2L5XA

Solution structure of il1a-s100a13 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
151
structure length
151
Chain Sequence
NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 alpha
publication title The IL1alpha-S100A13 heterotetrameric complex structure: a component in the non-classical pathway for interleukin 1alpha secretion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/transport protein
total genus 17
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2l5xA00
3S8KA 2YUGA 2KH2A 4I2SA 2RSTA 2VSEA 2MLLB 4X38A 2FDBM 2BFHA 2VUAA 1WD4A 3O4AA 4ZOTA 1AXMA 3PHZA 1AVUA 1PUMB 1HWNB 3OJMA 3JUTA 5F8SA 1MD6A 5BVPI 2HZ9A 2VU9A 3AKFA 4LO2C 4I6IA 4IZEA 5F8WA 1FQ9A 1BARA 5BXTA 2HW9A 4L4HA 4Q9PA 4ENDA 4JKXB 4HJJA 3I29B 5BQUC 4IYBA 3BRGC 3ZC8A 3AH4A 3AJ6A 3FJ8A 3V0AA 3VT1A 4L4IA 1BASA 3HBWA 4QBCA 4I4UA 4A7YA 1FWUA 4QBVA 2K43A 1K5VA 3V0BA 1FN0A 2KI6B 5DSSB 4GAFA 1ISXA 1R8OA 3OJVA 1I1EA 2RG9B 2AXMA 5G00A 4LO3A 1J0SA 3RSJA 1PWAA 4J2SA 2GO2A 3SNVA 4X3AA 4GP0A 4AN7B 3BTAA 1TP0A 1JLXA 1IT0A 3IM7A 4P0LA 2UUSA 2WRYA 4QKRA 4OWLA 4LO2A 1IJTA 3IIRA 2AQZA 5B2HA 1EV2A 1RY7A 4KBBA 3I2XA 2D20A 4G9MA 2VXTI 1IRPA 3KMVA 1T9FA 1V6WA 1W3GA 3BA4A 2DS0A 3OGFA 4EB2B 4JPZA 3ZC9A 5BQUA 1ITBA 4I4PA 3AKGA 4QO3A 1SR4A 2D44A 1QXMA 3HOMA 4LO8B 4JAWA 3K1XA 2Z48A 3TC2A 1I1BA 2MIBA 4I4YA 4I4RA 2F8XC 3Q7YA 3WO4A 4D8HA 4ISQA 3VT0A 2DRZA 1FV3A 4A7ZA 1G82A 1S0GA 1CVSA 4G6JA 4GOVA 4IQPA 3Q7WA 3BAGA 1DFCA 2D22A 1S0FA 1ISVA 4ZBVB 1MC9A 2MC2A 1HCEA 4HR6C 2D7RA 3P6JA 3CU1B 3RMXA 1G9CA 3UDAA 2NTDA 3IAGC 2FGFA 3CA1A 1VCLA 4OEGA 1G9DA 2RQ9A 2VXRA 4Q9GA 5DVHA 3BX1C 4QALA 3ZXDA 4XFTA 3WO2A 2L5XA 1CE7B 3O4CA 3WMUA 4I1EA 5FZYA 4HA2A 1DFQA 3HMYA 1DQGA 2IWTB 4I3NA 4IONA 4LO1A 4DEPA 3UD8A 1A8DA 2R9KB 3WO3A 5FZZA 3MPPG 4JRAA 1Q04A 1JT3A 4KEKA 1M16A 1XYFA 1XHBA 3FJ9A 3N7KA 1AVAC 2ESUA 1PZZA 1S0BA 4I0YA 4FVVA 2VSAA 4QKSA 4X37A 4I4VA 1GGPB 3P6IA 1II4A 4QD2C 2M49A 4QD2B 3BRFA 4LO7C 3N0KA 4LO7B 4XFUA 1ILR1 1RMLA 5HPZA 1PC8B 2GZBA 2KKIA 4GAIA 1ISYA 1V6UA 2Y9XE 5BP5C 1FV2A 3CA3A 4EKXB 4J2YA 1FMMS 3BAQA 4I96A 6I1BA 1K5UA 4IY8A 3WINC 3V79C 2NZ9A 4P0JA 1HWMB 3OBTA 4G6MA 4P6AA 1JTCA 3BAUA 3ZXGA 3OBRA 1Q1UA 4R6UB 1HCDA 1Z2VA 3O49A 1RG8A 5BXRA 5F90A 2NVHA 2NYYA 1YTOA 4F34A 5BXPA 3VEQA 1JT5A 3IM5A 2ZQNA 4JKQA 4XKIA 1WD3A 1JY0A 3H6RB 3AH2A 1IHKA 4D0TA 3FGMA 4DCKC 4QC4A 2QYIB 1HWPB 1KNMA 1SZ6B 1JT4A 1R8NA 1AF9A 1S0EA 3FJBA 4LO0C 3H6SE 4OWJA 4ZA3B 2FFVA 4OW4A 3HN1A 1FMZA 2F2FC 3C9ZA 3BAOA 3E8LC 3NJ5A 1EPWA 7I1BA 4I4OA 1S0CA 1OQLB 3VWCA 3CQAA 1P63A 3HALA 4IY9A 1Z0HA 3RTIB 3FJKA 2QN4A 4J2XA 4KEIA 2LIEA 2P39A 1T4QA 2FFUA 3N7JA 4H9WA 3WA1A 4F83A 5EG6C 4I4SA 1IOBA 3W9TA 2FO1A 4ZLBB 2Y9GA 3B9UA 4IHZA 2E4MC 2HWAA 1DZDA 5D61A 1TWMA 3UD7A 3FJHA 3NBCA 1BFFA 2Y9WC 1BLAA 4G1RA 1L2HA 3CRIA 3H6RA 4G9NA 2KI4A 3CA6A 1HWOB 5FZUA 3OJ2A 4XFSA 3VSFA 3A22A 3FJIA 1TIEA 3JRRA 3LLPA 4ZFUB 2DREA 3FJFA 5BOWA 3O4OA 3VUOA 21BIA 5EHAA 2HWMA 4LO0A 1W3AA 4P0KA 4I1BA 5EC5A 5FNXA 1QQKA 3BAHA 1AFCA 1BA7A 2F2FA 3D7WB 5I1BA 9ILBA 1S0LA 4H04A 4ISRA 3BRDA 1IILA 1YXWA 3A23A 1YF8B 3FUQA 3T8SA 1DIWA 2NP0A 2XOAA 2D23A 3AKHA 1TFMB 2VLCA 1DLLA 1WBCA 4I37A 4ZKTB 1ISWA 4KEJA 4PC4A 1PUUB 1G9BA 3CA4A 3BAVA 4LO3C 3AZWA 4KC3A 1NZKA 2D43A 1ABRB 3RTJB 1N4KA 2D7IA 4J23B 4J2KA 3FJJA 5FNWA 2AFGA 3UJ4A 3R4UA 2D1ZA 3PUBA 5GAQA 3AKIA 4OWKA 2Y9FA 1Q03A 3NBDA 2LIQA 3O5WB 2Q3NB 2KLLA 5D63A 4Q91A 1JQZA 4ZGRB 5JLVA 2BEBA 1G9AA 4OEEA 1DQOA 1ISZA 3MALA 3WMVA 4I7IA 4TLPA 3I2AA 1SR4C 2WBCA 1XG6A 3QR5A 3FUOA 1EVTA 3A07A 3H6QA 4I4QA 3ILAA 3N7LA 3NBNA 3N7MA 2ZR1B 4EEEB 1HKNA 1ONKB 3FJDA 3Q7XA 1BFCA 1V6XA 3BA7A 3EF2A 3CAHA 4Z8SB 41BIA 5F8YA 3CA0A 4I8MA 4OUJA 1QQLA 4USPA 5BP5A 1DJSB 2NM1A 2DRYA 4JP0A 5DUYA 3FJCA 3O3QA 2ET2A 1F31A 1IRAX 3WINA 3POKA 1S0DA 3P53A 3R4SA 1M2TB 1W3FA 3BADA 1XZZA 3PMEA 5D62A 2P23A 3F1RA 3AJ5A 1AVWB 1RZOB 1UPSA 1WBAA 1HIBA 2X2TA 4EFRA 3FJEA 2BEAA 3LTQA 4OEFA 4ZFYB 4LO1C 2IHOA 4Z9WB 3CA5A 5JMCA 4X39A 3HSMA 4WBCA 1BLDA 4EFPA 4GP3A 1NUNA 8I1BA 3AH1A 3AZVA 1TWEA 4D0ZA 3CRHA 4DENA 3CRGA 3FFZA 1DZCA 4II0A 3FJAA 3A21A 1EYLA 2ERMA 4ZFWB 3NBEA 3ZX7A 2Z49A 3O44A 4IZXA 1TTUA 4I4XA 3UJ0A 1E0OA 2X2SA 3OGGA 4EFQA 3S8JA 5E24E 1YBIA 4JQ0A 1AVXB 3BA5A 3F62B 2K8RA 2AAIB 3O4DA 1FWVA 4CJMA 1D0HA 3O4BA 3QYDA 1YYNA 3IM6A 1FGAA 2D24A 3VSZA 1V6VA 5DZUA 3RMYA 4GOYA 3V0AB 31BIA 2J3PA 2I1BA 2K4AB 4FGFA 1TOOA 3PG0A 1BFGA 4A7KA 5BXSA 2Q9XA 3UD9A 1JT7A 4YOLA 1BFBA 1JLYA 4USOA 1Z4SA 4AN6A 3V0BB 3VT2A 3BB2A 2ZQOA 2E4MA
chains in the Genus database with same CATH superfamily
3S8KA 2YUGA 2KH2A 4I2SA 2RSTA 2VSEA 4MZFB 2MLLB 4X38A 2FDBM 2BFHA 2VUAA 1WD4A 3O4AA 4ZOTA 1AXMA 3PHZA 1AVUA 1PUMB 1HWNB 3OJMA 3JUTA 5F8SA 1MD6A 5BVPI 2HZ9A 2VU9A 3AKFA 4LO2C 4I6IA 4IZEA 5F8WA 1FQ9A 1BARA 5BXTA 2HW9A 4L4HA 4Q9PA 4ENDA 4JKXB 4HJJA 3I29B 5BQUC 4IYBA 3BRGC 3ZC8A 3AH4A 3AJ6A 3FJ8A 3V0AA 3VT1A 4L4IA 1BASA 3HBWA 4QBCA 4I4UA 4A7YA 1FWUA 4QBVA 2K43A 1K5VA 3V0BA 1FN0A 2KI6B 5DSSB 4GAFA 1ISXA 1R8OA 3OJVA 1I1EA 2RG9B 2AXMA 5G00A 4LO3A 1J0SA 3RSJA 1PWAA 4J2SA 2GO2A 3SNVA 4X3AA 4GP0A 4AN7B 3BTAA 1TP0A 1JLXA 1IT0A 3IM7A 4P0LA 2UUSA 2WRYA 4QKRA 4OWLA 4LO2A 1IJTA 3IIRA 2AQZA 5B2HA 1EV2A 1RY7A 4KBBA 3I2XA 2D20A 4G9MA 2VXTI 1IRPA 3KMVA 1T9FA 1V6WA 1W3GA 3BA4A 2DS0A 3OGFA 4EB2B 4JPZA 3ZC9A 5BQUA 1ITBA 4I4PA 4H75A 3AKGA 4QO3A 1SR4A 2D44A 1QXMA 3HOMA 4LO8B 4JAWA 3K1XA 2Z48A 3TC2A 1I1BA 2MIBA 4I4YA 4I4RA 2F8XC 3Q7YA 3WO4A 4D8HA 4ISQA 3VT0A 2DRZA 1FV3A 4A7ZA 1G82A 1S0GA 1CVSA 4G6JA 4GOVA 4IQPA 3Q7WA 3BAGA 1DFCA 2D22A 1S0FA 1ISVA 4ZBVB 1MC9A 2MC2A 1HCEA 4HR6C 2D7RA 3P6JA 3CU1B 3RMXA 1G9CA 3UDAA 2NTDA 3IAGC 2FGFA 3CA1A 1VCLA 4OEGA 1G9DA 2RQ9A 2VXRA 4Q9GA 5DVHA 3BX1C 4QALA 3ZXDA 4XFTA 3WO2A 2L5XA 1CE7B 3O4CA 3WMUA 4I1EA 5FZYA 4HA2A 1DFQA 3HMYA 1DQGA 2IWTB 4I3NA 4IONA 4LO1A 4DEPA 3UD8A 1A8DA 2R9KB 3WO3A 5FZZA 3MPPG 4JRAA 1Q04A 1JT3A 4KEKA 1M16A 1XYFA 1XHBA 3FJ9A 3N7KA 1AVAC 2ESUA 1PZZA 1S0BA 4I0YA 4FVVA 2VSAA 4QKSA 4X37A 4I4VA 1GGPB 3P6IA 1II4A 4QD2C 2M49A 4QD2B 3BRFA 4LO7C 3N0KA 4LO7B 4XFUA 1ILR1 1RMLA 5HPZA 1PC8B 2GZBA 2KKIA 4GAIA 1ISYA 1V6UA 2Y9XE 5BP5C 1FV2A 3CA3A 4EKXB 4J2YA 1FMMS 3BAQA 4I96A 6I1BA 1K5UA 4IY8A 3WINC 3V79C 2NZ9A 4P0JA 1HWMB 3OBTA 4G6MA 4P6AA 1JTCA 3BAUA 3ZXGA 3OBRA 1Q1UA 4R6UB 1HCDA 1Z2VA 3O49A 1RG8A 5BXRA 5F90A 2NVHA 2NYYA 1YTOA 4F34A 5BXPA 3VEQA 1JT5A 3IM5A 2ZQNA 4JKQA 4XKIA 4MZHA 1WD3A 1JY0A 3H6RB 3AH2A 1IHKA 4D0TA 3FGMA 4DCKC 4QC4A 2QYIB 1HWPB 1KNMA 1SZ6B 1JT4A 1R8NA 1AF9A 1S0EA 3FJBA 4LO0C 3H6SE 4OWJA 4ZA3B 2FFVA 4OW4A 3HN1A 1FMZA 2F2FC 3C9ZA 3BAOA 3E8LC 3NJ5A 1EPWA 7I1BA 4I4OA 1S0CA 1OQLB 3VWCA 3CQAA 1P63A 3HALA 4IY9A 1Z0HA 3RTIB 3FJKA 2QN4A 4J2XA 4KEIA 2LIEA 2P39A 1T4QA 2FFUA 3N7JA 4H9WA 3WA1A 4F83A 5EG6C 4I4SA 1IOBA 3W9TA 2FO1A 4ZLBB 2Y9GA 3B9UA 4IHZA 2E4MC 2HWAA 1DZDA 5D61A 1TWMA 3UD7A 3FJHA 3NBCA 1BFFA 2Y9WC 1BLAA 4G1RA 1L2HA 3CRIA 3H6RA 4G9NA 2KI4A 3CA6A 1HWOB 5FZUA 3OJ2A 4XFSA 3VSFA 3A22A 3FJIA 1TIEA 3JRRA 3LLPA 4ZFUB 2DREA 3FJFA 5BOWA 3O4OA 3VUOA 21BIA 5EHAA 2HWMA 4LO0A 1W3AA 4P0KA 4I1BA 5EC5A 5FNXA 1QQKA 3BAHA 1AFCA 1BA7A 2F2FA 3D7WB 5I1BA 9ILBA 1S0LA 4H04A 4ISRA 3BRDA 1IILA 1YXWA 3A23A 1YF8B 3FUQA 3T8SA 1DIWA 2NP0A 2XOAA 2D23A 3AKHA 1TFMB 2VLCA 1DLLA 1WBCA 4I37A 4ZKTB 1ISWA 4KEJA 4PC4A 1PUUB 1G9BA 3CA4A 3BAVA 4LO3C 3AZWA 4MZGB 4KC3A 1NZKA 2D43A 1ABRB 3RTJB 1N4KA 2D7IA 4J23B 4J2KA 3FJJA 5FNWA 2AFGA 3UJ4A 3R4UA 2D1ZA 3PUBA 5GAQA 3AKIA 4OWKA 2Y9FA 1Q03A 3NBDA 2LIQA 3O5WB 2Q3NB 2KLLA 5D63A 4Q91A 1JQZA 4ZGRB 5JLVA 2BEBA 1G9AA 4OEEA 1DQOA 1ISZA 3MALA 3WMVA 4I7IA 4TLPA 3I2AA 1SR4C 2WBCA 4UY4A 1XG6A 3QR5A 3FUOA 1EVTA 3A07A 3H6QA 4I4QA 3ILAA 3N7LA 3NBNA 3N7MA 2ZR1B 4EEEB 1HKNA 1ONKB 3FJDA 3Q7XA 1BFCA 1V6XA 3BA7A 3EF2A 3CAHA 4Z8SB 41BIA 5F8YA 3CA0A 4I8MA 4OUJA 1QQLA 4USPA 5BP5A 1DJSB 2NM1A 2DRYA 4JP0A 5DUYA 2NS2A 3FJCA 3O3QA 2ET2A 1F31A 1IRAX 3WINA 3POKA 1S0DA 3P53A 3R4SA 1M2TB 1W3FA 3BADA 1XZZA 3PMEA 5D62A 2P23A 3F1RA 3AJ5A 1AVWB 1RZOB 1UPSA 1WBAA 1HIBA 2X2TA 4EFRA 3FJEA 2BEAA 3LTQA 4OEFA 4ZFYB 4LO1C 2IHOA 4Z9WB 3CA5A 5JMCA 4X39A 3HSMA 4WBCA 1BLDA 4EFPA 4GP3A 1NUNA 8I1BA 3AH1A 3AZVA 1TWEA 4D0ZA 3CRHA 4DENA 3CRGA 3FFZA 1DZCA 4II0A 3FJAA 3A21A 1EYLA 2ERMA 4ZFWB 3NBEA 3ZX7A 2Z49A 3O44A 4IZXA 1TTUA 4I4XA 3UJ0A 1E0OA 2X2SA 3OGGA 4EFQA 3S8JA 5E24E 1YBIA 4JQ0A 1AVXB 3BA5A 3F62B 2K8RA 2AAIB 3O4DA 1FWVA 4CJMA 1D0HA 3O4BA 3QYDA 1YYNA 3IM6A 1FGAA 2D24A 3VSZA 1V6VA 5DZUA 3RMYA 4GOYA 3V0AB 31BIA 2J3PA 2I1BA 2K4AB 4FGFA 1TOOA 3PG0A 1BFGA 4A7KA 5BXSA 2Q9XA 3UD9A 1JT7A 4YOLA 1BFBA 1JLYA 4USOA 1Z4SA 4AN6A 3V0BB 3VT2A 3BB2A 2ZQOA 2E4MA
chains in the Genus database with same CATH topology
3S8KA 2YUGA 2KH2A 4I2SA 2RSTA 2VSEA 4MZFB 2MLLB 4X38A 2FDBM 2BFHA 2VUAA 1WD4A 3O4AA 4ZOTA 1AXMA 3PHZA 1AVUA 1PUMB 1HWNB 3OJMA 3JUTA 5F8SA 1MD6A 5BVPI 2HZ9A 2VU9A 3AKFA 4LO2C 4I6IA 4IZEA 5F8WA 1FQ9A 1BARA 5BXTA 2HW9A 4L4HA 4Q9PA 4ENDA 4JKXB 4HJJA 3I29B 5BQUC 4IYBA 3BRGC 3ZC8A 3AH4A 3AJ6A 3FJ8A 3V0AA 3VT1A 4L4IA 1BASA 3HBWA 4QBCA 4I4UA 4A7YA 1FWUA 4QBVA 2K43A 1K5VA 3V0BA 1FN0A 2KI6B 5DSSB 4GAFA 1ISXA 1R8OA 3OJVA 1I1EA 2RG9B 2AXMA 5G00A 4LO3A 1J0SA 3RSJA 1PWAA 4J2SA 2GO2A 3SNVA 4X3AA 4GP0A 4AN7B 3BTAA 1TP0A 1JLXA 1IT0A 3IM7A 4P0LA 2UUSA 2WRYA 4QKRA 4OWLA 4LO2A 1IJTA 3IIRA 2AQZA 5B2HA 1EV2A 1RY7A 4KBBA 3I2XA 2D20A 4G9MA 2VXTI 1IRPA 3KMVA 1T9FA 1V6WA 1W3GA 3BA4A 2DS0A 3OGFA 4EB2B 4JPZA 3ZC9A 5BQUA 1ITBA 4I4PA 4H75A 3AKGA 4QO3A 1SR4A 2D44A 1QXMA 3HOMA 4LO8B 4JAWA 3K1XA 2Z48A 3TC2A 1I1BA 2MIBA 4I4YA 4I4RA 2F8XC 3Q7YA 3WO4A 4D8HA 4ISQA 3VT0A 2DRZA 1FV3A 4A7ZA 1G82A 1S0GA 1CVSA 4G6JA 4GOVA 4IQPA 3Q7WA 3BAGA 1DFCA 2D22A 1S0FA 1ISVA 4ZBVB 1MC9A 2MC2A 1HCEA 4HR6C 2D7RA 3P6JA 3CU1B 3RMXA 1G9CA 3UDAA 2NTDA 3IAGC 2FGFA 3CA1A 1VCLA 4OEGA 1G9DA 2RQ9A 2VXRA 4Q9GA 5DVHA 3BX1C 4QALA 3ZXDA 4XFTA 3WO2A 2L5XA 1CE7B 3O4CA 3WMUA 4I1EA 5FZYA 4HA2A 1DFQA 3HMYA 1DQGA 2IWTB 4I3NA 4IONA 4LO1A 4DEPA 3UD8A 1A8DA 2R9KB 3WO3A 5FZZA 3MPPG 4JRAA 1Q04A 1JT3A 4KEKA 1M16A 1XYFA 1XHBA 3FJ9A 3N7KA 1AVAC 2ESUA 1PZZA 1S0BA 4I0YA 4FVVA 2VSAA 4QKSA 4X37A 4I4VA 1GGPB 3P6IA 1II4A 4QD2C 2M49A 4QD2B 3BRFA 4LO7C 3N0KA 4LO7B 4XFUA 1ILR1 1RMLA 5HPZA 1PC8B 2GZBA 2KKIA 4GAIA 1ISYA 1V6UA 2Y9XE 5BP5C 1FV2A 3CA3A 4EKXB 4J2YA 1FMMS 3BAQA 4I96A 6I1BA 1K5UA 4IY8A 3WINC 3V79C 2NZ9A 4P0JA 1HWMB 3OBTA 4G6MA 4P6AA 1JTCA 3BAUA 3ZXGA 3OBRA 1Q1UA 4R6UB 1HCDA 1Z2VA 3O49A 1RG8A 5BXRA 5F90A 2NVHA 2NYYA 1YTOA 4F34A 5BXPA 3VEQA 1JT5A 3IM5A 2ZQNA 4JKQA 4XKIA 4MZHA 1WD3A 1JY0A 3H6RB 3AH2A 1IHKA 4D0TA 3FGMA 4DCKC 4QC4A 2QYIB 1HWPB 1KNMA 1SZ6B 1JT4A 1R8NA 1AF9A 1S0EA 3FJBA 4LO0C 3H6SE 4OWJA 4ZA3B 2FFVA 4OW4A 3HN1A 1FMZA 2F2FC 3C9ZA 3BAOA 3E8LC 3NJ5A 1EPWA 7I1BA 4I4OA 1S0CA 1OQLB 3VWCA 3CQAA 1P63A 3HALA 4IY9A 1Z0HA 3RTIB 3FJKA 2QN4A 4J2XA 4KEIA 2LIEA 2P39A 1T4QA 2FFUA 3N7JA 4H9WA 3WA1A 4F83A 5EG6C 4I4SA 1IOBA 3W9TA 2FO1A 4ZLBB 2Y9GA 3B9UA 4IHZA 2E4MC 2HWAA 1DZDA 5D61A 1TWMA 3UD7A 3FJHA 3NBCA 1BFFA 2Y9WC 1BLAA 4G1RA 1L2HA 3CRIA 3H6RA 4G9NA 2KI4A 3CA6A 1HWOB 5FZUA 3OJ2A 4XFSA 3VSFA 3A22A 3FJIA 1TIEA 3JRRA 3LLPA 4ZFUB 2DREA 3FJFA 5BOWA 3O4OA 3VUOA 21BIA 5EHAA 2HWMA 4LO0A 1W3AA 4P0KA 4I1BA 5EC5A 5FNXA 1QQKA 3BAHA 1AFCA 1BA7A 2F2FA 3D7WB 5I1BA 9ILBA 1S0LA 4H04A 4ISRA 3BRDA 1IILA 1YXWA 3A23A 1YF8B 3FUQA 3T8SA 1DIWA 2NP0A 2XOAA 2D23A 3AKHA 1TFMB 2VLCA 1DLLA 1WBCA 4I37A 4ZKTB 1ISWA 4KEJA 4PC4A 1PUUB 1G9BA 3CA4A 3BAVA 4LO3C 3AZWA 4MZGB 4KC3A 1NZKA 2D43A 1ABRB 3RTJB 1N4KA 2D7IA 4J23B 4J2KA 3FJJA 5FNWA 2AFGA 3UJ4A 3R4UA 2D1ZA 3PUBA 5GAQA 3AKIA 4OWKA 2Y9FA 1Q03A 3NBDA 2LIQA 3O5WB 2Q3NB 2KLLA 5D63A 4Q91A 1JQZA 4ZGRB 5JLVA 2BEBA 1G9AA 4OEEA 1DQOA 1ISZA 3MALA 3WMVA 4I7IA 4TLPA 3I2AA 1SR4C 2WBCA 4UY4A 1XG6A 3QR5A 3FUOA 1EVTA 3A07A 3H6QA 4I4QA 3ILAA 3N7LA 3NBNA 3N7MA 2ZR1B 4EEEB 1HKNA 1ONKB 3FJDA 3Q7XA 1BFCA 1V6XA 3BA7A 3EF2A 3CAHA 4Z8SB 41BIA 5F8YA 3CA0A 4I8MA 4OUJA 1QQLA 4USPA 5BP5A 1DJSB 2NM1A 2DRYA 4JP0A 5DUYA 2NS2A 3FJCA 3O3QA 2ET2A 1F31A 1IRAX 3WINA 3POKA 1S0DA 3P53A 3R4SA 1M2TB 1W3FA 3BADA 1XZZA 3PMEA 5D62A 2P23A 3F1RA 3AJ5A 1AVWB 1RZOB 1UPSA 1WBAA 1HIBA 2X2TA 4EFRA 3FJEA 2BEAA 3LTQA 4OEFA 4ZFYB 4LO1C 2IHOA 4Z9WB 3CA5A 5JMCA 4X39A 3HSMA 4WBCA 1BLDA 4EFPA 4GP3A 1NUNA 8I1BA 3AH1A 3AZVA 1TWEA 4D0ZA 3CRHA 4DENA 3CRGA 3FFZA 1DZCA 4II0A 3FJAA 3A21A 1EYLA 2ERMA 4ZFWB 3NBEA 3ZX7A 2Z49A 3O44A 4IZXA 1TTUA 4I4XA 3UJ0A 1E0OA 2X2SA 3OGGA 4EFQA 3S8JA 5E24E 1YBIA 4JQ0A 1AVXB 3BA5A 3F62B 2K8RA 2AAIB 3O4DA 1FWVA 4CJMA 1D0HA 3O4BA 3QYDA 1YYNA 3IM6A 1FGAA 2D24A 3VSZA 1V6VA 5DZUA 3RMYA 4GOYA 3V0AB 31BIA 2J3PA 2I1BA 2K4AB 4FGFA 1TOOA 3PG0A 1BFGA 4A7KA 5BXSA 2Q9XA 3UD9A 1JT7A 4YOLA 1BFBA 1JLYA 4USOA 1Z4SA 4AN6A 3V0BB 3VT2A 3BB2A 2ZQOA 2E4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S8K A;  2YUG A;  2KH2 A;  4I2S A;  2RST A;  2VSE A;  2MLL B;  4X38 A;  2FDB M;  2BFH A;  2VUA A;  1WD4 A;  3O4A A;  4ZOT A;  1AXM A;  3PHZ A;  1AVU A;  1PUM B;  1HWN B;  3OJM A;  3JUT A;  5F8S A;  1MD6 A;  5BVP I;  2HZ9 A;  2VU9 A;  3AKF A;  4LO2 C;  4I6I A;  4IZE A;  5F8W A;  1FQ9 A;  1BAR A;  5BXT A;  2HW9 A;  4L4H A;  4Q9P A;  4END A;  4JKX B;  4HJJ A;  3I29 B;  5BQU C;  4IYB A;  3BRG C;  3ZC8 A;  3AH4 A;  3AJ6 A;  3FJ8 A;  3V0A A;  3VT1 A;  4L4I A;  1BAS A;  3HBW A;  4QBC A;  4I4U A;  4A7Y A;  1FWU A;  4QBV A;  2K43 A;  1K5V A;  3V0B A;  1FN0 A;  2KI6 B;  5DSS B;  4GAF A;  1ISX A;  1R8O A;  3OJV A;  1I1E A;  2RG9 B;  2AXM A;  5G00 A;  4LO3 A;  1J0S A;  3RSJ A;  1PWA A;  4J2S A;  2GO2 A;  3SNV A;  4X3A A;  4GP0 A;  4AN7 B;  3BTA A;  1TP0 A;  1JLX A;  1IT0 A;  3IM7 A;  4P0L A;  2UUS A;  2WRY A;  4QKR A;  4OWL A;  4LO2 A;  1IJT A;  3IIR A;  2AQZ A;  5B2H A;  1EV2 A;  1RY7 A;  4KBB A;  3I2X A;  2D20 A;  4G9M A;  2VXT I;  1IRP A;  3KMV A;  1T9F A;  1V6W A;  1W3G A;  3BA4 A;  2DS0 A;  3OGF A;  4EB2 B;  4JPZ A;  3ZC9 A;  5BQU A;  1ITB A;  4I4P A;  3AKG A;  4QO3 A;  1SR4 A;  2D44 A;  1QXM A;  3HOM A;  4LO8 B;  4JAW A;  3K1X A;  2Z48 A;  3TC2 A;  1I1B A;  2MIB A;  4I4Y A;  4I4R A;  2F8X C;  3Q7Y A;  3WO4 A;  4D8H A;  4ISQ A;  3VT0 A;  2DRZ A;  1FV3 A;  4A7Z A;  1G82 A;  1S0G A;  1CVS A;  4G6J A;  4GOV A;  4IQP A;  3Q7W A;  3BAG A;  1DFC A;  2D22 A;  1S0F A;  1ISV A;  4ZBV B;  1MC9 A;  2MC2 A;  1HCE A;  4HR6 C;  2D7R A;  3P6J A;  3CU1 B;  3RMX A;  1G9C A;  3UDA A;  2NTD A;  3IAG C;  2FGF A;  3CA1 A;  1VCL A;  4OEG A;  1G9D A;  2RQ9 A;  2VXR A;  4Q9G A;  5DVH A;  3BX1 C;  4QAL A;  3ZXD A;  4XFT A;  3WO2 A;  2L5X A;  1CE7 B;  3O4C A;  3WMU A;  4I1E A;  5FZY A;  4HA2 A;  1DFQ A;  3HMY A;  1DQG A;  2IWT B;  4I3N A;  4ION A;  4LO1 A;  4DEP A;  3UD8 A;  1A8D A;  2R9K B;  3WO3 A;  5FZZ A;  3MPP G;  4JRA A;  1Q04 A;  1JT3 A;  4KEK A;  1M16 A;  1XYF A;  1XHB A;  3FJ9 A;  3N7K A;  1AVA C;  2ESU A;  1PZZ A;  1S0B A;  4I0Y A;  4FVV A;  2VSA A;  4QKS A;  4X37 A;  4I4V A;  1GGP B;  3P6I A;  1II4 A;  4QD2 C;  2M49 A;  4QD2 B;  3BRF A;  4LO7 C;  3N0K A;  4LO7 B;  4XFU A;  1ILR 1;  1RML A;  5HPZ A;  1PC8 B;  2GZB A;  2KKI A;  4GAI A;  1ISY A;  1V6U A;  2Y9X E;  5BP5 C;  1FV2 A;  3CA3 A;  4EKX B;  4J2Y A;  1FMM S;  3BAQ A;  4I96 A;  6I1B A;  1K5U A;  4IY8 A;  3WIN C;  3V79 C;  2NZ9 A;  4P0J A;  1HWM B;  3OBT A;  4G6M A;  4P6A A;  1JTC A;  3BAU A;  3ZXG A;  3OBR A;  1Q1U A;  4R6U B;  1HCD A;  1Z2V A;  3O49 A;  1RG8 A;  5BXR A;  5F90 A;  2NVH A;  2NYY A;  1YTO A;  4F34 A;  5BXP A;  3VEQ A;  1JT5 A;  3IM5 A;  2ZQN A;  4JKQ A;  4XKI A;  1WD3 A;  1JY0 A;  3H6R B;  3AH2 A;  1IHK A;  4D0T A;  3FGM A;  4DCK C;  4QC4 A;  2QYI B;  1HWP B;  1KNM A;  1SZ6 B;  1JT4 A;  1R8N A;  1AF9 A;  1S0E A;  3FJB A;  4LO0 C;  3H6S E;  4OWJ A;  4ZA3 B;  2FFV A;  4OW4 A;  3HN1 A;  1FMZ A;  2F2F C;  3C9Z A;  3BAO A;  3E8L C;  3NJ5 A;  1EPW A;  7I1B A;  4I4O A;  1S0C A;  1OQL B;  3VWC A;  3CQA A;  1P63 A;  3HAL A;  4IY9 A;  1Z0H A;  3RTI B;  3FJK A;  2QN4 A;  4J2X A;  4KEI A;  2LIE A;  2P39 A;  1T4Q A;  2FFU A;  3N7J A;  4H9W A;  3WA1 A;  4F83 A;  5EG6 C;  4I4S A;  1IOB A;  3W9T A;  2FO1 A;  4ZLB B;  2Y9G A;  3B9U A;  4IHZ A;  2E4M C;  2HWA A;  1DZD A;  5D61 A;  1TWM A;  3UD7 A;  3FJH A;  3NBC A;  1BFF A;  2Y9W C;  1BLA A;  4G1R A;  1L2H A;  3CRI A;  3H6R A;  4G9N A;  2KI4 A;  3CA6 A;  1HWO B;  5FZU A;  3OJ2 A;  4XFS A;  3VSF A;  3A22 A;  3FJI A;  1TIE A;  3JRR A;  3LLP A;  4ZFU B;  2DRE A;  3FJF A;  5BOW A;  3O4O A;  3VUO A;  21BI A;  5EHA A;  2HWM A;  4LO0 A;  1W3A A;  4P0K A;  4I1B A;  5EC5 A;  5FNX A;  1QQK A;  3BAH A;  1AFC A;  1BA7 A;  2F2F A;  3D7W B;  5I1B A;  9ILB A;  1S0L A;  4H04 A;  4ISR A;  3BRD A;  1IIL A;  1YXW A;  3A23 A;  1YF8 B;  3FUQ A;  3T8S A;  1DIW A;  2NP0 A;  2XOA A;  2D23 A;  3AKH A;  1TFM B;  2VLC A;  1DLL A;  1WBC A;  4I37 A;  4ZKT B;  1ISW A;  4KEJ A;  4PC4 A;  1PUU B;  1G9B A;  3CA4 A;  3BAV A;  4LO3 C;  3AZW A;  4KC3 A;  1NZK A;  2D43 A;  1ABR B;  3RTJ B;  1N4K A;  2D7I A;  4J23 B;  4J2K A;  3FJJ A;  5FNW A;  2AFG A;  3UJ4 A;  3R4U A;  2D1Z A;  3PUB A;  5GAQ A;  3AKI A;  4OWK A;  2Y9F A;  1Q03 A;  3NBD A;  2LIQ A;  3O5W B;  2Q3N B;  2KLL A;  5D63 A;  4Q91 A;  1JQZ A;  4ZGR B;  5JLV A;  2BEB A;  1G9A A;  4OEE A;  1DQO A;  1ISZ A;  3MAL A;  3WMV A;  4I7I A;  4TLP A;  3I2A A;  1SR4 C;  2WBC A;  1XG6 A;  3QR5 A;  3FUO A;  1EVT A;  3A07 A;  3H6Q A;  4I4Q A;  3ILA A;  3N7L A;  3NBN A;  3N7M A;  2ZR1 B;  4EEE B;  1HKN A;  1ONK B;  3FJD A;  3Q7X A;  1BFC A;  1V6X A;  3BA7 A;  3EF2 A;  3CAH A;  4Z8S B;  41BI A;  5F8Y A;  3CA0 A;  4I8M A;  4OUJ A;  1QQL A;  4USP A;  5BP5 A;  1DJS B;  2NM1 A;  2DRY A;  4JP0 A;  5DUY A;  3FJC A;  3O3Q A;  2ET2 A;  1F31 A;  1IRA X;  3WIN A;  3POK A;  1S0D A;  3P53 A;  3R4S A;  1M2T B;  1W3F A;  3BAD A;  1XZZ A;  3PME A;  5D62 A;  2P23 A;  3F1R A;  3AJ5 A;  1AVW B;  1RZO B;  1UPS A;  1WBA A;  1HIB A;  2X2T A;  4EFR A;  3FJE A;  2BEA A;  3LTQ A;  4OEF A;  4ZFY B;  4LO1 C;  2IHO A;  4Z9W B;  3CA5 A;  5JMC A;  4X39 A;  3HSM A;  4WBC A;  1BLD A;  4EFP A;  4GP3 A;  1NUN A;  8I1B A;  3AH1 A;  3AZV A;  1TWE A;  4D0Z A;  3CRH A;  4DEN A;  3CRG A;  3FFZ A;  1DZC A;  4II0 A;  3FJA A;  3A21 A;  1EYL A;  2ERM A;  4ZFW B;  3NBE A;  3ZX7 A;  2Z49 A;  3O44 A;  4IZX A;  1TTU A;  4I4X A;  3UJ0 A;  1E0O A;  2X2S A;  3OGG A;  4EFQ A;  3S8J A;  5E24 E;  1YBI A;  4JQ0 A;  1AVX B;  3BA5 A;  3F62 B;  2K8R A;  2AAI B;  3O4D A;  1FWV A;  4CJM A;  1D0H A;  3O4B A;  3QYD A;  1YYN A;  3IM6 A;  1FGA A;  2D24 A;  3VSZ A;  1V6V A;  5DZU A;  3RMY A;  4GOY A;  3V0A B;  31BI A;  2J3P A;  2I1B A;  2K4A B;  4FGF A;  1TOO A;  3PG0 A;  1BFG A;  4A7K A;  5BXS A;  2Q9X A;  3UD9 A;  1JT7 A;  4YOL A;  1BFB A;  1JLY A;  4USO A;  1Z4S A;  4AN6 A;  3V0B B;  3VT2 A;  3BB2 A;  2ZQO A;  2E4M A; 
#chains in the Genus database with same CATH topology
 3S8K A;  2YUG A;  2KH2 A;  4I2S A;  2RST A;  2VSE A;  4MZF B;  2MLL B;  4X38 A;  2FDB M;  2BFH A;  2VUA A;  1WD4 A;  3O4A A;  4ZOT A;  1AXM A;  3PHZ A;  1AVU A;  1PUM B;  1HWN B;  3OJM A;  3JUT A;  5F8S A;  1MD6 A;  5BVP I;  2HZ9 A;  2VU9 A;  3AKF A;  4LO2 C;  4I6I A;  4IZE A;  5F8W A;  1FQ9 A;  1BAR A;  5BXT A;  2HW9 A;  4L4H A;  4Q9P A;  4END A;  4JKX B;  4HJJ A;  3I29 B;  5BQU C;  4IYB A;  3BRG C;  3ZC8 A;  3AH4 A;  3AJ6 A;  3FJ8 A;  3V0A A;  3VT1 A;  4L4I A;  1BAS A;  3HBW A;  4QBC A;  4I4U A;  4A7Y A;  1FWU A;  4QBV A;  2K43 A;  1K5V A;  3V0B A;  1FN0 A;  2KI6 B;  5DSS B;  4GAF A;  1ISX A;  1R8O A;  3OJV A;  1I1E A;  2RG9 B;  2AXM A;  5G00 A;  4LO3 A;  1J0S A;  3RSJ A;  1PWA A;  4J2S A;  2GO2 A;  3SNV A;  4X3A A;  4GP0 A;  4AN7 B;  3BTA A;  1TP0 A;  1JLX A;  1IT0 A;  3IM7 A;  4P0L A;  2UUS A;  2WRY A;  4QKR A;  4OWL A;  4LO2 A;  1IJT A;  3IIR A;  2AQZ A;  5B2H A;  1EV2 A;  1RY7 A;  4KBB A;  3I2X A;  2D20 A;  4G9M A;  2VXT I;  1IRP A;  3KMV A;  1T9F A;  1V6W A;  1W3G A;  3BA4 A;  2DS0 A;  3OGF A;  4EB2 B;  4JPZ A;  3ZC9 A;  5BQU A;  1ITB A;  4I4P A;  4H75 A;  3AKG A;  4QO3 A;  1SR4 A;  2D44 A;  1QXM A;  3HOM A;  4LO8 B;  4JAW A;  3K1X A;  2Z48 A;  3TC2 A;  1I1B A;  2MIB A;  4I4Y A;  4I4R A;  2F8X C;  3Q7Y A;  3WO4 A;  4D8H A;  4ISQ A;  3VT0 A;  2DRZ A;  1FV3 A;  4A7Z A;  1G82 A;  1S0G A;  1CVS A;  4G6J A;  4GOV A;  4IQP A;  3Q7W A;  3BAG A;  1DFC A;  2D22 A;  1S0F A;  1ISV A;  4ZBV B;  1MC9 A;  2MC2 A;  1HCE A;  4HR6 C;  2D7R A;  3P6J A;  3CU1 B;  3RMX A;  1G9C A;  3UDA A;  2NTD A;  3IAG C;  2FGF A;  3CA1 A;  1VCL A;  4OEG A;  1G9D A;  2RQ9 A;  2VXR A;  4Q9G A;  5DVH A;  3BX1 C;  4QAL A;  3ZXD A;  4XFT A;  3WO2 A;  2L5X A;  1CE7 B;  3O4C A;  3WMU A;  4I1E A;  5FZY A;  4HA2 A;  1DFQ A;  3HMY A;  1DQG A;  2IWT B;  4I3N A;  4ION A;  4LO1 A;  4DEP A;  3UD8 A;  1A8D A;  2R9K B;  3WO3 A;  5FZZ A;  3MPP G;  4JRA A;  1Q04 A;  1JT3 A;  4KEK A;  1M16 A;  1XYF A;  1XHB A;  3FJ9 A;  3N7K A;  1AVA C;  2ESU A;  1PZZ A;  1S0B A;  4I0Y A;  4FVV A;  2VSA A;  4QKS A;  4X37 A;  4I4V A;  1GGP B;  3P6I A;  1II4 A;  4QD2 C;  2M49 A;  4QD2 B;  3BRF A;  4LO7 C;  3N0K A;  4LO7 B;  4XFU A;  1ILR 1;  1RML A;  5HPZ A;  1PC8 B;  2GZB A;  2KKI A;  4GAI A;  1ISY A;  1V6U A;  2Y9X E;  5BP5 C;  1FV2 A;  3CA3 A;  4EKX B;  4J2Y A;  1FMM S;  3BAQ A;  4I96 A;  6I1B A;  1K5U A;  4IY8 A;  3WIN C;  3V79 C;  2NZ9 A;  4P0J A;  1HWM B;  3OBT A;  4G6M A;  4P6A A;  1JTC A;  3BAU A;  3ZXG A;  3OBR A;  1Q1U A;  4R6U B;  1HCD A;  1Z2V A;  3O49 A;  1RG8 A;  5BXR A;  5F90 A;  2NVH A;  2NYY A;  1YTO A;  4F34 A;  5BXP A;  3VEQ A;  1JT5 A;  3IM5 A;  2ZQN A;  4JKQ A;  4XKI A;  4MZH A;  1WD3 A;  1JY0 A;  3H6R B;  3AH2 A;  1IHK A;  4D0T A;  3FGM A;  4DCK C;  4QC4 A;  2QYI B;  1HWP B;  1KNM A;  1SZ6 B;  1JT4 A;  1R8N A;  1AF9 A;  1S0E A;  3FJB A;  4LO0 C;  3H6S E;  4OWJ A;  4ZA3 B;  2FFV A;  4OW4 A;  3HN1 A;  1FMZ A;  2F2F C;  3C9Z A;  3BAO A;  3E8L C;  3NJ5 A;  1EPW A;  7I1B A;  4I4O A;  1S0C A;  1OQL B;  3VWC A;  3CQA A;  1P63 A;  3HAL A;  4IY9 A;  1Z0H A;  3RTI B;  3FJK A;  2QN4 A;  4J2X A;  4KEI A;  2LIE A;  2P39 A;  1T4Q A;  2FFU A;  3N7J A;  4H9W A;  3WA1 A;  4F83 A;  5EG6 C;  4I4S A;  1IOB A;  3W9T A;  2FO1 A;  4ZLB B;  2Y9G A;  3B9U A;  4IHZ A;  2E4M C;  2HWA A;  1DZD A;  5D61 A;  1TWM A;  3UD7 A;  3FJH A;  3NBC A;  1BFF A;  2Y9W C;  1BLA A;  4G1R A;  1L2H A;  3CRI A;  3H6R A;  4G9N A;  2KI4 A;  3CA6 A;  1HWO B;  5FZU A;  3OJ2 A;  4XFS A;  3VSF A;  3A22 A;  3FJI A;  1TIE A;  3JRR A;  3LLP A;  4ZFU B;  2DRE A;  3FJF A;  5BOW A;  3O4O A;  3VUO A;  21BI A;  5EHA A;  2HWM A;  4LO0 A;  1W3A A;  4P0K A;  4I1B A;  5EC5 A;  5FNX A;  1QQK A;  3BAH A;  1AFC A;  1BA7 A;  2F2F A;  3D7W B;  5I1B A;  9ILB A;  1S0L A;  4H04 A;  4ISR A;  3BRD A;  1IIL A;  1YXW A;  3A23 A;  1YF8 B;  3FUQ A;  3T8S A;  1DIW A;  2NP0 A;  2XOA A;  2D23 A;  3AKH A;  1TFM B;  2VLC A;  1DLL A;  1WBC A;  4I37 A;  4ZKT B;  1ISW A;  4KEJ A;  4PC4 A;  1PUU B;  1G9B A;  3CA4 A;  3BAV A;  4LO3 C;  3AZW A;  4MZG B;  4KC3 A;  1NZK A;  2D43 A;  1ABR B;  3RTJ B;  1N4K A;  2D7I A;  4J23 B;  4J2K A;  3FJJ A;  5FNW A;  2AFG A;  3UJ4 A;  3R4U A;  2D1Z A;  3PUB A;  5GAQ A;  3AKI A;  4OWK A;  2Y9F A;  1Q03 A;  3NBD A;  2LIQ A;  3O5W B;  2Q3N B;  2KLL A;  5D63 A;  4Q91 A;  1JQZ A;  4ZGR B;  5JLV A;  2BEB A;  1G9A A;  4OEE A;  1DQO A;  1ISZ A;  3MAL A;  3WMV A;  4I7I A;  4TLP A;  3I2A A;  1SR4 C;  2WBC A;  4UY4 A;  1XG6 A;  3QR5 A;  3FUO A;  1EVT A;  3A07 A;  3H6Q A;  4I4Q A;  3ILA A;  3N7L A;  3NBN A;  3N7M A;  2ZR1 B;  4EEE B;  1HKN A;  1ONK B;  3FJD A;  3Q7X A;  1BFC A;  1V6X A;  3BA7 A;  3EF2 A;  3CAH A;  4Z8S B;  41BI A;  5F8Y A;  3CA0 A;  4I8M A;  4OUJ A;  1QQL A;  4USP A;  5BP5 A;  1DJS B;  2NM1 A;  2DRY A;  4JP0 A;  5DUY A;  2NS2 A;  3FJC A;  3O3Q A;  2ET2 A;  1F31 A;  1IRA X;  3WIN A;  3POK A;  1S0D A;  3P53 A;  3R4S A;  1M2T B;  1W3F A;  3BAD A;  1XZZ A;  3PME A;  5D62 A;  2P23 A;  3F1R A;  3AJ5 A;  1AVW B;  1RZO B;  1UPS A;  1WBA A;  1HIB A;  2X2T A;  4EFR A;  3FJE A;  2BEA A;  3LTQ A;  4OEF A;  4ZFY B;  4LO1 C;  2IHO A;  4Z9W B;  3CA5 A;  5JMC A;  4X39 A;  3HSM A;  4WBC A;  1BLD A;  4EFP A;  4GP3 A;  1NUN A;  8I1B A;  3AH1 A;  3AZV A;  1TWE A;  4D0Z A;  3CRH A;  4DEN A;  3CRG A;  3FFZ A;  1DZC A;  4II0 A;  3FJA A;  3A21 A;  1EYL A;  2ERM A;  4ZFW B;  3NBE A;  3ZX7 A;  2Z49 A;  3O44 A;  4IZX A;  1TTU A;  4I4X A;  3UJ0 A;  1E0O A;  2X2S A;  3OGG A;  4EFQ A;  3S8J A;  5E24 E;  1YBI A;  4JQ0 A;  1AVX B;  3BA5 A;  3F62 B;  2K8R A;  2AAI B;  3O4D A;  1FWV A;  4CJM A;  1D0H A;  3O4B A;  3QYD A;  1YYN A;  3IM6 A;  1FGA A;  2D24 A;  3VSZ A;  1V6V A;  5DZU A;  3RMY A;  4GOY A;  3V0A B;  31BI A;  2J3P A;  2I1B A;  2K4A B;  4FGF A;  1TOO A;  3PG0 A;  1BFG A;  4A7K A;  5BXS A;  2Q9X A;  3UD9 A;  1JT7 A;  4YOL A;  1BFB A;  1JLY A;  4USO A;  1Z4S A;  4AN6 A;  3V0B B;  3VT2 A;  3BB2 A;  2ZQO A;  2E4M A; 
#chains in the Genus database with same CATH homology
 3S8K A;  2YUG A;  2KH2 A;  4I2S A;  2RST A;  2VSE A;  4MZF B;  2MLL B;  4X38 A;  2FDB M;  2BFH A;  2VUA A;  1WD4 A;  3O4A A;  4ZOT A;  1AXM A;  3PHZ A;  1AVU A;  1PUM B;  1HWN B;  3OJM A;  3JUT A;  5F8S A;  1MD6 A;  5BVP I;  2HZ9 A;  2VU9 A;  3AKF A;  4LO2 C;  4I6I A;  4IZE A;  5F8W A;  1FQ9 A;  1BAR A;  5BXT A;  2HW9 A;  4L4H A;  4Q9P A;  4END A;  4JKX B;  4HJJ A;  3I29 B;  5BQU C;  4IYB A;  3BRG C;  3ZC8 A;  3AH4 A;  3AJ6 A;  3FJ8 A;  3V0A A;  3VT1 A;  4L4I A;  1BAS A;  3HBW A;  4QBC A;  4I4U A;  4A7Y A;  1FWU A;  4QBV A;  2K43 A;  1K5V A;  3V0B A;  1FN0 A;  2KI6 B;  5DSS B;  4GAF A;  1ISX A;  1R8O A;  3OJV A;  1I1E A;  2RG9 B;  2AXM A;  5G00 A;  4LO3 A;  1J0S A;  3RSJ A;  1PWA A;  4J2S A;  2GO2 A;  3SNV A;  4X3A A;  4GP0 A;  4AN7 B;  3BTA A;  1TP0 A;  1JLX A;  1IT0 A;  3IM7 A;  4P0L A;  2UUS A;  2WRY A;  4QKR A;  4OWL A;  4LO2 A;  1IJT A;  3IIR A;  2AQZ A;  5B2H A;  1EV2 A;  1RY7 A;  4KBB A;  3I2X A;  2D20 A;  4G9M A;  2VXT I;  1IRP A;  3KMV A;  1T9F A;  1V6W A;  1W3G A;  3BA4 A;  2DS0 A;  3OGF A;  4EB2 B;  4JPZ A;  3ZC9 A;  5BQU A;  1ITB A;  4I4P A;  4H75 A;  3AKG A;  4QO3 A;  1SR4 A;  2D44 A;  1QXM A;  3HOM A;  4LO8 B;  4JAW A;  3K1X A;  2Z48 A;  3TC2 A;  1I1B A;  2MIB A;  4I4Y A;  4I4R A;  2F8X C;  3Q7Y A;  3WO4 A;  4D8H A;  4ISQ A;  3VT0 A;  2DRZ A;  1FV3 A;  4A7Z A;  1G82 A;  1S0G A;  1CVS A;  4G6J A;  4GOV A;  4IQP A;  3Q7W A;  3BAG A;  1DFC A;  2D22 A;  1S0F A;  1ISV A;  4ZBV B;  1MC9 A;  2MC2 A;  1HCE A;  4HR6 C;  2D7R A;  3P6J A;  3CU1 B;  3RMX A;  1G9C A;  3UDA A;  2NTD A;  3IAG C;  2FGF A;  3CA1 A;  1VCL A;  4OEG A;  1G9D A;  2RQ9 A;  2VXR A;  4Q9G A;  5DVH A;  3BX1 C;  4QAL A;  3ZXD A;  4XFT A;  3WO2 A;  2L5X A;  1CE7 B;  3O4C A;  3WMU A;  4I1E A;  5FZY A;  4HA2 A;  1DFQ A;  3HMY A;  1DQG A;  2IWT B;  4I3N A;  4ION A;  4LO1 A;  4DEP A;  3UD8 A;  1A8D A;  2R9K B;  3WO3 A;  5FZZ A;  3MPP G;  4JRA A;  1Q04 A;  1JT3 A;  4KEK A;  1M16 A;  1XYF A;  1XHB A;  3FJ9 A;  3N7K A;  1AVA C;  2ESU A;  1PZZ A;  1S0B A;  4I0Y A;  4FVV A;  2VSA A;  4QKS A;  4X37 A;  4I4V A;  1GGP B;  3P6I A;  1II4 A;  4QD2 C;  2M49 A;  4QD2 B;  3BRF A;  4LO7 C;  3N0K A;  4LO7 B;  4XFU A;  1ILR 1;  1RML A;  5HPZ A;  1PC8 B;  2GZB A;  2KKI A;  4GAI A;  1ISY A;  1V6U A;  2Y9X E;  5BP5 C;  1FV2 A;  3CA3 A;  4EKX B;  4J2Y A;  1FMM S;  3BAQ A;  4I96 A;  6I1B A;  1K5U A;  4IY8 A;  3WIN C;  3V79 C;  2NZ9 A;  4P0J A;  1HWM B;  3OBT A;  4G6M A;  4P6A A;  1JTC A;  3BAU A;  3ZXG A;  3OBR A;  1Q1U A;  4R6U B;  1HCD A;  1Z2V A;  3O49 A;  1RG8 A;  5BXR A;  5F90 A;  2NVH A;  2NYY A;  1YTO A;  4F34 A;  5BXP A;  3VEQ A;  1JT5 A;  3IM5 A;  2ZQN A;  4JKQ A;  4XKI A;  4MZH A;  1WD3 A;  1JY0 A;  3H6R B;  3AH2 A;  1IHK A;  4D0T A;  3FGM A;  4DCK C;  4QC4 A;  2QYI B;  1HWP B;  1KNM A;  1SZ6 B;  1JT4 A;  1R8N A;  1AF9 A;  1S0E A;  3FJB A;  4LO0 C;  3H6S E;  4OWJ A;  4ZA3 B;  2FFV A;  4OW4 A;  3HN1 A;  1FMZ A;  2F2F C;  3C9Z A;  3BAO A;  3E8L C;  3NJ5 A;  1EPW A;  7I1B A;  4I4O A;  1S0C A;  1OQL B;  3VWC A;  3CQA A;  1P63 A;  3HAL A;  4IY9 A;  1Z0H A;  3RTI B;  3FJK A;  2QN4 A;  4J2X A;  4KEI A;  2LIE A;  2P39 A;  1T4Q A;  2FFU A;  3N7J A;  4H9W A;  3WA1 A;  4F83 A;  5EG6 C;  4I4S A;  1IOB A;  3W9T A;  2FO1 A;  4ZLB B;  2Y9G A;  3B9U A;  4IHZ A;  2E4M C;  2HWA A;  1DZD A;  5D61 A;  1TWM A;  3UD7 A;  3FJH A;  3NBC A;  1BFF A;  2Y9W C;  1BLA A;  4G1R A;  1L2H A;  3CRI A;  3H6R A;  4G9N A;  2KI4 A;  3CA6 A;  1HWO B;  5FZU A;  3OJ2 A;  4XFS A;  3VSF A;  3A22 A;  3FJI A;  1TIE A;  3JRR A;  3LLP A;  4ZFU B;  2DRE A;  3FJF A;  5BOW A;  3O4O A;  3VUO A;  21BI A;  5EHA A;  2HWM A;  4LO0 A;  1W3A A;  4P0K A;  4I1B A;  5EC5 A;  5FNX A;  1QQK A;  3BAH A;  1AFC A;  1BA7 A;  2F2F A;  3D7W B;  5I1B A;  9ILB A;  1S0L A;  4H04 A;  4ISR A;  3BRD A;  1IIL A;  1YXW A;  3A23 A;  1YF8 B;  3FUQ A;  3T8S A;  1DIW A;  2NP0 A;  2XOA A;  2D23 A;  3AKH A;  1TFM B;  2VLC A;  1DLL A;  1WBC A;  4I37 A;  4ZKT B;  1ISW A;  4KEJ A;  4PC4 A;  1PUU B;  1G9B A;  3CA4 A;  3BAV A;  4LO3 C;  3AZW A;  4MZG B;  4KC3 A;  1NZK A;  2D43 A;  1ABR B;  3RTJ B;  1N4K A;  2D7I A;  4J23 B;  4J2K A;  3FJJ A;  5FNW A;  2AFG A;  3UJ4 A;  3R4U A;  2D1Z A;  3PUB A;  5GAQ A;  3AKI A;  4OWK A;  2Y9F A;  1Q03 A;  3NBD A;  2LIQ A;  3O5W B;  2Q3N B;  2KLL A;  5D63 A;  4Q91 A;  1JQZ A;  4ZGR B;  5JLV A;  2BEB A;  1G9A A;  4OEE A;  1DQO A;  1ISZ A;  3MAL A;  3WMV A;  4I7I A;  4TLP A;  3I2A A;  1SR4 C;  2WBC A;  4UY4 A;  1XG6 A;  3QR5 A;  3FUO A;  1EVT A;  3A07 A;  3H6Q A;  4I4Q A;  3ILA A;  3N7L A;  3NBN A;  3N7M A;  2ZR1 B;  4EEE B;  1HKN A;  1ONK B;  3FJD A;  3Q7X A;  1BFC A;  1V6X A;  3BA7 A;  3EF2 A;  3CAH A;  4Z8S B;  41BI A;  5F8Y A;  3CA0 A;  4I8M A;  4OUJ A;  1QQL A;  4USP A;  5BP5 A;  1DJS B;  2NM1 A;  2DRY A;  4JP0 A;  5DUY A;  2NS2 A;  3FJC A;  3O3Q A;  2ET2 A;  1F31 A;  1IRA X;  3WIN A;  3POK A;  1S0D A;  3P53 A;  3R4S A;  1M2T B;  1W3F A;  3BAD A;  1XZZ A;  3PME A;  5D62 A;  2P23 A;  3F1R A;  3AJ5 A;  1AVW B;  1RZO B;  1UPS A;  1WBA A;  1HIB A;  2X2T A;  4EFR A;  3FJE A;  2BEA A;  3LTQ A;  4OEF A;  4ZFY B;  4LO1 C;  2IHO A;  4Z9W B;  3CA5 A;  5JMC A;  4X39 A;  3HSM A;  4WBC A;  1BLD A;  4EFP A;  4GP3 A;  1NUN A;  8I1B A;  3AH1 A;  3AZV A;  1TWE A;  4D0Z A;  3CRH A;  4DEN A;  3CRG A;  3FFZ A;  1DZC A;  4II0 A;  3FJA A;  3A21 A;  1EYL A;  2ERM A;  4ZFW B;  3NBE A;  3ZX7 A;  2Z49 A;  3O44 A;  4IZX A;  1TTU A;  4I4X A;  3UJ0 A;  1E0O A;  2X2S A;  3OGG A;  4EFQ A;  3S8J A;  5E24 E;  1YBI A;  4JQ0 A;  1AVX B;  3BA5 A;  3F62 B;  2K8R A;  2AAI B;  3O4D A;  1FWV A;  4CJM A;  1D0H A;  3O4B A;  3QYD A;  1YYN A;  3IM6 A;  1FGA A;  2D24 A;  3VSZ A;  1V6V A;  5DZU A;  3RMY A;  4GOY A;  3V0A B;  31BI A;  2J3P A;  2I1B A;  2K4A B;  4FGF A;  1TOO A;  3PG0 A;  1BFG A;  4A7K A;  5BXS A;  2Q9X A;  3UD9 A;  1JT7 A;  4YOL A;  1BFB A;  1JLY A;  4USO A;  1Z4S A;  4AN6 A;  3V0B B;  3VT2 A;  3BB2 A;  2ZQO A;  2E4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...