW A;  4BA7 A;  1UA5 A;  4YAP A;  3HZ4 A;  2B6M A;  1WJK A;  1XCC A;  1A8Y A;  3VWW A;  2WJU A;  4RQX A;  4ECJ A;  5L71 A;  2H19 A;  1IYH A;  6GSS A;  4HQS A;  1Z7R A;  5LCZ A;  3GSS A;  2FHE A;  3ME7 A;  3ZMK A;  2MMZ A;  3M9J A;  2HXK A;  1SKW B;  2Z9S A;  3L9S A;  5ECR B;  2MBT A;  2XPE A;  5ECQ B;  3KP8 A;  4EF0 A;  1FB0 A;  4KSM A;  3TOU A;  5ECK B;  2DJK A;  1CQG A;  2G2Q A;  2JAD A;  2C3T A;  3Q74 A;  2E0Q A;  5IMZ A;  2LV3 A;  3UIW A;  3GKN A;  4IW9 A;  5D9T A;  5DQY A;  5DQS A;  2LTK A;  1O85 A;  1OC9 B;  3APS A;  4MLY A;  4O7H A;  5D93 A;  1SK1 A;  2YCD A;  1EOH A;  2MMN A;  5DJL A;  2GSS A;  3HA9 A;  3TJF A;  1OE8 A;  2K8V A;  4G2E A;  4ZB8 A;  3IPZ A;  5H5S A;  1WPI A;  5FWG A;  1OC9 A;  3WGE A;  2IME A;  2CVB A;  5J3R A;  3O3T A;  2VCZ A;  4BL7 A;  11GS A;  3KZQ A;  4JE1 A;  5CRH A;  3FHK A;  4EVM A;  1ZMA A;  2OE3 A;  3UVT A;  4FYB A;  2XBI A;  4POB A;  4HJ2 A;  2C0D A;  2XBQ A;  2BJX A;  2JL4 A;  2CT6 A;  4PGT A;  2H71 A;  4DEJ A;  1SJZ A;  1GLQ A;  1K3O A;  1WE0 A;  4KGI A;  1YQ1 A;  1XW6 A;  2RUE A;  2KHP A;  3QFA C;  4XIH A;  1GSE A;  3ZIJ A;  1X5E A;  2FY6 A;  5G31 A;  3H93 A;  4TXO B;  2DBC A;  1MTC A;  5IIZ A;  5AIX A;  1Q98 A;  1UC7 A;  2L6C A;  4HS1 A;  4MZW A;  3C7M A;  5HR0 A;  1X9M B;  3HDC A;  2MBS A;  2YV9 A;  2GZP A;  4TXO A;  3WD6 A;  3CSI A;  1T3B A;  1I9D A;  3WT2 A;  1I5G A;  4ISD A;  4FIW A;  3N5O A;  2GSQ A;  4IEL A;  4K2D A;  3H8Q A;  3F8U A;  3ZLP A;  1PX6 A;  3ERG A;  3D6I A;  2GLR A;  4KX4 A;  1NHO A;  5GZZ B;  2H01 A;  5LD0 A;  1XW9 A;  2YV7 A;  4WF5 A;  1OAZ A;  2DML A;  1G7O A;  5EL8 A;  4HUA A;  3TJG A;  3G7Y A;  2B7J A;  4E8H A;  3EIN A;  1U88 A;  1GNE A;  1A23 A;  3W6G A;  1OKT A;  1XWB A;  5IOX A;  4JZQ A;  3DVW A;  1GH2 A;  3GST A;  3TCO A;  2YZH A;  1A24 A;  3CRU A;  4GXZ A;  1XW5 A;  2C4J A;  2MZC A;  3A5W A;  1GTU A;  2GQK A;  5G1K A;  6GST A;  1LU4 A;  3UOM A;  1MD3 A;  2DJ2 A;  2OKA A;  2XHF A;  3L0H A;  1SK2 A;  1YEX A;  1Z6M A;  1GTI A;  5ELG A;  3VFI A;  2JZT A;  5CRE A;  5EVO A;  1M2B A;  5LNK e;  1Y6E A;  3ZVJ A;  4Q5R A;  3TDG A;  2PWJ A;  5ID2 B;  4J2F A;  1SKS B;  2GZY A;  5HFI A;  1GUK A;  2L59 A;  4MAB A;  2IMF A;  1VF4 A;  2X8C A;  3VWU A;  5ID2 A;  4Z7X A;  4N11 A;  3IXR A;  2FWE A;  3C8E A;  2DJ1 A;  3BD2 A;  3HVV A;  1O81 A;  1J08 A;  1U3I A;  1EV4 A;  2LST A;  5D9W A;  3VUR A;  2CVD A;  4EDZ A;  3WGD A;  3CYN A;  2PGT A;  5JCW A;  1C72 A;  2YZU A;  1ST9 A;  2AAW A;  5CP1 A;  2X8G A;  2OE0 A;  3FW2 A;  4NHZ A;  3TKS E;  1V40 A;  4F9Z A;  2NDO A;  7GSS A;  3F4R A;  3D4T A;  2L5O A;  2WCI A;  3HJO A;  1GSQ A;  1K0N A;  1OKD A;  4ILF A;  2A2R A;  1PGT A;  1ERW A;  4PUR A;  2KP2 A;  2ES7 A;  1R7H A;  5JWR B;  2KOK A;  2JU5 A;  1SYX A;  1H4O A;  1VRS D;  1HNC A;  4AJ8 A;  4JRR A;  3FR6 A;  1E2Y A;  5ENU A;  1YKC A;  3A2X A;  4TVE A;  3F9U A;  4F03 A;  2C8U A;  3VPT A;  2FNO A;  3HVS A;  5GSS A;  2REM A;  1TU7 A;  1VF3 A;  1JLW A;  1O6J A;  5F0G A;  2LQO A;  2J9H A;  3RBT A;  2OBI A;  3LEF A;  5DJM A;  2M80 A;  4I2U A;  1K0B A;  3ED3 A;  4CDO A;  3EU4 A;  3BOA A;  3HCZ A;  2GZZ A;  2TRC P;  3PH9 A;  6GSW A;  4XTS A;  3VWX A;  2DMM A;  2LUS A;  1BG5 A;  4PQI A;  5IMC A;  5ELA A;  3GH6 A;  1FHE A;  3VI5 A;  3EU3 A;  1A0R P;  3LOR A;  3M3M A;  1AW9 A;  1SYR A;  2R6K A;  3HY2 A;  5IQY A;  1AIU A;  1BQ7 A;  1TP9 A;  3W8S A;  4KCE A;  3RPN A;  5ECL B;  3GYK A;  2XC2 A;  2VD1 A;  2P5R A;  4QQ7 A;  5H5R A;  2LQQ A;  2L57 A;  3LJR A;  2TIR A;  13GS A;  4NWY A;  4JED A;  1GSS A;  2V32 A;  5J41 A;  5C04 A;  4MJE A;  5A4U A;  2CAI A;  2C80 A;  2RM6 A;  4XS4 B;  3A3T A;  4WET A;  3GNJ A;  2JZS A;  2H66 A;  5J9B A;  4GTU A;  4HEA 2;  2D2Z A;  4HZ2 A;  1BYE A;  3KIJ A;  4KSO A;  1X5C A;  1R26 A;  3D22 A;  1DE2 A;  3F3Q A;  3I9V 2;  1YF0 A;  4XS4 A;  3DEX A;  2R4V A;  4MF5 A;  1A8L A;  3KH7 A;  1JHB A;  1AQX A;  1TU8 A;  3PGT A;  1VF2 A;  4O5R A;  2MYG A;  5DCH A;  1V2A A;  2O85 A;  3EVI A;  1A2L A;  3QOU A;  1DSB A;  1Z7P A;  4GST A;  3K8N A;  4TR4 A;  4GRF A;  3GUR A;  2YJH A;  2CZ3 A;  3V1W A;  1EOG A;  1GUM A;  3KD0 A;  1A0F A;  1XWA A;  5D73 A;  3APO A;  1TK0 B;  1G7E A;  5CAX A;  2OJL A;  4IKH A;  2P0G A;  1T00 A;  2VL3 A;  2FWF A;  2N5B A;  1HNA A;  1LJR A;  1QXH A;  5GAP D;  2WDU A;  1LBK A;  2VM2 A;  4F0C A;  2WGR A;  3QR6 A;  5ECP B;  2V6O A;  4NPB A;  4RQR A;  1ACV A;  1K3L A;  4ZIJ A;  5CRD A;  1DBY A;  4OCE A;  4JR6 A;  2O7K A;  2TRX A;  3SWL A;  1GSY A;  2YWM A;  5IM9 A;  2H0I A;  3O6T A;  2OAD A;  4K8M A;  3DRN A;  1BED A;  2H1D A;  3UBK A;  1XOA A;  5F07 A;  5G1L A;  2DSA A;  4ULX A;  4GCI A;  3EC3 A;  3I43 A;  1PSQ A;  4FH8 A;  3GHA A;  1J0F A;  3D0Z A;  3GTU B;  2GS3 A;  3KCM A;  4AGS A;  2CA8 A;  2AUV A;  4BWQ A;  2VCW A;  2H75 A;  1V9W A;  3GTU A;  2HRF A;  1GP1 A;  2YPM A;  19GS A;  2DJJ A;  2I3Y A;  3VPQ A;  4DSQ A;  1SL2 B;  2P5Q A;  1TW9 A;  2LNS A;  2MMO A;  2WFC A;  2FCH A;  3IR4 A;  4PUA A;  3HZ8 A;  3P7X A;  5JWQ B;  1NSW A;  3IAS 2;  1R4W A;  1GTA A;  1SD8 A;  2NPB A;  1JZW A;  5A5K A;  3GX8 A;  3GKM A;  3TRP A;  2VLT A;  2AYT A;  3TKS C;  5D9X A;  2AJQ B;  1SJI A;  3M8N A;  1ZL9 A;  3QD9 A;  4QL7 A;  3P2A A;  1EP8 A;  5EY6 A;  2C3Q A;  3HVX A;  4TR0 A;  4ML6 A;  2IMK A;  3GL5 A;  5JCG A;  4NXI A;  1Z5Y E;  3JCM L;  3CTG A;  4GSN A;  1AC1 A;  1TRU A;  1XXU A;  4Q5Q A;  4POL A;  4K9Z A;  4FYC A;  5IMA A;  2PBJ A;  4ZBB A;  3FZ9 A;  4WKW A;  3IOS A;  1U6T A;  2A2S A;  1OC8 A;  3ERF A;  2VO4 A;  4ZBA A;  5HQP A;  2AHE A;  3M1G A;  3IHQ A;  3GV1 A;  3U6V A;  3FK8 A;  4GF0 A;  2F8F A;  3HKR A;  2ON7 A;  4X1U A;  4ACS A;  1SD9 A;  1PD2 1;  1ERU A;  2VL2 C;  4L5L A;  3ERW A;  3IC4 A;  3RPP A; 
#chains in the Genus database with same CATH topology
 2V41 A;  4POK A;  1GUH A;  5F06 A;  4TXV A;  1X9S B;  4BVX A;  2BTO T;  6GSU A;  4XS1 A;  4O32 A;  1O7U A;  3H4K A;  2RLI A;  2YWN A;  4WXT A;  3UBL A;  1N2A A;  3D5J A;  2QC7 A;  2JSY A;  2V2G A;  3DML A;  1S3R A;  18GS A;  4OWY A;  1S3A A;  2F51 A;  2PUK C;  3KH9 A;  1DE1 A;  3FY7 A;  4TR3 A;  2B5E A;  1TXX A;  1GLP A;  3GH9 A;  2LJK A;  3RHB A;  4KND A;  2VUP A;  1UVZ A;  2BMX A;  3BBY A;  4X43 A;  3NOF A;  3QAG A;  5A4W A;  4PQ1 A;  4ID0 A;  2K6V A;  2VCV A;  4RI7 A;  4K0N A;  4MA9 A;  3A5I A;  4I8B A;  1YJ6 A;  3KGK A;  2L4Q A;  9GSS A;  1PA3 A;  4YQV A;  3GUS A;  1R5A A;  4MZB A;  1F37 A;  4CHS A;  3SBC A;  2ALB A;  3KEB A;  1CQH A;  1EEJ A;  4H86 A;  3M9K A;  3WGX A;  4ZIL A;  4TW5 A;  4LLR A;  3US3 A;  2VL9 A;  1M9A A;  2HFD A;  2RII A;  3FKF A;  4YH2 A;  4N0Z A;  4ZBD A;  1F6M C;  1F3B A;  1Z3E A;  4IP6 A;  1K0M A;  3UL3 A;  4KA0 A;  3CRT A;  1YEP A;  4MDC A;  4TRX A;  4OO5 A;  1XWC A;  1ON4 A;  5IO0 A;  1GWC A;  1OVN A;  2HSY A;  4ECB A;  1M0U A;  5B8A A;  1SK0 A;  2R37 A;  4K7O A;  4Q5F A;  4K0G A;  2EIR A;  2DLX A;  4IQ1 A;  4EXJ A;  1MDJ A;  1QK8 A;  3EMX A;  4V1A p;  2FWH A;  4PX1 A;  3APQ A;  4X4J A;  5AIV A;  1ZYQ B;  3TKP A;  5DDL A;  1O8W A;  2VL2 A;  2CX3 A;  3ZTL A;  2GQL A;  5DBQ A;  4MP4 A;  5D8I A;  3ZRE A;  3ZIV A;  4IQA A;  1FG4 A;  3J7Y b;  1T4Y A;  5KEJ A;  1W4V A;  1F9M A;  2RUF A;  1RQM A;  2ON5 A;  4JR4 A;  4XS6 A;  2IIY A;  2L4C A;  3L9U A;  4L0U A;  4Q5N A;  4WR5 A;  5HFK A;  5GAN D;  4L5O A;  3RAZ A;  3ZZX A;  14GS A;  2EC4 A;  3FZ5 A;  2HYX A;  4PTS A;  1ZYE A;  4F0B A;  4GSS A;  4HZ4 A;  3H1N A;  4V2M A;  1M2D A;  4IGJ A;  2H74 A;  1Q4J A;  3HHV A;  2J23 A;  1PKW A;  16GS A;  3TRQ A;  3CBU A;  2FA4 A;  3TJJ A;  1U3A A;  1QFN A;  4X0X A;  1VF1 A;  3D4M A;  5G30 A;  2YJ7 A;  2GT5 A;  3ME8 A;  1GRX A;  4EKZ A;  2GVP A;  5FHI A;  2C0F A;  1SU9 A;  3GA4 A;  1IYI A;  1X0R A;  1GNW A;  3LW9 A;  4LMW A;  2EIO A;  1Z6N A;  1A2J A;  1XVQ A;  4TN8 A;  1X5D A;  2WRT A;  4YQM A;  3E0U A;  2R2J A;  1FB6 A;  5D9V A;  4EL1 A;  5B6M A;  3IAM 2;  1PQN A;  2YN1 A;  4IS0 A;  3IDV A;  4OO4 A;  1RK4 A;  3TUE A;  3MSZ A;  2G0F A;  2N5F A;  4POM A;  3L4N A;  3GN3 A;  2AV4 A;  4IBP A;  2PVQ A;  1K0A A;  1ZYN A;  2YOI A;  3LSZ A;  3VLN A;  3WT1 A;  1R5P A;  3NIV A;  2IFQ B;  1YF1 A;  3VI7 A;  2M72 A;  1HQO A;  3C1R A;  1BJX A;  2QSI A;  1XBS A;  2GQM A;  2IFQ A;  2YNX A;  5ABR A;  2CX4 A;  2K18 A;  3KJY A;  4OCF A;  2H73 A;  5B8B A;  1KNG A;  3Q18 A;  4MPF A;  1JZD A;  2HRA A;  4KUN A;  3EE2 A;  3G7J A;  5KOX A;  4PQH A;  2FD3 A;  4K7I A;  1NM3 A;  2LEG A;  2H1A A;  1KTE A;  4WBR D;  5KN0 A;  2VCT A;  2B5Y A;  2VCX A;  3EYT A;  3FR3 A;  3KMN A;  2FLS A;  1HNB A;  1URM A;  2OE1 A;  2OBK A;  5IPG A;  1K0D A;  4OD7 A;  1KBN A;  3UVH A;  4HU7 A;  3WYW A;  1MEK A;  2YAN A;  3R2Q A;  6GSX A;  1TK8 B;  4KE3 A;  4YKF A;  1YY7 A;  5G5E A;  2HI7 A;  3QDN A;  4ZL9 A;  1FVK A;  2M46 A;  1SL0 B;  3F4S A;  1GTB A;  3F63 A;  5G5F A;  1PFO A;  4WR4 A;  4LL1 B;  4NV2 A;  3ZVJ D;  3EMP A;  3CMI A;  4G0L A;  4HOJ A;  1Y25 A;  2CVK A;  1GSD A;  2VOC A;  4WEY A;  4EDY A;  2F3M A;  1TDI A;  3I6A A;  3ZFL A;  4G10 A;  2H0G A;  2YWO A;  2GT6 A;  1O73 A;  1WWJ A;  4MPG A;  6GSY A;  6GSV A;  4PXO A;  1PKZ A;  3LFL A;  3KTB A;  3HXS A;  2OA7 A;  4K6X A;  5HFG A;  2I4A A;  1MD4 A;  1GL8 A;  4ZXG A;  2I81 A;  3EUR A;  3Q6O A;  4G0I A;  3TKQ A;  1AQV A;  1WP0 A;  4PNG A;  4EUY A;  1M99 A;  2IMI A;  1FO5 A;  1HYU A;  2VCQ A;  3LQ7 A;  2IMD A;  3BJ5 A;  3DKS A;  5ECN B;  4QL9 A;  1ERV A;  4MMM A;  3Q19 A;  3KMO A;  3EWL A;  2JAC A;  5JWO B;  2JZR A;  3FZA A;  4AJ6 A;  4OFN A;  3KP9 A;  3DGQ A;  2YWI A;  1TI3 A;  2H76 A;  5DVB A;  3TJK A;  4LA1 A;  2QGV A;  5E59 A;  3CSJ A;  22GS A;  2LNT A;  2CQ9 A;  1SL1 B;  1EEM A;  2CV4 A;  3LGC A;  2B3S A;  2H6X A;  4MH2 A;  4GLT A;  4G9H A;  2LRN A;  5IOW A;  2VLU A;  3HJM A;  2E2G A;  2R3X A;  1EZK A;  3GL3 A;  4NV5 A;  3P8W A;  2GDR A;  2VAF A;  1BX9 A;  4G19 A;  4MZC A;  2RM5 A;  5J5N A;  4TOP A;  4KAE A;  4K5S A;  4I6X A;  4Z2T A;  3IRA A;  4KCA A;  4KDY A;  4YAV A;  3KXO A;  4AF2 A;  3DYR A;  4BWS A;  3F0I A;  2NBS A;  1ZCP A;  8GSS A;  1PMT A;  1B9X C;  4DSS B;  5ECM B;  1UN2 A;  5G2Z A;  3HYP A;  5DAL B;  3QAW A;  1ZOF A;  3M0F A;  3IK7 A;  4EE0 A;  5HR2 A;  5CO3 A;  4MF7 A;  1G0T A;  1FVJ A;  1O8X A;  3UEM A;  3QFB C;  4DSS A;  1F2E A;  2HRN A;  5DAL A;  4ZB9 A;  1FW1 A;  3TRX A;  2C0E A;  2N5A A;  3W8J A;  3LYK A;  1G6W A;  2XPD A;  3FYG A;  4KH7 A;  4OFT A;  1MDK A;  2B1K A;  4CY6 A;  3QCP A;  5GST A;  1T4Z A;  1S3C A;  3FRC A;  3GKK A;  5C00 A;  3CXG A;  2QKE A;  2WB9 A;  5DCG A;  2B1L A;  3TOT A;  2O8V B;  3D21 A;  4O92 A;  5COH A;  1GSU A;  2X4A A;  1TRS A;  2E7P A;  1GSF A;  3J7Y k;  3CQF A;  4MJB A;  4MJC A;  1AQW A;  4XRD A;  3FZ4 A;  2A4V A;  1B8X A;  1WRY A;  2WS2 A;  3IE3 A;  12GS A;  2KLX A;  3LG6 A;  3UAP A;  2H0H A;  5IPH A;  4ZL8 A;  1QMV A;  4XHM A;  3VK9 A;  2VIM A;  2AB6 A;  3L78 A;  2X49 A;  4N30 A;  3DWV A;  4F82 A;  1ABA A;  5IMD A;  2P31 A;  2DKI A;  2L5L A;  1TOF A;  3P90 A;  3QMX A;  2L6D A;  4BVY B;  5HR1 A;  3FMW A;  1MDI A;  1TKD B;  1XWK A;  1Z9H A;  4PUF C;  1USB A;  3CSH A;  3LXZ A;  4ZB6 A;  4MH3 A;  5ECI B;  2NVL A;  4BVY A;  3F6F A;  5INY A;  2H6Y A;  1JLV A;  3OR5 A;  5KN2 A;  3ZML A;  4I97 A;  4J57 E;  3ZFB A;  4CW9 A;  2FUG 2;  4EO3 A;  3MAK A;  3ZIT A;  2GTU A;  2OAC A;  2PPT A;  3TKS A;  2IWT A;  4IHU A;  3G7I A;  4GQC A;  4WBJ A;  2HZF A;  3FR9 A;  3F3R A;  4KDU A;  4L8E A;  1X9W B;  1RW1 A;  3QPM A;  1BAY A;  3FEU A;  4O5Q A;  1ML6 A;  1XPV A;  4DSR A;  4MF6 A;  3TJB A;  4HI7 A;  1YZX A;  2X8H A;  5D96 A;  3RDW A;  1EP7 A;  3GRX A;  3QAV A;  1J9B A;  1XWG A;  4MK3 A;  3LYP A;  2FGX A;  5IO2 A;  3IV4 A;  3DVX A;  4I5Q A;  3NZN A;  2PVO C;  4F2I A;  1KEB A;  4N0V A;  2LRC A;  4EC0 A;  2E2M A;  3F4T A;  3UMA A;  2H1G A;  1M2A A;  1QQ2 A;  3HJP A;  4FO5 A;  4HDE A;  1K0O A;  1ZZY A;  3DIE A;  4ML1 A;  1U87 A;  2DIZ A;  2VLV A;  3PIN A;  4V1A g;  1V57 A;  2KP1 A;  4D73 B;  2V6K A;  5IMV A;  2VD0 A;  1TJD A;  2LS5 A;  4HU9 A;  3A2W A;  1TTZ A;  3VWV A;  4TKY A;  5IMF A;  1H75 A;  1EGO A;  5KN1 A;  5F05 A;  4D73 A;  4MCU A;  2MMA A;  1M9B A;  4L0W A;  1GUL A;  1TK5 B;  1AAZ A;  2R5G A;  2PER A;  2C1Y A;  3LWA A;  4FQU A;  4GWR A;  4Z2U A;  1W89 A;  3DXB A;  10GS A;  1E6B A;  1JFU A;  2H8L A;  1N8J A;  2WUL A;  2V1M A;  4WF4 A;  3A2V A;  3C1S A;  3N9J A;  1AXD A;  2X99 A;  1TRV A;  1XOB A;  4KB3 A;  4HJM A;  3TB2 A;  1ZGN A;  1PL2 A;  3U5R E;  4TR1 B;  2IL3 A;  4DVC A;  1WIK A;  2VM1 A;  4IP1 A;  2CZ2 A;  4HQZ A;  4LMV A;  3ZRD A;  3ZL5 A;  2GST A;  4KDX A;  3IBH A;  4ECI A;  4TR1 A;  1JZO A;  5JCU A;  3MNG A;  2PN8 A;  1V98 A;  1B4P A;  2HE3 A;  1T7P B;  5F8B A;  1XFL A;  4XRA A;  2ZUP A;  1HD2 A;  2KUC A;  4NMU A;  1XIY A;  3IA1 A;  5DAK B;  5AN1 A;  1OE7 A;  1B48 A;  5B7C A;  3GX0 A;  1T8E B;  4CY8 A;  1M3J A;  4N10 A;  5B6N A;  1T1V A;  3PR8 A;  2LKU A;  2WZ9 A;  5DAK A;  2DJ3 A;  1DUG A;  4NAX A;  1AUC A;  2I9H A;  3F6D A;  5ECS A;  1PRX A;  3O76 A;  2HT9 A;  1FOV A;  20GS A;  4IJ3 A;  3RHC A;  4JBB A;  1XZO A;  1FAA A;  3C73 A;  3IHG A;  4LL4 B;  2C3N A;  5J9C A;  1G6Y A;  1TI1 A;  1WMJ A;  2HSH A;  4GQF A;  1OYJ A;  1THO A;  2B7K A;  3MDK A;  4AJ7 A;  4BPY A;  3IK9 A;  2JSZ A;  1THX A;  2H72 A;  1NHY A;  4I2T A;  3L9V A;  2HNL A;  3GMF A;  2LRT A;  2R0G A;  2H1B A;  1A2M A;  5EPF A;  3H79 A;  1SEN A;  2PMT A;  4JU5 A;  2F9S A;  17GS A;  5H5Q A;  1V58 A;  1SJ6 A;  1NW2 A;  3S9F A;  1PL1 A;  2H70 A;  5ECO B;  2F8A A;  3BCK A;  2IN3 A;  1FOH A;  4IVF A;  1JZR A;  4G0K A;  5ECH B;  2I1U A;  2LJA A;  2O87 A;  2X64 A;  5CYY A;  2FA8 A;  2FWG A;  2GGT A;  3BCI A;  2PU9 C;  4RUV A;  1QGV A;  2ZNM A;  4ECC A;  4V2N A;  3AY8 A;  5J4U A;  4YQU A;  1QUW A;  2DIY A;  2H6Z A;  4K7N A;  4MJA A;  4V2L A;  5AGY A;  1PN9 A;  4NHW A;  3UAR A;  4KW6 A;  1YKA A;  2ZCT A;  1EWX A;  3GKX A;  4K1F A;  3GFK A;  2B5X A;  1WOU A;  3UJ1 A;  3MIX A;  4IJI A;  5A4V A;  2K8S A;  5CRG A;  4OMV A;  3DD3 A;  4FYU A;  5CNW A;  2DC5 A;  3I69 A;  3KTL A;  5E4W A;  2CAQ A;  1F3A A;  2DJ0 A;  2EIQ A;  3HD5 A;  4E8E A;  2HLS A;  3E3E A;  3MWH A;  5AIS A;  3C71 A;  2IPA A;  1ILO A;  1B9Y C;  2O89 A;  4P3Y B;  5FT3 A;  1EGR A;  2NTO A;  1XVW A;  3GIX A;  3ISO A;  2H30 A;  3CTF A;  1VGL A;  2GSR A;  1PX7 A;  3G9B A;  1S3D A;  3TKR A;  4RI6 A;  4IN0 A;  1K3Y A;  1K0C A;  1ERT A;  3KM6 A;  1M7T A;  1EV9 A;  2C0G A;  2HZE B;  5KN3 A;  2IJY A;  2K9F A;  1TRW A;  4EIQ A;  2YP6 A;  3LXT A;  4XCS A;  1OC3 A;  4J56 E;  3E9J B;  3ZYW A;  5HR3 A;  2HZE A;  2LJR A;  4PNF A;  1YDK A;  1SKR B;  4OFM A;  4ZL7 A;  1B4Q A;  3TGZ A;  2R0P A;  5CRW A;  4BA7 A;  1M3I A;  4YAP A;  1UA5 A;  3HZ4 A;  2B6M A;  1WJK A;  1XCC A;  1A8Y A;  3VWW A;  3MYD A;  2WJU A;  4RQX A;  4ECJ A;  5BMU A;  5L71 A;  2H19 A;  1IYH A;  6GSS A;  4HQS A;  1Z7R A;  1ZYP A;  5LCZ A;  3GSS A;  2FHE A;  4KF9 A;  3ME7 A;  3R3E A;  3ZMK A;  2MMZ A;  3M9J A;  2HXK A;  1SKW B;  2Z9S A;  3L9S A;  5ECR B;  2MBT A;  2XPE A;  5ECQ B;  3KP8 A;  4EF0 A;  1FB0 A;  4KSM A;  3TOU A;  5ECK B;  2DJK A;  1CQG A;  2G2Q A;  2JAD A;  2C3T A;  3Q74 A;  2E0Q A;  3PPU A;  5IMZ A;  2LV3 A;  3UIW A;  3GKN A;  4IW9 A;  5D9T A;  5DQY A;  5DQS A;  2LTK A;  1O85 A;  1OC9 B;  3APS A;  4MLY A;  4O7H A;  5D93 A;  1SK1 A;  2YCD A;  1EOH A;  2MMN A;  5DJL A;  2GSS A;  3HA9 A;  3TJF A;  1OE8 A;  4BL7 B;  2K8V A;  4G2E A;  4ZB8 A;  3IPZ A;  5H5S A;  1WPI A;  5FWG A;  1OC9 A;  3WGE A;  2IME A;  2CVB A;  5J3R A;  3O3T A;  2VCZ A;  4BL7 A;  11GS A;  3KZQ A;  4JE1 A;  5CRH A;  3FHK A;  4EVM A;  1ZMA A;  2OE3 A;  3UVT A;  4FYB A;  2XBI A;  1XG8 A;  4POB A;  4HJ2 A;  2C0D A;  2XBQ A;  2BJX A;  2JL4 A;  2CT6 A;  4PGT A;  2H71 A;  4DEJ A;  1SJZ A;  1GLQ A;  1K3O A;  1WE0 A;  4KGI A;  1PN0 A;  1YQ1 A;  1XW6 A;  2RUE A;  3IC8 A;  2KHP A;  3QFA C;  4XIH A;  1GSE A;  3ZIJ A;  1X5E A;  2FY6 A;  5G31 A;  3H93 A;  4EIP A;  4TXO B;  2DBC A;  1MTC A;  5IIZ A;  5AIX A;  1Q98 A;  1UC7 A;  2L6C A;  4HS1 A;  4MZW A;  3C7M A;  5HR0 A;  1X9M B;  3HDC A;  2MBS A;  2YV9 A;  2GZP A;  4TXO A;  3WD6 A;  3CSI A;  1T3B A;  1I9D A;  3WT2 A;  1I5G A;  4A5P A;  4ISD A;  4FIW A;  3N5O A;  2GSQ A;  4IEL A;  4K2D A;  3H8Q A;  3F8U A;  3ZLP A;  1PX6 A;  2A4H A;  3ERG A;  3D6I A;  2GLR A;  2HRK A;  4KX4 A;  1NHO A;  5GZZ B;  2H01 A;  5LD0 A;  1XW9 A;  2YV7 A;  4WF5 A;  1OAZ A;  2DML A;  1G7O A;  5EL8 A;  4HUA A;  3TJG A;  3G7Y A;  2B7J A;  2HSM A;  4E8H A;  3EIN A;  1U88 A;  4YKG A;  4K2X A;  1GNE A;  1A23 A;  3W6G A;  1OKT A;  1XWB A;  5IOX A;  4JZQ A;  3DVW A;  1GH2 A;  3GST A;  3TCO A;  2YZH A;  1A24 A;  3CRU A;  4GXZ A;  1XW5 A;  2C4J A;  2MZC A;  3A5W A;  1GTU A;  2GQK A;  5G1K A;  6GST A;  1LU4 A;  3UOM A;  1MD3 A;  2DJ2 A;  2OKA A;  2XHF A;  3L0H A;  1SK2 A;  1YEX A;  1Z6M A;  1GTI A;  5ELG A;  3VFI A;  2JZT A;  5CRE A;  5EVO A;  1M2B A;  5LNK e;  1Y6E A;  3ZVJ A;  4Q5R A;  3TDG A;  2PWJ A;  5ID2 B;  4J2F A;  1SKS B;  2GZY A;  5HFI A;  1GUK A;  2L59 A;  4MAB A;  2IMF A;  1VF4 A;  2X8C A;  3VWU A;  5ID2 A;  4Z7X A;  4N11 A;  3IXR A;  2FWE A;  3C8E A;  2DJ1 A;  3BD2 A;  5KOW A;  3HVV A;  1O81 A;  1J08 A;  1U3I A;  1EV4 A;  2LST A;  5D9W A;  3VUR A;  2CVD A;  4EDZ A;  3WGD A;  3CYN A;  2PGT A;  5JCW A;  1C72 A;  2YZU A;  1ST9 A;  2AAW A;  4USS A;  5CP1 A;  2X8G A;  2OE0 A;  3FW2 A;  4NHZ A;  3TKS E;  1V40 A;  4F9Z A;  2NDO A;  7GSS A;  3F4R A;  3D4T A;  2L5O A;  2WCI A;  3HJO A;  1GSQ A;  1K0N A;  1OKD A;  4ILF A;  2A2R A;  1PGT A;  1ERW A;  4PUR A;  2KP2 A;  2ES7 A;  1R7H A;  5JWR B;  2KOK A;  2JU5 A;  1SYX A;  1H4O A;  1VRS D;  1HNC A;  4AJ8 A;  4JRR A;  3EPT A;  3HVN A;  3FR6 A;  1E2Y A;  2R0C A;  5ENU A;  1YKC A;  3A2X A;  4TVE A;  3F9U A;  4F03 A;  2C8U A;  3VPT A;  2FNO A;  3HVS A;  5GSS A;  4ICY A;  2REM A;  5BRT A;  1TU7 A;  1VF3 A;  1JLW A;  1O6J A;  5F0G A;  2LQO A;  2J9H A;  3RBT A;  2OBI A;  3LEF A;  5DJM A;  2M80 A;  4I2U A;  1K0B A;  3ED3 A;  4CDO A;  3EU4 A;  3BOA A;  3HCZ A;  2GZZ A;  2TRC P;  3PH9 A;  6GSW A;  4XTS A;  3VWX A;  2DMM A;  2LUS A;  1BG5 A;  4PQI A;  5IMC A;  5ELA A;  3GH6 A;  1FHE A;  3VI5 A;  3EU3 A;  4HSC X;  1A0R P;  3LOR A;  3M3M A;  1AW9 A;  1SYR A;  2R6K A;  4K5R A;  3HY2 A;  5IQY A;  1AIU A;  1BQ7 A;  4MNN A;  1TP9 A;  3W8S A;  4KCE A;  3RPN A;  5ECL B;  3GYK A;  2XC2 A;  2VD1 A;  2P5R A;  4QQ7 A;  5H5R A;  2LQQ A;  2L57 A;  3LJR A;  2TIR A;  13GS A;  4NWY A;  4JED A;  1GSS A;  2V32 A;  5J41 A;  5C04 A;  4MJE A;  5A4U A;  2CAI A;  2C80 A;  4Z2R A;  2RM6 A;  4XS4 B;  3A3T A;  4WET A;  3GNJ A;  2JZS A;  2H66 A;  5J9B A;  4GTU A;  4HEA 2;  2D2Z A;  4HZ2 A;  1BYE A;  3KIJ A;  4KSO A;  1X5C A;  1R26 A;  3D22 A;  1DE2 A;  3F3Q A;  3I9V 2;  1YF0 A;  4XS4 A;  3DEX A;  2R4V A;  4MF5 A;  1A8L A;  3KH7 A;  1JHB A;  1AQX A;  1TU8 A;  3PGT A;  1VF2 A;  4O5R A;  2MYG A;  5DCH A;  1V2A A;  4BIK A;  2O85 A;  3EVI A;  1A2L A;  3QOU A;  1DSB A;  1Z7P A;  4GST A;  3K8N A;  4TR4 A;  4GRF A;  3GUR A;  2YJH A;  2CZ3 A;  3V1W A;  1EOG A;  1GUM A;  3KD0 A;  1A0F A;  1XWA A;  5D73 A;  3APO A;  1TK0 B;  1G7E A;  5CAX A;  2OJL A;  4IKH A;  2P0G A;  1T00 A;  2VL3 A;  2FWF A;  2N5B A;  1HNA A;  1LJR A;  1QXH A;  5GAP D;  2WDU A;  1LBK A;  2VM2 A;  4F0C A;  2WGR A;  4O5U A;  3QR6 A;  5ECP B;  2V6O A;  4NPB A;  4RQR A;  1ACV A;  1K3L A;  4ZIJ A;  5CRD A;  1DBY A;  4OCE A;  4JR6 A;  2O7K A;  2TRX A;  3SWL A;  1GSY A;  2YWM A;  5IM9 A;  2H0I A;  3O6T A;  2OAD A;  4K8M A;  2QA2 A;  3DRN A;  1BED A;  2H1D A;  3UBK A;  1XOA A;  5F07 A;  5G1L A;  2DSA A;  4ULX A;  4GCI A;  3EC3 A;  3I43 A;  1PSQ A;  4FH8 A;  3GHA A;  1J0F A;  3D0Z A;  3GTU B;  2GS3 A;  3KCM A;  4AGS A;  2UZ8 A;  2CA8 A;  2AUV A;  4BWQ A;  2VCW A;  2H75 A;  1V9W A;  3GTU A;  2HRF A;  1GP1 A;  2YPM A;  19GS A;  2DJJ A;  2I3Y A;  3VPQ A;  4DSQ A;  1SL2 B;  2P5Q A;  1TW9 A;  2LNS A;  2MMO A;  2WFC A;  2FCH A;  3IR4 A;  4PUA A;  3HZ8 A;  3P7X A;  5JWQ B;  1NSW A;  3IAS 2;  1R4W A;  2DKH A;  1GTA A;  1SD8 A;  2NPB A;  1JZW A;  5A5K A;  3GX8 A;  3GKM A;  3TRP A;  2VLT A;  2AYT A;  3TKS C;  5D9X A;  2AJQ B;  2QA1 A;  1SJI A;  3M8N A;  2A2P A;  1ZL9 A;  3QD9 A;  4QL7 A;  3P2A A;  1EP8 A;  5EY6 A;  2C3Q A;  3HVX A;  4TR0 A;  4ML6 A;  2IMK A;  3GL5 A;  5JCG A;  4NXI A;  1Z5Y E;  3JCM L;  3CTG A;  4GSN A;  1AC1 A;  1TRU A;  1XXU A;  4Q5Q A;  4POL A;  4K9Z A;  4FYC A;  5IMA A;  2PBJ A;  4ZBB A;  3FZ9 A;  4WKW A;  3IOS A;  1U6T A;  2A2S A;  1OC8 A;  3ERF A;  2VO4 A;  4ZBA A;  5HQP A;  2AHE A;  3M1G A;  3IHQ A;  3GV1 A;  3U6V A;  3FK8 A;  4GF0 A;  2F8F A;  4BVX B;  3HKR A;  2ON7 A;  4X1U A;  4ACS A;  1SD9 A;  1PD2 1;  1ERU A;  2VL2 C;  4L5L A;  3ERW A;  3IC4 A;  3RPP A; 
#chains in the Genus database with same CATH homology
 2V41 A;  4POK A;  1GUH A;  5F06 A;  4TXV A;  1X9S B;  4BVX A;  2BTO T;  6GSU A;  4XS1 A;  4O32 A;  1O7U A;  3H4K A;  2RLI A;  2YWN A;  4WXT A;  3UBL A;  1N2A A;  3D5J A;  2QC7 A;  2JSY A;  2V2G A;  3DML A;  18GS A;  4OWY A;  1S3A A;  2F51 A;  2PUK C;  3KH9 A;  1DE1 A;  3FY7 A;  4TR3 A;  2B5E A;  1TXX A;  1GLP A;  3GH9 A;  2LJK A;  3RHB A;  4KND A;  2VUP A;  1UVZ A;  2BMX A;  3BBY A;  4X43 A;  3NOF A;  3QAG A;  5A4W A;  4PQ1 A;  4ID0 A;  2K6V A;  2VCV A;  4RI7 A;  4K0N A;  4MA9 A;  3A5I A;  4I8B A;  1YJ6 A;  3KGK A;  2L4Q A;  9GSS A;  1PA3 A;  4YQV A;  3GUS A;  1R5A A;  4MZB A;  1F37 A;  4CHS A;  3SBC A;  2ALB A;  3KEB A;  1CQH A;  1EEJ A;  4H86 A;  3M9K A;  3WGX A;  4ZIL A;  4TW5 A;  4LLR A;  3US3 A;  2VL9 A;  1M9A A;  2HFD A;  2RII A;  3FKF A;  4YH2 A;  4N0Z A;  4ZBD A;  1F6M C;  1F3B A;  1Z3E A;  4IP6 A;  1K0M A;  3UL3 A;  4KA0 A;  3CRT A;  1YEP A;  4MDC A;  4TRX A;  4OO5 A;  1XWC A;  1ON4 A;  5IO0 A;  1GWC A;  1OVN A;  2HSY A;  4ECB A;  1M0U A;  5B8A A;  1SK0 A;  2R37 A;  4K7O A;  4Q5F A;  4K0G A;  2EIR A;  2DLX A;  4IQ1 A;  4EXJ A;  1MDJ A;  1QK8 A;  3EMX A;  4V1A p;  2FWH A;  4PX1 A;  3APQ A;  4X4J A;  5AIV A;  1ZYQ B;  3TKP A;  5DDL A;  1O8W A;  2VL2 A;  2CX3 A;  3ZTL A;  2GQL A;  5DBQ A;  4MP4 A;  5D8I A;  3ZRE A;  3ZIV A;  4IQA A;  1FG4 A;  3J7Y b;  1T4Y A;  5KEJ A;  1W4V A;  1F9M A;  2RUF A;  1RQM A;  2ON5 A;  4JR4 A;  4XS6 A;  2IIY A;  2L4C A;  3L9U A;  4L0U A;  4Q5N A;  4WR5 A;  5HFK A;  5GAN D;  4L5O A;  3RAZ A;  3ZZX A;  14GS A;  2EC4 A;  3FZ5 A;  2HYX A;  4PTS A;  1ZYE A;  4F0B A;  4GSS A;  4HZ4 A;  3H1N A;  4V2M A;  1M2D A;  4IGJ A;  2H74 A;  1Q4J A;  3HHV A;  2J23 A;  1PKW A;  16GS A;  3TRQ A;  3CBU A;  2FA4 A;  3TJJ A;  1U3A A;  1QFN A;  4X0X A;  1VF1 A;  3D4M A;  5G30 A;  2YJ7 A;  2GT5 A;  3ME8 A;  1GRX A;  4EKZ A;  2GVP A;  5FHI A;  2C0F A;  1SU9 A;  3GA4 A;  1IYI A;  1X0R A;  1GNW A;  3LW9 A;  4LMW A;  2EIO A;  1Z6N A;  1A2J A;  1XVQ A;  4TN8 A;  1X5D A;  2WRT A;  4YQM A;  3E0U A;  2R2J A;  1FB6 A;  5D9V A;  4EL1 A;  5B6M A;  3IAM 2;  1PQN A;  2YN1 A;  4IS0 A;  3IDV A;  4OO4 A;  1RK4 A;  3TUE A;  3MSZ A;  2G0F A;  2N5F A;  4POM A;  3L4N A;  3GN3 A;  2AV4 A;  4IBP A;  2PVQ A;  1K0A A;  1ZYN A;  2YOI A;  3LSZ A;  3VLN A;  3WT1 A;  1R5P A;  3NIV A;  2IFQ B;  1YF1 A;  3VI7 A;  2M72 A;  1HQO A;  3C1R A;  1BJX A;  2QSI A;  1XBS A;  2GQM A;  2IFQ A;  2YNX A;  5ABR A;  2CX4 A;  2K18 A;  3KJY A;  4OCF A;  2H73 A;  5B8B A;  1KNG A;  3Q18 A;  4MPF A;  1JZD A;  2HRA A;  4KUN A;  3EE2 A;  3G7J A;  5KOX A;  4PQH A;  2FD3 A;  4K7I A;  1NM3 A;  2LEG A;  2H1A A;  1KTE A;  4WBR D;  5KN0 A;  2VCT A;  2B5Y A;  2VCX A;  3EYT A;  3FR3 A;  3KMN A;  2FLS A;  1HNB A;  1URM A;  2OE1 A;  2OBK A;  5IPG A;  1K0D A;  4OD7 A;  1KBN A;  3UVH A;  4HU7 A;  3WYW A;  1MEK A;  2YAN A;  3R2Q A;  6GSX A;  1TK8 B;  4KE3 A;  4YKF A;  1YY7 A;  5G5E A;  2HI7 A;  3QDN A;  4ZL9 A;  1FVK A;  2M46 A;  1SL0 B;  3F4S A;  1GTB A;  3F63 A;  5G5F A;  4WR4 A;  4LL1 B;  4NV2 A;  3ZVJ D;  3EMP A;  3CMI A;  4G0L A;  4HOJ A;  1Y25 A;  2CVK A;  1GSD A;  2VOC A;  4WEY A;  4EDY A;  2F3M A;  1TDI A;  3I6A A;  3ZFL A;  4G10 A;  2H0G A;  2YWO A;  2GT6 A;  1O73 A;  1WWJ A;  4MPG A;  6GSY A;  6GSV A;  4PXO A;  1PKZ A;  3LFL A;  3KTB A;  3HXS A;  2OA7 A;  4K6X A;  5HFG A;  2I4A A;  1MD4 A;  1GL8 A;  4ZXG A;  2I81 A;  3EUR A;  3Q6O A;  4G0I A;  3TKQ A;  1AQV A;  1WP0 A;  4PNG A;  4EUY A;  1M99 A;  2IMI A;  1FO5 A;  1HYU A;  2VCQ A;  3LQ7 A;  2IMD A;  3BJ5 A;  3DKS A;  5ECN B;  4QL9 A;  1ERV A;  4MMM A;  3Q19 A;  3KMO A;  3EWL A;  2JAC A;  5JWO B;  2JZR A;  3FZA A;  4AJ6 A;  4OFN A;  3KP9 A;  3DGQ A;  2YWI A;  1TI3 A;  2H76 A;  5DVB A;  3TJK A;  4LA1 A;  2QGV A;  5E59 A;  3CSJ A;  22GS A;  2LNT A;  2CQ9 A;  1SL1 B;  1EEM A;  2CV4 A;  3LGC A;  2B3S A;  2H6X A;  4MH2 A;  4GLT A;  4G9H A;  2LRN A;  5IOW A;  2VLU A;  3HJM A;  2E2G A;  2R3X A;  1EZK A;  3GL3 A;  4NV5 A;  3P8W A;  2GDR A;  2VAF A;  1BX9 A;  4G19 A;  4MZC A;  2RM5 A;  5J5N A;  4TOP A;  4KAE A;  4K5S A;  4I6X A;  4Z2T A;  3IRA A;  4KCA A;  4KDY A;  4YAV A;  3KXO A;  4AF2 A;  3DYR A;  4BWS A;  3F0I A;  2NBS A;  1ZCP A;  8GSS A;  1PMT A;  1B9X C;  4DSS B;  5ECM B;  1UN2 A;  5G2Z A;  3HYP A;  5DAL B;  3QAW A;  1ZOF A;  3M0F A;  3IK7 A;  4EE0 A;  5HR2 A;  5CO3 A;  4MF7 A;  1G0T A;  1FVJ A;  1O8X A;  3UEM A;  3QFB C;  4DSS A;  1F2E A;  2HRN A;  5DAL A;  4ZB9 A;  1FW1 A;  3TRX A;  2C0E A;  2N5A A;  3W8J A;  3LYK A;  1G6W A;  2XPD A;  3FYG A;  4KH7 A;  4OFT A;  1MDK A;  2B1K A;  4CY6 A;  3QCP A;  5GST A;  1T4Z A;  1S3C A;  3FRC A;  3GKK A;  5C00 A;  3CXG A;  2QKE A;  2WB9 A;  5DCG A;  2B1L A;  3TOT A;  2O8V B;  3D21 A;  4O92 A;  5COH A;  1GSU A;  2X4A A;  1TRS A;  2E7P A;  1GSF A;  3J7Y k;  4MJB A;  4MJC A;  1AQW A;  4XRD A;  3FZ4 A;  2A4V A;  1B8X A;  1WRY A;  2WS2 A;  3IE3 A;  12GS A;  2KLX A;  3LG6 A;  3UAP A;  2H0H A;  5IPH A;  4ZL8 A;  1QMV A;  4XHM A;  3VK9 A;  2VIM A;  2AB6 A;  3L78 A;  2X49 A;  4N30 A;  3DWV A;  4F82 A;  1ABA A;  5IMD A;  2P31 A;  2DKI A;  2L5L A;  1TOF A;  3P90 A;  3QMX A;  2L6D A;  4BVY B;  5HR1 A;  3FMW A;  1MDI A;  1TKD B;  1XWK A;  1Z9H A;  4PUF C;  1USB A;  3CSH A;  3LXZ A;  4ZB6 A;  4MH3 A;  5ECI B;  2NVL A;  4BVY A;  3F6F A;  5INY A;  2H6Y A;  1JLV A;  3OR5 A;  5KN2 A;  3ZML A;  4I97 A;  4J57 E;  3ZFB A;  4CW9 A;  2FUG 2;  4EO3 A;  3MAK A;  3ZIT A;  2GTU A;  2OAC A;  2PPT A;  3TKS A;  2IWT A;  4IHU A;  3G7I A;  4GQC A;  4WBJ A;  2HZF A;  3FR9 A;  3F3R A;  4KDU A;  4L8E A;  1X9W B;  1RW1 A;  3QPM A;  1BAY A;  3FEU A;  4O5Q A;  1ML6 A;  1XPV A;  4DSR A;  4MF6 A;  3TJB A;  4HI7 A;  1YZX A;  2X8H A;  5D96 A;  3RDW A;  1EP7 A;  3GRX A;  3QAV A;  1J9B A;  1XWG A;  4MK3 A;  3LYP A;  2FGX A;  5IO2 A;  3IV4 A;  3DVX A;  4I5Q A;  3NZN A;  2PVO C;  4F2I A;  1KEB A;  4N0V A;  2LRC A;  4EC0 A;  2E2M A;  3F4T A;  3UMA A;  2H1G A;  1M2A A;  1QQ2 A;  3HJP A;  4FO5 A;  4HDE A;  1K0O A;  1ZZY A;  3DIE A;  4ML1 A;  1U87 A;  2DIZ A;  2VLV A;  3PIN A;  4V1A g;  1V57 A;  2KP1 A;  4D73 B;  2V6K A;  5IMV A;  2VD0 A;  1TJD A;  2LS5 A;  4HU9 A;  3A2W A;  1TTZ A;  3VWV A;  4TKY A;  5IMF A;  1H75 A;  1EGO A;  5KN1 A;  5F05 A;  4D73 A;  4MCU A;  2MMA A;  1M9B A;  4L0W A;  1GUL A;  1TK5 B;  1AAZ A;  2R5G A;  2PER A;  2C1Y A;  3LWA A;  4FQU A;  4GWR A;  4Z2U A;  1W89 A;  3DXB A;  10GS A;  1E6B A;  1JFU A;  2H8L A;  1N8J A;  2WUL A;  2V1M A;  4WF4 A;  3A2V A;  3C1S A;  3N9J A;  1AXD A;  2X99 A;  1TRV A;  1XOB A;  4KB3 A;  4HJM A;  3TB2 A;  1ZGN A;  1PL2 A;  3U5R E;  4TR1 B;  2IL3 A;  4DVC A;  1WIK A;  2VM1 A;  4IP1 A;  2CZ2 A;  4HQZ A;  4LMV A;  3ZRD A;  3ZL5 A;  2GST A;  4KDX A;  3IBH A;  4ECI A;  4TR1 A;  1JZO A;  5JCU A;  3MNG A;  2PN8 A;  1V98 A;  1B4P A;  2HE3 A;  1T7P B;  5F8B A;  1XFL A;  4XRA A;  2ZUP A;  1HD2 A;  2KUC A;  4NMU A;  1XIY A;  3IA1 A;  5DAK B;  5AN1 A;  1OE7 A;  1B48 A;  5B7C A;  3GX0 A;  1T8E B;  4CY8 A;  4N10 A;  5B6N A;  1T1V A;  3PR8 A;  2LKU A;  2WZ9 A;  5DAK A;  2DJ3 A;  1DUG A;  4NAX A;  1AUC A;  2I9H A;  3F6D A;  5ECS A;  1PRX A;  3O76 A;  2HT9 A;  1FOV A;  20GS A;  4IJ3 A;  3RHC A;  4JBB A;  1XZO A;  1FAA A;  3C73 A;  3IHG A;  4LL4 B;  2C3N A;  5J9C A;  1G6Y A;  1TI1 A;  1WMJ A;  2HSH A;  4GQF A;  1OYJ A;  1THO A;  2B7K A;  3MDK A;  4AJ7 A;  4BPY A;  3IK9 A;  2JSZ A;  1THX A;  2H72 A;  1NHY A;  4I2T A;  3L9V A;  2HNL A;  3GMF A;  2LRT A;  2R0G A;  2H1B A;  1A2M A;  5EPF A;  3H79 A;  1SEN A;  2PMT A;  4JU5 A;  2F9S A;  17GS A;  5H5Q A;  1V58 A;  1SJ6 A;  1NW2 A;  3S9F A;  1PL1 A;  2H70 A;  5ECO B;  2F8A A;  3BCK A;  2IN3 A;  1FOH A;  4IVF A;  1JZR A;  4G0K A;  5ECH B;  2I1U A;  2LJA A;  2O87 A;  2X64 A;  5CYY A;  2FA8 A;  2FWG A;  2GGT A;  3BCI A;  2PU9 C;  4RUV A;  1QGV A;  2ZNM A;  4ECC A;  4V2N A;  3AY8 A;  5J4U A;  4YQU A;  1QUW A;  2DIY A;  2H6Z A;  4K7N A;  4MJA A;  4V2L A;  5AGY A;  1PN9 A;  4NHW A;  3UAR A;  4KW6 A;  1YKA A;  2ZCT A;  1EWX A;  3GKX A;  4K1F A;  3GFK A;  2B5X A;  1WOU A;  3UJ1 A;  3MIX A;  4IJI A;  5A4V A;  2K8S A;  5CRG A;  4OMV A;  3DD3 A;  4FYU A;  5CNW A;  2DC5 A;  3I69 A;  3KTL A;  5E4W A;  2CAQ A;  1F3A A;  2DJ0 A;  2EIQ A;  3HD5 A;  4E8E A;  2HLS A;  3E3E A;  3MWH A;  5AIS A;  3C71 A;  2IPA A;  1ILO A;  1B9Y C;  2O89 A;  4P3Y B;  5FT3 A;  1EGR A;  2NTO A;  1XVW A;  3GIX A;  3ISO A;  2H30 A;  3CTF A;  1VGL A;  2GSR A;  1PX7 A;  3G9B A;  1S3D A;  3TKR A;  4RI6 A;  4IN0 A;  1K3Y A;  1K0C A;  1ERT A;  3KM6 A;  1M7T A;  1EV9 A;  2C0G A;  2HZE B;  5KN3 A;  2IJY A;  2K9F A;  1TRW A;  4EIQ A;  2YP6 A;  3LXT A;  4XCS A;  1OC3 A;  4J56 E;  3E9J B;  3ZYW A;  5HR3 A;  2HZE A;  2LJR A;  4PNF A;  1YDK A;  1SKR B;  4OFM A;  4ZL7 A;  1B4Q A;  3TGZ A;  2R0P A;  5CRW A;  4BA7 A;  4YAP A;  1UA5 A;  3HZ4 A;  2B6M A;  1WJK A;  1XCC A;  1A8Y A;  3VWW A;  3MYD A;  2WJU A;  4RQX A;  4ECJ A;  5BMU A;  5L71 A;  2H19 A;  1IYH A;  6GSS A;  4HQS A;  1Z7R A;  1ZYP A;  5LCZ A;  3GSS A;  2FHE A;  4KF9 A;  3ME7 A;  3R3E A;  3ZMK A;  2MMZ A;  3M9J A;  2HXK A;  1SKW B;  2Z9S A;  3L9S A;  5ECR B;  2MBT A;  2XPE A;  5ECQ B;  3KP8 A;  4EF0 A;  1FB0 A;  4KSM A;  3TOU A;  5ECK B;  2DJK A;  1CQG A;  2G2Q A;  2JAD A;  2C3T A;  3Q74 A;  2E0Q A;  3PPU A;  5IMZ A;  2LV3 A;  3UIW A;  3GKN A;  4IW9 A;  5D9T A;  5DQY A;  5DQS A;  2LTK A;  1O85 A;  1OC9 B;  3APS A;  4MLY A;  4O7H A;  5D93 A;  1SK1 A;  2YCD A;  1EOH A;  2MMN A;  5DJL A;  2GSS A;  3HA9 A;  3TJF A;  1OE8 A;  4BL7 B;  2K8V A;  4G2E A;  4ZB8 A;  3IPZ A;  5H5S A;  1WPI A;  5FWG A;  1OC9 A;  3WGE A;  2IME A;  2CVB A;  5J3R A;  3O3T A;  2VCZ A;  4BL7 A;  11GS A;  3KZQ A;  4JE1 A;  5CRH A;  3FHK A;  4EVM A;  1ZMA A;  2OE3 A;  3UVT A;  4FYB A;  2XBI A;  4POB A;  4HJ2 A;  2C0D A;  2XBQ A;  2BJX A;  2JL4 A;  2CT6 A;  4PGT A;  2H71 A;  4DEJ A;  1SJZ A;  1GLQ A;  1K3O A;  1WE0 A;  4KGI A;  1PN0 A;  1YQ1 A;  1XW6 A;  2RUE A;  3IC8 A;  2KHP A;  3QFA C;  4XIH A;  1GSE A;  3ZIJ A;  1X5E A;  2FY6 A;  5G31 A;  3H93 A;  4EIP A;  4TXO B;  2DBC A;  1MTC A;  5IIZ A;  5AIX A;  1Q98 A;  1UC7 A;  2L6C A;  4HS1 A;  4MZW A;  3C7M A;  5HR0 A;  1X9M B;  3HDC A;  2MBS A;  2YV9 A;  2GZP A;  4TXO A;  3WD6 A;  3CSI A;  1T3B A;  1I9D A;  3WT2 A;  1I5G A;  4A5P A;  4ISD A;  4FIW A;  3N5O A;  2GSQ A;  4IEL A;  4K2D A;  3H8Q A;  3F8U A;  3ZLP A;  1PX6 A;  2A4H A;  3ERG A;  3D6I A;  2GLR A;  2HRK A;  4KX4 A;  1NHO A;  5GZZ B;  2H01 A;  5LD0 A;  1XW9 A;  2YV7 A;  4WF5 A;  1OAZ A;  2DML A;  1G7O A;  5EL8 A;  4HUA A;  3TJG A;  3G7Y A;  2B7J A;  2HSM A;  4E8H A;  3EIN A;  1U88 A;  4YKG A;  4K2X A;  1GNE A;  1A23 A;  3W6G A;  1OKT A;  1XWB A;  5IOX A;  4JZQ A;  3DVW A;  1GH2 A;  3GST A;  3TCO A;  2YZH A;  1A24 A;  3CRU A;  4GXZ A;  1XW5 A;  2C4J A;  2MZC A;  3A5W A;  1GTU A;  2GQK A;  5G1K A;  6GST A;  1LU4 A;  3UOM A;  1MD3 A;  2DJ2 A;  2OKA A;  2XHF A;  3L0H A;  1SK2 A;  1YEX A;  1Z6M A;  1GTI A;  5ELG A;  3VFI A;  2JZT A;  5CRE A;  5EVO A;  1M2B A;  5LNK e;  1Y6E A;  3ZVJ A;  4Q5R A;  3TDG A;  2PWJ A;  5ID2 B;  4J2F A;  1SKS B;  2GZY A;  5HFI A;  1GUK A;  2L59 A;  4MAB A;  2IMF A;  1VF4 A;  2X8C A;  3VWU A;  5ID2 A;  4Z7X A;  4N11 A;  3IXR A;  2FWE A;  3C8E A;  2DJ1 A;  3BD2 A;  5KOW A;  3HVV A;  1O81 A;  1J08 A;  1U3I A;  1EV4 A;  2LST A;  5D9W A;  3VUR A;  2CVD A;  4EDZ A;  3WGD A;  3CYN A;  2PGT A;  5JCW A;  1C72 A;  2YZU A;  1ST9 A;  2AAW A;  4USS A;  5CP1 A;  2X8G A;  2OE0 A;  3FW2 A;  4NHZ A;  3TKS E;  1V40 A;  4F9Z A;  2NDO A;  7GSS A;  3F4R A;  3D4T A;  2L5O A;  2WCI A;  3HJO A;  1GSQ A;  1K0N A;  1OKD A;  4ILF A;  2A2R A;  1PGT A;  1ERW A;  4PUR A;  2KP2 A;  2ES7 A;  1R7H A;  5JWR B;  2KOK A;  2JU5 A;  1SYX A;  1H4O A;  1VRS D;  1HNC A;  4AJ8 A;  4JRR A;  3EPT A;  3FR6 A;  1E2Y A;  2R0C A;  5ENU A;  1YKC A;  3A2X A;  4TVE A;  3F9U A;  4F03 A;  2C8U A;  3VPT A;  2FNO A;  3HVS A;  5GSS A;  4ICY A;  2REM A;  5BRT A;  1TU7 A;  1VF3 A;  1JLW A;  1O6J A;  5F0G A;  2LQO A;  2J9H A;  3RBT A;  2OBI A;  3LEF A;  5DJM A;  2M80 A;  4I2U A;  1K0B A;  3ED3 A;  4CDO A;  3EU4 A;  3BOA A;  3HCZ A;  2GZZ A;  2TRC P;  3PH9 A;  6GSW A;  4XTS A;  3VWX A;  2DMM A;  2LUS A;  1BG5 A;  4PQI A;  5IMC A;  5ELA A;  3GH6 A;  1FHE A;  3VI5 A;  3EU3 A;  1A0R P;  3LOR A;  3M3M A;  1AW9 A;  1SYR A;  2R6K A;  4K5R A;  3HY2 A;  5IQY A;  1AIU A;  1BQ7 A;  4MNN A;  1TP9 A;  3W8S A;  4KCE A;  3RPN A;  5ECL B;  3GYK A;  2XC2 A;  2VD1 A;  2P5R A;  4QQ7 A;  5H5R A;  2LQQ A;  2L57 A;  3LJR A;  2TIR A;  13GS A;  4NWY A;  4JED A;  1GSS A;  2V32 A;  5J41 A;  5C04 A;  4MJE A;  5A4U A;  2CAI A;  2C80 A;  4Z2R A;  2RM6 A;  4XS4 B;  3A3T A;  4WET A;  3GNJ A;  2JZS A;  2H66 A;  5J9B A;  4GTU A;  4HEA 2;  2D2Z A;  4HZ2 A;  1BYE A;  3KIJ A;  4KSO A;  1X5C A;  1R26 A;  3D22 A;  1DE2 A;  3F3Q A;  3I9V 2;  1YF0 A;  4XS4 A;  3DEX A;  2R4V A;  4MF5 A;  1A8L A;  3KH7 A;  1JHB A;  1AQX A;  1TU8 A;  3PGT A;  1VF2 A;  4O5R A;  2MYG A;  5DCH A;  1V2A A;  2O85 A;  3EVI A;  1A2L A;  3QOU A;  1DSB A;  1Z7P A;  4GST A;  3K8N A;  4TR4 A;  4GRF A;  3GUR A;  2YJH A;  2CZ3 A;  3V1W A;  1EOG A;  1GUM A;  3KD0 A;  1A0F A;  1XWA A;  5D73 A;  3APO A;  1TK0 B;  1G7E A;  5CAX A;  2OJL A;  4IKH A;  2P0G A;  1T00 A;  2VL3 A;  2FWF A;  2N5B A;  1HNA A;  1LJR A;  1QXH A;  5GAP D;  2WDU A;  1LBK A;  2VM2 A;  4F0C A;  2WGR A;  4O5U A;  3QR6 A;  5ECP B;  2V6O A;  4NPB A;  4RQR A;  1ACV A;  1K3L A;  4ZIJ A;  5CRD A;  1DBY A;  4OCE A;  4JR6 A;  2O7K A;  2TRX A;  3SWL A;  1GSY A;  2YWM A;  5IM9 A;  2H0I A;  3O6T A;  2OAD A;  4K8M A;  2QA2 A;  3DRN A;  1BED A;  2H1D A;  3UBK A;  1XOA A;  5F07 A;  5G1L A;  2DSA A;  4ULX A;  4GCI A;  3EC3 A;  3I43 A;  1PSQ A;  4FH8 A;  3GHA A;  1J0F A;  3D0Z A;  3GTU B;  2GS3 A;  3KCM A;  4AGS A;  2UZ8 A;  2CA8 A;  2AUV A;  4BWQ A;  2VCW A;  2H75 A;  1V9W A;  3GTU A;  2HRF A;  1GP1 A;  2YPM A;  19GS A;  2DJJ A;  2I3Y A;  3VPQ A;  4DSQ A;  1SL2 B;  2P5Q A;  1TW9 A;  2LNS A;  2MMO A;  2WFC A;  2FCH A;  3IR4 A;  4PUA A;  3HZ8 A;  3P7X A;  5JWQ B;  1NSW A;  3IAS 2;  1R4W A;  2DKH A;  1GTA A;  1SD8 A;  2NPB A;  1JZW A;  5A5K A;  3GX8 A;  3GKM A;  3TRP A;  2VLT A;  2AYT A;  3TKS C;  5D9X A;  2AJQ B;  2QA1 A;  1SJI A;  3M8N A;  2A2P A;  1ZL9 A;  3QD9 A;  4QL7 A;  3P2A A;  1EP8 A;  5EY6 A;  2C3Q A;  3HVX A;  4TR0 A;  4ML6 A;  2IMK A;  3GL5 A;  5JCG A;  4NXI A;  1Z5Y E;  3JCM L;  3CTG A;  4GSN A;  1AC1 A;  1TRU A;  1XXU A;  4Q5Q A;  4POL A;  4K9Z A;  4FYC A;  5IMA A;  2PBJ A;  4ZBB A;  3FZ9 A;  4WKW A;  3IOS A;  1U6T A;  2A2S A;  1OC8 A;  3ERF A;  2VO4 A;  4ZBA A;  5HQP A;  2AHE A;  3M1G A;  3IHQ A;  3GV1 A;  3U6V A;  3FK8 A;  4GF0 A;  2F8F A;  4BVX B;  3HKR A;  2ON7 A;  4X1U A;  4ACS A;  1SD9 A;  1PD2 1;  1ERU A;  2VL2 C;  4L5L A;  3ERW A;  3IC4 A;  3RPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...