2L5XA

Solution structure of il1a-s100a13 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
151
structure length
151
Chain Sequence
b'NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 alpha
publication title The IL1alpha-S100A13 heterotetrameric complex structure: a component in the non-classical pathway for interleukin 1alpha secretion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/transport protein
total genus 17
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2l5xA00
4CJMA 1Q03A 4J2SA 2GZBA 4LO0A 1F31A 1S0GA 3P6JA 2DRYA 1PUMB 5G00A 3O4AA 4R6UB 2ZQNA 1RY7A 1S0BA 1HWPB 1AF9A 2ZR1B 1Q1UA 1ISYA 4EFRA 3OBRA 1G9DA 2P23A 4KEJA 2DS0A 3NBCA 1FV2A 3WO4A 3H6RA 4II0A 2VXRA 2KI6B 3WMUA 2HWAA 2BEBA 4F83A 3R4SA 4QKRA 2BEAA 1IILA 3HMYA 1EYLA 1BFGA 4JKXB 3LTQA 4KEKA 5DSSB 3BAVA 4ZOTA 4G6JA 1NUNA 3C9ZA 2ERMA 4JQ0A 1W3FA 3D7WB 4L4HA 3WINA 4ZBVB 2I1BA 3I29B 3V0AB 4X3AA 4G9MA 2NTDA 4YOLA 2Q3NB 5BP5A 3CA0A 3FGMA 3NBEA 2K43A 3OGFA 3NBNA 2ET2A 3BRFA 1K5UA 3V0BA 3UD8A 2D23A 3IM6A 1WBAA 1JT7A 2Z49A 4IQPA 1FMMS 3PG0A 5FZYA 2NZ9A 1ITBA 5DUYA 2AAIB 5I1BA 3VUOA 1HIBA 1Z0HA 1PZZA 1XHBA 4HA2A 4I0YA 4LO3C 2R9KB 3BAHA 1HWNB 1ISVA 1BLDA 3AH1A 4EKXB 3FJ9A 2F8XC 5D62A 1TIEA 4EFPA 4XFTA 4ISQA 2IWTB 3H6SE 4QC4A 1XYFA 3T8SA 1ISZA 3F1RA 1SR4C 1FN0A 4IY9A 3HBWA 3UD9A 1Z2VA 3O5WB 3FJFA 4XKIA 2LIEA 2X2TA 1OQLB 1AVXB 1JLXA 4LO2A 4OEFA 1CE7B 3CRGA 4OWJA 3BA5A 1DFQA 1FGAA 2Y9XE 2D1ZA 4LO7B 5D61A 3JRRA 1WD3A 4JAWA 5E24E 2NM1A 3BADA 4ZA3B 1V6WA 3ZC9A 1DQOA 2F2FA 3O44A 4AN7B 5BQUA 1GGPB 2MC2A 2L5XA 4G6MA 3E8LC 4KBBA 5GAQA 3A07A 2QN4A 5BXSA 1KNMA 1YXWA 2RG9B 3POKA 3MPPG 1L2HA 1FWUA 3FJEA 4I4SA 41BIA 4ZGRB 1RMLA 2YUGA 4USOA 4ZFYB 1QXMA 4HR6C 3CA6A 1J0SA 2K4AB 1A8DA 1AVAC 3ZXGA 2HW9A 2HZ9A 4I37A 4ZLBB 1T4QA 3RTJB 4GP3A 4OUJA 1HWOB 3OBTA 1XZZA 4DENA 3CQAA 5JMCA 3S8KA 3BAOA 2VSAA 4IY8A 5BVPI 1NZKA 4LO1C 3HOMA 3O4OA 1G82A 1BFBA 1G9AA 2KLLA 5BXTA 1W3AA 5HPZA 1FQ9A 1MD6A 1PUUB 3MALA 3A22A 4I4OA 4XFUA 3AJ6A 3PHZA 1D0HA 1IHKA 3JUTA 1II4A 4IYBA 5F8WA 2HWMA 3AKHA 4X37A 4LO7C 1YTOA 3F62B 3FJKA 4I4XA 3WO3A 2Q9XA 1FV3A 3N0KA 3OJ2A 2AQZA 4EEEB 4I2SA 3Q7XA 4I7IA 3V0BB 3UJ0A 3RTIB 1W3GA 4ZFWB 1S0FA 4LO3A 4QBVA 5FNXA 1SZ6B 1CVSA 3CA5A 2VU9A 4IHZA 3FUOA 3FJ8A 2M49A 4G9NA 4J2KA 1BASA 1IRAX 4OEGA 3IM7A 3W9TA 2MLLB 2Y9FA 3I2XA 4QO3A 4I6IA 1DJSB 2DRZA 3N7KA 4EB2B 5F8SA 4P0LA 4I4QA 4I1EA 4OWLA 1S0LA 2MIBA 1R8NA 2E4MA 1R8OA 2BFHA 3ILAA 1S0CA 1UPSA 1IJTA 2Y9WC 4WBCA 5FNWA 4I96A 2X2SA 1RG8A 4J2XA 5D63A 2RQ9A 7I1BA 3HALA 4KC3A 2D44A 4D0TA 21BIA 2NYYA 4I4UA 3WO2A 3BAUA 2VUAA 3V79C 3KMVA 3IM5A 4HJJA 1V6XA 2LIQA 1RZOB 3BB2A 2VSEA 4A7KA 3O49A 5BP5C 1DFCA 4Z9WB 3Q7YA 1JY0A 5DVHA 4JP0A 2GO2A 1XG6A 1FWVA 2D22A 3Q7WA 4Q91A 1ILR1 31BIA 4X38A 1WD4A 1FMZA 1TFMB 5BOWA 2RSTA 3RMYA 4EFQA 5F90A 5FZUA 4ENDA 4JRAA 4FGFA 1YYNA 4G1RA 4KEIA 3VT1A 1IOBA 2Z48A 3VT2A 5B2HA 3CRHA 1M16A 1ABRB 3VT0A 3AH4A 2XOAA 3FFZA 1BARA 1S0DA 2WBCA 1TWEA 1YF8B 3CRIA 3FJJA 1S0EA 4XFSA 4JKQA 4P0JA 1QQLA 3RSJA 4OW4A 4DCKC 5BXRA 1JT4A 2K8RA 1N4KA 1AXMA 4IZEA 3FJCA 4ZKTB 4LO2C 3WA1A 1P63A 3NJ5A 3PMEA 3ZC8A 3B9UA 4I4RA 3H6RB 1Q04A 3CU1B 1AVWB 4I1BA 3ZX7A 3AZWA 3BAGA 2ZQOA 3BRGC 1BA7A 1V6UA 2F2FC 1BLAA 3VEQA 3BA7A 1E0OA 5BQUC 3AH2A 4GOYA 1BFCA 1G9BA 1EPWA 3FJAA 3K1XA 4Q9GA 1YBIA 4GOVA 4I4YA 1JT5A 4GP0A 2FO1A 3CA4A 4JPZA 2IHOA 2D24A 1AFCA 3N7JA 3S8JA 1HWMB 1G9CA 5JLVA 2NVHA 2Y9GA 5DZUA 1JQZA 5F8YA 4OEEA 4I3NA 1DLLA 1PWAA 4F34A 4Z8SB 1ISWA 1ONKB 4X39A 1ISXA 1PC8B 3VWCA 2AFGA 2VXTI 4QD2B 3P53A 2AXMA 4AN6A 4A7YA 3AZVA 1JTCA 3FJDA 4LO0C 2FFVA 4QKSA 1SR4A 1Z4SA 1DZCA 4TLPA 1EVTA 4D0ZA 3QR5A 3SNVA 1DQGA 3RMXA 2KI4A 1QQKA 1TP0A 4P6AA 4USPA 3TC2A 3WMVA 4OWKA 2D43A 3O4DA 4D8HA 4DEPA 1TOOA 2D7IA 3IIRA 2WRYA 1V6VA 3P6IA 4I4PA 3V0AA 3AKFA 1EV2A 2VLCA 4J2YA 3WINC 3A23A 2P39A 1HCDA 1K5VA 3LLPA 2D7RA 1VCLA 3O4BA 3FJBA 3ZXDA 3N7LA 3AJ5A 3CA1A 3NBDA 5EG6C 1I1BA 3OJMA 3OJVA 3IAGC 3BTAA 3O4CA 6I1BA 5EHAA 4L4IA 3HN1A 1TWMA 4Q9PA 3N7MA 4GAFA 1IRPA 2FFUA 3FJIA 1HKNA 1JT3A 2E4MC 3H6QA 2J3PA 1I1EA 4IONA 4LO8B 4QD2C 8I1BA 1TTUA 1WBCA 4PC4A 3BA4A 4ZFUB 3UJ4A 3CA3A 4LO1A 3BAQA 3R4UA 3UD7A 3O3QA 1T9FA 3BX1C 3UDAA 3AKIA 3PUBA 4GAIA 2QYIB 1JLYA 3QYDA 4J23B 3VSZA 4ISRA 4P0KA 1IT0A 4FVVA 3BRDA 2KH2A 3CAHA 3I2AA 3AKGA 2DREA 3VSFA 4I8MA 5BXPA 5FZZA 9ILBA 4H9WA 4QALA 3OGGA 2NP0A 2FDBM 2D20A 1DZDA 4H04A 1AVUA 1BFFA 3FUQA 3A21A 1M2TB 1MC9A 5EC5A 4QBCA 4A7ZA 2FGFA 4I4VA 4IZXA 3EF2A 3FJHA 2ESUA 2KKIA 1DIWA 3HSMA 1HCEA 2UUSA
chains in the Genus database with same CATH superfamily
4CJMA 1Q03A 4J2SA 2GZBA 4LO0A 1F31A 1S0GA 3P6JA 2DRYA 1PUMB 5G00A 3O4AA 4R6UB 2ZQNA 1RY7A 1S0BA 1HWPB 1AF9A 2ZR1B 1Q1UA 1ISYA 4EFRA 3OBRA 1G9DA 2P23A 4KEJA 2DS0A 3NBCA 1FV2A 3WO4A 3H6RA 4II0A 2VXRA 2KI6B 3WMUA 2HWAA 2BEBA 4F83A 3R4SA 4QKRA 2BEAA 1IILA 3HMYA 1EYLA 1BFGA 4JKXB 3LTQA 4KEKA 5DSSB 3BAVA 4ZOTA 4G6JA 1NUNA 3C9ZA 2ERMA 4JQ0A 1W3FA 3D7WB 4L4HA 3WINA 4ZBVB 2I1BA 3I29B 3V0AB 4X3AA 4G9MA 2NTDA 4YOLA 2Q3NB 5BP5A 3CA0A 3FGMA 3NBEA 2K43A 3OGFA 3NBNA 2ET2A 3BRFA 1K5UA 3V0BA 3UD8A 2D23A 3IM6A 1WBAA 1JT7A 2Z49A 4IQPA 1FMMS 3PG0A 5FZYA 2NZ9A 1ITBA 5DUYA 2AAIB 5I1BA 3VUOA 1HIBA 1Z0HA 1PZZA 1XHBA 4HA2A 4I0YA 4LO3C 2R9KB 3BAHA 1HWNB 1ISVA 1BLDA 3AH1A 4EKXB 3FJ9A 2F8XC 5D62A 1TIEA 4EFPA 4XFTA 4ISQA 2IWTB 3H6SE 4MZFB 4QC4A 1XYFA 3T8SA 1ISZA 3F1RA 1SR4C 1FN0A 4IY9A 3HBWA 3UD9A 1Z2VA 3O5WB 3FJFA 4XKIA 2LIEA 2X2TA 1OQLB 1AVXB 1JLXA 4LO2A 4OEFA 1CE7B 3CRGA 4OWJA 3BA5A 1DFQA 1FGAA 2Y9XE 2D1ZA 4LO7B 5D61A 3JRRA 1WD3A 4JAWA 5E24E 2NM1A 3BADA 4ZA3B 1V6WA 3ZC9A 1DQOA 2F2FA 3O44A 4AN7B 5BQUA 1GGPB 2MC2A 2L5XA 4G6MA 3E8LC 4KBBA 5GAQA 3A07A 2QN4A 5BXSA 1KNMA 1YXWA 2RG9B 3POKA 3MPPG 1L2HA 1FWUA 3FJEA 4I4SA 41BIA 4ZGRB 1RMLA 2YUGA 4USOA 4ZFYB 1QXMA 4HR6C 3CA6A 1J0SA 2K4AB 1A8DA 1AVAC 3ZXGA 2HW9A 2HZ9A 4I37A 4ZLBB 1T4QA 3RTJB 4GP3A 4OUJA 1HWOB 3OBTA 1XZZA 4DENA 3CQAA 5JMCA 3S8KA 3BAOA 2VSAA 4IY8A 5BVPI 1NZKA 4LO1C 3HOMA 3O4OA 1G82A 1BFBA 1G9AA 2KLLA 5BXTA 1W3AA 5HPZA 1FQ9A 1MD6A 1PUUB 3MALA 3A22A 4I4OA 4XFUA 3AJ6A 3PHZA 1D0HA 1IHKA 3JUTA 1II4A 4IYBA 5F8WA 2HWMA 3AKHA 4X37A 4LO7C 1YTOA 3F62B 3FJKA 4I4XA 3WO3A 2Q9XA 1FV3A 3N0KA 3OJ2A 2AQZA 4EEEB 4I2SA 3Q7XA 4I7IA 3V0BB 3UJ0A 3RTIB 1W3GA 4ZFWB 1S0FA 4MZHA 4LO3A 4QBVA 5FNXA 1SZ6B 1CVSA 3CA5A 2VU9A 4IHZA 3FUOA 3FJ8A 4MZGB 2M49A 4G9NA 4J2KA 1BASA 1IRAX 4OEGA 3IM7A 3W9TA 2MLLB 2Y9FA 3I2XA 4QO3A 4I6IA 1DJSB 2DRZA 3N7KA 4EB2B 5F8SA 2NS2A 4P0LA 4I4QA 4I1EA 4OWLA 1S0LA 2MIBA 1R8NA 2E4MA 1R8OA 2BFHA 3ILAA 1S0CA 1UPSA 1IJTA 2Y9WC 4WBCA 5FNWA 4I96A 2X2SA 1RG8A 4J2XA 5D63A 2RQ9A 7I1BA 3HALA 4KC3A 2D44A 4D0TA 21BIA 2NYYA 4I4UA 3WO2A 3BAUA 2VUAA 3V79C 3KMVA 3IM5A 4HJJA 1V6XA 2LIQA 1RZOB 3BB2A 2VSEA 4A7KA 3O49A 5BP5C 1DFCA 4Z9WB 3Q7YA 1JY0A 5DVHA 4JP0A 2GO2A 1XG6A 1FWVA 2D22A 3Q7WA 4Q91A 1ILR1 31BIA 4X38A 1WD4A 1FMZA 1TFMB 5BOWA 2RSTA 3RMYA 4EFQA 5F90A 5FZUA 4ENDA 4JRAA 4FGFA 1YYNA 4G1RA 4KEIA 3VT1A 1IOBA 2Z48A 3VT2A 5B2HA 3CRHA 1M16A 1ABRB 3VT0A 3AH4A 2XOAA 3FFZA 1BARA 1S0DA 2WBCA 1TWEA 1YF8B 3CRIA 3FJJA 1S0EA 4XFSA 4JKQA 4P0JA 1QQLA 3RSJA 4OW4A 4DCKC 5BXRA 1JT4A 2K8RA 1N4KA 1AXMA 4IZEA 3FJCA 4ZKTB 4LO2C 3WA1A 1P63A 3NJ5A 3PMEA 3ZC8A 3B9UA 4I4RA 3H6RB 1Q04A 3CU1B 1AVWB 4I1BA 3ZX7A 3AZWA 3BAGA 2ZQOA 3BRGC 1BA7A 1V6UA 2F2FC 1BLAA 3VEQA 3BA7A 1E0OA 5BQUC 3AH2A 4GOYA 1BFCA 1G9BA 1EPWA 3FJAA 3K1XA 4Q9GA 1YBIA 4GOVA 4I4YA 1JT5A 4GP0A 2FO1A 3CA4A 4JPZA 2IHOA 2D24A 1AFCA 3N7JA 3S8JA 1HWMB 1G9CA 5JLVA 2NVHA 2Y9GA 5DZUA 1JQZA 5F8YA 4OEEA 4I3NA 1DLLA 1PWAA 4F34A 4Z8SB 1ISWA 1ONKB 4X39A 1ISXA 1PC8B 3VWCA 2AFGA 2VXTI 4QD2B 3P53A 2AXMA 4AN6A 4A7YA 3AZVA 1JTCA 3FJDA 4LO0C 2FFVA 4QKSA 4UY4A 1SR4A 1Z4SA 1DZCA 4TLPA 1EVTA 4D0ZA 3QR5A 3SNVA 1DQGA 3RMXA 2KI4A 1QQKA 1TP0A 4H75A 4P6AA 4USPA 3TC2A 3WMVA 4OWKA 2D43A 3O4DA 4D8HA 4DEPA 1TOOA 2D7IA 3IIRA 2WRYA 1V6VA 3P6IA 4I4PA 3V0AA 3AKFA 1EV2A 2VLCA 4J2YA 3WINC 3A23A 2P39A 1HCDA 1K5VA 3LLPA 2D7RA 1VCLA 3O4BA 3FJBA 3ZXDA 3N7LA 3AJ5A 3CA1A 3NBDA 5EG6C 1I1BA 3OJMA 3OJVA 3IAGC 3BTAA 3O4CA 6I1BA 5EHAA 4L4IA 3HN1A 1TWMA 4Q9PA 3N7MA 4GAFA 1IRPA 2FFUA 3FJIA 1HKNA 1JT3A 2E4MC 3H6QA 2J3PA 1I1EA 4IONA 4LO8B 4QD2C 8I1BA 1TTUA 1WBCA 4PC4A 3BA4A 4ZFUB 3UJ4A 3CA3A 4LO1A 3BAQA 3R4UA 3UD7A 3O3QA 1T9FA 3BX1C 3UDAA 3AKIA 3PUBA 4GAIA 2QYIB 1JLYA 3QYDA 4J23B 3VSZA 4ISRA 4P0KA 1IT0A 4FVVA 3BRDA 2KH2A 3CAHA 3I2AA 3AKGA 2DREA 3VSFA 4I8MA 5BXPA 5FZZA 9ILBA 4H9WA 4QALA 3OGGA 2NP0A 2FDBM 2D20A 1DZDA 4H04A 1AVUA 1BFFA 3FUQA 3A21A 1M2TB 1MC9A 5EC5A 4QBCA 4A7ZA 2FGFA 4I4VA 4IZXA 3EF2A 3FJHA 2ESUA 2KKIA 1DIWA 3HSMA 1HCEA 2UUSA
chains in the Genus database with same CATH topology
4CJMA 1Q03A 4J2SA 2GZBA 4LO0A 1F31A 1S0GA 3P6JA 2DRYA 1PUMB 5G00A 3O4AA 4R6UB 2ZQNA 1RY7A 1S0BA 1HWPB 1AF9A 2ZR1B 1Q1UA 1ISYA 4EFRA 3OBRA 1G9DA 2P23A 4KEJA 2DS0A 3NBCA 1FV2A 3WO4A 3H6RA 4II0A 2VXRA 2KI6B 3WMUA 2HWAA 2BEBA 4F83A 3R4SA 4QKRA 2BEAA 1IILA 3HMYA 1EYLA 1BFGA 4JKXB 3LTQA 4KEKA 5DSSB 3BAVA 4ZOTA 4G6JA 1NUNA 3C9ZA 2ERMA 4JQ0A 1W3FA 3D7WB 4L4HA 3WINA 4ZBVB 2I1BA 3I29B 3V0AB 4X3AA 4G9MA 2NTDA 4YOLA 2Q3NB 5BP5A 3CA0A 3FGMA 3NBEA 2K43A 3OGFA 3NBNA 2ET2A 3BRFA 1K5UA 3V0BA 3UD8A 2D23A 3IM6A 1WBAA 1JT7A 2Z49A 4IQPA 1FMMS 3PG0A 5FZYA 2NZ9A 1ITBA 5DUYA 2AAIB 5I1BA 3VUOA 1HIBA 1Z0HA 1PZZA 1XHBA 4HA2A 4I0YA 4LO3C 2R9KB 3BAHA 1HWNB 1ISVA 1BLDA 3AH1A 4EKXB 3FJ9A 2F8XC 5D62A 1TIEA 4EFPA 4XFTA 4ISQA 2IWTB 3H6SE 4MZFB 4QC4A 1XYFA 3T8SA 1ISZA 3F1RA 1SR4C 1FN0A 4IY9A 3HBWA 3UD9A 1Z2VA 3O5WB 3FJFA 4XKIA 2LIEA 2X2TA 1OQLB 1AVXB 1JLXA 4LO2A 4OEFA 1CE7B 3CRGA 4OWJA 3BA5A 1DFQA 1FGAA 2Y9XE 2D1ZA 4LO7B 5D61A 3JRRA 1WD3A 4JAWA 5E24E 2NM1A 3BADA 4ZA3B 1V6WA 3ZC9A 1DQOA 2F2FA 3O44A 4AN7B 5BQUA 1GGPB 2MC2A 2L5XA 4G6MA 3E8LC 4KBBA 5GAQA 3A07A 2QN4A 5BXSA 1KNMA 1YXWA 2RG9B 3POKA 3MPPG 1L2HA 1FWUA 3FJEA 4I4SA 41BIA 4ZGRB 1RMLA 2YUGA 4USOA 4ZFYB 1QXMA 4HR6C 3CA6A 1J0SA 2K4AB 1A8DA 1AVAC 3ZXGA 2HW9A 2HZ9A 4I37A 4ZLBB 1T4QA 3RTJB 4GP3A 4OUJA 1HWOB 3OBTA 1XZZA 4DENA 3CQAA 5JMCA 3S8KA 3BAOA 2VSAA 4IY8A 5BVPI 1NZKA 4LO1C 3HOMA 3O4OA 1G82A 1BFBA 1G9AA 2KLLA 5BXTA 1W3AA 5HPZA 1FQ9A 1MD6A 1PUUB 3MALA 3A22A 4I4OA 4XFUA 3AJ6A 3PHZA 1D0HA 1IHKA 3JUTA 1II4A 4IYBA 5F8WA 2HWMA 3AKHA 4X37A 4LO7C 1YTOA 3F62B 3FJKA 4I4XA 3WO3A 2Q9XA 1FV3A 3N0KA 3OJ2A 2AQZA 4EEEB 4I2SA 3Q7XA 4I7IA 3V0BB 3UJ0A 3RTIB 1W3GA 4ZFWB 1S0FA 4MZHA 4LO3A 4QBVA 5FNXA 1SZ6B 1CVSA 3CA5A 2VU9A 4IHZA 3FUOA 3FJ8A 4MZGB 2M49A 4G9NA 4J2KA 1BASA 1IRAX 4OEGA 3IM7A 3W9TA 2MLLB 2Y9FA 3I2XA 4QO3A 4I6IA 1DJSB 2DRZA 3N7KA 4EB2B 5F8SA 2NS2A 4P0LA 4I4QA 4I1EA 4OWLA 1S0LA 2MIBA 1R8NA 2E4MA 1R8OA 2BFHA 3ILAA 1S0CA 1UPSA 1IJTA 2Y9WC 4WBCA 5FNWA 4I96A 2X2SA 1RG8A 4J2XA 5D63A 2RQ9A 7I1BA 3HALA 4KC3A 2D44A 4D0TA 21BIA 2NYYA 4I4UA 3WO2A 3BAUA 2VUAA 3V79C 3KMVA 3IM5A 4HJJA 1V6XA 2LIQA 1RZOB 3BB2A 2VSEA 4A7KA 3O49A 5BP5C 1DFCA 4Z9WB 3Q7YA 1JY0A 5DVHA 4JP0A 2GO2A 1XG6A 1FWVA 2D22A 3Q7WA 4Q91A 1ILR1 31BIA 4X38A 1WD4A 1FMZA 1TFMB 5BOWA 2RSTA 3RMYA 4EFQA 5F90A 5FZUA 4ENDA 4JRAA 4FGFA 1YYNA 4G1RA 4KEIA 3VT1A 1IOBA 2Z48A 3VT2A 5B2HA 3CRHA 1M16A 1ABRB 3VT0A 3AH4A 2XOAA 3FFZA 1BARA 1S0DA 2WBCA 1TWEA 1YF8B 3CRIA 3FJJA 1S0EA 4XFSA 4JKQA 4P0JA 1QQLA 3RSJA 4OW4A 4DCKC 5BXRA 1JT4A 2K8RA 1N4KA 1AXMA 4IZEA 3FJCA 4ZKTB 4LO2C 3WA1A 1P63A 3NJ5A 3PMEA 3ZC8A 3B9UA 4I4RA 3H6RB 1Q04A 3CU1B 1AVWB 4I1BA 3ZX7A 3AZWA 3BAGA 2ZQOA 3BRGC 1BA7A 1V6UA 2F2FC 1BLAA 3VEQA 3BA7A 1E0OA 5BQUC 3AH2A 4GOYA 1BFCA 1G9BA 1EPWA 3FJAA 3K1XA 4Q9GA 1YBIA 4GOVA 4I4YA 1JT5A 4GP0A 2FO1A 3CA4A 4JPZA 2IHOA 2D24A 1AFCA 3N7JA 3S8JA 1HWMB 1G9CA 5JLVA 2NVHA 2Y9GA 5DZUA 1JQZA 5F8YA 4OEEA 4I3NA 1DLLA 1PWAA 4F34A 4Z8SB 1ISWA 1ONKB 4X39A 1ISXA 1PC8B 3VWCA 2AFGA 2VXTI 4QD2B 3P53A 2AXMA 4AN6A 4A7YA 3AZVA 1JTCA 3FJDA 4LO0C 2FFVA 4QKSA 4UY4A 1SR4A 1Z4SA 1DZCA 4TLPA 1EVTA 4D0ZA 3QR5A 3SNVA 1DQGA 3RMXA 2KI4A 1QQKA 1TP0A 4H75A 4P6AA 4USPA 3TC2A 3WMVA 4OWKA 2D43A 3O4DA 4D8HA 4DEPA 1TOOA 2D7IA 3IIRA 2WRYA 1V6VA 3P6IA 4I4PA 3V0AA 3AKFA 1EV2A 2VLCA 4J2YA 3WINC 3A23A 2P39A 1HCDA 1K5VA 3LLPA 2D7RA 1VCLA 3O4BA 3FJBA 3ZXDA 3N7LA 3AJ5A 3CA1A 3NBDA 5EG6C 1I1BA 3OJMA 3OJVA 3IAGC 3BTAA 3O4CA 6I1BA 5EHAA 4L4IA 3HN1A 1TWMA 4Q9PA 3N7MA 4GAFA 1IRPA 2FFUA 3FJIA 1HKNA 1JT3A 2E4MC 3H6QA 2J3PA 1I1EA 4IONA 4LO8B 4QD2C 8I1BA 1TTUA 1WBCA 4PC4A 3BA4A 4ZFUB 3UJ4A 3CA3A 4LO1A 3BAQA 3R4UA 3UD7A 3O3QA 1T9FA 3BX1C 3UDAA 3AKIA 3PUBA 4GAIA 2QYIB 1JLYA 3QYDA 4J23B 3VSZA 4ISRA 4P0KA 1IT0A 4FVVA 3BRDA 2KH2A 3CAHA 3I2AA 3AKGA 2DREA 3VSFA 4I8MA 5BXPA 5FZZA 9ILBA 4H9WA 4QALA 3OGGA 2NP0A 2FDBM 2D20A 1DZDA 4H04A 1AVUA 1BFFA 3FUQA 3A21A 1M2TB 1MC9A 5EC5A 4QBCA 4A7ZA 2FGFA 4I4VA 4IZXA 3EF2A 3FJHA 2ESUA 2KKIA 1DIWA 3HSMA 1HCEA 2UUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJM A;  1Q03 A;  4J2S A;  2GZB A;  4LO0 A;  1F31 A;  1S0G A;  3P6J A;  2DRY A;  1PUM B;  5G00 A;  3O4A A;  4R6U B;  2ZQN A;  1RY7 A;  1S0B A;  1HWP B;  1AF9 A;  2ZR1 B;  1Q1U A;  1ISY A;  4EFR A;  3OBR A;  1G9D A;  2P23 A;  4KEJ A;  2DS0 A;  3NBC A;  1FV2 A;  3WO4 A;  3H6R A;  4II0 A;  2VXR A;  2KI6 B;  3WMU A;  2HWA A;  2BEB A;  4F83 A;  3R4S A;  4QKR A;  2BEA A;  1IIL A;  3HMY A;  1EYL A;  1BFG A;  4JKX B;  3LTQ A;  4KEK A;  5DSS B;  3BAV A;  4ZOT A;  4G6J A;  1NUN A;  3C9Z A;  2ERM A;  4JQ0 A;  1W3F A;  3D7W B;  4L4H A;  3WIN A;  4ZBV B;  2I1B A;  3I29 B;  3V0A B;  4X3A A;  4G9M A;  2NTD A;  4YOL A;  2Q3N B;  5BP5 A;  3CA0 A;  3FGM A;  3NBE A;  2K43 A;  3OGF A;  3NBN A;  2ET2 A;  3BRF A;  1K5U A;  3V0B A;  3UD8 A;  2D23 A;  3IM6 A;  1WBA A;  1JT7 A;  2Z49 A;  4IQP A;  1FMM S;  3PG0 A;  5FZY A;  2NZ9 A;  1ITB A;  5DUY A;  2AAI B;  5I1B A;  3VUO A;  1HIB A;  1Z0H A;  1PZZ A;  1XHB A;  4HA2 A;  4I0Y A;  4LO3 C;  2R9K B;  3BAH A;  1HWN B;  1ISV A;  1BLD A;  3AH1 A;  4EKX B;  3FJ9 A;  2F8X C;  5D62 A;  1TIE A;  4EFP A;  4XFT A;  4ISQ A;  2IWT B;  3H6S E;  4QC4 A;  1XYF A;  3T8S A;  1ISZ A;  3F1R A;  1SR4 C;  1FN0 A;  4IY9 A;  3HBW A;  3UD9 A;  1Z2V A;  3O5W B;  3FJF A;  4XKI A;  2LIE A;  2X2T A;  1OQL B;  1AVX B;  1JLX A;  4LO2 A;  4OEF A;  1CE7 B;  3CRG A;  4OWJ A;  3BA5 A;  1DFQ A;  1FGA A;  2Y9X E;  2D1Z A;  4LO7 B;  5D61 A;  3JRR A;  1WD3 A;  4JAW A;  5E24 E;  2NM1 A;  3BAD A;  4ZA3 B;  1V6W A;  3ZC9 A;  1DQO A;  2F2F A;  3O44 A;  4AN7 B;  5BQU A;  1GGP B;  2MC2 A;  2L5X A;  4G6M A;  3E8L C;  4KBB A;  5GAQ A;  3A07 A;  2QN4 A;  5BXS A;  1KNM A;  1YXW A;  2RG9 B;  3POK A;  3MPP G;  1L2H A;  1FWU A;  3FJE A;  4I4S A;  41BI A;  4ZGR B;  1RML A;  2YUG A;  4USO A;  4ZFY B;  1QXM A;  4HR6 C;  3CA6 A;  1J0S A;  2K4A B;  1A8D A;  1AVA C;  3ZXG A;  2HW9 A;  2HZ9 A;  4I37 A;  4ZLB B;  1T4Q A;  3RTJ B;  4GP3 A;  4OUJ A;  1HWO B;  3OBT A;  1XZZ A;  4DEN A;  3CQA A;  5JMC A;  3S8K A;  3BAO A;  2VSA A;  4IY8 A;  5BVP I;  1NZK A;  4LO1 C;  3HOM A;  3O4O A;  1G82 A;  1BFB A;  1G9A A;  2KLL A;  5BXT A;  1W3A A;  5HPZ A;  1FQ9 A;  1MD6 A;  1PUU B;  3MAL A;  3A22 A;  4I4O A;  4XFU A;  3AJ6 A;  3PHZ A;  1D0H A;  1IHK A;  3JUT A;  1II4 A;  4IYB A;  5F8W A;  2HWM A;  3AKH A;  4X37 A;  4LO7 C;  1YTO A;  3F62 B;  3FJK A;  4I4X A;  3WO3 A;  2Q9X A;  1FV3 A;  3N0K A;  3OJ2 A;  2AQZ A;  4EEE B;  4I2S A;  3Q7X A;  4I7I A;  3V0B B;  3UJ0 A;  3RTI B;  1W3G A;  4ZFW B;  1S0F A;  4LO3 A;  4QBV A;  5FNX A;  1SZ6 B;  1CVS A;  3CA5 A;  2VU9 A;  4IHZ A;  3FUO A;  3FJ8 A;  2M49 A;  4G9N A;  4J2K A;  1BAS A;  1IRA X;  4OEG A;  3IM7 A;  3W9T A;  2MLL B;  2Y9F A;  3I2X A;  4QO3 A;  4I6I A;  1DJS B;  2DRZ A;  3N7K A;  4EB2 B;  5F8S A;  4P0L A;  4I4Q A;  4I1E A;  4OWL A;  1S0L A;  2MIB A;  1R8N A;  2E4M A;  1R8O A;  2BFH A;  3ILA A;  1S0C A;  1UPS A;  1IJT A;  2Y9W C;  4WBC A;  5FNW A;  4I96 A;  2X2S A;  1RG8 A;  4J2X A;  5D63 A;  2RQ9 A;  7I1B A;  3HAL A;  4KC3 A;  2D44 A;  4D0T A;  21BI A;  2NYY A;  4I4U A;  3WO2 A;  3BAU A;  2VUA A;  3V79 C;  3KMV A;  3IM5 A;  4HJJ A;  1V6X A;  2LIQ A;  1RZO B;  3BB2 A;  2VSE A;  4A7K A;  3O49 A;  5BP5 C;  1DFC A;  4Z9W B;  3Q7Y A;  1JY0 A;  5DVH A;  4JP0 A;  2GO2 A;  1XG6 A;  1FWV A;  2D22 A;  3Q7W A;  4Q91 A;  1ILR 1;  31BI A;  4X38 A;  1WD4 A;  1FMZ A;  1TFM B;  5BOW A;  2RST A;  3RMY A;  4EFQ A;  5F90 A;  5FZU A;  4END A;  4JRA A;  4FGF A;  1YYN A;  4G1R A;  4KEI A;  3VT1 A;  1IOB A;  2Z48 A;  3VT2 A;  5B2H A;  3CRH A;  1M16 A;  1ABR B;  3VT0 A;  3AH4 A;  2XOA A;  3FFZ A;  1BAR A;  1S0D A;  2WBC A;  1TWE A;  1YF8 B;  3CRI A;  3FJJ A;  1S0E A;  4XFS A;  4JKQ A;  4P0J A;  1QQL A;  3RSJ A;  4OW4 A;  4DCK C;  5BXR A;  1JT4 A;  2K8R A;  1N4K A;  1AXM A;  4IZE A;  3FJC A;  4ZKT B;  4LO2 C;  3WA1 A;  1P63 A;  3NJ5 A;  3PME A;  3ZC8 A;  3B9U A;  4I4R A;  3H6R B;  1Q04 A;  3CU1 B;  1AVW B;  4I1B A;  3ZX7 A;  3AZW A;  3BAG A;  2ZQO A;  3BRG C;  1BA7 A;  1V6U A;  2F2F C;  1BLA A;  3VEQ A;  3BA7 A;  1E0O A;  5BQU C;  3AH2 A;  4GOY A;  1BFC A;  1G9B A;  1EPW A;  3FJA A;  3K1X A;  4Q9G A;  1YBI A;  4GOV A;  4I4Y A;  1JT5 A;  4GP0 A;  2FO1 A;  3CA4 A;  4JPZ A;  2IHO A;  2D24 A;  1AFC A;  3N7J A;  3S8J A;  1HWM B;  1G9C A;  5JLV A;  2NVH A;  2Y9G A;  5DZU A;  1JQZ A;  5F8Y A;  4OEE A;  4I3N A;  1DLL A;  1PWA A;  4F34 A;  4Z8S B;  1ISW A;  1ONK B;  4X39 A;  1ISX A;  1PC8 B;  3VWC A;  2AFG A;  2VXT I;  4QD2 B;  3P53 A;  2AXM A;  4AN6 A;  4A7Y A;  3AZV A;  1JTC A;  3FJD A;  4LO0 C;  2FFV A;  4QKS A;  1SR4 A;  1Z4S A;  1DZC A;  4TLP A;  1EVT A;  4D0Z A;  3QR5 A;  3SNV A;  1DQG A;  3RMX A;  2KI4 A;  1QQK A;  1TP0 A;  4P6A A;  4USP A;  3TC2 A;  3WMV A;  4OWK A;  2D43 A;  3O4D A;  4D8H A;  4DEP A;  1TOO A;  2D7I A;  3IIR A;  2WRY A;  1V6V A;  3P6I A;  4I4P A;  3V0A A;  3AKF A;  1EV2 A;  2VLC A;  4J2Y A;  3WIN C;  3A23 A;  2P39 A;  1HCD A;  1K5V A;  3LLP A;  2D7R A;  1VCL A;  3O4B A;  3FJB A;  3ZXD A;  3N7L A;  3AJ5 A;  3CA1 A;  3NBD A;  5EG6 C;  1I1B A;  3OJM A;  3OJV A;  3IAG C;  3BTA A;  3O4C A;  6I1B A;  5EHA A;  4L4I A;  3HN1 A;  1TWM A;  4Q9P A;  3N7M A;  4GAF A;  1IRP A;  2FFU A;  3FJI A;  1HKN A;  1JT3 A;  2E4M C;  3H6Q A;  2J3P A;  1I1E A;  4ION A;  4LO8 B;  4QD2 C;  8I1B A;  1TTU A;  1WBC A;  4PC4 A;  3BA4 A;  4ZFU B;  3UJ4 A;  3CA3 A;  4LO1 A;  3BAQ A;  3R4U A;  3UD7 A;  3O3Q A;  1T9F A;  3BX1 C;  3UDA A;  3AKI A;  3PUB A;  4GAI A;  2QYI B;  1JLY A;  3QYD A;  4J23 B;  3VSZ A;  4ISR A;  4P0K A;  1IT0 A;  4FVV A;  3BRD A;  2KH2 A;  3CAH A;  3I2A A;  3AKG A;  2DRE A;  3VSF A;  4I8M A;  5BXP A;  5FZZ A;  9ILB A;  4H9W A;  4QAL A;  3OGG A;  2NP0 A;  2FDB M;  2D20 A;  1DZD A;  4H04 A;  1AVU A;  1BFF A;  3FUQ A;  3A21 A;  1M2T B;  1MC9 A;  5EC5 A;  4QBC A;  4A7Z A;  2FGF A;  4I4V A;  4IZX A;  3EF2 A;  3FJH A;  2ESU A;  2KKI A;  1DIW A;  3HSM A;  1HCE A;  2UUS A; 
#chains in the Genus database with same CATH topology
 4CJM A;  1Q03 A;  4J2S A;  2GZB A;  4LO0 A;  1F31 A;  1S0G A;  3P6J A;  2DRY A;  1PUM B;  5G00 A;  3O4A A;  4R6U B;  2ZQN A;  1RY7 A;  1S0B A;  1HWP B;  1AF9 A;  2ZR1 B;  1Q1U A;  1ISY A;  4EFR A;  3OBR A;  1G9D A;  2P23 A;  4KEJ A;  2DS0 A;  3NBC A;  1FV2 A;  3WO4 A;  3H6R A;  4II0 A;  2VXR A;  2KI6 B;  3WMU A;  2HWA A;  2BEB A;  4F83 A;  3R4S A;  4QKR A;  2BEA A;  1IIL A;  3HMY A;  1EYL A;  1BFG A;  4JKX B;  3LTQ A;  4KEK A;  5DSS B;  3BAV A;  4ZOT A;  4G6J A;  1NUN A;  3C9Z A;  2ERM A;  4JQ0 A;  1W3F A;  3D7W B;  4L4H A;  3WIN A;  4ZBV B;  2I1B A;  3I29 B;  3V0A B;  4X3A A;  4G9M A;  2NTD A;  4YOL A;  2Q3N B;  5BP5 A;  3CA0 A;  3FGM A;  3NBE A;  2K43 A;  3OGF A;  3NBN A;  2ET2 A;  3BRF A;  1K5U A;  3V0B A;  3UD8 A;  2D23 A;  3IM6 A;  1WBA A;  1JT7 A;  2Z49 A;  4IQP A;  1FMM S;  3PG0 A;  5FZY A;  2NZ9 A;  1ITB A;  5DUY A;  2AAI B;  5I1B A;  3VUO A;  1HIB A;  1Z0H A;  1PZZ A;  1XHB A;  4HA2 A;  4I0Y A;  4LO3 C;  2R9K B;  3BAH A;  1HWN B;  1ISV A;  1BLD A;  3AH1 A;  4EKX B;  3FJ9 A;  2F8X C;  5D62 A;  1TIE A;  4EFP A;  4XFT A;  4ISQ A;  2IWT B;  3H6S E;  4MZF B;  4QC4 A;  1XYF A;  3T8S A;  1ISZ A;  3F1R A;  1SR4 C;  1FN0 A;  4IY9 A;  3HBW A;  3UD9 A;  1Z2V A;  3O5W B;  3FJF A;  4XKI A;  2LIE A;  2X2T A;  1OQL B;  1AVX B;  1JLX A;  4LO2 A;  4OEF A;  1CE7 B;  3CRG A;  4OWJ A;  3BA5 A;  1DFQ A;  1FGA A;  2Y9X E;  2D1Z A;  4LO7 B;  5D61 A;  3JRR A;  1WD3 A;  4JAW A;  5E24 E;  2NM1 A;  3BAD A;  4ZA3 B;  1V6W A;  3ZC9 A;  1DQO A;  2F2F A;  3O44 A;  4AN7 B;  5BQU A;  1GGP B;  2MC2 A;  2L5X A;  4G6M A;  3E8L C;  4KBB A;  5GAQ A;  3A07 A;  2QN4 A;  5BXS A;  1KNM A;  1YXW A;  2RG9 B;  3POK A;  3MPP G;  1L2H A;  1FWU A;  3FJE A;  4I4S A;  41BI A;  4ZGR B;  1RML A;  2YUG A;  4USO A;  4ZFY B;  1QXM A;  4HR6 C;  3CA6 A;  1J0S A;  2K4A B;  1A8D A;  1AVA C;  3ZXG A;  2HW9 A;  2HZ9 A;  4I37 A;  4ZLB B;  1T4Q A;  3RTJ B;  4GP3 A;  4OUJ A;  1HWO B;  3OBT A;  1XZZ A;  4DEN A;  3CQA A;  5JMC A;  3S8K A;  3BAO A;  2VSA A;  4IY8 A;  5BVP I;  1NZK A;  4LO1 C;  3HOM A;  3O4O A;  1G82 A;  1BFB A;  1G9A A;  2KLL A;  5BXT A;  1W3A A;  5HPZ A;  1FQ9 A;  1MD6 A;  1PUU B;  3MAL A;  3A22 A;  4I4O A;  4XFU A;  3AJ6 A;  3PHZ A;  1D0H A;  1IHK A;  3JUT A;  1II4 A;  4IYB A;  5F8W A;  2HWM A;  3AKH A;  4X37 A;  4LO7 C;  1YTO A;  3F62 B;  3FJK A;  4I4X A;  3WO3 A;  2Q9X A;  1FV3 A;  3N0K A;  3OJ2 A;  2AQZ A;  4EEE B;  4I2S A;  3Q7X A;  4I7I A;  3V0B B;  3UJ0 A;  3RTI B;  1W3G A;  4ZFW B;  1S0F A;  4MZH A;  4LO3 A;  4QBV A;  5FNX A;  1SZ6 B;  1CVS A;  3CA5 A;  2VU9 A;  4IHZ A;  3FUO A;  3FJ8 A;  4MZG B;  2M49 A;  4G9N A;  4J2K A;  1BAS A;  1IRA X;  4OEG A;  3IM7 A;  3W9T A;  2MLL B;  2Y9F A;  3I2X A;  4QO3 A;  4I6I A;  1DJS B;  2DRZ A;  3N7K A;  4EB2 B;  5F8S A;  2NS2 A;  4P0L A;  4I4Q A;  4I1E A;  4OWL A;  1S0L A;  2MIB A;  1R8N A;  2E4M A;  1R8O A;  2BFH A;  3ILA A;  1S0C A;  1UPS A;  1IJT A;  2Y9W C;  4WBC A;  5FNW A;  4I96 A;  2X2S A;  1RG8 A;  4J2X A;  5D63 A;  2RQ9 A;  7I1B A;  3HAL A;  4KC3 A;  2D44 A;  4D0T A;  21BI A;  2NYY A;  4I4U A;  3WO2 A;  3BAU A;  2VUA A;  3V79 C;  3KMV A;  3IM5 A;  4HJJ A;  1V6X A;  2LIQ A;  1RZO B;  3BB2 A;  2VSE A;  4A7K A;  3O49 A;  5BP5 C;  1DFC A;  4Z9W B;  3Q7Y A;  1JY0 A;  5DVH A;  4JP0 A;  2GO2 A;  1XG6 A;  1FWV A;  2D22 A;  3Q7W A;  4Q91 A;  1ILR 1;  31BI A;  4X38 A;  1WD4 A;  1FMZ A;  1TFM B;  5BOW A;  2RST A;  3RMY A;  4EFQ A;  5F90 A;  5FZU A;  4END A;  4JRA A;  4FGF A;  1YYN A;  4G1R A;  4KEI A;  3VT1 A;  1IOB A;  2Z48 A;  3VT2 A;  5B2H A;  3CRH A;  1M16 A;  1ABR B;  3VT0 A;  3AH4 A;  2XOA A;  3FFZ A;  1BAR A;  1S0D A;  2WBC A;  1TWE A;  1YF8 B;  3CRI A;  3FJJ A;  1S0E A;  4XFS A;  4JKQ A;  4P0J A;  1QQL A;  3RSJ A;  4OW4 A;  4DCK C;  5BXR A;  1JT4 A;  2K8R A;  1N4K A;  1AXM A;  4IZE A;  3FJC A;  4ZKT B;  4LO2 C;  3WA1 A;  1P63 A;  3NJ5 A;  3PME A;  3ZC8 A;  3B9U A;  4I4R A;  3H6R B;  1Q04 A;  3CU1 B;  1AVW B;  4I1B A;  3ZX7 A;  3AZW A;  3BAG A;  2ZQO A;  3BRG C;  1BA7 A;  1V6U A;  2F2F C;  1BLA A;  3VEQ A;  3BA7 A;  1E0O A;  5BQU C;  3AH2 A;  4GOY A;  1BFC A;  1G9B A;  1EPW A;  3FJA A;  3K1X A;  4Q9G A;  1YBI A;  4GOV A;  4I4Y A;  1JT5 A;  4GP0 A;  2FO1 A;  3CA4 A;  4JPZ A;  2IHO A;  2D24 A;  1AFC A;  3N7J A;  3S8J A;  1HWM B;  1G9C A;  5JLV A;  2NVH A;  2Y9G A;  5DZU A;  1JQZ A;  5F8Y A;  4OEE A;  4I3N A;  1DLL A;  1PWA A;  4F34 A;  4Z8S B;  1ISW A;  1ONK B;  4X39 A;  1ISX A;  1PC8 B;  3VWC A;  2AFG A;  2VXT I;  4QD2 B;  3P53 A;  2AXM A;  4AN6 A;  4A7Y A;  3AZV A;  1JTC A;  3FJD A;  4LO0 C;  2FFV A;  4QKS A;  4UY4 A;  1SR4 A;  1Z4S A;  1DZC A;  4TLP A;  1EVT A;  4D0Z A;  3QR5 A;  3SNV A;  1DQG A;  3RMX A;  2KI4 A;  1QQK A;  1TP0 A;  4H75 A;  4P6A A;  4USP A;  3TC2 A;  3WMV A;  4OWK A;  2D43 A;  3O4D A;  4D8H A;  4DEP A;  1TOO A;  2D7I A;  3IIR A;  2WRY A;  1V6V A;  3P6I A;  4I4P A;  3V0A A;  3AKF A;  1EV2 A;  2VLC A;  4J2Y A;  3WIN C;  3A23 A;  2P39 A;  1HCD A;  1K5V A;  3LLP A;  2D7R A;  1VCL A;  3O4B A;  3FJB A;  3ZXD A;  3N7L A;  3AJ5 A;  3CA1 A;  3NBD A;  5EG6 C;  1I1B A;  3OJM A;  3OJV A;  3IAG C;  3BTA A;  3O4C A;  6I1B A;  5EHA A;  4L4I A;  3HN1 A;  1TWM A;  4Q9P A;  3N7M A;  4GAF A;  1IRP A;  2FFU A;  3FJI A;  1HKN A;  1JT3 A;  2E4M C;  3H6Q A;  2J3P A;  1I1E A;  4ION A;  4LO8 B;  4QD2 C;  8I1B A;  1TTU A;  1WBC A;  4PC4 A;  3BA4 A;  4ZFU B;  3UJ4 A;  3CA3 A;  4LO1 A;  3BAQ A;  3R4U A;  3UD7 A;  3O3Q A;  1T9F A;  3BX1 C;  3UDA A;  3AKI A;  3PUB A;  4GAI A;  2QYI B;  1JLY A;  3QYD A;  4J23 B;  3VSZ A;  4ISR A;  4P0K A;  1IT0 A;  4FVV A;  3BRD A;  2KH2 A;  3CAH A;  3I2A A;  3AKG A;  2DRE A;  3VSF A;  4I8M A;  5BXP A;  5FZZ A;  9ILB A;  4H9W A;  4QAL A;  3OGG A;  2NP0 A;  2FDB M;  2D20 A;  1DZD A;  4H04 A;  1AVU A;  1BFF A;  3FUQ A;  3A21 A;  1M2T B;  1MC9 A;  5EC5 A;  4QBC A;  4A7Z A;  2FGF A;  4I4V A;  4IZX A;  3EF2 A;  3FJH A;  2ESU A;  2KKI A;  1DIW A;  3HSM A;  1HCE A;  2UUS A; 
#chains in the Genus database with same CATH homology
 4CJM A;  1Q03 A;  4J2S A;  2GZB A;  4LO0 A;  1F31 A;  1S0G A;  3P6J A;  2DRY A;  1PUM B;  5G00 A;  3O4A A;  4R6U B;  2ZQN A;  1RY7 A;  1S0B A;  1HWP B;  1AF9 A;  2ZR1 B;  1Q1U A;  1ISY A;  4EFR A;  3OBR A;  1G9D A;  2P23 A;  4KEJ A;  2DS0 A;  3NBC A;  1FV2 A;  3WO4 A;  3H6R A;  4II0 A;  2VXR A;  2KI6 B;  3WMU A;  2HWA A;  2BEB A;  4F83 A;  3R4S A;  4QKR A;  2BEA A;  1IIL A;  3HMY A;  1EYL A;  1BFG A;  4JKX B;  3LTQ A;  4KEK A;  5DSS B;  3BAV A;  4ZOT A;  4G6J A;  1NUN A;  3C9Z A;  2ERM A;  4JQ0 A;  1W3F A;  3D7W B;  4L4H A;  3WIN A;  4ZBV B;  2I1B A;  3I29 B;  3V0A B;  4X3A A;  4G9M A;  2NTD A;  4YOL A;  2Q3N B;  5BP5 A;  3CA0 A;  3FGM A;  3NBE A;  2K43 A;  3OGF A;  3NBN A;  2ET2 A;  3BRF A;  1K5U A;  3V0B A;  3UD8 A;  2D23 A;  3IM6 A;  1WBA A;  1JT7 A;  2Z49 A;  4IQP A;  1FMM S;  3PG0 A;  5FZY A;  2NZ9 A;  1ITB A;  5DUY A;  2AAI B;  5I1B A;  3VUO A;  1HIB A;  1Z0H A;  1PZZ A;  1XHB A;  4HA2 A;  4I0Y A;  4LO3 C;  2R9K B;  3BAH A;  1HWN B;  1ISV A;  1BLD A;  3AH1 A;  4EKX B;  3FJ9 A;  2F8X C;  5D62 A;  1TIE A;  4EFP A;  4XFT A;  4ISQ A;  2IWT B;  3H6S E;  4MZF B;  4QC4 A;  1XYF A;  3T8S A;  1ISZ A;  3F1R A;  1SR4 C;  1FN0 A;  4IY9 A;  3HBW A;  3UD9 A;  1Z2V A;  3O5W B;  3FJF A;  4XKI A;  2LIE A;  2X2T A;  1OQL B;  1AVX B;  1JLX A;  4LO2 A;  4OEF A;  1CE7 B;  3CRG A;  4OWJ A;  3BA5 A;  1DFQ A;  1FGA A;  2Y9X E;  2D1Z A;  4LO7 B;  5D61 A;  3JRR A;  1WD3 A;  4JAW A;  5E24 E;  2NM1 A;  3BAD A;  4ZA3 B;  1V6W A;  3ZC9 A;  1DQO A;  2F2F A;  3O44 A;  4AN7 B;  5BQU A;  1GGP B;  2MC2 A;  2L5X A;  4G6M A;  3E8L C;  4KBB A;  5GAQ A;  3A07 A;  2QN4 A;  5BXS A;  1KNM A;  1YXW A;  2RG9 B;  3POK A;  3MPP G;  1L2H A;  1FWU A;  3FJE A;  4I4S A;  41BI A;  4ZGR B;  1RML A;  2YUG A;  4USO A;  4ZFY B;  1QXM A;  4HR6 C;  3CA6 A;  1J0S A;  2K4A B;  1A8D A;  1AVA C;  3ZXG A;  2HW9 A;  2HZ9 A;  4I37 A;  4ZLB B;  1T4Q A;  3RTJ B;  4GP3 A;  4OUJ A;  1HWO B;  3OBT A;  1XZZ A;  4DEN A;  3CQA A;  5JMC A;  3S8K A;  3BAO A;  2VSA A;  4IY8 A;  5BVP I;  1NZK A;  4LO1 C;  3HOM A;  3O4O A;  1G82 A;  1BFB A;  1G9A A;  2KLL A;  5BXT A;  1W3A A;  5HPZ A;  1FQ9 A;  1MD6 A;  1PUU B;  3MAL A;  3A22 A;  4I4O A;  4XFU A;  3AJ6 A;  3PHZ A;  1D0H A;  1IHK A;  3JUT A;  1II4 A;  4IYB A;  5F8W A;  2HWM A;  3AKH A;  4X37 A;  4LO7 C;  1YTO A;  3F62 B;  3FJK A;  4I4X A;  3WO3 A;  2Q9X A;  1FV3 A;  3N0K A;  3OJ2 A;  2AQZ A;  4EEE B;  4I2S A;  3Q7X A;  4I7I A;  3V0B B;  3UJ0 A;  3RTI B;  1W3G A;  4ZFW B;  1S0F A;  4MZH A;  4LO3 A;  4QBV A;  5FNX A;  1SZ6 B;  1CVS A;  3CA5 A;  2VU9 A;  4IHZ A;  3FUO A;  3FJ8 A;  4MZG B;  2M49 A;  4G9N A;  4J2K A;  1BAS A;  1IRA X;  4OEG A;  3IM7 A;  3W9T A;  2MLL B;  2Y9F A;  3I2X A;  4QO3 A;  4I6I A;  1DJS B;  2DRZ A;  3N7K A;  4EB2 B;  5F8S A;  2NS2 A;  4P0L A;  4I4Q A;  4I1E A;  4OWL A;  1S0L A;  2MIB A;  1R8N A;  2E4M A;  1R8O A;  2BFH A;  3ILA A;  1S0C A;  1UPS A;  1IJT A;  2Y9W C;  4WBC A;  5FNW A;  4I96 A;  2X2S A;  1RG8 A;  4J2X A;  5D63 A;  2RQ9 A;  7I1B A;  3HAL A;  4KC3 A;  2D44 A;  4D0T A;  21BI A;  2NYY A;  4I4U A;  3WO2 A;  3BAU A;  2VUA A;  3V79 C;  3KMV A;  3IM5 A;  4HJJ A;  1V6X A;  2LIQ A;  1RZO B;  3BB2 A;  2VSE A;  4A7K A;  3O49 A;  5BP5 C;  1DFC A;  4Z9W B;  3Q7Y A;  1JY0 A;  5DVH A;  4JP0 A;  2GO2 A;  1XG6 A;  1FWV A;  2D22 A;  3Q7W A;  4Q91 A;  1ILR 1;  31BI A;  4X38 A;  1WD4 A;  1FMZ A;  1TFM B;  5BOW A;  2RST A;  3RMY A;  4EFQ A;  5F90 A;  5FZU A;  4END A;  4JRA A;  4FGF A;  1YYN A;  4G1R A;  4KEI A;  3VT1 A;  1IOB A;  2Z48 A;  3VT2 A;  5B2H A;  3CRH A;  1M16 A;  1ABR B;  3VT0 A;  3AH4 A;  2XOA A;  3FFZ A;  1BAR A;  1S0D A;  2WBC A;  1TWE A;  1YF8 B;  3CRI A;  3FJJ A;  1S0E A;  4XFS A;  4JKQ A;  4P0J A;  1QQL A;  3RSJ A;  4OW4 A;  4DCK C;  5BXR A;  1JT4 A;  2K8R A;  1N4K A;  1AXM A;  4IZE A;  3FJC A;  4ZKT B;  4LO2 C;  3WA1 A;  1P63 A;  3NJ5 A;  3PME A;  3ZC8 A;  3B9U A;  4I4R A;  3H6R B;  1Q04 A;  3CU1 B;  1AVW B;  4I1B A;  3ZX7 A;  3AZW A;  3BAG A;  2ZQO A;  3BRG C;  1BA7 A;  1V6U A;  2F2F C;  1BLA A;  3VEQ A;  3BA7 A;  1E0O A;  5BQU C;  3AH2 A;  4GOY A;  1BFC A;  1G9B A;  1EPW A;  3FJA A;  3K1X A;  4Q9G A;  1YBI A;  4GOV A;  4I4Y A;  1JT5 A;  4GP0 A;  2FO1 A;  3CA4 A;  4JPZ A;  2IHO A;  2D24 A;  1AFC A;  3N7J A;  3S8J A;  1HWM B;  1G9C A;  5JLV A;  2NVH A;  2Y9G A;  5DZU A;  1JQZ A;  5F8Y A;  4OEE A;  4I3N A;  1DLL A;  1PWA A;  4F34 A;  4Z8S B;  1ISW A;  1ONK B;  4X39 A;  1ISX A;  1PC8 B;  3VWC A;  2AFG A;  2VXT I;  4QD2 B;  3P53 A;  2AXM A;  4AN6 A;  4A7Y A;  3AZV A;  1JTC A;  3FJD A;  4LO0 C;  2FFV A;  4QKS A;  4UY4 A;  1SR4 A;  1Z4S A;  1DZC A;  4TLP A;  1EVT A;  4D0Z A;  3QR5 A;  3SNV A;  1DQG A;  3RMX A;  2KI4 A;  1QQK A;  1TP0 A;  4H75 A;  4P6A A;  4USP A;  3TC2 A;  3WMV A;  4OWK A;  2D43 A;  3O4D A;  4D8H A;  4DEP A;  1TOO A;  2D7I A;  3IIR A;  2WRY A;  1V6V A;  3P6I A;  4I4P A;  3V0A A;  3AKF A;  1EV2 A;  2VLC A;  4J2Y A;  3WIN C;  3A23 A;  2P39 A;  1HCD A;  1K5V A;  3LLP A;  2D7R A;  1VCL A;  3O4B A;  3FJB A;  3ZXD A;  3N7L A;  3AJ5 A;  3CA1 A;  3NBD A;  5EG6 C;  1I1B A;  3OJM A;  3OJV A;  3IAG C;  3BTA A;  3O4C A;  6I1B A;  5EHA A;  4L4I A;  3HN1 A;  1TWM A;  4Q9P A;  3N7M A;  4GAF A;  1IRP A;  2FFU A;  3FJI A;  1HKN A;  1JT3 A;  2E4M C;  3H6Q A;  2J3P A;  1I1E A;  4ION A;  4LO8 B;  4QD2 C;  8I1B A;  1TTU A;  1WBC A;  4PC4 A;  3BA4 A;  4ZFU B;  3UJ4 A;  3CA3 A;  4LO1 A;  3BAQ A;  3R4U A;  3UD7 A;  3O3Q A;  1T9F A;  3BX1 C;  3UDA A;  3AKI A;  3PUB A;  4GAI A;  2QYI B;  1JLY A;  3QYD A;  4J23 B;  3VSZ A;  4ISR A;  4P0K A;  1IT0 A;  4FVV A;  3BRD A;  2KH2 A;  3CAH A;  3I2A A;  3AKG A;  2DRE A;  3VSF A;  4I8M A;  5BXP A;  5FZZ A;  9ILB A;  4H9W A;  4QAL A;  3OGG A;  2NP0 A;  2FDB M;  2D20 A;  1DZD A;  4H04 A;  1AVU A;  1BFF A;  3FUQ A;  3A21 A;  1M2T B;  1MC9 A;  5EC5 A;  4QBC A;  4A7Z A;  2FGF A;  4I4V A;  4IZX A;  3EF2 A;  3FJH A;  2ESU A;  2KKI A;  1DIW A;  3HSM A;  1HCE A;  2UUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...