The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
2
|
sequence length |
53
|
structure length |
53
|
Chain Sequence |
AVEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTFDESEGVVKIQLLKEPWK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transcription regulator
|
| molecule keywords |
Transcriptional regulator, AbrB family
|
| publication title |
The DNA-recognition fold of Sso7c4 suggests a new member of SpoVT-AbrB superfamily from archaea.
pubmed doi rcsb |
| source organism |
Sulfolobus solfataricus
|
| total genus |
2
|
| structure length |
53
|
| sequence length |
53
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2010-11-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04014 | MazE_antitoxin | Antidote-toxin recognition MazE, bacterial antitoxin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Pemi-like Protein 1; Chain: D | Pemi-like Protein 1; Chain: D |
#chains in the Genus database with same CATH superfamily 2GLW A; 2L66 A; 2FY9 A; 5ITJ A; 2RO4 A; 3TND B; 1YSF A; 1MVF D; 2K1N A; 2RO3 A; 5ITM A; 1UB4 C; 3O27 A; 1YFB A; 2RO5 A; 2W1T A; 1Z0R A; 2W1T B; #chains in the Genus database with same CATH topology 4JDO A; 1UB4 C; 3O27 A; 1Z0R A; 2L66 A; 3TND B; 5ITM A; 1YFB A; 2W1T B; 2FY9 A; 2RO4 A; 1MVF D; 2RO3 A; 2RO5 A; 2W1T A; 2GLW A; 5ITJ A; 2QA4 I; 2K1N A; 4JDM A; 1YSF A; #chains in the Genus database with same CATH homology 4JDO A; 1UB4 C; 3O27 A; 1Z0R A; 2L66 A; 3TND B; 5ITM A; 1YFB A; 2W1T B; 2FY9 A; 2RO4 A; 1MVF D; 2RO3 A; 2RO5 A; 2W1T A; 2GLW A; 5ITJ A; 2QA4 I; 2K1N A; 4JDM A; 1YSF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
