2L69A

Solution nmr structure of de novo designed protein, p-loop ntpase fold, northeast structural genomics consortium target or28
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
134
structure length
134
Chain Sequence
MNIVIVVFSTDEETLRKFKDIIKKNGFKVRTVRSPQELKDSIEELVKKYNATIVVVVVDDKEWAEKAIRFVKSLGAQVLIIIYDQDQNRLEEFSREVRRRGFEVRTVTSPDDFKKSLERLIREVGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of de novo designed rossmann 2x3 fold protein, Northeast Structural Genomics Consortium Target OR28
rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords Rossmann 2x3 fold protein
total genus 42
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2l69A00
2L82A 2LR0A 4J29A 2N3ZA 2LCIA 2LVBA 5GAJA 2LTAA 2N75A 2LNDA 2MR5A 2KPOA 2LV8A 2L69A 2LRHA 2MR6A
chains in the Genus database with same CATH superfamily
4PPFA 4OH7A 4X7BA 2FRVA 1WQ3A 3A6PC 2VZLA 1R0KA 1ZK4A 2AEFA 2H5EA 3NBYC 3CS3A 1M33A 4NOLA 4Y2XA 3A4VA 1T3TA 1ORRA 2H57A 4L8WB 2JCYA 3CVYA 2J9GA 3PWKA 4IUYA 5DXAA 2AFIA 4PHTA 2A78A 2GTPA 3HM2A 3JRNA 3USES 4Q9NA 1E5VA 1V48A 4RY9A 5P21A 3C6XA 3KHUA 4S12A 2ARKA 5CDYA 1RZ3A 4REQB 4KNVA 1GPWB 3TLKA 4YMGA 1WB6A 2QTFA 2I2WA 4KWIA 3P2OA 1OXSC 3CM0A 3NHMA 4ZO7A 3LRPA 3VNUA 2ZYSA 1J42A 1F0KA 4ZMRA 1JV2B 2I8CA 3VAAA 1UK9A 3HKCA 4BU1A 3HP4A 2C2OA 2Q7XA 2R6JA 3E84A 2DHDA 2FKNA 2VYVA 4GR9A 4HUJA 3DEZA 1NUPA 2P9TA 1NHGA 4R05A 5KTYA 4MVJM 4BFYA 2IHZA 2P78A 3H83A 3E1GA 3F49S 3PRYA 4K9QA 4LDQA 5CR9A 5DN6A 4EAQA 4TS3A 1UMDA 2ZB4A 3CISA 3NIWA 4E1BA 3QSYA 4JQSA 4UZEA 3E82A 2E4VA 2VTVA 1M2OA 3GJTA 4BFCA 4Z6KA 5KQMA 5DGHA 5CEEA 2C97A 4UW9A 3CLUD 3CZMA 3P9PA 4M8KA 2W83A 1IDN1 2HNBA 3DYIA 5HM8A 1L1FA 2Q4BA 1G7TA 3D1LA 1M2FA 3Q3VA 3I58A 1U9IA 5AVRA 2YY7A 3W3AA 3CZQA 4DV0B 4A0QA 1QKJA 4KOAA 4YHHB 2IK8A 3W2IA 3HZZA 3G68A 1M5RA 3GGCA 4NCXA 2O7RA 1UWKA 3LQ2A 3RC8A 2GSDA 1KZ6A 1G20B 2BFCA 4ARSA 6PFKA 2YW9A 3KVNA 3P32A 1JYSA 5M3BA 4MICA 8GPBA 3B3FA 1FXUA 5JD5A 2CXNA 1NI5A 2PGJA 3ADKA 3GAFA 5JH7F 2QMOA 5AK5A 4A5OA 1P2FA 3RRNA 1KSHA 2JI9A 2DQZA 4FKMA 4G09A 2V7VA 4D9EA 4DIDA 4GLFA 4HRXA 2E85A 4X8MA 2FQQA 2HA7A 3AHDA 1G8JA 3SQMA 2YZNA 3N2NA 3NDIA 4U63A 1PR0A 1EUDB 3ICWA 1J0CA 1DDGA 4JK3A 1FYFA 4XJVA 2Q5OA 4FBMA 1I4EB 2ENUA 4C4SA 2PWAA 1QRDA 1DRJA 2R8XA 5FL3A 1L4GA 5HIJA 5JSHA 2JFBA 1PWEA 2HM7A 1E1MA 3O4HA 4JI8B 1QGYA 3QLUC 2EAUA 3BKXA 1HPLA 4LWOA 3SF8A 2ZANA 3TJRA 1FTNA 4MDHA 4LFBB 1FS6A 1CS0B 3DM5A 1BD3A 5EQFA 2I76A 4R68A 4KQXA 1BU8A 2RDMA 1C14A 1GP2A 2FYTA 3MQ4A 4HDOB 4JC5A 4MPTA 3TZCA 1E3JA 3U49A 2BGGA 3WYBA 1UT6A 2YOHA 4IGIA 3CXRA 2PUJA 3IAAA 4PLWA 5BRJA 3ODPA 4GL4A 4CPDA 4DVJA 5IS2A 4I6EA 3WRVA 1CZHA 3G8CA 5CT6A 3QK7A 5FOUA 1ZRNA 3HYLA 4WLFA 2HDOA 2XYHA 5C4IA 5ENDA 4V02A 3ETLA 1T5BA 2D8AA 1YB5A 3ONWA 1GL6A 3OOJA 4L50A 3TTVA 5FV4A 2OFXA 1XHLA 1YDEA 3FPBA 4NMLA 1M6NA 2NO1A 3PFKA 4K6FA 4ONEA 5F1PA 5HJ2A 5B1SA 2IWHA 1J90A 5C5EA 4TS9A 4CV0A 4PQRA 1HQKA 1SG0A 4DM7A 5CBKA 3ER9A 1YOVB 1HNXB 3P4YA 1CUHA 3T0GA 5FJIA 1YJQA 1Z4LA 1RMYA 2O2HA 3Q8KA 1VMIA 4OIMA 5DH9A 2P62A 1C0EA 1ZD5A 4JHLA 4ZEXA 3O73A 3DR5A 5CFZA 2OCBA 3ZWCA 1RLTA 1N1GA 1XVIA 4MGIR 4K88A 4LRXA 5DWVA 1ZH4A 4I4LA 4RHCA 3C87A 2XSZA 4OHOA 4D9BA 4B7UA 2PX2A 4EUSA 1OASA 4D9KA 1GAXA 5GONF 3VVCA 1MFPA 3HCCA 4Z7OB 3L4BC 3QVVA 1T0PA 1DE0A 3WIBA 2V7EA 5IFLA 1TZ2A 1OLUA 2A58A 1O6FA 4KDFA 1F38A 1K8XB 3EMDA 4D98A 1K66A 4Z1OA 2WQ7A 1XRJA 2B7LA 4LZAA 1KEKA 1NXPA 2H11A 2V74B 2OO5C 3EN0A 3ON5A 4Q37A 1Q20A 3EULA 3G0BA 1SMKA 1HYBA 4FOLA 3UKJA 3ZU5A 5ADUS 4OB7A 3I5XA 1N5JA 1SIWA 1A71A 1VYHA 2D0PB 2XTZA 2ZREA 3EZGA 2RK6A 2X4DA 4CMEA 4QXMA 5A5GA 1NJFA 2YVUA 5ILQA 4DKJA 2XADA 3PNLA 3JQGB 3OUZA 2XEDA 2HJGA 2QX6A 1EXDA 3A9UA 1HK7A 4N49A 3M33A 1RWKA 4JP2A 4ZT5A 3ROMA 1E2LA 3NHFA 2CXPA 4HNQA 3L6UA 3NCHA 1GFIA 2G71A 1UPUA 2WP0A 1BRMA 4JI1B 1I14A 4PLHA 2X5XA 3X2SA 1CUUA 5JXWA 1C1XB 4HO1X 2OZKA 3EMVA 2VLIA 5CNMA 2BVNA 1L5MA 4G0MA 3RUEA 3W4KA 3H9UA 1GFWA 1X39A 1P31A 1GPNA 2QRQA 2X3FA 1P9NA 3C14C 3K8ZA 3PUVA 5JHGB 3GFQA 4EG6A 1J8QA 4CDMA 2ENWA 3T06B 4ZI3A 1F5NA 4HNAA 1J0BA 2I78A 4P3OA 4K2HA 4MKFA 4PZYA 2NO9A 3BSSA 1ST3A 4RX1A 2KWIA 4XDYA 2COUA 5JZBA 1I0LA 3H5AA 2L42A 3QV2A 5K0LA 5H9WA 1IYZA 2X2PA 3DCYA 2R79A 2FWPA 4R01A 1R6TA 1L8XA 3DBRA 3FUCA 1PGJA 3OT5A 2C4WA 3DOIA 1BQEA 1TNDA 1YZTA 2R8PA 3NUQA 1SBCA 3TJMA 4GMKA 2P1DA 2OXCA 3MVEA 4LYAA 4MW1A 5K4AA 3ULKA 3ELWA 4PZ0A 1YHZA 1N7IA 4HDQB 4W4TA 4BLRA 4MRSA 2DXIA 5K4GA 1WXIA 5CMLA 4JVNA 3QIAA 4XTRA 1W96A 5ALYA 3R74A 2FN7A 2VBIA 5E6RB 2JFGA 2ZQZA 4LZZA 4OXIA 1B8NA 2RHRA 4BVLA 1LLDA 2AMFA 4PHHA 4BIMA 1LBEA 1K7XB 2JZOA 5JI3E 1YZYA 2CCGA 3H3XA 1YB4A 3ESYA 3FI9A 3GNQA 4DBVO 2HMSA 4ZEMA 4L5CA 3TNLA 1PWXA 1UJ2A 3HY3A 5DEOA 3BCUA 5E7JA 5GV7A 1K2VN 3ASYA 3RIEA 3QLJA 4LZWA 1SU7A 4BLPA 4MI6A 5KTMA 4KVZA 1RM5A 4K26A 3UCXA 5JNSA 2EJCA 3EG9A 3DNMA 3ESAA 2ANCA 2V3WA 3H2GA 2B0JA 1UT8A 3GLUA 3HKDA 1DV1A 3A6EA 2QRHA 4YREA 2DJIA 4D6XA 4E09A 1K86A 1GUFA 1R66A 4ZQIA 1BGXT 2VBCA 4K5QA 4R54A 2C84A 3FX2A 5EN4A 1GR1A 1DT5A 3LA8A 4GWKA 4JC8A 4NHEA 4TRNA 4KAFA 3RSZA 1UBSB 4AF8A 3F6PA 3FH0A 2JIRA 5IKMA 2JLBA 2PJUA 1NXTA 1RLJA 2ZDGA 3PT9A 4JXKA 4KQFA 4P83A 1POXA 1W9MA 3ED5A 3KPJA 3OZSA 2ORVA 4QICA 4CLOB 4KE6A 4HYTA 2XD9A 5HIAA 1A8SA 4Y6QA 5IYZF 5AVXA 3V4FA 3S4YA 4N6NA 5K7SA 2VVTA 4EG3A 3GUHA 2AOTA 3FCSB 3MCUA 1YCFA 5KQGA 1TCBA 3AI7A 4FQ7A 2JDID 3RBZA 3OCCA 3PQCA 5JS7A 2VJOA 1CR6A 1TFRA 3KQVA 4HJRA 4WCVA 3DAYA 4YWJA 3T8YA 3ZLVA 4CM6A 4H6XA 4EF6A 5BN3B 5I9MA 5HCUA 4K6KA 3VNAA 3WP0A 3ZE7A 1SBHA 4CEJB 1PJTA 1LDYA 1ZL2A 3C8HA 3D6TB 2ZDQA 1GSOA 5BQFA 2VBGA 1FTQA 5BPHA 4F56A 1GZHB 3W2TA 4FBLA 4BAUA 4CTKA 3LJKA 2P3OA 1ZIXA 3ANLA 3SMVA 1DRWA 3V2HA 3EVGA 2XXAA 2EGUA 3PNMA 4JYAB 2XDWA 3PJFA 4DABA 1L4EA 4L2IA 4Y2UA 4EX6A 1UEIA 1IPFA 1XPRA 1W93A 2FWBA 1VHQA 1X1CA 5EOVA 4EK9A 3I01A 1IONA 4W9NC 2I8LA 1M76A 2O8CB 1WDTA 5G4LA 1MAUA 4BLVA 1RRKA 1NR1A 3K0EA 4MVJH 5DHPA 2J3QA 3HN6A 1TTTA 3HRKA 1KI6B 4MUMA 2H4WA 1E60A 2F64A 4G25A 3VR0A 1AU9A 3CZCA 4C4AA 4O2LA 1X7WA 5A3QA 3B2EA 3IT1A 5UKDA 1H94A 1I94B 2H92A 4YRPA 2HTFA 2EF0A 2ATEA 4LYEA 3GLFE 3UM9A 1L3CA 4KMMA 4MRNA 4M0LA 2IU6A 3A04A 2RGEA 4I1RA 1W0JA 5EQTA 4WY2A 4JMLA 4AIRA 1SOAA 2ORYA 2OPHA 2JLSA 2QNRA 3IQIX 3MJRA 4JB3A 1SCUB 1XA4A 2AFRA 1MHPA 4JBYA 4X00A 1P4GA 1BE6A 1PRYA 4Z8YA 5DX0A 1T2CA 2RARA 4A6EA 1ULUA 2VSFA 3KB8A 4FIDA 3ZBQA 5MGNA 1MT3A 2UV8A 3N07A 4K6CA 4RKQA 2OR3A 2RIRA 4D2IA 2AJDA 1P7ZA 1Z28A 1E1QD 2PA3A 2P2LA 3IHLA 2BKEA 2Q0XA 3QVXA 3RASA 3EPHA 1J8VA 2WBLC 3DMPA 5ALOA 4B35A 4YX9A 5IT5A 4Z4GA 1L3IA 1EB9A 1RPJA 5E4TA 3DOFA 1QP4A 2JIOA 3AHJA 4KPFC 3D8HA 4ZT3A 2CVPA 5JZVA 1B41A 2FW1A 3ROPA 2HSZA 3NT5A 2XIQA 4ZGGA 1E8DA 5JAQA 2L69A 2OHHA 3N8GA 1B43A 3FYUA 1CR0A 4KO3S 4DVGA 5SYAA 4J7XA 2OAGA 3E6AA 3IP3A 3BFPA 1IRIA 3ZK8A 1Q7BA 1ICEA 1V4VA 4R8VA 4F97A 3D7NA 5A1TA 4UTNA 1W4ZA 3G0GA 5A4KA 4J7UA 3ZJTA 4B34A 2ZB3A 5J2UB 1DPGA 1W1IA 3BHIA 4BB9A 4YP6A 4ZU3A 1XJ0A 2AWNA 3B9BA 4WNYA 2IZ7A 2QHXA 3CWQA 3VZSA 1QG6A 3ETNA 4WN9A 2QD3A 5ALGA 5JLAA 4PZUA 2SCUA 2VF2A 4JYPA 1O8CA 2R1VA 1USUA 1K89A 3B8EA 1CUFA 4ZEOA 3D5EA 3R6DA 4URUR 1KH3A 2PL5A 2YWCA 5CFPA 4BRZA 2WQ6A 5ALIA 4YH1A 5A9TA 1Q77A 2FPSA 3VHRA 1UPAA 1OTYA 3B8HA 4ACBA 3IDFA 4DUYB 2VSNA 2BN4A 3F5MA 3ND9A 4PYKA 4H7PA 2P2GA 1NX9A 4DT1A 2Q5QA 4OG2A 4KEAA 4Y1FA 5JAHA 2Q5EA 3U80A 2C7RA 1UMKA 2P40A 1H22A 1CQIA 2ZT5A 3OJFA 5A4MS 1J09A 3U62A 4L8FA 2L18A 3OEEA 3VR6A 1EE1A 2I71A 3E9EA 1PJQA 4W82A 1H6BA 3S2UA 1G21E 1N2IA 2FEMA 3VYTB 3WLQA 4D8TA 4DLRA 4DV1B 1RQLA 4P7JA 2VP4A 3ADPA 2QG9A 2C9CA 3H6HA 1MO4A 4JUFA 1E6UA 4MI1A 4NJMB 2C4HA 4Q6WA 1UOOA 1JWBB 2OV4A 3BEOA 1S3SA 1MZVA 1U3FA 2HAEA 2NTVA 3FOCA 5FTJA 1U81A 4BFTA 1A98A 5TS3A 1JA1A 2XB2A 2O59A 1IH8A 2F1KA 3EXFB 4PNEA 4CEHA 3RC7A 3NVMB 2AC7A 1CUZA 4CM8B 1HMYA 3OQ1A 3IMGA 3M4XA 3TS1A 821PA 3TGLA 3CVVA 2ZTUA 2LD4A 4KUHA 3SEFA 1F9AA 2BZGA 5A3RA 3BJIC 2OYRA 3LKBA 1FNSA 3QHPA 5A2QA 1PR1A 3G5TA 1BMQA 1RLMA 3L0PA 2X77A 5G1NA 4MS3A 3LVFO 4Y6RA 1M72A 1RACA 2CXRA 4EY6A 1A8QA 4NC9A 1WSDA 4MYHA 1YZLA 3L41A 1UP4A 3HDYA 2OD9A 1Q7TA 4XX0A 1MGOA 3DKRA 3H3FA 3K6SB 3EVCA 3MWGA 1B0UA 3UV7A 1G8YA 4MHTA 4J1TC 2GBGA 3HXKA 2WHRA 4N3AA 2O1SA 3IR7A 4JBXA 4D9HA 1PDOA 1VECA 4YJHA 1DEKA 3SFZA 1FY2A 4V24A 3BGDA 3UUGA 3A1UA 3HV0A 3TB6A 5H83A 4KC0A 5IBRA 2GBFA 2EJVA 1QPZA 3TE7A 1KQ3A 5DGCA 1U31A 1NQTA 2IHTA 3JRXA 4NVRA 4DZRA 4LV6A 4FZVA 1C0PA 4YJFA 5IJAA 2KLHA 1N2CB 1T1RA 5BUSA 1XTZA 3KDSE 1DBVO 3AJDA 3NYQA 4NZOA 4TV8A 5AQEA 3V6MA 4GL2A 2XUOA 3GDWA 4YY3B 3P2EA 2ZBQA 1IPEA 4AZ3B 4ZVLA 2C1ZA 2VRCD 3GN2A 3H4TA 2O8CA 1IB6A 3EEBA 3RUDA 4B84A 3P0FA 1IOVA 1ZJ6A 1A7UA 3OX4A 1JHVA 1T9ZA 4IVPA 1BX1A 4S1TA 1ZGZA 5HTKA 4ZTZB 1BS1A 2WWXA 1YBMA 4TXMA 4WJLA 2WUEA 4TWZA 5IEJA 1AKNA 1WMEA 5A4DA 4OXYA 3A6GA 2UVDA 4RD0A 1M0SA 1FFCA 2Y4NA 3AY0A 4M1MA 4XWAA 5K3CA 4HPXB 2IWRA 2DWOA 1XT6A 3RF7A 4OUKX 3FLBA 1P8JA 2RK4A 2YWEA 3KJFA 3NM5A 4KZKA 1VYVA 2QEQA 3NWOA 3PCXA 1G5IA 4GBGA 3S6JA 4RWEA 2HADA 1RNLA 3DR3A 3L7CA 1XTQA 2XKAA 3UMJA 2D59A 3UATA 3FDZB 3TZ6A 3VKUA 3QUAA 1BVYF 3WJ1A 4IIGA 1T6ZA 4RZUA 5L45A 2CSXA 4BZZA 4BBAA 5ES4B 2C9OA 1Q17A 2NSDA 1AK9A 3QNMA 4MQEB 3KAQA 3GLHB 4KQ9A 1R0BA 4QUIA 3WLKX 1BDBA 2Q5HA 3H7AA 4K05A 3RTGA 4LF6B 3DOUA 4N0QA 4YMWA 5CA0F 1DDIA 1MHTA 3QMPA 3PR1A 4MRRA 1DSSG 1QH8A 1YJCA 3RE1A 2IXTA 2W7TA 4EY4A 3QOFA 4I5DA 5IMSA 3D4OA 2QMUA 1P4JA 2VDLB 3AH8A 4NV1A 2X3UA 4YBRA 2FXIA 1UDBA 2LCIA 4QGHA 4YJHB 2DLDA 4EVSA 4BNIA 1LK5A 4EO4A 1OI4A 5D01A 1ZR2A 4TKUB 5DYIA 4ZYXA 1DWPA 5A05A 4O2BF 1LTHR 1YAHA 2DF8A 2W6JA 4JB0A 1RXCA 1W34A 3O74A 3L82B 4HDCA 3GJ0A 3GROA 1SUEA 4ZI5A 3ZHSA 3QVKA 2WQZA 4RNDB 2Y1OA 5FWYA 1G4HA 3ZTYA 2CXHA 2PX4A 1ULSA 3G2JA 4AY5A 2AMYA 4KFRA 5KREA 3EVEA 3X1DA 3DDSA 3WICA 2Y66A 2QV7A 4OUDB 1XNQB 1YIOA 2VNIA 2A9VA 3FZQA 3O47A 3A31A 2XV1A 1FYVA 1PTKA 1YMVA 2JJQA 2ZATA 4HQOA 4LRSB 3RVSA 3RKUA 4DQLA 5CFNA 5AI8A 2PXCA 3DDCA 1DV2A 2EL9A 1PL0A 1RBQA 2VPZA 3DLPX 1ARZA 3DCNA 3AQIA 1J2UA 2AZ4A 3EGVA 4TVBA 3UHJA 3LC0A 4G0QA 4BU0A 4MS1B 4C76A 2DSTA 3NTLA 5AXDA 5E3IA 2CLMB 3GGSA 2IS6A 3MF4A 1OFTA 1SURA 3W5CA 3DA8A 2IYQA 4FMDB 4Z0TA 1OX5A 3MG9A 4QJBA 3EXG2 3LIIA 4PC6A 2JLVA 5A7HA 1PD0A 1JG7A 1BXZA 1PW5A 2F48A 2GX6A 2ZI4A 3QHAA 4L5YA 1NXVA 5IKXA 1Z0FA 1XP5A 4MDEA 3GEHA 3C6BA 1YZFA 3KJQA 1ADYA 5CLGA 1EWYA 4LJRA 4IZHA 3W5UA 4OQEA 4Y8VA 4BNUA 1GSAA 4ZYVA 3EFBA 3GEDA 4NPAA 1WA5A 3NJRA 4CKEB 2VDKB 3AEKB 3K9CA 3IPCA 3RJMA 1YQDA 4YCCA 4MUHA 3SWWA 2BZSA 4IGAA 3ZVNA 1GQ2A 3WDLA 4DGSA 5DM2A 1LQTA 1OCEA 4FWTA 3EVNA 5JJLA 4FFPA 4XIIA 1O4WA 3ZN2A 1MA0A 5F3DA 2HY7A 4U0KA 1GTSA 4AKIA 2WVJA 1R88A 3CNEA 3R5HA 4W8OA 3CUWA 4O4LF 4V2UA 3BJRA 1VL0A 5BMVB 4O4IA 3ZXIA 1COWD 2FZEA 3JQPA 3H97A 1G41A 1KZ4A 5K45A 1PKXA 3WVNA 1ZI6A 2JGNA 5GAJA 4GVPA 3FFBA 4ZVNA 3RC3A 1YJ5A 4I1VA 4BCDA 1W36D 2DVMA 1V9LA 1GU7A 1R64A 2GJ8A 3NBXX 5HG0A 4V3CA 4E6PA 5KHLB 3JQAA 3G6WA 3M1IA 3A9TA 3LXMA 2ZXUA 4LXXA 4UUOA 1DC6A 4X7PA 4V1CB 5KB3A 1RRGA 4OBBA 3IPRA 4NYIQ 1TMOA 2PXXA 5ER6A 1H8ED 4DA9A 1BFDA 1VCHA 2FG5A 3K0HA 5M7EA 5BSRA 1RQ7A 4J7CA 3BHNA 4TT3A 4Q03A 2RIPA 1CHDA 4CKBB 1FJGB 2V1XA 5U4QA 2JFQA 3ZE0B 5JSUA 1GUDA 3KRTA 3L8GA 1NF2A 1CLUA 3IO3A 4I9FA 1KC1A 2ZM5A 3Q10A 2JH9A 1QVRA 1G8GA 3DBLB 3K8OE 4AY2A 4I9UA 1UDWA 1OFIA 2QDXA 1YJ8A 2CF5A 5ALQA 2W4IA 2GYVA 4MA4A 5EIOA 4BLUA 4Z4CA 3X1XA 5JAUA 2D74A 2VR1A 3WIOA 1RMQA 3SF0A 3VU9A 4BLOA 3I09A 1XTUA 2ZK7A 4DLVA 1FOEB 5JCXA 3VAZA 1QO0A 2BKUA 3L5OA 3VC1A 1U6JA 2FB9A 4BFLA 4YBZA 2NO4A 4C7OA 4JT9A 3V97A 3GJZA 4BECA 2JEOA 3PHGA 5JQWA 1MX9A 1WEKA 1Y9EA 3B6KA 1JG6A 1QLHA 1ISSA 3T1VA 1IY9A 4OJTA 1HUQA 1T9GS 1IAQA 4ITVA 2BJWA 2VZ9A 4RAQA 4RKWA 4RM3A 4XARA 1ZM7A 2SHKA 1PT8A 2QUJA 1XTVA 2C2ZA 2W71A 2WNSA 3E0QA 4GOND 4PNPA 1XRQA 4RY2A 1V96A 5CG1A 1FNBA 1WCWA 3BIXA 1OX4A 2VDJA 5A0TA 1MX5A 3UUWA 3BJZA 1CBUA 3K9NA 4TX1A 4YAWA 4W5RA 1XAGA 4J1NA 5JOQA 1QTQA 1RCUA 3GLVA 3PE4A 1W5BA 2J1LA 1GARA 3CF4A 1P6QA 3EZFA 2FDXA 3W8RA 5K03A 4OD0A 2XCIA 4B45A 2SKCA 2V4UA 3VTAA 4AJ4A 4BKOA 1FFGA 5BPFA 2GXQA 1D8AA 1F6WA 3KFVA 1G21B 3D1JA 1NPYA 3H4VA 4FDVA 3RSLA 2G9UA 2JL1A 1UQTA 5CDSA 3ZWVA 1BN6A 3HU1A 2PU5A 4US2R 3EPKA 5DT2A 1Y4SA 1ZO8A 3AR7A 3PDHA 4U8HA 3IV9A 4UMFA 1F2UA 3CMCO 3FNQA 3PGA1 5ELMA 5FXMA 1TTQB 2B2XA 1SVLA 5BR4A 5JC8A 1LWOA 4ZT6A 3R77A 2QRVB 1KYZA 2HA3A 2VAPA 5HW0A 5IU6A 1ZOLA 5J43A 2AWOA 3D8RA 3RQIA 1EBBA 1TYEB 4J3FA 1M7GA 1PBNA 2DULA 2YV2A 4KH0A 4DLUA 2WU0A 5CVJA 5FR2A 5TMBA 4P32A 2J9YB 3NH6A 4RTRA 1DAOA 2OCPA 4Y6SA 2EF1A 3VHXB 1LD3A 5K01A 1E1RA 1HYHA 2IE8A 4M1ZA 4P5DA 4E2XA 1KAEA 1LPMA 2XVZA 3DXFA 4P36A 3SBEA 1GXSB 4DLNA 3ZGZA 1RPNA 5HMMA 3N2KB 4G3XA 3UG7A 1T3LA 2W6CX 1KI4A 1RJ9A 2GS9A 1EP1B 3DFMA 4K7JA 5A6SA 3L46A 5A62A 1P9RA 2IL1A 3IMCA 3U4AA 3ZXUB 2AJBA 1PWYE 3B5JA 4WZBB 4ZMBA 3QUSA 1MPTA 4Y6LA 3ADOA 3PDJA 4ZDKA 4YUYA 4YAFA 2QN1A 3DFFA 5KKNB 3KG2A 3LY7A 4ZOBA 3NPAA 4CL0A 3HXMA 4ESHA 4C4YA 2F7SA 2VH5R 2OGZA 1KK3A 1GZDA 3AZOA 4EM6A 4LS3A 3NWEA 1VLJA 4D44A 2IPOA 4RPIA 3GJ8A 3UBMA 1U0OC 1UWVA 1XLVA 1UPXA 3OAAA 2M2IA 4WNCA 4XD7A 1T3SA 1TGYA 3KSDO 1B0AA 5DPMA 3OM1A 1H8HA 1S7GA 2FGJA 5DB4A 1YS9A 2MMCA 4MVJD 3WYCA 4B7ZA 3C4QA 5FX2A 2NT4A 721PA 4IUBS 2FWMX 3N39C 1I6MA 1FCJA 4X6LA 1P44A 1LPBB 1SB9A 5TEWA 4ABTA 1MOSA 1CZNA 1UJBA 5DHUA 4Z3DA 4KN9S 2CUNA 3L8ZA 5HE9A 3CSSA 3DVAA 3BGSA 4HEA1 2DETA 4WGFA 3I3OA 1NQVA 1S3GA 1X6VA 1ZK1A 4FWIB 4Y2TA 1LF0A 5I4CA 1SZJG 1IAVA 1AURA 3ICPA 3OZUA 4WOPA 1AS3A 1C3JA 1SZCA 2OQIA 3N86A 4CMAA 1GN9A 2O5EA 3ZWXA 1QTIA 2I3GA 2HA2A 4YV1A 1O97C 4M0UA 2FX2A 4PIMA 2HMWA 1VDZA 2HZBA 2QR5A 3UK7A 1X74A 4CM5A 3P9RA 5LU9A 3T35A 3DP7A 2H7YA 4R2MA 4AICA 3REQB 4BLWA 1A4IA 1XU7A 2Q27A 3IESA 4P08A 2JA2A 3BAZA 4DJ5X 5FEMA 4GICA 1RP1A 1XJCA 1ZUWA 4ER0A 1YE8A 5I7OA 1W30A 5JRJA 4R4JA 3RU9A 4DADA 3NETA 1UBNA 3ZZNA 3ECCA 2BC9A 2YZGA 2ORED 2Y0BA 4K9DA 3ZHRA 1U3VA 1V71A 4YRZA 4B4KA 5JQGA 2ZE7A 3ZQKA 5CA1F 4O4JF 2HJ9A 1E62A 2I80A 2QJTA 3N0WA 3PZBA 2R44A 4RSHA 3ZHVA 3LCVB 4DDTA 2V9CA 1FL9A 4RKRA 2DCUA 4Y2PA 3TLAA 3VBEA 4YCSA 5IK2D 3HK2A 3KTFA 1VKNA 4G97A 2WT8A 1SRRA 5ARDA 4DC1A 5LZ2A 3IVXA 5FDFA 1MJ5A 2P9CA 5CDGA 4G63A 4KI7A 4DOMA 1L8AA 3OJEA 1ZCZA 4MJXA 1BXKA 1XMVA 3CRNA 3GLIB 3I8OA 2HWXA 1DBSA 1Y89A 3CO5A 3IODA 4IMRA 4UTPA 5JWRA 4ZMSA 3OY2A 1KH1A 2V6BA 1O6BA 1J2YA 2X5OA 2R1UA 2UYYA 4QBFA 1Z4PX 4S1WA 2H4JA 4EYSA 1P7YA 2Y4OA 1AUVA 2BGRA 4RLSA 1ETUA 3F6CA 4PFKA 2Q4DA 1ZRSA 2X6TA 1JECA 2JVIA 2YVAA 4DHWA 4ZICA 1PJ3A 4QUGA 4INZA 4ZI2A 2GILA 1P19A 1UC4B 4OBXA 2QVBA 2CYAA 4M89A 2FFRA 3HCDA 3HGQA 1ZIYA 4PS0A 4G36A 1YZNA 3TIIA 4I2VA 3DTVA 2D1TA 1L7QA 3AHGA 2OOSA 1RWXA 3Q3JB 4KIUA 5T6MA 2J46A 3SE7A 4QTYA 5FA5A 1CNEA 3EJWA 3IE0A 1LB1B 3KETA 4ZPXA 1CQXA 1EXNA 3KLMX 4XLZA 2AD5A 4R1SA 5GVSA 4Q19A 1AGRA 3LBAA 3PNQA 4HYEA 2EQBA 4J4BA 5CPBA 5EZSA 4G0ZA 3U4MA 4C05A 1WZEA 4HAXA 4N9WA 1QFMA 3SBXA 2XVAA 3WAJA 3WNDA 4HX9A 1O8BA 4QQKA 1U2QA 3TKAA 1YV9A 4A6XA 3V80A 4F9TA 4J07A 1U7ZA 1DWUA 2I29A 3LK7A 4ZO6A 1DOZA 3PFFA 2ZU6A 5TJ9A 1F0YA 2IIQA 1NQOA 2CSUA 2IELA 1EXVA 1NSYA 3QQPA 4L27A 3TZHA 2BDEA 1OWNA 3HSSA 4HX2A 4YI5A 2XEXA 5JO0A 2GJKA 2C42A 3BORA 3IL2A 1E2PA 1DZ3A 2AN9A 2WF8A 2ZE5A 3GIDA 4FEYA 4LV5B 4MLZA 3QKSB 4CDNA 4FBGA 4YV0A 2QW8A 5A04A 2ZYRA 4X7RA 1MF7A 2GPTA 1O6CA 2PH5A 4LNAA 3T9CA 4D92A 3DDHA 1KL7A 1WCXA 4X9XA 5IF3A 2VNJA 5DI3B 1XBTA 2I7VA 2PKQP 1QHSA 2REBA 2QRGA 1HRKA 1L7MA 1E2GA 1D7OA 1QYVA 1ZJ5A 1CJSA 2P0YA 1QZZA 3UT5A 4RVUA 4BPBA 2BTQA 4JUIA 1V1RA 3WQRA 1YDFA 3EFHA 4FLMA 4XUEA 3QPCA 4LDJA 1GKYA 1NP7A 2IF0A 1XL1A 5EYPB 3BKWA 4IV0A 4BKQA 3WGUA 5I7VA 1JXAA 1YASA 4HCJA 2OCYC 1OQAA 4JJZA 4TWJA 4YHBA 2DSNA 2XOKD 4AF7A 3T9FA 3AKCA 5THKA 1WXDA 4QOIA 4E46A 2ABWA 5ER9A 2H7XA 3F46A 2Q9CA 1YO6A 3N1UA 2L0XA 2ZYDA 2EHJA 1EFRA 4WN9B 5A6VA 1WF3A 2CLOB 2FSIA 2QIPA 2H17A 3JQ8B 5CRIA 5IW8A 3S8YA 1E92A 1XV5A 4PR0A 4RCZA 3ZDBA 5F23A 4ZARA 5JLJA 1E8NA 2IRWA 3I2HA 2W9XA 2KLBA 5GGXA 3NYWA 2V8OA 3OFNA 4R7TA 1DAEA 4FQ8A 5ADWA 1RYHA 2OBBA 2FSUA 2ZBUA 3EMBA 3SHWA 4BWVA 5EJGA 2WK1A 2A9RA 2HXSA 2A9KA 4L02A 3TQHA 4D56A 3MYRA 3QXGA 4WHMA 5EUCA 3IGFA 5IYZB 3HKCB 4JLAA 1OZ0A 3VR3D 1D5WA 4HVLA 4GDMA 2VOJA 2GPAA 2ZUFA 1NFFA 2G3YA 2VNAA 1YR6A 3M3HA 3W6NA 1P5HA 1YFJA 4XWYA 2AFIE 2GCGA 3K0AB 4GC5A 3BE4A 4URVR 3GFFA 1GG5A 1XDWA 3RNLA 1ESZA 5HJEA 3AYZB 1QTRA 3VH2A 1G8FA 2FAXA 2J85A 2FPIA 4B40A 2VTBB 3UOWA 4EHDA 1RI3A 4ENPA 4IJUA 4MOWA 3EXIA 4ZJUA 3FGZA 1KKMA 1E1LA 4LCJA 1QB8A 4Y9DA 4Z51A 4DSTA 5EE9A 3KTAA 3M4NA 4FFMA 4M1QA 2FPWA 1WHTA 3TQCA 4O8ZA 5ADHA 4F5YA 4D26A 4EPYA 4X63A 5F2KA 3FWZA 3G9UA 1ZRHA 1NJ1A 1QP8A 4QE3A 1SKMA 5G1PA 3MJCA 3VX4A 1EVQA 3E58A 4OHPA 4DIBA 4XUGB 1LNZA 2J3HA 3U3RA 5C5IA 4OYLA 1FYEA 3JVIA 4F4IA 4D96A 3KXDA 1EDBA 4H1WA 5C8YB 2DQKA 2AOUA 4KE9A 2HDHA 3D81A 4ERNA 4P33A 4B2YA 4EAAA 1UKAA 2ATCA 1DUVG 2REXB 1Z4MA 4YMTA 1NG9A 3TRKA 3TAUA 2BFDB 2JFXA 1YJBA 1YR2A 1T36A 3AERB 4JC4A 4D9GA 3Q6IA 4I1OA 3AX6A 4JB8A 3DUFB 4KE7A 4EFMA 4DQVA 5ARBA 3S81A 1JYEA 3KZVA 3OEWA 2H8GA 2VQ3A 4PPGA 4B5LA 3C3EA 4ZQCB 4WERA 2C5SA 5KO2A 1GGHA 2NU9A 2ZRKA 3L7OA 4M7PA 4R2WA 5E9QA 3UGJA 2AQ8A 2FP3A 3KSRA 3EYAA 1A9QA 4EYQA 1VC2A 5E4JA 2FE1A 1K6MA 4M9RA 1E1QA 3T3PB 1J8DA 3SZ3A 3FYUC 4OJYA 2QYTA 4ZAFA 3O26A 4LY9A 3KSUA 5BSHA 3PQ2A 5K8TA 3ZG6A 1IOWA 1J2EA 2Z2KA 2JKZA 2ID7A 2ZB2A 4MHOA 1D4AA 3IAHA 1ZWKA 1SBZA 3GJXC 4DLWA 3VU0A 4A1FA 4HLCA 5CA1B 2ZJBA 2ZJOA 3BL6A 4A8JC 3N2YA 4C01A 4DREA 4IG4A 4ARUA 4EA7A 5K3OA 2V8BA 2Y71A 4DCVA 3IE2A 4MA0A 5ESXA 3IA7A 5FTKA 5H3CA 3Q41A 2D7DA 2B94A 4RY8A 1ZY2A 3AM5A 5BUZA 1DHTA 2AI3A 3PYXA 1YONA 4RTMA 5EZ6B 2M1ZA 3VKFA 5KTTA 2OC4A 4OSEA 1JI0A 2IQIA 4HWPA 3U7QA 3NTVA 5IP5A 2DLNA 4JZKA 4ZRDA 3P9YA 3BDVA 2W4MA 2C1EA 3WZLA 1R6XA 1TIBA 1PNRA 4EMSA 1OVGA 3M0EA 2JFOA 1ZMXA 4G2TA 4R51A 3TEMA 5B64A 3JD4A 3T0FA 2JLWA 3NI2A 2XE4A 3E35A 1Y1TA 5DRTA 2BSQA 3WLPA 1N6PA 2IQ5A 2QLMA 2HU7A 4GBED 3LL7A 3EPLA 1E79A 3RC9A 2GJ4A 4E5DA 3X3HA 1O9GA 1F0NA 5KTRA 4N5HX 3REGA 3VZRA 2UUCB 1E98A 2IEGA 1YJXA 3GT4A 4DZZA 3B52X 3CH6A 2PNFA 5DO9A 2QTWB 5FR1A 4I0WB 4RUKA 2IV3A 4BFWA 1XFDA 2OG1A 4B33A 4MV6A 3TOCA 5AKKA 4MDYA 1CP3A 4ZO9A 1LDEA 13PKA 4ZDWA 3GYBA 1TL7C 1YQ9A 4IQ8A 1RQGA 3AHHA 3GFBA 2AMVA 1BX3A 3PC8A 2GAJA 2EQAA 3QLEA 4X20B 3L8CA 3IJRA 4YP7A 4PLPA 1LW6E 1CDZA 2B3DA 3DMRA 3L79A 1IHPA 1LBHA 4KXUA 3DL7A 3F67A 5D87A 4EQ6B 1NA5A 2V7XA 4MW7A 2HV8A 4ZCMA 3PGXA 4G1FA 2GUGA 2G83A 5IAGA 4B4VA 1EQUA 2IGTA 3U60B 4QOEA 3PEYA 4KK3A 3AG6A 4Q93A 3SDSA 2NW6A 3CGGA 2A57A 3KWJA 1ZIPA 4Q9KA 1E3WA 2KB0A 4O4HA 4GPD1 1ID8A 3AJ9A 1U90A 2B35A 2Q6VA 1ULHA 4U7JA 4G5OA 5CB4F 3O21A 3OIDA 5BV0A 2LPMA 2ZR9A 1EVJA 4QUEA 1R4AA 3JYPA 1J97A 2KYRA 1V26A 2V98A 4EGSA 1O0BA 3UMBA 4XB1A 4D8YA 5JEEA 4P3NA 2O0KA 2QX8A 3KT6A 1A9PA 3B51X 2VJAA 2XCUA 2H1CA 4DLBA 4YT4A 3G2HA 3ZV5A 2CUTA 5JBIA 2ZS8A 1CZOA 3GA5A 3OTQA 2QLFA 3T5DA 1A5SB 1U1GA 4JFRA 3SC2A 4AM8A 2QV0A 4KRGA 2LKDA 1F1BA 5EP1A 1ABBA 3TH5A 3WDSA 2E89A 4OLHA 4BTLA 3FPHA 3M9WA 4KIFA 3Q8WA 1V9CA 1X94A 5GVRA 5A3VA 3V4ZA 1AV6A 1PX0A 3N2LA 5DE3A 2OXTA 3G1UA 4OMUA 5CB6A 5CM8B 5CX1A 3KQHA 3VOBA 2XTJA 2IYAA 3B7GA 1WQ1R 1V6SA 3FW1A 4GOJA 2IUUA 4WIAA 1NPDA 3LGXA 3MT7A 1Z3IX 4UBLA 1C7QA 2ZYGA 2A9OA 1W76A 3GJ4A 1IY8A 3CFYA 4TMZA 1KYWA 4B6QA 5JT1A 4C9BA 4QG3A 5KZMB 2FG7C 1KARA 3RJ9A 1TEZA 1XKLA 1Z5PA 2XF8A 3PB3A 3TPFA 2PUTA 3TCXB 1GZ6A 3OIFA 3O1IC 1X0XA 1XCLA 3CIFA 4AQ7A 2C4NA 1IK4A 2DTDA 1VBFA 2JJ1A 2PX6A 3IR5A 4K1LA 4KRXA 3ROEA 4CG1A 4BMXA 1HTBA 4MQEA 4MEBA 4HUQB 3TNDA 1V43A 5C80A 4ND7A 1KMMA 3OECA 4Q7QA 1QGED 3EOZA 3NIDB 4XIJA 4ICIA 1XFAA 3W04A 2O54A 2PAFA 3K5WA 2K5UA 2AW3A 3WGTA 2BP7B 4JLVA 4AKHA 3B5EA 1WUHS 5EJMA 1I8TA 5I4IA 3SX2A 4LHWA 4Z2YA 5TY0A 5EJEA 4DUZB 4FHFA 4KBYA 1SK9A 4ECAA 2GVNA 2PS9A 4G56A 4CI9A 4KQIA 5E0OA 1XKQA 2AMLA 3E2MA 1SVUA 3G85A 4EGCB 1EM8A 1NN0A 1OD6A 3P2JA 2B2CA 3OZVA 5ICSA 5H4HA 3FOAA 2PV7A 1E6KA 3G0IA 3SU8A 1E5DA 3TGWA 1GRRA 5EWLB 1V3TA 3T7CA 4DC9A 2BF4A 3IVAA 1TUBA 5FT9A 2IYFA 3CNBA 1Y80A 4M9CA 2D0OB 1XEXB 2EIHA 2IW3A 4Q9JA 4AJEA 3IEUA 1FP7A 4N12A 4L3VA 1O95D 4XQ9A 2ZUSA 3M82A 3DLAA 3HO8A 4CJXA 3HO6A 1CS0A 1U3GA 4UBOA 5AI0A 3GVPA 4YRMA 3E1SA 4H35A 5IDXA 5E7IA 5TXGA 2ZWAA 5BWBA 2FTKE 2VEDA 4ARBA 1U2EA 1C50A 2VEOA 5KOYA 3KJGA 3OUTA 4KHZA 3VTZA 2P9QA 1DKOA 2BGMA 3Q72A 3ZD8A 1XVUA 4B87A 4UAJA 2IXFA 4CQJA 3RVOA 4F9FA 3D0RA 3EIUA 2RB5A 3A32A 4B79A 1N5MA 4MHSA 3DV2A 1ZM4A 5ALNA 5SYNA 4O3FA 4F9EA 4Q02A 4Q3AA 1CJMA 1DAFA 2HMYB 4R2HA 3R4CA 1TB4A 5T3YA 3C85A 4AJNA 1ZPDA 4QFBA 2YIDA 4MQMA 3AR3A 5IH3A 2G17A 4YP1A 2QNBA 2EJWA 2HLNA 3BA1A 1G20A 1XZQA 3L40A 3P9KA 1JAHA 5CPFA 3F9RA 5BWMA 3HKDB 1KS9A 3RG8A 4TTPA 5G0SA 4K28A 2EKZA 1J56A 3R7WB 1U02A 4HEJA 3ZHUA 5DI9A 4B73A 1MAWA 1JBEA 1V7ZA 3W34A 1LS6A 1UIRA 3RSHA 3RS8A 3OEED 3ZDRA 2H4XA 2DFLA 3OQPA 3I9KA 4AJ2A 1G38A 1ZSYA 5YASA 4LYGA 3ZD7A 5AUNB 1LK7A 1RBYA 1F06A 4UD6A 5AD1A 3WHPA 3DTNA 3L6BA 3AB3A 4UEQA 3FZGA 2AKAB 3RIXA 1E4OA 4D3YA 4QGAA 3J81A 4Y2YA 2B21A 3MGCA 3S3TA 1MC1A 4RVNA 4CIVA 4RVFA 4CIWA 3SD7A 4KTVE 3U3KA 1G5RA 3CUUA 3K6RA 3TSAA 3WA6A 1TK2A 3GOHA 4RL4A 3G0OA 3OJWA 4QNMA 3LKVA 3UJ6A 2FI1A 3IAS6 1M1NA 2GPSA 4ZK6A 1YH3A 4KL8S 4R3NA 4XCQA 4C14A 2OO7A 1AKMA 4EHBA 3SBOA 1T29A 5CLJA 4D5EA 1MIOB 3GZ4A 2R5WA 4IDOA 4BX8A 5KVQA 4JXZA 5G0WA 1ZAYA 1AN9A 4KW7A 4QO8A 2OOKA 2JLYA 4YRAA 3DHVA 3OT1B 1BKDR 4PLTA 1N34B 2WM3A 1I2MA 1P0QA 3M3PA 1D7AA 1B3RA 2QT0A 3P1JA 4M9SA 4Q3CA 4RZSA 3THSA 1TQHA 4GPBA 5EJ5A 3ZDDA 1P8AA 2CLHB 3TMKA 3CH7A 1EIZA 4GLOA 3KQNA 1VI6A 1KERA 4F3CA 3LXXA 1CR1A 1RZUA 3OQIB 4NEQA 1NBIA 3GW8A 1N6HA 2J5KA 1PTJA 2P6MA 3UB4A 4DV4B 2D8MA 2Y1WA 5BYJA 4INOA 5LQRA 2HLPA 1DEXA 1YC2A 4NL4H 3SHFA 4NSNA 1HV8A 1A4XA 3A4IA 4B80A 2O05A 3D3KA 4ND5A 4LZNA 3CNQS 4KR0A 4KFUA 2VT7A 3PGVA 4FR0A 5ENVA 4EHNA 4MVJE 3GMDA 2Z56A 1A9XB 1GEGA 3SJUA 4QVIA 5HMLA 1HNWB 1S01A 4M76B 1YK1A 5CUQA 1ZITA 3T34A 4C3OB 3N6XA 2HFJA 3JR3A 1E9RA 2GB4A 2QE7A 3Q9NA 2PA0A 3OEHD 2GTHA 2ZT7A 4KQGA 1Q7RA 2IOHA 3HDGA 4JP3A 1LK0A 2XVMA 1QHGA 3VHQA 3AONB 4LXHA 5CIYA 5E9AA 4PN3A 2AT1A 2EJBA 3Q5GA 3LQ1A 1E69A 1DIAA 4EYGA 1QK3A 4LYYA 5H59A 2WI8A 4CKCA 5KJCA 1CUDA 1F3LA 3AFIA 2CK3A 1U28C 1IUPA 3OWHA 3MHPA 1G3MA 5KWSA 5KWIA 4X0EA 2PIAA 1FF9A 2B4QA 2YN4A 2QAIA 4F7DA 3CWZA 4LVUA 3WGQA 1D6NA 4EZIA 4W1SA 3KEMA 4WXEA 3UC9A 5LA6B 4BX0A 3AVPA 3GHYA 4FHGA 4J0GA 3GJ7A 3PFHA 3IKTA 3TPZA 1XOIA 4R16A 2AK3A 2VWPA 5CFLA 3CTMA 3FOZA 3OKAA 1U0JA 4L4YA 4HDNA 1JHYA 1V8DA 3AL2A 2ZZNA 1RWNA 3IKLA 4RXUA 1MR3F 1X3LA 2NG1A 4FMBB 4Z9BA 1GXSA 3VHXA 2X9NA 4NLLA 3EGWA 5K51A 1ZUNA 1XLTC 5IUJC 4ZCRA 4MR7B 1YE5A 3UJCA 5CDFA 3R5FA 3RCBA 2AKEA 1SKUA 1E2JA 1P45A 2GNOA 1G17A 3WLRA 1TAGA 4JX9A 1N8NA 4U7HA 3TQRA 4KDCA 2NYAA 5AOVA 5CB4A 1U0EA 2QRVA 4BUZA 3PJDA 1ADGA 2Q7OE 3PENA 1TC2A 5KVAA 3JQ6A 4YP0A 2PCJA 1SKBA 3IB6A 3SBDA 1N57A 3VR6H 5CD1A 4C3ZA 4L7QA 1VIDA 2HXGA 4GRDA 2AS0A 5C9ZA 4OGFA 1UZNA 4FHZA 4BNVA 4H1UA 1PBTA 3IBYA 1SXJB 3W5VA 1FLNA 2AOXA 2OESA 2XBUA 1XZDA 5CYGA 1E6MA 1IQRA 3WRWA 4P34A 3FCCA 1UCFA 1ZICA 3ICQB 3EFEA 1ZM2A 1MVOA 4NCAA 1Q0QA 4CCSA 3R20A 2M98A 4AO8A 2C82A 5LQSA 1U2DC 4X45A 1RWWA 5LZ7A 4BCCA 2IPNA 4AQYB 5JY1A 4O2RA 3EEIA 4RK1A 1VI5A 2MSWA 4P3XA 3FJ1A 3KZXA 3I37X 3MWDA 5JPCA 2YJZA 4QFMA 5DX1A 5EE1A 1SOWA 4P22A 5LNK6 1N3BA 4MGEA 2P8SA 4KHPB 1BTOA 2L17A 3NXKA 4MKZA 3UJHA 5DHAA 4GRAA 4UVIA 1JKIA 3SQDA 4FE3A 4BFSA 1B7GO 5IDVA 1E2EA 2GZHA 4U7GA 4IPTA 3JYLA 3F6RA 4HR7A 4MYRA 2AI1A 4FJ0A 2BIFA 4OMCA 2OLJA 4NE2A 1QNLA 2JI7A 3V8NA 1OYOA 1NF3A 1KMQA 4WD3A 3SSNA 4BMSA 2F2TA 5CFQA 4IO0A 4QAQA 4P38A 4D4MA 5LU8A 1KP3A 4YACA 1TD9A 2ODBA 1RYFA 4ZZ1A 3N0VA 4RETA 1TKAA 1JH9A 1C9NA 5ECYA 1AK2A 1GCUA 1O6GA 3DL2A 1OX6A 4JGBA 5B37A 2CHUA 5LMUB 1QZTA 1Z45A 4FFDA 1M1XB 4JUBA 3J7TA 3RFCA 2PBRA 1MP0A 3PT5A 2H1OA 4QRDA 1XVTA 4CKYA 1X7YA 4PX3A 1V8FA 1VE7A 3IP6A 3IQGX 3LUJA 3OTGA 4RFVA 1WB9A 1LSOA 2HQOA 3VSAA 4INPA 1KMCA 4CKWB 1YS4A 2YZMA 2MCFA 3AEKA 3SY8A 2IH5A 3REFA 1NY6A 4YXWA 4ND6A 5K20A 4FIZA 5CP8A 4TT3D 1U04A 2I87A 2C78A 3ZCVA 4XVHA 4P4SA 3ITDA 3UJ8A 3K9QO 5KYUA 3WMWA 2YHAA 2VOEA 3O90A 3KAPA 5LXTB 3CMMA 3IR6A 4OPMA 2JLRA 3D8TA 1V7QA 4WE3A 4DB2A 3ENKA 1N0IA 1T9CA 4YV7A 1VHLA 3T3IA 1ZN9A 5IZCA 4PZLA 3VHLB 1RMTA 3A1CA 4GZLA 4IZ6A 1JG3A 1JFFB 4ZN6A 2B2NA 2G06A 2VWGA 4KQ6A 5KDLA 1GPAA 1P4RA 1SJ9A 2SCUB 3C98A 1CJBA 1PL6A 3QVJA 3WI7A 2UZAA 1QO0D 4RVGA 4UU0A 3BZBA 3I04M 3BICA 1QLWA 1FRZA 1M0TA 3E7XA 5AVOA 4RO0A 2BRUA 2QG6A 3X2FA 2J9XB 4C07A 2UXDB 2D54A 3IUQA 4AJ1A 1QHHA 3G3EA 4OHUA 2WA2A 4L9WA 5FCDA 5DGXA 1Z17A 3TLGB 5LKRA 3DOHA 4W63A 1KI1A 3O4FA 3QVSA 4X95A 1EYZA 1NUAA 5BRNA 3A2KA 2H8KA 4F2PA 2X2FA 3I64A 3KUXA 4L07A 1RCFA 2DRIA 2G76A 3M70A 3SNHA 1AQ6A 1C1DB 5AJZA 3WS7A 2JIBA 2P68A 4F2GA 2P79A 1GDTA 4HG2A 2CYCA 2H4YA 1EZ4A 2BFNA 3I1YA 4BNJA 5L95A 3T9AA 1S8NA 2YS7A 1NN5A 1OBFO 3NT4A 4NBNA 4GQBA 4DBLC 2PBLA 1E4VA 1MJFA 1XVLA 2Y2UA 1TZMA 4HV4A 3OU2A 2I9KA 1E3MA 1L9KA 4HLQB 4PG4A 2QTTA 1U8ZA 1NVKA 2PX3A 1D1SA 1KMIY 3EHEA 4ODIA 1DKNA 1BH2A 2WVHA 2ZPUA 4QA9A 3INYA 1VG1A 5JVDA 5DNYB 4X1KA 4BVKA 1QBKC 3UUFA 3KBOA 5JVDF 1NBHA 3HM9A 3U7IA 4MKIA 5TPZA 2F9LA 2CKMA 2B5OA 4IOKA 4NMWA 4TLAA 1W7AA 3WNBA 5K09A 1KI7A 4BO3A 4TOIA 1IUKA 3R9XB 1ORWA 1TQ8A 3HE3A 1O94D 2H0AA 3QF4B 2D7CA 2D5IA 3E9RA 4G5HA 1MIOA 3MC1A 4HDRA 3IAUA 4Y6OA 1XXHB 5HQTA 4EDFA 5FOXA 2VF7A 4BNDB 2C9YA 2PZFA 1IN7A 2VUUA 1HRDA 4QPZA 4F7WA 3DE1X 3PXAA 3R8FA 4KXXA 4XH9B 3D4BA 2Z2JA 3NRBA 4CT5A 5KDOA 2EGHA 1E58A 3ZGXA 1TQ4A 2Y1EA 3GEIA 1O57A 3NHLA 3PC7A 1MJGA 4QXOA 4GQIA 4W7HA 2HH9A 1Z6PA 2QN9A 3MPOA 1I3OA 1XTSA 4NEHB 1H2YA 5FL7D 3I73A 4UNSA 2WAYA 3M2TA 3LDAA 4G0OA 1WIWA 3BFVA 5AI9A 2F17A 2QVCA 3AZQA 3FMOB 3RVNA 1QLJA 1TCUA 1XTPA 3CLKA 4C0HA 2HA6A 3I1JA 1FU4A 4FR2A 4ZQBA 3U5ZB 1NI4A 4DAEA 3KT8A 1ENPA 1PQPA 2QDKA 2ZEJA 2O3UA 3O9VA 1Z13A 1R37A 4J3JA 2Y0EA 4E7PA 2Z2ZA 4CHTA 1N0WA 3JZDA 4NNOA 5EXPA 1U9ZA 1EGVB 3WMFA 3F1KA 3R8CA 1IEQA 2NZUG 2B1QA 5DJ5A 5ITWA 1G8HA 1PQ4A 3FTDA 1RRVA 2PL1A 4ZT2A 5BR8B 5FBQB 5CA1A 2IEAA 4QDUA 2N0SA 5TB5A 3MW8A 3WYGA 1LV8A 1QR2A 2WT4A 3F74A 3GD5A 4U7WA 2X8JB 1GA1A 1T8PA 3I9JA 4G1EB 4CLRB 4DIMA 4TYYA 4FTWA 4DLSA 2PK3A 2R4UA 1NM5C 1XRPA 3KQMA 4GS5A 3EXHC 3IPXA 3TNFA 4IOMA 1MAAA 2XGGA 3NWPA 1NXWA 5KIAA 1FIUA 4FFVA 1BW9B 1EGMB 2HI0A 1U94A 2MJLA 4W9NA 5EJ6A 3V8VA 3A10A 2HLHA 1Q1EA 3ZHTA 3SZUA 3HQ4O 1DO8A 2VHZA 4RCYA 1XCJA 4CKBA 4XUCA 3SPXA 1J33A 2PRZA 3FCEA 2Q2QA 2RI6A 4QYSA 3HVHA 4UTXA 4AYXA 2XB8A 2HO4A 3C7TA 4NF2A 4KR6A 1QOPB 2VNKA 4KVFA 2CFOA 3H87A 4E11A 1NLZA 1YDHA 2QGZA 2XB6A 1ZGBA 3KL2A 1XB2A 4JLSA 4NIMA 4ALNA 2O8FB 3BGOS 4RKEA 4C6HA 3B1VA 1UXJA 5KWVA 3CVOA 4BS9A 1TVKA 4X71A 2JC3A 1UJNA 1EX1A 3ZLBA 5C8YA 5JNLA 2JLQA 3FUUA 4BNGA 2O2XA 3EVBA 4TMKA 5I9NA 1MW9X 4DJJA 1CYEA 1R9GA 3R6WA 4L0CA 5LNK1 1YZVA 3DWIA 2HDNB 3VR5D 3SSAA 1V35A 3N74A 1R18A 1FDRA 1Q57A 4HQ0A 2C5GA 3HCEA 1J23A 4GOXA 1Y4DE 3KPVA 4BAZA 3T1YB 1B74A 4KWCA 2FMIA 3W5SA 3GC6A 3EIHA 3KAKA 3WKDA 4ZANA 1IBMB 5IX8A 2IZOA 3DZIA 4TT8A 1WSBA 4GX1A 4ZVRA 3D1VA 1WVIA 3OIYA 4RXMA 3U1TA 1UINA 3E9NA 5EJ4A 4JKOA 4L3WA 4P3YA 5CDHA 1KK0A 4RDCA 1K92A 1EG2A 2CLEB 5J63A 5CXQA 4Q9DA 1KXZA 3R6TA 3CLSC 4NRDA 5I7SA 4CF6A 4HOYA 4IJQA 4EF5A 4YJDA 3EA4A 2R2AA 1ATIA 1D4ZA 1Z8HA 4L9RA 2WLSA 3EIFA 4K9MA 4B4OA 2ZRIA 3ZIDA 2GZAA 3IUEA 1M66A 4U2FA 5JAMA 4KZPA 2JKYA 4DA6A 3VQTA 1D1QA 1KA9H 3DJYA 3HMQA 4KQWA 3GPLA 2FN9A 4LVCA 4BVEA 5A02A 3MS7A 3QTTA 3SQNA 4LGVA 4U2CA 2NQTA 1PT9A 2EW1A 3ZUGA 5BSVA 5LR6A 1ZW1A 4D8WA 5JQGF 3QG5A 2GCPA 2ZRBA 2YC2C 3ZI0A 3Q8LA 2NUAB 4B85A 4GO1A 5TIIA 2IY7A 1H65A 4DIFA 1A77A 3LLUA 5HDBB 5A5FA 1K75A 2K2WA 3UAOA 1HORA 4DT1B 1IN8A 4ZRMA 1ANKA 5DRYA 3GUVA 2DHCA 3OQHA 4PW0A 3AVTA 4MV1A 2P1ZA 2RH9B 4WOBA 4DJFC 2P3LA 3G82C 1W87A 2IYUA 3B36A 1QS0B 4RH0A 4R5HA 3VUEA 3AM3A 3IPAA 3PA6A 5CJPA 4C87A 3VGPA 1OLSB 3NEAA 2XDQB 4FE7A 2Q4OA 3R0VA 4G5YA 4OBWA 1QTNA 2BY4A 2H48A 1PT7A 5FLYA 2X5NA 3EWAA 3QFRA 2YVKA 1W46A 2O5CA 2QLJA 2ZJAA 1FS5A 1HMPA 1ZQ1A 2OZPA 4US1R 2NXWA 2QTHA 3V33A 3H11A 4HB2A 2FPIB 1XA3A 1DUIA 3Q8MA 1MA3A 1EGHA 4HHEA 1I24A 4PYOA 5I7RA 4A0FA 3LBIA 3DPUA 2EFDB 3DE6X 3GPBA 1V11A 1M2EA 3RAEC 1S2IA 3B48A 3HVJA 3MGBA 2RB4A 1E1RD 4OGGA 1W0JD 1H4SA 2FW9A 4HYYA 2AG6A 3TZKA 3KVRA 3NV9A 4TZ0A 1LX7A 1VMDA 2NZXA 5AVQA 4OB6A 2NUTB 3I34X 1RI4A 5HKKD 2D0IA 3A2MA 1GITA 2IYTA 3K9GA 4PPQA 5DTIA 5H82A 1JHRA 3VPXA 1GD1O 2SKEA 4BXOB 2GSWA 1I5OA 2B99A 2C0QA 4Y2QA 1M73E 4ZAGA 4N5IX 2EX0A 2KHZA 1FUYB 3P94A 4Q4HB 4NQRA 3V1YA 1QAQA 4MCHA 2W2KB 4KN6A 1KJYA 2R5FA 3KVYA 3W3AD 1WXEA 5KVVA 5B4VA 4EG1A 5J2TB 1E77A 2M9MA 3BMXA 2AOTB 3KQPA 4GFDA 1RQXA 3QY9A 4ZHSA 3OO1A 3QWIA 4CW7A 4Y0AA 1GA6A 1KDVA 3MA0A 2YTZA 5H5JA 3AW9A 4YRTA 3LLSA 3P2IA 3QELB 3A26A 3NHUA 2B8EA 4R1PA 1I0IA 2BEWB 3A3KA 3BXXA 1NDHA 4KXLA 2WU3A 4DC0A 5JHHB 3ZD6A 3Q3GE 1Z29A 5KYUB 4W6QA 5HRCA 1PGPA 3FHLA 1QHYA 3U37A 4ZVSA 5DGIA 2OD2A 1RJGA 1GNPA 3BSYA 4PFQA 1R4NB 1NIJA 3GP5A 1TF2A 2PRIA 5KQSA 4YV2A 2BMEA 1TU4A 2W6NA 2PTHA 1XZPA 4LJSA 5DP2A 1J5PA 1XDSA 3EYWA 4EW6A 1RXUA 1N9GB 3LQYA 1H0KA 2ZIFA 4KVAA 5JCPA 4JYMA 5CLIA 4CFYA 3PXGA 3VR6D 3TMYA 2ZIZA 4RGVA 4WASA 4AX8A 4PYJA 3DHNA 1RCTE 3JPWA 4CETA 3LOPA 2VTEA 3PFIA 1KAMA 1ZL0A 4H7HA 2H29A 5KU1A 4W1PA 1G2PA 4Z2AA 3QW4B 4PHGA 1W85B 1IMJA 1JIJA 2IVZA 3HUUA 3BWYA 3WSTA 1RP7A 1RYMA 1V5GA 3L8DA 4W5WA 3BSWA 2NU7A 5IZ4A 1FVOA 2Z5FA 1BS9A 4ANFA 1JB9A 3ILXA 2G9VA 2P2CA 4MWEA 3DZFA 1H2XA 5B3KA 4HXEB 3AK4A 1O5OA 5MN6A 4CWAA 1VRWA 4RGQA 1F2TB 3DEJA 3BQNB 5TGTA 2D4HA 4D1YA 4JZYA 2QAGC 4DS3A 3R7AA 1SQSA 3W5BA 4LHZA 3ONFA 3B5IA 1YIDA 1U9JA 1K27A 1BCRA 2W6QA 3DOEA 3O8OB 5FJJA 3AERA 3MTQA 5TVKA 2IYSA 3RU7A 3U44B 5K3BA 4CQNA 4HXGA 1W8IA 2KX7A 4HZUA 4E7OA 4X8OA 5GZ3A 1AUXA 2PGIA 5CLHA 3VBCA 2G1UA 3L49A 4EFLA 1DINA 1T9BA 1KGSA 3OO0A 1OIXA 5FWNA 2J9ZB 4OQPA 1TJYA 1P1RA 4AULA 1H42A 5GZ1A 4Z7NB 5CA0A 2RBKA 621PA 2WNIA 4B4DA 1EXMA 1UODA 3TLJA 1JW9B 4GE0A 2FEOA 2PPLA 1MUUA 4BVFA 4HQRA 4ZTBA 1JQJC 1IFXA 1Q21A 2JD2A 1NBOA 2A1TR 3OZGA 3UJ9A 3C5EA 3JPYA 3ABSB 4HLDA 4OVKA 4TM7A 3V48A 2OUIA 4AN4A 2R6ZA 5AKGA 1WDLA 3DOOA 4LTDA 2O7QA 1I10A 4YTEA 4QSMA 3IALA 1QIGA 3L7NA 1Z4KA 4LOKA 5EGNA 4J75A 5SY6A 2WHPB 3P0IA 3Q9LA 4MAMA 5JVDB 3ST7A 3SX4A 1IY0A 1ONPA 5CJJA 3MT8A 4JLMA 1ISJA 3FPJA 5IAJA 4I2NA 4R5MA 2WKWA 1JSLA 2VDNB 3FHOA 1U0HC 3QKIA 5T67A 1SVOA 5TF4A 3S27A 3EODA 1YB2A 2PWBA 2WILA 3OWOA 4GVLA 3V9PA 4CV3A 1X70A 2CV0A 4U3JB 1E20A 1VXRA 1BVRA 1HE4A 2NYUA 2QG4A 2ZP1A 3C7AA 4U4AA 4DLPA 2ZYHA 4N7JA 1ZGJA 2GN4A 421PA 2G6TA 4RXTA 3Q2IA 3Q7RA 3IDQA 3QU9A 2FSHA 4A23A 2JJMA 1T5HX 3PWSA 5HZGA 1BROA 1NVVQ 2C92A 3QVUA 4Q0MA 4MWZA 3S2EA 1T0BA 1KJWA 3KR0A 3MCWA 4JVLA 4LY3A 2JFZA 2JIPA 5P8WA 3ZYZA 3JVUA 4G1BA 2QUZA 4FYMA 1JUDA 4EZBA 3MEQA 1PNVA 3L1UA 4J03A 4P84A 3V4PB 4YPVA 2IS2A 5JFTA 2WABA 1Z5ZA 3QBEA 1ADBA 3GJSA 4ZU1X 3IERA 2CFCA 2QJRA 4M99A 3GIWA 3D4PA 4Y1EA 3BWDD 1ZLYA 2FZ4A 4JELA 2Q0QA 2ZG6A 3IOCA 2CFTA 1PR6A 1O58A 5KVCA 3Q12A 2W48A 4KGZA 3VR5A 1O94C 4RTLA 1MC5A 1WVMA 1QQ5A 1X80A 2VUHB 2HRDA 4B9EA 2YZ7A 4KB5A 2W58A 2C7VA 2Q62A 2Y1FA 2YQ5A 2H0QA 5EMLA 4QXQA 2VF4X 3HVKA 2HF2A 1ZG3A 5JCJA 5BV7A 4LVNA 2C5HA 3ILYA 2DECA 4QBIA 4RD1A 3B2QA 2HHLA 4GR5A 5B6JA 1MW8X 2Q41A 3ZUPA 4P58A 4IG9A 4Q48A 2JFUA 3LQFA 1KMHB 5ULLA 3SR0A 1JI3A 4YDHB 3F9CA 1MENA 3O3CA 1FJXA 1MB9A 3AILA 1XI2A 4QRIA 4E4YA 2H4FA 3PCRB 1K7EB 1LDBA 3LFTA 3UUEA 3OCXA 2VJYA 2ZJZA 3FHJA 4BNLA 4MDFA 2J3JA 4F6CA 4HAYA 4EHHA 1FDWA 5AOBA 5C32A 2PWPA 1IRXA 4MV0A 3RR2A 4K0KB 4WBXC 3LXRA 5LDGA 1CIVA 1M3SA 4UCWA 6AT1A 4JU8A 3C1UA 1RJFA 3TKLA 4TV8F 3LTNC 1EHCA 2W42A 1CRWG 1GT6A 2I4IA 1YRAA 3K9HA 3O75A 5LB2A 1VGRA 2WIAA 3TO5A 4OHWA 4BJ3A 3RYFA 3R7WA 4IUDS 2G67A 4CNBA 1HLDA 3W5AA 2BMVA 4IF4A 4MTLA 3GT0A 4QWMA 2XITA 4J8PA 1AO0A 4H1TA 1FXWA 3V8BA 3LD9A 3SLGA 5DYGA 1BN7A 1C3EA 1WSAA 5BWLA 3MUOA 1L4LA 4WV3A 3D43A 2E5WA 1R0CA 3LV8A 4L16A 3OFSA 4CF5A 2RCNA 3M5DA 4MMYB 4A8JB 5KJ1A 3TMAA 2NV6A 2SBTA 3VOAA 4J9UE 4JQZA 2A5JA 1FDUA 1NKTA 3KEGA 2A35A 4JT4A 4LRTB 3L18A 4WNAB 3B6IA 2X86A 2XLBA 3RWOA 3CRMA 1TMGE 2GA8A 5HJ7A 3KPYA 4N48A 1E3EA 2G0TA 3R7DA 1P6UA 3TTSA 2R7AA 3U9LA 1WPGA 1FFEA 1RJWA 1H69A 4AG5A 1X14A 1L4KA 1GLVA 4IIVA 1T5IA 3LU1A 1DFIA 2JAHA 2X8AA 4BC0A 2XF2A 4C0QC 5I5EA 2X0FA 5BOSB 2JASA 3EDQA 1NGSA 5FKJA 2VDRB 3PVSA 3H1AA 4QUBA 1O7JA 1OI2A 3GNSA 2A1UA 4OJQA 5EIBD 4CIDA 3OLQA 1SXJA 2I2BA 4P93A 3PGKA 1F8FA 1U0RA 3WLLA 2XBMA 4U39A 4AG3A 1Y9DA 2XTAA 3Q5DA 3D3WB 2PGXA 2WAXA 4GMXA 3GUUA 1DQYA 4FEEA 1KEVA 4ZOAA 1FP2A 3LUHA 4UM9B 2IE0A 4J4TA 2IT1A 3ZZMA 4MRPA 1NNLA 2E18A 4PX2A 3RSQA 1ES9A 1N4AA 1AMOA 2W2LA 4Q4AA 3VR4D 3SZOA 4CM9A 5ALMA 3A4LA 2G8LA 4M1EA 5JDCA 2VDVE 3FVWA 4URZR 2HHCA 1HDIA 1MG5A 2GESA 4RDXA 1P39A 1I4LD 4RPKA 4K9LA 4FP9A 1XZHA 2J6BA 3SICE 3WK5A 4LJAA 2ZAOA 1KTIA 2PMFA 1A69A 3VJLA 3K32A 4TM8A 5BN1A 5BNTA 3RRXA 2C2WA 4MCIA 1WX1A 3H16A 1JEQB 3NEJA 3ZHBA 4HXFB 5DSXA 2BPOA 1UC8A 4BJ5A 4IVRA 1SPXA 4Z0PA 2CNKA 2GOYA 4BQNA 2H7VA 1QV6A 1X8JA 2PS0A 3N2IA 4G81A 1VFPA 5HILA 3UK1A 1IJEA 3GBSA 3NHJA 1JYFA 4P54A 1KGDA 2P90A 4N01A 4RDHA 1JTVA 1MABB 2JFHA 2MSEB 4P80A 4PC2A 5EJAA 4UPEA 2ACWA 4O1MA 1TMYA 2WFAA 2HBRA 3ZWAA 2PPVA 4EMUA 1EK1A 4E21A 2FWAA 2TMYA 3F2IA 3FGPA 3PNKA 4QG7A 1G9TA 2NZ8A 3DCJA 3H1TA 2QLLA 4R2JA 5A1JA 5IN4A 2Q07A 4J0FA 5C18A 3ZWQA 1UBJS 1BDJA 3W9SA 4FONA 2R60A 2ANBA 3PUIA 4TLCA 1H2AS 1H0HA 3C8MA 3IQZA 3NNDA 4KVGA 2FRXA 4PHFA 2K7ZA 3D2LA 4DSUA 5KNCD 1EVKA 1VJRA 4QJ5A 5BQOA 2OGTA 3EOAI 4G41A 3BWMA 3UB2A 4HY3A 3FIUA 1K4MA 2W6PA 4IWXA 2GAIA 4WXRA 2BEVA 2C4KA 1E3SA 4HH4A 5JALA 221PA 4MQ4A 4B9AA 3Q3CA 2BR5A 3AFHA 1PR4A 4CEHB 3HYRA 1D04A 1UBMS 2J48A 5EHNA 1V9SA 2KE5A 1VJ5A 5J59A 5JS2A 4FOPA 3G5LA 1XJQA 2H2AA 4WKCA 2ZTSA 3OLWA 5DHQA 5I51A 4IEIA 5KYYA 3IUMA 1G0NA 4ZVMA 4LK2A 1G42A 2Z9CA 4XJXA 3VNSA 4CM1A 4MV3A 1CQJA 3SFVA 1GUZA 4IAOA 1PQUA 1GTL1 3VKWA 3ZCUA 4KMSA 4YB8A 5EXSA 4Q7EA 1LVGA 2K87A 3RS7A 3RWMB 3OT1A 2V7GA 4CODB 4PQGA 4XM0A 4CGZA 1X7GA 2YVLA 3UXHA 2I2CA 3I45A 3U31A 4O2AB 5JPIA 4DR6B 1YQGA 5AVZA 2PUDA 5E1OA 2BELA 1VJ0A 3BTUA 4QKQA 5HFAA 1FFDA 1UBEA 3PD0A 3VDQA 1R27A 2X0DA 1ZUHA 2O0MA 4BTEA 4C4OA 2WJ3A 3C3CA 1YB1A 3RVMA 2PJRA 1W5EA 1NDQA 2Z30A 4MUYA 2PN1A 1PQWA 3GT7A 3QEKA 5AJHA 1YJAA 4LDRA 4BY9E 4DZTA 1XTIA 3SI7A 1VKZA 1ZMBA 4E33A 5DXFA 1U2RA 1E7RA 3EF0A 4B09A 4DYHA 3AESB 4RS4A 2HSDA 1JS1X 2GD0A 4JXXA 2GBPA 2O6HA 3PHJA 4QUHA 4RD4A 5DHFA 3VO1A 1VPTA 2BKAA 4AZWA 1Y1QA 4LKOA 3CRZA 2H51A 1HXHA 1A5AB 1Q16A 1U9IC 2ISCA 5I3ZA 4GKJB 1EFKA 4UVGA 1GGMA 3L8HA 5BSGA 1A0OA 1DJLA 2YHSA 5CITA 3QPVA 2F67A 2QUBA 3GLRA 5FYDA 1ZHFA 1HLPA 1OF1A 4ENSA 5HZMA 4E12A 4D6YA 2A4MA 2AG1A 2GK3A 1W4BA 3PZRA 3QE2A 2G1PA 2BMJA 4YJ3B 4EECA 1A9RA 1TAHA 4QOGA 2B92A 1KF0A 2Q5LA 5DSTA 1TE2A 2FRDA 1DCMA 1LZKA 3DBHB 2Q1SA 2OSVA 3ONNA 4E31A 2VPQA 2C8VA 2H9AA 4BP8A 4LC1A 5E1BA 3OQMA 3I2JA 3MLBA 5F4ZA 3PTZA 2VHXA 1NMYA 4NX2A 2HWWA 4LSWA 4MKGA 5D6NA 3RABA 2A86A 3FYDA 2Q5CA 2ZIGA 1FRVA 2XQGA 4IIUA 3HA2A 2Z1MA 1PFQA 4RU1A 5JR3A 3EQZA 5JS8A 1HI9A 2H08A 3MOSA 3LSYA 3OWXA 1QOZA 3P19A 1EINA 1UKYA 5D5QA 2XW6A 4LJ9A 4Z4QA 1Q83A 1T6YA 3GEBA 2P1RA 1XYVA 4MUEA 4ABYA 4Z53A 5KUTA 4IKPA 1WO8A 3NQ41 1NJ5A 3KEFA 5SZJA 2NU8B 2IYYA 4B3RB 1RQ2A 3MCAA 4LXYA 1QZXA 4C2UA 2Z9BA 4NJMA 4RZHA 1FDIA 2ZITA 4EGQA 4GKBA 1DG3A 4Q82A 1EJBA 1PZFA 3WWZA 1CF2O 3DUFA 3W90A 5KCMA 6YASA 3RU3A 1SXPA 1JJFA 1U0FA 2QI9F 1YU6A 2FSPA 3OCYA 3ANSA 1E4EB 2C04A 3H8JA 4LW8A 4DG5A 4Q1VA 5K3FA 4EVIA 1TUEA 1P6XA 4I4TA 3DTTA 3FGOA 2D2VA 2TECE 1CZRA 2IGBA 3HC7A 3BH0A 3VPCA 4HNVA 1P33A 1GG2A 3IPYA 4G0YA 1X86B 3NONA 5IJ0B 1ML3A 4TUYB 1BCSA 1Q50A 5AJWA 1EAYA 3TAHA 2A0XA 3TK1A 2W6ID 1DCTA 1OROA 2O3SA 1DBIA 1UM9A 4MPDA 4ZV9A 1Z6TA 4AY4A 4YDQA 2PMEA 3D64A 3UT6A 1W5FA 5ITSA 1V6AA 2PD3A 4Z4HA 2DBVO 1WB5A 3WIEA 3ZWMA 2ODQA 2K6GA 2PGAA 1Z6XA 1U5BA 4L0MA 3CWCA 3B82A 4AN1A 5L6LB 1HG1A 2EWVA 1RE0A 2G72A 1W75A 1JA9A 5AKHA 5ELXA 1NUQA 3IKMB 1G2OA 3UZUA 2HQ1A 5BQPA 2Q21A 1M5UA 3QKTA 2WFZA 5LWHA 3U7RA 5LQUA 2IYNA 5D5PA 1GPKA 3E9ZA 3F7NA 4YDRA 1VE1A 2Y05A 4RBNA 1Z8DA 3I12A 1TUIA 1DQRA 3H9JA 4JBGA 1KYVA 4QECA 3WFJA 1EQ2A 1TI7A 2PGNA 3CX4A 1U3CA 3QPBA 4NH0A 4DLXA 2V5AA 1YVUA 1ID1A 3STHA 2WV9A 1SULA 4ZQHA 5BVGA 1QG4A 1OZGA 3EUEA 4J49A 3GCGA 1GNTA 1UDAA 3WV4A 1AOXA 2I7TA 1MNQA 3AFMA 3TLGA 4HATA 4YCJA 1RQNA 3UCFA 4LX8A 1FP4B 1GUYA 1A1VA 1IXYA 5BSEA 2O2EA 1GPH1 1Y33E 5FBHA 4B3TB 1JA0A 1N2ZA 1L2TA 1EFHA 2UUOA 3P5SA 3M6WA 2JAOA 1XQ6A 3LUBA 1QVWA 3H13A 3WHIA 4DMCA 3Q40A 4R83A 4R71A 1B6TA 1K6XA 2V03A 2IHJA 3CHYA 2YQZA 4IQFA 1FBNA 3OE1A 1PE0A 2ORWA 2ONZA 4IKOA 1U0SY 3UPTA 3JWPA 5SICE 4CMJA 4M0PA 2XYQA 2VTBA 4PEVA 2CVZA 3LBHA 1WMAA 2ZM6B 3THYB 1ZWLA 4JASB 4I4TB 2NUAA 3JQQA 2XWQA 4DN6A 1NNEA 3VC7A 5E6SA 1F4PA 4BO1A 3CNHA 4L7VA 1UDCA 2WB4A 1EKXA 4AJLA 5EE0A 4GMGA 4ZYTA 4X94A 1JEYB 3RS3A 1R8JA 2QGFA 4OXKA 4P4SB 1QE0A 5BN4B 2O8FA 1A1SA 2Q49A 1YAJA 2ZI7A 1QH8B 2R11A 5JG7A 3H5TA 4D3XA 4P35A 3HTXA 3BL5A 4XCVA 1RM0A 2IY9A 1E7SA 3OZ7A 4MRVA 4RH1A 3T7TA 2CXTA 2G9QA 2PD4A 1DRVA 2FEKA 4AMVA 1R0LA 3NASA 1VG0B 1MC8A 1SCUA 2A0WA 2W2VA 3QBTA 3NR2A 3KZ1E 3R0IA 1W94A 2OVBA 4Y7DA 3FPGA 4COOA 1SKYE 4KUGA 4MCJA 1XCGB 2JJYA 4OU5A 4PSKA 1FFBA 4Q9AA 1DJMA 3BHJA 4JVMA 3ICVA 3RK0A 3ZVKA 3LRTA 4ZHQF 3FJOA 4XIYA 4QJ3A 3CNOA 3F5QA 3M34A 1QFJA 2DC1A 3DE4X 1HFEL 1CC1S 1TM5E 2AG5A 1AUOA 3L3BA 3MTJA 1C41A 4BLQA 1YZQA 3HDTA 3OAAD 3GDFA 1ZOIA 3LXUX 4FS3A 5IPFA 4TTIA 2D2FA 3LGAA 3EIEA 1W0KA 1ZKMA 1YNOA 2HW8A 3I6MA 1RJEA 4P86A 1W88A 3GF4A 4QNNA 4XUDA 3V7UA 3TLBA 3KQYA 3CX8A 1T13A 2GAOA 1QHXA 1Z4OA 3CCBA 4DJDC 2YJ5A 4P1ZA 4IDPA 2FUG1 4YJ3A 3ITNA 2RSLA 5DWDA 2HK8A 2QL6A 3RNOA 1ORVA 1XJ5A 1IZ7A 1GNRA 1H2EA 3BXHA 3FSJX 4PHCA 3T9DA 2JGDB 4BATA 1AF7A 2PFGA 4AJJA 3CQ9A 2PH1A 5LVAA 2J5RA 2PXAA 4RQTA 3S44A 4DSZA 3ZDCA 3H8SA 4ER6A 4HKTA 3IQDB 2RGBA 2LXNA 2VJPA 3IXMA 3TPCA 3B7PA 4EEXA 1HZZC 1I1QB 2RAVA 4N8SA 4XVQA 3TTYA 1LU9A 2PUFA 3HFSA 2B5VA 4NU8X 4O4IF 5IFKA 3B3GA 4KRFA 2C7PA 2ZAGA 2B8WA 2VA8A 3KSMA 4BEJA 5KKCA 2GM9A 4JXJA 4RK5A 2OCKA 3RVJA 1C8LA 3RVQA 3GFGA 2ZWOA 4QEZA 2Z3WA 4KN5A 5DK6A 3HR8A 2GNAA 4LHEA 2R6DA 4L51A 5TEVA 2OHIA 1E9VA 3GLSA 2IV7A 1D2CA 5DCWA 4FOSA 4KSBA 3PI7A 4E5NA 4E1AA 4FDTA 2X22A 4TTQA 5HS6A 3FMIA 5EFOA 3WWYA 3TSCA 1BYIA 1DXHA 1F4VA 1S4QA 3V46A 4D41A 2J45A 4YR7A 3SVLA 5FNVF 2CL7X 4HB3A 2ZBDA 2C7QA 3BJMA 3L1HA 2PANA 4TWRA 2QM3A 1AG9A 5JDCC 5FEUA 1M6VB 3DMDA 2JATA 4XWWA 1Y6JA 1PSWA 4IW3B 2BFDA 5NULA 3PFWO 2FY8A 1YCGA 2DBRA 3QU2A 4O1HA 4ZREA 1MVLA 1T4BA 3EVDA 4P98A 4MR8A 2ZUUA 4N6GA 3V4RA 2FWJA 3CT4A 3CVJA 1XWWA 5DM0A 4RLFA 3WHLA 3FMFA 3BIWA 4U6SA 4Y6PA 1DT3A 2EXXA 2WU1A 4LG1A 3UMGA 4TMFA 1J39A 3AGQA 4A9AA 1J7KA 4MNTA 1CJUC 4JT2A 3VJRA 1EFUA 1VA5A 4Q05A 5DLEA 3UJAA 5E95A 4DR1B 3D3NA 3AVYA 3RADC 3BRSA 3ZJ4A 1U8UA 1HFJA 2MYTA 4OAPA 4RMNA 5K0SA 5EEHA 3I9NA 2QX7A 2ZRJA 4IF6A 1A50B 2QD4A 3LHKA 1QYXA 1DBPA 3ZGVA 1YQUA 1YRLA 4YRIA 3OA2A 3ZVMA 2LV8A 1YUBA 3LIPA 2DBQA 2BEJA 5DCYA 4GYWA 4G4SP 4NDNE 4PX5A 1NYTA 5B7PA 4G0WA 4CCWA 2FG6C 4MUBA 4UPDA 4EEKA 1THGA 3N0RA 4WDRA 2V7PA 3ASVA 4JOSA 2R8RA 3K09C 1I3LA 1G5FA 2J9FA 4CM4B 1SC9A 2ZI3A 5H1YA 2J3LA 1RXVA 2RK3A 2XKJE 3WKEA 1XD8A 2NYVA 3GCWA 3ZJYA 4ENQA 3ZV6A 1ZCAA 4AIIA 3FBGA 2X0KA 4WFIA 3RF6A 4FFNA 4H3SA 3OD5A 3BCSA 1IY2A 4IP0A 4K8RB 3U81A 1A9XA 3RYIA 2N3ZA 4WACA 4F4FA 3C43A 1EJ0A 1Z5NA 3EVZA 1RLOA 1UQRA 1ZVQA 3BIFA 3FMVA 1E1YA 1TJ5A 3L6EA 3MLEA 4KFTA 4IIEA 1EX6A 2PRYA 4WMLA 1RTTA 2I62A 3OZWA 4OK3A 4AL4A 4AAYA 4CUZA 5ITZB 4FYHA 4DM4A 5HIKA 5AW4A 1KK2A 2JFFA 2H63A 2QQ0A 3WB1A 1TCCA 1WDMA 3WWOA 5HWSA 4JN6B 4KX3A 3ME5A 4QSHA 4BQPA 2QTVA 4I5GA 2ZRGA 2FPOA 2VP5A 3DLIA 2IOFA 2OYCA 2VUSA 1E5TA 5LD2B 1WP9A 4HFNA 3KBBA 1Q5PA 5E1MA 1CEEA 4JEHA 3TRFA 4NZMA 1E7YA 2R6HA 3PQDA 4I99A 1JEDA 5M5BA 2N1BA 3DZ8A 4F38A 4N7MA 4CM4A 1KRHA 4DG9A 1AXEA 4QUDA 3FYTA 2CXXA 4X1IA 5U4XA 1EHYA 3OESA 3WKBA 2C2GA 6GPBA 1YULA 4E2YA 1EUCB 4FXPA 4M36A 5F21A 2AVNA 3MQ2A 4X5OA 4Z0HO 5I8WA 3NC0C 1PYDA 3OIVA 4B3XA 1DHRA 3WLAA 1PZGA 1X19A 5DW3A 1GKUB 4YYZA 1HF3A 3U26A 3PUKA 4B6FA 4E3ZA 5KC8A 4WRRA 3MWJA 2PMWB 4GEKA 1OAOC 2AFHB 4YPFA 5IH7A 5L8VA 2VDPB 3PPYA 5EHIA 3V2IA 5IKEA 1QQBA 1MC4A 1N33B 1BVUA 2H3EA 2QR2A 1TJNA 3HSKA 2X0IA 1F2UB 1FLVA 1YQTA 2HK7A 5TNXA 4MMZB 5A5EA 3UPUA 1OE0A 2ETXA 5JISA 1DMSA 1GAJA 4X24A 1M2GA 3C3AA 1FNDA 1CERA 2P2SA 4Y6GB 2C5EA 1UFQA 4TS4A 1JAXA 4X6YA 5KYTA 2C57A 3S2ZA 3WG9A 3IV6A 3CH4B 1G59A 5DLDA 1T6BY 3FE2A 1KNQA 2YIJA 4QBTA 2JA1A 1R4MA 2QMZA 3TOXA 3HYSA 1NWHA 1Z7WA 5JYDA 2CNOA 1O3YA 4DQXA 5A5DA 4KP7A 2PT7A 1S1MA 1JX6A 2WHYA 1AKEA 4A8JA 4V0ME 2VATA 2YRFA 3OG9A 4TUYF 3QX8A 2HNKA 1VBKA 1K7YA 2AYXA 5FA6A 2RBEA 521PA 1L4FA 3I1FA 4B6GA 2Z2XA 1ISFA 4C5CA 3ZCTA 4OXNA 3LYHA 1TQ6A 2JZNA 1NM5A 2R97A 3AP1A 3IBSA 2P5TB 3PICA 4DUPA 2ZRMA 3I62A 4OF4A 2Q5IA 2XKBA 3CPJB 1ZD4A 4JNKA 1DRKA 1MNAA 1QO7A 2PFKA 3U1BA 3AY3A 1ZW6A 1V16A 3CW2A 3HLYA 3V4OA 4ARZB 5EPOA 4B3IA 1HE2A 2POQX 1OIWA 2Y2VA 4NZZA 1GPBA 3KZKA 4TLLB 3WZMA 1QX3A 2CMHA 4L15A 1KYXA 2YC4C 2G9NA 2YXDA 4R0NA 1M34E 1VBNA 2QENA 5ICCA 1E8MA 5AW2A 3PNOA 2H2IA 4AWXA 1XPOA 4GIBA 2EX4A 3QXXA 1BEEA 2JGDA 2WSSD 1TMKA 3R5SA 1FA9A 2Y1GA 3EFOB 1NW6A 4DJAA 1NNUA 2C1XA 1LW7A 4ZQEA 5AW9A 2PKXA 5KYVA 2OV3A 5F9FA 1XF1A 1NMSA 1NE2A 1OXMA 4WXMA 1CCWA 1FYWA 1X0VA 3MMXA 5BQXA 1CY2A 4K86A 1MH1A 1GTRA 8MHTA 1IOLA 4N3NA 3IDSA 3P52A 3QOXA 4UHFA 5JQGB 5FOQA 1EUDA 2PY6A 2FU5C 3HH8A 9ATCA 4EITA 1GADO 2C58A 3GCDA