2L6CA

Solution structure of desulfothioredoxin from desulfovibrio vulgaris hildenborough in its oxidized form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Structural and mechanistic insights into unusual thiol disulfide oxidoreductase.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxidoreductase
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2l6cA00
5HFGA 1WPIA 5D96A 4DEJA 3IRAA 2IFQB 1ON4A 1TRUA 2VCWA 2VLVA 4MJBA 4GWRA 3VWVA 1PD21 2CZ2A 4MABA 4DSSB 2P5RA 1A0RP 2PN8A 2GSQA 3I43A 2LSTA 2C3TA 2F8AA 3DMLA 3GMFA 4ML6A 1K0DA 3F9UA 4BA7A 3KCMA 3UOMA 1TJDA 2H66A 2P31A 1EP8A 5HFKA 2TRCP 2E7PA 3HJOA 3HJMA 2DMMA 4AJ6A 4KW6A 3HHVA 4MJAA 4V1Ap 2LJKA 1GTAA 1X5EA 1XWKA 4ID0A 2KP1A 3LGCA 1QXHA 4JE1A 4PQ1A 1Z9HA 5DALB 5DQYA 2ON7A 5FT3A 1SL1B 1ABAA 1TK5B 1SD8A 4HJ2A 5EY6A 2ZCTA 5JCUA 3C8EA 3W8SA 4MH3A 2P0GA 4GXZA 5ECPB 5G2ZA 4GQCA 6GSWA 3DVWA 3LWAA 5AN1A 1HNBA 4YAPA 1FOVA 2EC4A 2C3QA 3KMOA 3ZMKA 3RDWA 2FCHA 4WF4A 1FW1A 2HZEB 2LRTA 2E0QA 3KH7A 2C8UA 1S3DA 3KM6A 3GH6A 2VCTA 2VO4A 2JL4A 1Z3EA 2LJAA 3TOUA 1OKDA 1XWBA 4V2MA 4IS0A 2V32A 4GSTA 1QFNA 2K18A 3ZITA 5IOXA 5IO2A 3U6VA 1SYRA 2REMA 1O85A 1WP0A 5JWQB 1U88A 2IN3A 4OD7A 1F2EA 1M0UA 4XTSA 2KOKA 5HR3A 5F07A 4WR5A 4K6XA 1A2JA 1K0CA 3KTBA 2MMNA 4Q5QA 2IL3A 3TKSC 3EINA 1EV9A 5B7CA 3ZRDA 1WJKA 3BBYA 2DJ2A 3HKRA 1G7OA 1XW5A 5E59A 4ZXGA 3V1WA 12GSA 3I9V2 2EIQA 2NBSA 1ZGNA 5G1KA 3ZZXA 1HD2A 1SD9A 1Z5YE 2GVPA 2IMKA 3VPQA 3FHKA 2B5EA 2IMDA 1EV4A 3F3QA 4NWYA 4ZILA 2B1LA 1ZMAA 1KNGA 1T3BA 2YOIA 4MJCA 5ECLB 3CYNA 2H01A 5GSSA 1JHBA 3TJKA 2A2SA 5B6NA 2HSHA 3TKPA 2F51A 1VF3A 2YWNA 4YAVA 2JSZA 2PGTA 4PXOA 2FY6A 1C72A 3H93A 3E3EA 1ILOA 3APSA 1TW9A 4ULXA 2WFCA 2NPBA 4ZIJA 1NW2A 2V6OA 4IBPA 16GSA 4FYCA 1TKDB 2VAFA 2HI7A 2FNOA 2IMEA 1G6YA 1F9MA 2YWIA 1OC9A 4F9ZA 2F3MA 3F4RA 2LRNA 3ZFLA 3Q74A 3UVHA 5D8IA 5IMZA 2DC5A 2LEGA 2KHPA 4NHZA 2QC7A 3A2VA 10GSA 5G30A 2WULA 1A2MA 4AJ8A 3O6TA 3TDGA 4GTUA 1EGRA 2PPTA 4AJ7A 1LU4A 1QQ2A 3HXSA 3F8UA 1VF2A 4PX1A 4IKHA 2B1KA 5IO0A 3EU3A 1SL0B 2I3YA 4EUYA 3FKFA 2GTUA 5J41A 3IPZA 3UARA 2KUCA 3QAWA 1OE8A 1T8EB 1BAYA 1RQMA 4BWSA 1ZCPA 5LNKe 1TU8A 1XWCA 3DXBA 3NIVA 5ABRA 3TKRA 4OO5A 1ML6A 1TK0B 1Y25A 3L9SA 2E2MA 1ERUA 5H5QA 4KCAA 11GSA 1XWGA 2MBSA 5KN1A 4D73A 4L0WA 4XIHA 4KUNA 1TOFA 2MMOA 2YPMA 3G7JA 4K0NA 4F03A 1Z7RA 5DAKB 2BJXA 1NSWA 3LFLA 3G7YA 1ZZYA 3N5OA 4LL4B 1H4OA 2C80A 2IFQA 4JEDA 2R3XA 1K3LA 4MF5A 1AIUA 4I97A 1O6JA 4EDZA 1G0TA 2D2ZA 2X8HA 1JZOA 3DGQA 2P5QA 3L78A 2H19A 1SJ6A 3GKMA 5KEJA 1SKSB 4OO4A 2DLXA 1G6WA 2GT5A 5IOWA 4H86A 3LSZA 3LORA 1TDIA 1X9WB 1XZOA 1PQNA 2GSTA 2WCIA 4E8EA 2H0HA 2VCXA 5KN3A 4L0UA 4XS4B 4WEYA 5G31A 3CSJA 3RPNA 1B9YC 1VGLA 3CRTA 4NV2A 1GUHA 1NM3A 3HZ8A 1KEBA 4TR4A 4POKA 4KX4A 3LYKA 5DALA 4F0BA 3QFAC 4ISDA 1MEKA 3ZMLA 1A23A 4ZL8A 1XCCA 1VRSD 2R6KA 5ECMB 4KB3A 3OR5A 4PQIA 5KN2A 2FWFA 4EKZA 1QGVA 4XRDA 4G2EA 3EVIA 2PMTA 3GTUB 4KCEA 4K0GA 4JR6A 3D6IA 2H0IA 1O73A 2H1BA 1ST9A 1EGOA 2HZEA 3O76A 3WT1A 1ERTA 2HSYA 2PERA 2M80A 2DJJA 2CQ9A 4I2UA 2WDUA 3M8NA 2YJ7A 3MNGA 3C1SA 3FEUA 3GX8A 3HVXA 1BYEA 4FIWA 3E0UA 3I69A 2GQLA 3DRNA 3ZTLA 2R2JA 1HQOA 4K7OA 1GRXA 1AUCA 3ZIVA 1DE2A 1XFLA 2CVKA 4MA9A 3QAGA 2LUSA 3PH9A 3QAVA 4Q5RA 1PN9A 4EVMA 4NMUA 1BJXA 3GKNA 2FUG2 2H70A 3QCPA 3GSTA 3KZQA 2BTOT 1FVJA 2OADA 2GSRA 4MPGA 4EXJA 2MMZA 4Q5NA 2VCVA 2VL9A 3APQA 1HYUA 2CA8A 1VF1A 2H6YA 4TR1B 5B6MA 1ZOFA 1T1VA 4DSRA 1EOGA 2Z9SA 2YWMA 3UVTA 4O32A 1A0FA 3VWUA 1O7UA 3GX0A 3EMXA 1A8LA 1X9SB 5ECOB 2DMLA 4MP4A 3CSHA 4D73B 4MLYA 1TTZA 2FWHA 4ML1A 1PL1A 3FZ5A 2L4CA 2L5OA 2GGTA 1MD4A 4KSOA 4F2IA 4KSMA 1QMVA 1BG5A 3H4KA 4IHUA 5D9VA 2H74A 1ERWA 2RUEA 2FD3A 2HNLA 3D5JA 2VD0A 1M7TA 5DJMA 4K9ZA 2A4VA 3ZREA 2YZUA 3TGZA 2GSSA 3KIJA 2O8VB 4I5QA 1V9WA 1TI1A 4POMA 2CT6A 3GHAA 5ECSA 1PRXA 2M46A 4HDEA 4HI7A 1DSBA 1X5DA 5J4UA 3UAPA 4CDOA 3G9BA 4KDYA 4J56E 1T4YA 2JZTA 3C1RA 3GV1A 1UA5A 4MZBA 3SWLA 4EC0A 1VF4A 4KGIA 2XHFA 3CTFA 4K7NA 2DSAA 2MZCA 3FR3A 3FR9A 3A3TA 3GL5A 4HU7A 1FAAA 4J57E 2CAQA 14GSA 3IK7A 2X8GA 4N10A 4QL7A 2RM6A 3NOFA 2VL3A 4Q5FA 3TJBA 5DAKA 2DJ3A 4IQ1A 2C0GA 6GSTA 2V41A 4EE0A 1AXDA 4PUFC 3TJJA 4MZCA 1SK2A 5FWGA 5IMAA 3QR6A 2M72A 1R5PA 1OVNA 5CRWA 2WS2A 1MDJA 1GSSA 3UBLA 4QL9A 1I9DA 3E9JB 5INYA 3IAM2 5HR2A 4HQSA 2DBCA 5AGYA 3ERWA 3F4SA 4PGTA 5D9XA 1W4VA 7GSSA 1SKRB 5IMVA 5ELAA 4V1Ag 3A2XA 5B8AA 1Q98A 3TJFA 1GUMA 4XS4A 4TR3A 1EP7A 2HXKA 5L71A 1I5GA 3HVSA 3LYPA 4HJMA 2B7JA 3TKQA 1YY7A 5AIXA 5ECRB 4BL7A 3NZNA 1GSDA 5DBQA 2L6CA 2I9HA 4NAXA 5COHA 1EOHA 4YQVA 4WXTA 2H1GA 2YWOA 3EC3A 4MDCA 3IC4A 5F8BA 2IPAA 1K0AA 2J23A 4XCSA 3R2QA 3H1NA 3GTUA 3ZL5A 1SJIA 3BCIA 3IXRA 4BPYA 2F9SA 1JLVA 2GS3A 3ERGA 2VLUA 1GH2A 4CW9A 3HCZA 1JLWA 1RW1A 3S9FA 3N9JA 5IMDA 2OBIA 3APOA 2C0FA 1YJ6A 1HNAA 4X1UA 4MMMA 1XBSA 5JWRB 5CO3A 2HLSA 1CQHA 2N5BA 1CQGA 1Y6EA 2E2GA 5J3RA 6GSYA 2OACA 4ZBDA 5GSTA 5ECKB 1M2AA 2NDOA 3ME7A 4NXIA 3DKSA 2VL2C 3VK9A 2B5XA 4DVCA 2K8VA 2A2RA 2R37A 4L8EA 3C71A 2OJLA 3RHCA 2C3NA 5J9BA 4RI6A 2DJ1A 2WB9A 3QD9A 2ON5A 2AHEA 4WETA 5FHIA 5CREA 4EL1A 2YCDA 2XC2A 5F06A 1GULA 4O7HA 4KDUA 4K1FA 4I8BA 3QDNA 4J2FA 4Z7XA 5KN0A 4N30A 3VWXA 1YF0A 3D22A 1FO5A 2C0EA 3LEFA 4TR1A 1NHOA 1WWJA 1GNEA 2ES7A 5ELGA 1OC8A 2H8LA 1A8YA 3TUEA 4JU5A 3QFBC 4L5LA 1JZDA 1GLQA 4IQAA 1TK8B 2H30A 3MAKA 2LRCA 1Q4JA 3GUSA 2AAWA 1AC1A 3K8NA 4POLA 2RUFA 3IK9A 2JZRA 1N2AA 1PX7A 3L4NA 4L5OA 5CNWA 1OYJA 2H0GA 2VUPA 2R5GA 4I6XA 5A4VA 5HR0A 4K7IA 1Z6MA 2LS5A 4XS6A 3M3MA 1BQ7A 2ZNMA 5G5FA 4N0ZA 1K0MA 2LV3A 2PVOC 2EIRA 2PWJA 1H75A 3H79A 2O7KA 1J9BA 4BVXA 1YDKA 18GSA 3GA4A 4POBA 3VI5A 1SU9A 1DBYA 1MDIA 3Q6OA 1V2AA 1GL8A 2PBJA 1KTEA 3A2WA 4HQZA 5EPFA 1XW6A 1V40A 1V57A 2YZHA 1GLPA 3D0ZA 3CMIA 5IMCA 1T7PB 1SKWB 5A4WA 3QOUA 4PNGA 1V98A 1DE1A 1B48A 3KJYA 4MZWA 3ZFBA 2WRTA 3IBHA 3EYTA 5DCHA 3M9KA 4JRRA 2OKAA 5D73A 1U87A 1TRSA 2WGRA 3TB2A 5EVOA 3VWWA 4IELA 3HJPA 3EE2A 3ERFA 5LD0A 2YP6A 1F3AA 4RQRA 4KE3A 2PU9C 1ACVA 2FWGA 4MF7A 1GP1A 13GSA 1PMTA 1K0OA 3MWHA 1GUKA 2C0DA 3MDKA 1FG4A 4IN0A 5GAND 1M2BA 1B4PA 4KDXA 2OE3A 4OFTA 3BCKA 2V2GA 1XXUA 4E8HA 3L9UA 4HEA2 1XOAA 1PA3A 2C1YA 1URMA 3I6AA 1JZRA 4GRFA 1SK0A 4TVEA 2IWTA 4IJIA 1PSQA 1WIKA 4YQUA 1LBKA 9GSSA 3IE3A 1FHEA 2XBQA 3IV4A 3MSZA 5ECQB 3LG6A 1EEMA 2PUKC 2LQQA 1JZWA 3P2AA 4XRAA 5C04A 3TRPA 4PNFA 5AIVA 1DUGA 4GF0A 3UJ1A 1IYIA 2IMFA 3O3TA 4TKYA 3KH9A 4MF6A 20GSA 5G5EA 5IIZA 1J0FA 4EO3A 2XBIA 3ZVJD 4RI7A 3F0IA 1LJRA 2VM2A 3FR6A 1AQXA 1K0NA 3TJGA 5JWOB 2DIZA 2L5LA 1U6TA 4GLTA 2VLTA 3GSSA 3TKSE 2O85A 4G9HA 1TXXA 3WGXA 4OFNA 3L0HA 3H8QA 3DD3A 4IGJA 4HOJA 5CRHA 5H5RA 3SBCA 1OE7A 4HS1A 5ID2B 1GSFA 1HNCA 1AQWA 3IR4A 4IJ3A 4N0VA 2PVQA 1XPVA 2K9FA 2LTKA 3CTGA 2NVLA 1YF1A 2VCZA 1X0RA 4FYUA 2YV9A 3EWLA 2BMXA 2LJRA 3KD0A 1W89A 2JADA 3LXZA 1SJZA 2HZFA 3TCOA 4O5RA 1GSEA 1UVZA 3M9JA 3HD5A 3HYPA 3BD2A 1N8JA 4IVFA 4GSSA 19GSA 4KA0A 2LKUA 2FWEA 4BVYA 3GURA 3IDVA 2JSYA 3ED3A 5EL8A 2CVDA 3DEXA 2JU5A 1WOUA 5GZZB 1R4WA 3TRQA 4ECCA 1YEPA 3IA1A 4HZ4A 2YJHA 4OFMA 1M2DA 2TRXA 4NPBA 2H73A 4FH8A 1R26A 3HY2A 2MYGA 1SYXA 2K6VA 3GH9A 1ZYEA 2VD1A 3EU4A 2AYTA 2LQOA 2RLIA 1PKZA 1G7EA 1RK4A 3KP9A 5DCGA 2RIIA 1GTUA 3VURA 4MPFA 3WT2A 4ECJA 3CSIA 1O81A 3KTLA 1B8XA 3ZYWA 5IPGA 3Q19A 5H5SA 2JACA 2F8FA 5CRGA 3DVXA 2I81A 5A5KA 2VOCA 4PQHA 5ECNB 4ECIA 3VPTA 2GQMA 1XW9A 3Q18A 4HU9A 3PINA 3UL3A 1ZYQB 3KEBA 1PKWA 5IQYA 4LA1A 2DJKA 2X64A 1GTBA 3FY7A 2XPEA 3WD6A 4XS1A 1FVKA 4JBBA 6GSVA 1B4QA 3GN3A 2FA4A 1Z6NA 3FW2A 1Z7PA 5JCGA 1TU7A 1GSYA 1TI3A 3C7MA 1OC3A 3GYKA 4G19A 1AAZA 1THXA 1TRVA 3G7IA 5D9WA 3ME8A 3FZ9A 5DQSA 1R5AA 4ZB8A 3TRXA 2H6ZA 1FB6A 4MK3A 1B9XC 2WZ9A 4TXOB 1A24A 4FYBA 2G2QA 1NHYA 2K8SA 2MMAA 1BEDA 1F3BA 2FLSA 1M9BA 1USBA 4IP6A 4WBJA 2B6MA 4NV5A 4ZBAA 2CZ3A 2KP2A 2CX4A 2XPDA 4OMVA 4GSNA 1XWAA 3VFIA 3FYGA 2L6DA 2WJUA 2GLRA 2B3SA 1TP9A 2MBTA 4EDYA 2AJQB 1GTIA 1PX6A 2VCQA 2AB6A 4JZQA 4TW5A 4WBRD 4KAEA 2ZUPA 2LNTA 1XIYA 2H72A 5HQPA 3VI7A 1O8XA 1OAZA 3US3A 2VIMA 6GSXA 1QUWA 1ZL9A 4K2DA 2O89A 1GWCA 1MDKA 5DDLA 5DVBA 3VLNA 4EF0A 3W6GA 1EEJA 3GKXA 4G10A 5HFIA 3P8WA 3ISOA 1F6MC 3IHQA 3P7XA 1SL2B 4DSQA 2OBKA 5J5NA 4AF2A 2JZSA 3F4TA 3RPPA 4LMWA 1YKAA 4IP1A 3ZIJA 5C00A 5DJLA 2FGXA 2GZZA 3FRCA 2YV7A 2QSIA 3D4MA 3PGTA 3CRUA 3KGKA 1WE0A 2YN1A 1MTCA 4X0XA 2HT9A 1WMJA 1XVWA 3WGEA 4P3YB 5ECHB 1AQVA 2RM5A 1EZKA 3KMNA 1S3AA 2YNXA 4QQ7A 2IJYA 2DJ0A 1YKCA 2O87A 2V1MA 1K3YA 2B7KA 1T00A 2TIRA 3F6DA 2C4JA 4FO5A 5HR1A 4KH7A 5B8BA 5ID2A 2LNSA 4MH2A 1FB0A 5ECIB 3UIWA 3ZLPA 1PGTA 5JCWA 3FK8A 1U3IA 2GZPA 1YQ1A 4XHMA 2HRFA 3M1GA 2FHEA 3D4TA 2GQKA 4AGSA 4ECBA 2X8CA 5F0GA 2EIOA 3QPMA 3HZ4A 4ZL9A 3LQ7A 5D9TA 3HDCA 1F37A 3BJ5A 5IM9A 4HZ2A 3AY8A 4O92A 4GQFA 3L9VA 4OWYA 4HUAA 4KNDA 3RAZA 1AW9A 3D21A 4TRXA 1K0BA 5CYYA 2CX3A 3EMPA 4RUVA 3UBKA 2V6KA 4DSSA 2B5YA 3LXTA 4OCFA 2AUVA 2CAIA 2QGVA 1E2YA 3F3RA 3FZ4A 4LLRA 5IPHA 2VM1A 1J08A 5F05A 1E6BA 2HRNA 4TR0A 2GZYA 5J9CA 5CP1A 3A5WA 2N5FA 3U5RE 3GL3A 3WGDA 2ALBA 5GAPD 1MD3A 2H6XA 1SK1A 4OCEA 3C73A 1T4ZA 1X5CA 4F0CA 1OKTA 1UC7A 5CAXA 3KP8A 4TN8A 2H75A 4TXVA 2H1AA 3BOAA 5G1LA 3UEMA 1TRWA 3PR8A 4CHSA 1PL2A 2HYXA 2CV4A 1QK8A 1IYHA 3QMXA 4NHWA 5CRDA 2H1DA 3GKKA 3JCML 2IIYA 3WYWA 1V58A 1YEXA 5ENUA 1UN2A 8GSSA 1S3CA 1XVQA 3TKSA 17GSA 2QKEA 2I1UA 3J7Yk 6GSSA 2N5AA 2HFDA 2H71A 1JFUA 4WF5A 1SENA 1THOA 3UMAA 2OE0A 1R7HA 1YZXA 3RBTA 4MCUA 3GRXA 1M99A 5E4WA 5A4UA 2IMIA 3LJRA 4TXOA 4ZB9A 1O8WA 4V2LA 4YH2A 2YANA 1OC9B 4ZBBA 4LL1B 1BX9A 4ZB6A 4RQXA 4IW9A 4PURA 2OA7A 1WRYA 3ZVJA 5IMFA 3F63A 5AISA 3J7Yb 4WR4A 4LMVA 4ZL7A 1M9AA 2H76A 6GSUA 4TOPA 3KXOA 2VL2A 3CXGA 4PUAA 2GT6A 4X43A 2R4VA 3F6FA 1A2LA 5LCZA 3DIEA 2L57A 3CBUA 2X99A 2G0FA 3EURA 4V2NA 2AV4A 4WKWA 3RHBA 2CVBA 2OE1A 3IOSA 1EWXA 4F82A 1GNWA 1X9MB 2I4AA 2L4QA 2GDRA 2HE3A 3FZAA 4ACSA 3P90A 3W8JA 3TOTA 4JR4A 1XOBA 4MJEA 3HA9A 22GSA 2FA8A 2J9HA 4GCIA 1GSQA 4I2TA 4N11A 3GIXA 2KLXA 4YQMA 4K8MA 2DIYA 3DWVA 4ILFA 1KBNA 3M0FA 2L59A 4BWQA 5D93A 1U3AA 3GNJA 3HVVA 3DYRA 1ERVA 1GSUA 3GFKA 1K3OA 3IAS2 2NTOA
chains in the Genus database with same CATH superfamily
5HFGA 1WPIA 5D96A 4DEJA 3IRAA 2IFQB 1ON4A 1TRUA 2VCWA 2VLVA 4MJBA 4GWRA 3VWVA 1PD21 2CZ2A 4MABA 4DSSB 2P5RA 1A0RP 4USSA 2PN8A 2GSQA 3I43A 2LSTA 2C3TA 2F8AA 3DMLA 3GMFA 4ML6A 1K0DA 3F9UA 4BA7A 3KCMA 3UOMA 1TJDA 2H66A 2P31A 1EP8A 3LW9A 5HFKA 2TRCP 2E7PA 3HJOA 3HJMA 2DMMA 4AJ6A 4KW6A 3HHVA 4MJAA 4V1Ap 2LJKA 1GTAA 1X5EA 1XWKA 4ID0A 2KP1A 3LGCA 1QXHA 4JE1A 4PQ1A 1Z9HA 5DALB 5DQYA 2ON7A 5FT3A 1SL1B 1ABAA 1TK5B 1SD8A 4HJ2A 5EY6A 2ZCTA 5JCUA 3C8EA 3W8SA 4MH3A 2P0GA 4GXZA 5ECPB 5G2ZA 4GQCA 6GSWA 3DVWA 5BRTA 3LWAA 5AN1A 1HNBA 4YAPA 1FOVA 2EC4A 2C3QA 3KMOA 3ZMKA 3RDWA 2FCHA 4WF4A 1FW1A 2HZEB 2LRTA 2E0QA 3KH7A 2C8UA 1S3DA 3KM6A 3GH6A 2VCTA 2VO4A 2JL4A 1Z3EA 2LJAA 3TOUA 1OKDA 1XWBA 4V2MA 4IS0A 2V32A 4GSTA 1QFNA 2K18A 3ZITA 5IOXA 5IO2A 3U6VA 1SYRA 2REMA 1O85A 1WP0A 5JWQB 1U88A 2IN3A 4OD7A 1F2EA 1M0UA 4XTSA 2KOKA 5HR3A 5F07A 4WR5A 4K6XA 1A2JA 1PN0A 1K0CA 3KTBA 2MMNA 4Q5QA 5KOXA 2IL3A 3TKSC 3EINA 1EV9A 5B7CA 3ZRDA 1WJKA 3BBYA 2DJ2A 3HKRA 1G7OA 1XW5A 5E59A 4ZXGA 3V1WA 12GSA 3I9V2 2EIQA 2NBSA 1ZGNA 5G1KA 3ZZXA 1HD2A 1SD9A 1Z5YE 2GVPA 2IMKA 3VPQA 3FHKA 2B5EA 2IMDA 1EV4A 3F3QA 4NWYA 4ZILA 2B1LA 1ZMAA 1KNGA 1T3BA 2YOIA 4X4JA 4MJCA 5ECLB 3CYNA 2H01A 5GSSA 1JHBA 3TJKA 2A2SA 5B6NA 2HSHA 3TKPA 2F51A 1VF3A 2YWNA 4YAVA 2JSZA 2PGTA 4PXOA 2FY6A 1C72A 3H93A 3E3EA 1ILOA 3APSA 1TW9A 4ULXA 2WFCA 2NPBA 4ZIJA 1NW2A 2V6OA 4IBPA 16GSA 4FYCA 1TKDB 2VAFA 2HI7A 4K5RA 2FNOA 2IMEA 1G6YA 1F9MA 2YWIA 1OC9A 4F9ZA 2F3MA 3F4RA 2LRNA 3ZFLA 3Q74A 3UVHA 5D8IA 5IMZA 2DC5A 2LEGA 2KHPA 4NHZA 2QC7A 3A2VA 10GSA 5G30A 2WULA 4ICYA 1A2MA 4AJ8A 3O6TA 3TDGA 4GTUA 1EGRA 2PPTA 4AJ7A 1LU4A 1QQ2A 3HXSA 3F8UA 1VF2A 4PX1A 4IKHA 2B1KA 5IO0A 3EU3A 1SL0B 2I3YA 4EUYA 3FKFA 2GTUA 5J41A 3IPZA 3UARA 2KUCA 3QAWA 1OE8A 1T8EB 1BAYA 1RQMA 4BWSA 1ZCPA 5LNKe 1TU8A 1XWCA 3DXBA 3NIVA 5ABRA 3TKRA 4OO5A 4Z2TA 1ML6A 1TK0B 1Y25A 3FMWA 3L9SA 2E2MA 1ERUA 5H5QA 4KCAA 1FOHA 11GSA 1XWGA 2MBSA 4Z2UA 5KN1A 4D73A 4L0WA 4XIHA 4KUNA 1TOFA 2MMOA 2YPMA 3G7JA 4K0NA 4F03A 1Z7RA 5DAKB 2BJXA 1NSWA 3LFLA 3G7YA 1ZZYA 3N5OA 4LL4B 1H4OA 2C80A 2IFQA 4JEDA 2R3XA 1K3LA 4MF5A 1AIUA 4I97A 1O6JA 4EDZA 1G0TA 2D2ZA 2X8HA 1JZOA 3DGQA 2P5QA 3L78A 2H19A 1SJ6A 3GKMA 5KEJA 1SKSB 4OO4A 2DLXA 1G6WA 2GT5A 5IOWA 4H86A 3LSZA 3LORA 1TDIA 1X9WB 1XZOA 1PQNA 2GSTA 2WCIA 4E8EA 2H0HA 2VCXA 5KN3A 4L0UA 4XS4B 4WEYA 5G31A 3CSJA 3RPNA 1B9YC 1VGLA 3CRTA 4NV2A 1GUHA 1NM3A 3HZ8A 1KEBA 4TR4A 4POKA 4KX4A 4BL7B 3LYKA 5DALA 4F0BA 3QFAC 4ISDA 1MEKA 3ZMLA 1A23A 4ZL8A 1XCCA 1VRSD 2R6KA 5ECMB 4KB3A 3OR5A 4PQIA 5KN2A 2UZ8A 2FWFA 4EKZA 1QGVA 4XRDA 4G0LA 4G2EA 3EVIA 2PMTA 3GTUB 4KCEA 4K0GA 4JR6A 3D6IA 2H0IA 1O73A 4G0IA 2H1BA 2HSMA 1ST9A 2HRKA 1EGOA 2HZEA 3O76A 3WT1A 1ERTA 2HSYA 2PERA 2M80A 2DJJA 2CQ9A 4I2UA 2WDUA 3M8NA 2YJ7A 3MNGA 3C1SA 3FEUA 3GX8A 3HVXA 1BYEA 4FIWA 3E0UA 3I69A 2GQLA 1ZYPA 3DRNA 3ZTLA 2R2JA 1HQOA 4K7OA 1GRXA 4O5UA 4O5QA 1AUCA 3ZIVA 1DE2A 1XFLA 2CVKA 4MA9A 3QAGA 2LUSA 3PH9A 3QAVA 4Q5RA 1PN9A 4EVMA 4NMUA 1BJXA 3GKNA 2FUG2 2H70A 3QCPA 3GSTA 3KZQA 2BTOT 1FVJA 2OADA 2GSRA 4MPGA 4EXJA 2MMZA 4Q5NA 2VCVA 4BIKA 2VL9A 3APQA 1HYUA 2CA8A 1VF1A 2H6YA 4TR1B 5B6MA 4HSCX 1ZOFA 1T1VA 4DSRA 1EOGA 2Z9SA 2YWMA 3UVTA 4O32A 1A0FA 3VWUA 1O7UA 3GX0A 3EMXA 2QA2A 1A8LA 2A4HA 1X9SB 5ECOB 2DMLA 4MP4A 3CSHA 4D73B 4MLYA 1TTZA 2FWHA 4ML1A 1PL1A 3FZ5A 2L4CA 2L5OA 2GGTA 1MD4A 4KSOA 4F2IA 4KSMA 1QMVA 1BG5A 3H4KA 4IHUA 5D9VA 2H74A 3MIXA 1ERWA 2RUEA 2FD3A 2HNLA 3D5JA 2VD0A 1M7TA 5DJMA 3R3EA 4K9ZA 2A4VA 3ZREA 2YZUA 3TGZA 2GSSA 3KIJA 2O8VB 4I5QA 1V9WA 4KF9A 1TI1A 4POMA 2CT6A 5KOWA 3GHAA 5ECSA 1PRXA 2M46A 4HDEA 4HI7A 3PPUA 1DSBA 1X5DA 5J4UA 3UAPA 4BVXB 4CDOA 3G9BA 4KDYA 4J56E 1T4YA 2JZTA 3C1RA 3GV1A 1UA5A 4MZBA 3SWLA 4EC0A 1VF4A 4KGIA 2XHFA 3CTFA 4K7NA 2DSAA 2MZCA 3FR3A 3FR9A 3A3TA 3GL5A 4HU7A 1FAAA 4J57E 2CAQA 14GSA 3IK7A 2X8GA 4N10A 4QL7A 2RM6A 3NOFA 2VL3A 4Q5FA 3TJBA 5DAKA 2DJ3A 4IQ1A 2C0GA 6GSTA 3CQFA 2V41A 4EE0A 1AXDA 4PUFC 3TJJA 4MZCA 1SK2A 5FWGA 5IMAA 3QR6A 2M72A 1R5PA 1OVNA 5CRWA 4EIQA 2WS2A 4A5PA 1MDJA 1GSSA 3UBLA 4QL9A 1I9DA 3E9JB 5INYA 3IAM2 5HR2A 4HQSA 2DBCA 5AGYA 3ERWA 3F4SA 4PGTA 5D9XA 1W4VA 7GSSA 1SKRB 5IMVA 5ELAA 4V1Ag 3A2XA 5B8AA 1Q98A 3TJFA 1GUMA 4XS4A 4TR3A 1EP7A 2HXKA 5L71A 1I5GA 3HVSA 4G0KA 3LYPA 4HJMA 2B7JA 3IC8A 3TKQA 1YY7A 5AIXA 5ECRB 4BL7A 3NZNA 1GSDA 5DBQA 2L6CA 2I9HA 4NAXA 5COHA 1EOHA 4YQVA 4WXTA 2H1GA 2YWOA 3EC3A 4MDCA 3IC4A 5F8BA 2IPAA 1K0AA 2J23A 4XCSA 3R2QA 3H1NA 3GTUA 3ZL5A 1SJIA 3BCIA 3IXRA 4BPYA 2DKHA 2F9SA 1JLVA 2GS3A 3ERGA 2VLUA 1GH2A 4CW9A 4YKFA 3HCZA 1JLWA 1RW1A 3S9FA 3N9JA 5IMDA 2OBIA 3APOA 2C0FA 1YJ6A 1HNAA 4X1UA 4MMMA 1XBSA 5JWRB 5CO3A 2HLSA 1CQHA 4YKGA 2N5BA 1CQGA 1Y6EA 2E2GA 1S3RA 5J3RA 6GSYA 2OACA 4K2XA 4ZBDA 1M3IA 5GSTA 5ECKB 1M2AA 2NDOA 3ME7A 4CY8A 4NXIA 3DKSA 2VL2C 3VK9A 2B5XA 4DVCA 2K8VA 2A2RA 2R37A 4L8EA 3C71A 2OJLA 3RHCA 2C3NA 5J9BA 4RI6A 3HVNA 2DJ1A 2WB9A 3QD9A 2ON5A 2AHEA 2A2PA 4WETA 5FHIA 5CREA 4EL1A 2YCDA 2XC2A 5F06A 1GULA 4O7HA 4KDUA 4K1FA 4I8BA 3QDNA 4J2FA 4BVYB 4Z7XA 5KN0A 4N30A 3VWXA 1YF0A 3D22A 2HRAA 1FO5A 2C0EA 3LEFA 4TR1A 1NHOA 1WWJA 1GNEA 2ES7A 5ELGA 1OC8A 2H8LA 1A8YA 4CY6A 3TUEA 4JU5A 3QFBC 4L5LA 1JZDA 1GLQA 4IQAA 1TK8B 2H30A 3MAKA 2LRCA 1Q4JA 3GUSA 2AAWA 1AC1A 3K8NA 4POLA 2RUFA 3IK9A 2JZRA 1N2AA 1PX7A 3L4NA 4L5OA 5CNWA 1OYJA 2H0GA 2VUPA 2R5GA 4I6XA 2QA1A 5A4VA 5HR0A 4K7IA 1Z6MA 2LS5A 4XS6A 3M3MA 1BQ7A 2ZNMA 5G5FA 4N0ZA 1K0MA 2LV3A 2PVOC 2EIRA 2PWJA 1H75A 3H79A 2O7KA 1J9BA 4BVXA 1YDKA 18GSA 3GA4A 4POBA 3VI5A 1SU9A 1DBYA 1MDIA 3Q6OA 1V2AA 1GL8A 2PBJA 4Z2RA 1KTEA 3A2WA 4HQZA 5EPFA 1XW6A 1V40A 1V57A 2YZHA 1GLPA 3D0ZA 3CMIA 5IMCA 1T7PB 1SKWB 5A4WA 3QOUA 4PNGA 1V98A 1DE1A 1B48A 3KJYA 4MZWA 3ZFBA 2WRTA 3IBHA 3EYTA 5DCHA 3M9KA 4JRRA 2OKAA 5D73A 1U87A 1TRSA 2WGRA 3TB2A 5EVOA 3VWWA 4IELA 3HJPA 3EE2A 3ERFA 5LD0A 2YP6A 1F3AA 4RQRA 4KE3A 2PU9C 1ACVA 2FWGA 4MF7A 1GP1A 13GSA 1PMTA 1K0OA 3MWHA 1GUKA 2C0DA 3MDKA 1FG4A 4IN0A 5GAND 1M2BA 1B4PA 4KDXA 2OE3A 4OFTA 3BCKA 2V2GA 1XXUA 4E8HA 3L9UA 4HEA2 1XOAA 1PA3A 2C1YA 1URMA 3I6AA 1JZRA 4GRFA 1ZYNA 1SK0A 4TVEA 2IWTA 4IJIA 1PSQA 1WIKA 4YQUA 1LBKA 9GSSA 3IE3A 1FHEA 2XBQA 3IV4A 3MSZA 5ECQB 3LG6A 1EEMA 2PUKC 2LQQA 1JZWA 3P2AA 4XRAA 5C04A 3TRPA 4PNFA 5AIVA 1DUGA 4GF0A 3UJ1A 1IYIA 2IMFA 3O3TA 4TKYA 3KH9A 4MF6A 20GSA 5G5EA 5IIZA 1J0FA 4EO3A 2XBIA 3ZVJD 4RI7A 2DKIA 3F0IA 4K5SA 1LJRA 2VM2A 3FR6A 1AQXA 1K0NA 3TJGA 2X49A 5JWOB 2DIZA 2L5LA 1U6TA 4GLTA 2VLTA 3GSSA 3TKSE 2O85A 4G9HA 1TXXA 3WGXA 4OFNA 3L0HA 4MNNA 3H8QA 3DD3A 4IGJA 4HOJA 5CRHA 5H5RA 3SBCA 1OE7A 4HS1A 5ID2B 1GSFA 1HNCA 1AQWA 3IR4A 4IJ3A 4N0VA 2PVQA 1XPVA 2K9FA 2LTKA 3CTGA 2NVLA 1YF1A 2VCZA 1X0RA 4FYUA 2YV9A 3EWLA 2BMXA 2LJRA 3KD0A 1W89A 2JADA 3LXZA 1SJZA 2HZFA 3TCOA 4O5RA 1GSEA 1UVZA 3M9JA 3HD5A 3HYPA 3BD2A 1N8JA 4IVFA 4GSSA 19GSA 4KA0A 2LKUA 2FWEA 4BVYA 3GURA 3IDVA 2JSYA 3ED3A 5EL8A 2CVDA 3DEXA 2JU5A 1WOUA 5GZZB 1R4WA 3TRQA 4ECCA 1YEPA 3IA1A 4HZ4A 2YJHA 4OFMA 1M2DA 2TRXA 4NPBA 2H73A 4FH8A 1R26A 3HY2A 2MYGA 1SYXA 2K6VA 3GH9A 1ZYEA 2VD1A 3EU4A 2AYTA 2LQOA 2RLIA 1PKZA 1G7EA 1RK4A 3KP9A 5DCGA 2RIIA 1GTUA 3VURA 4MPFA 3WT2A 4ECJA 3CSIA 1O81A 3KTLA 1B8XA 3ZYWA 5IPGA 3Q19A 5H5SA 2JACA 2F8FA 5CRGA 3DVXA 2I81A 5A5KA 2VOCA 4PQHA 5ECNB 4ECIA 3VPTA 2GQMA 1XW9A 3Q18A 4HU9A 3PINA 3UL3A 1ZYQB 1PFOA 3KEBA 4PTSA 1PKWA 5IQYA 4LA1A 2DJKA 2X64A 1GTBA 3FY7A 2XPEA 3WD6A 4XS1A 1FVKA 4JBBA 6GSVA 1B4QA 3GN3A 2FA4A 1Z6NA 3FW2A 1Z7PA 5JCGA 1TU7A 1GSYA 1TI3A 3C7MA 1OC3A 3GYKA 4G19A 1AAZA 1THXA 1TRVA 3G7IA 5D9WA 3ME8A 3IHGA 3FZ9A 5DQSA 1R5AA 4ZB8A 3TRXA 2H6ZA 1FB6A 4MK3A 1B9XC 2WZ9A 4TXOB 1A24A 4FYBA 2G2QA 1NHYA 2K8SA 2X4AA 2MMAA 1BEDA 1F3BA 2FLSA 1M9BA 1USBA 4IP6A 4WBJA 2B6MA 4NV5A 4ZBAA 2CZ3A 2KP2A 2CX4A 2XPDA 4OMVA 4GSNA 1XWAA 3VFIA 3FYGA 2L6DA 2WJUA 2GLRA 2B3SA 1TP9A 4EIPA 2MBTA 4EDYA 5BMUA 2AJQB 1GTIA 1PX6A 2VCQA 2AB6A 4JZQA 4TW5A 4WBRD 4KAEA 2ZUPA 2LNTA 1XIYA 2H72A 5HQPA 3VI7A 1O8XA 1OAZA 1XG8A 3US3A 2VIMA 6GSXA 1QUWA 1ZL9A 4K2DA 2O89A 1GWCA 1MDKA 5DDLA 5DVBA 3VLNA 4EF0A 3W6GA 1EEJA 3GKXA 4G10A 5HFIA 3P8WA 3ISOA 1F6MC 3IHQA 3P7XA 1SL2B 4DSQA 2OBKA 5J5NA 4AF2A 2JZSA 3F4TA 3RPPA 4LMWA 1YKAA 4IP1A 3ZIJA 5C00A 5DJLA 2FGXA 3MYDA 2GZZA 3FRCA 2YV7A 2QSIA 3D4MA 3PGTA 3CRUA 3KGKA 1WE0A 2YN1A 1MTCA 4X0XA 2HT9A 1WMJA 1XVWA 3WGEA 4P3YB 5ECHB 1AQVA 2RM5A 1EZKA 3KMNA 1S3AA 2YNXA 4QQ7A 2IJYA 2DJ0A 1YKCA 2O87A 2V1MA 1K3YA 2B7KA 1T00A 2TIRA 3F6DA 2C4JA 4FO5A 5HR1A 4KH7A 5B8BA 2R0GA 5ID2A 2LNSA 1M3JA 4MH2A 1FB0A 5ECIB 2R0PA 3UIWA 3ZLPA 1PGTA 5JCWA 3FK8A 3A5IA 1U3IA 2GZPA 1YQ1A 4XHMA 2HRFA 3M1GA 2FHEA 3D4TA 2GQKA 4AGSA 4ECBA 2X8CA 5F0GA 2EIOA 3EPTA 3QPMA 3HZ4A 4ZL9A 3LQ7A 5D9TA 3HDCA 1F37A 3BJ5A 5IM9A 4HZ2A 3AY8A 4O92A 4GQFA 3L9VA 4OWYA 4HUAA 4KNDA 3RAZA 1AW9A 3D21A 4TRXA 1K0BA 5CYYA 2CX3A 3EMPA 4RUVA 3UBKA 2V6KA 4DSSA 2B5YA 3LXTA 4OCFA 2AUVA 2CAIA 2QGVA 1E2YA 3F3RA 3FZ4A 4LLRA 5IPHA 2VM1A 1J08A 5F05A 1E6BA 2HRNA 4TR0A 2GZYA 5J9CA 5CP1A 3A5WA 2N5FA 3U5RE 3GL3A 3WGDA 2ALBA 5GAPD 1MD3A 2H6XA 1SK1A 4OCEA 3C73A 1T4ZA 1X5CA 4F0CA 1OKTA 1UC7A 5CAXA 3KP8A 4TN8A 2H75A 4TXVA 2H1AA 3BOAA 5G1LA 3UEMA 1TRWA 3PR8A 4CHSA 1PL2A 2HYXA 2CV4A 1QK8A 1IYHA 3QMXA 4NHWA 5CRDA 2H1DA 3GKKA 3JCML 2IIYA 3WYWA 1V58A 1YEXA 5ENUA 1UN2A 8GSSA 1S3CA 1XVQA 3TKSA 17GSA 2QKEA 2I1UA 3J7Yk 6GSSA 2N5AA 2HFDA 2H71A 1JFUA 4WF5A 1SENA 1THOA 3UMAA 2OE0A 1R7HA 1YZXA 3RBTA 4MCUA 3GRXA 1M99A 5E4WA 5A4UA 2IMIA 3LJRA 4TXOA 4ZB9A 1O8WA 4V2LA 4YH2A 2YANA 1OC9B 4ZBBA 4LL1B 1BX9A 4ZB6A 4RQXA 4IW9A 4PURA 2OA7A 1WRYA 3ZVJA 5IMFA 3F63A 2R0CA 5AISA 3J7Yb 4WR4A 4LMVA 4ZL7A 1M9AA 2H76A 6GSUA 4TOPA 3KXOA 2VL2A 3CXGA 4PUAA 2GT6A 4X43A 2R4VA 3F6FA 1A2LA 5LCZA 3DIEA 2L57A 3CBUA 2X99A 2G0FA 3EURA 4FQUA 4V2NA 2AV4A 4WKWA 3RHBA 2CVBA 2OE1A 3IOSA 1EWXA 4F82A 1GNWA 1X9MB 2I4AA 2L4QA 2GDRA 2HE3A 3FZAA 4ACSA 3P90A 3W8JA 3TOTA 4JR4A 1XOBA 4MJEA 3HA9A 22GSA 2FA8A 2J9HA 4GCIA 1GSQA 4I2TA 4N11A 3GIXA 2KLXA 4YQMA 4K8MA 2DIYA 3DWVA 4ILFA 1KBNA 3M0FA 2L59A 4BWQA 5D93A 1U3AA 3GNJA 3HVVA 3DYRA 1ERVA 1GSUA 3GFKA 1K3OA 3IAS2 2NTOA
chains in the Genus database with same CATH topology
5HFGA 1WPIA 5D96A 4DEJA 3IRAA 2IFQB 1ON4A 1TRUA 2VCWA 2VLVA 4MJBA 4GWRA 3VWVA 1PD21 2CZ2A 4MABA 4DSSB 2P5RA 1A0RP 4USSA 2PN8A 2GSQA 3I43A 2LSTA 2C3TA 2F8AA 3DMLA 3GMFA 4ML6A 1K0DA 3F9UA 4BA7A 3KCMA 3UOMA 1TJDA 2H66A 2P31A 1EP8A 3LW9A 5HFKA 2TRCP 2E7PA 3HJOA 3HJMA 2DMMA 4AJ6A 4KW6A 3HHVA 4MJAA 4V1Ap 2LJKA 1GTAA 1X5EA 1XWKA 4ID0A 2KP1A 3LGCA 1QXHA 4JE1A 4PQ1A 1Z9HA 5DALB 5DQYA 2ON7A 5FT3A 1SL1B 1ABAA 1TK5B 1SD8A 4HJ2A 5EY6A 2ZCTA 5JCUA 3C8EA 3W8SA 4MH3A 2P0GA 4GXZA 5ECPB 5G2ZA 4GQCA 6GSWA 3DVWA 5BRTA 3LWAA 5AN1A 1HNBA 4YAPA 1FOVA 2EC4A 2C3QA 3KMOA 3ZMKA 3RDWA 2FCHA 4WF4A 1FW1A 2HZEB 2LRTA 2E0QA 3KH7A 2C8UA 1S3DA 3KM6A 3GH6A 2VCTA 2VO4A 2JL4A 1Z3EA 2LJAA 3TOUA 1OKDA 1XWBA 4V2MA 4IS0A 2V32A 4GSTA 1QFNA 2K18A 3ZITA 5IOXA 5IO2A 3U6VA 1SYRA 2REMA 1O85A 1WP0A 5JWQB 1U88A 2IN3A 4OD7A 1F2EA 1M0UA 4XTSA 2KOKA 5HR3A 5F07A 4WR5A 4K6XA 1A2JA 1PN0A 1K0CA 3KTBA 2MMNA 4Q5QA 5KOXA 2IL3A 3TKSC 3EINA 1EV9A 5B7CA 3ZRDA 1WJKA 3BBYA 2DJ2A 3HKRA 1G7OA 1XW5A 5E59A 4ZXGA 3V1WA 12GSA 3I9V2 2EIQA 2NBSA 1ZGNA 5G1KA 3ZZXA 1HD2A 1SD9A 1Z5YE 2GVPA 2IMKA 3VPQA 3FHKA 2B5EA 2IMDA 1EV4A 3F3QA 4NWYA 4ZILA 2B1LA 1ZMAA 1KNGA 1T3BA 2YOIA 4X4JA 4MJCA 5ECLB 3CYNA 2H01A 5GSSA 1JHBA 3TJKA 2A2SA 5B6NA 2HSHA 3TKPA 2F51A 1VF3A 2YWNA 4YAVA 2JSZA 2PGTA 4PXOA 2FY6A 1C72A 3H93A 3E3EA 1ILOA 3APSA 1TW9A 4ULXA 2WFCA 2NPBA 4ZIJA 1NW2A 2V6OA 4IBPA 16GSA 4FYCA 1TKDB 2VAFA 2HI7A 4K5RA 2FNOA 2IMEA 1G6YA 1F9MA 2YWIA 1OC9A 4F9ZA 2F3MA 3F4RA 2LRNA 3ZFLA 3Q74A 3UVHA 5D8IA 5IMZA 2DC5A 2LEGA 2KHPA 4NHZA 2QC7A 3A2VA 10GSA 5G30A 2WULA 4ICYA 1A2MA 4AJ8A 3O6TA 3TDGA 4GTUA 1EGRA 2PPTA 4AJ7A 1LU4A 1QQ2A 3HXSA 3F8UA 1VF2A 4PX1A 4IKHA 2B1KA 5IO0A 3EU3A 1SL0B 2I3YA 4EUYA 3FKFA 2GTUA 5J41A 3IPZA 3UARA 2KUCA 3QAWA 1OE8A 1T8EB 1BAYA 1RQMA 4BWSA 1ZCPA 5LNKe 1TU8A 1XWCA 3DXBA 3NIVA 5ABRA 3TKRA 4OO5A 4Z2TA 1ML6A 1TK0B 1Y25A 3FMWA 3L9SA 2E2MA 1ERUA 5H5QA 4KCAA 1FOHA 11GSA 1XWGA 2MBSA 4Z2UA 5KN1A 4D73A 4L0WA 4XIHA 4KUNA 1TOFA 2MMOA 2YPMA 3G7JA 4K0NA 4F03A 1Z7RA 5DAKB 2BJXA 1NSWA 3LFLA 3G7YA 1ZZYA 3N5OA 4LL4B 1H4OA 2C80A 2IFQA 4JEDA 2R3XA 1K3LA 4MF5A 1AIUA 4I97A 1O6JA 4EDZA 1G0TA 2D2ZA 2X8HA 1JZOA 3DGQA 2P5QA 3L78A 2H19A 1SJ6A 3GKMA 5KEJA 1SKSB 4OO4A 2DLXA 1G6WA 2GT5A 5IOWA 4H86A 3LSZA 3LORA 1TDIA 1X9WB 1XZOA 1PQNA 2GSTA 2WCIA 4E8EA 2H0HA 2VCXA 5KN3A 4L0UA 4XS4B 4WEYA 5G31A 3CSJA 3RPNA 1B9YC 1VGLA 3CRTA 4NV2A 1GUHA 1NM3A 3HZ8A 1KEBA 4TR4A 4POKA 4KX4A 4BL7B 3LYKA 5DALA 4F0BA 3QFAC 4ISDA 1MEKA 3ZMLA 1A23A 4ZL8A 1XCCA 1VRSD 2R6KA 5ECMB 4KB3A 3OR5A 4PQIA 5KN2A 2UZ8A 2FWFA 4EKZA 1QGVA 4XRDA 4G0LA 4G2EA 3EVIA 2PMTA 3GTUB 4KCEA 4K0GA 4JR6A 3D6IA 2H0IA 1O73A 4G0IA 2H1BA 2HSMA 1ST9A 2HRKA 1EGOA 2HZEA 3O76A 3WT1A 1ERTA 2HSYA 2PERA 2M80A 2DJJA 2CQ9A 4I2UA 2WDUA 3M8NA 2YJ7A 3MNGA 3C1SA 3FEUA 3GX8A 3HVXA 1BYEA 4FIWA 3E0UA 3I69A 2GQLA 1ZYPA 3DRNA 3ZTLA 2R2JA 1HQOA 4K7OA 1GRXA 4O5UA 4O5QA 1AUCA 3ZIVA 1DE2A 1XFLA 2CVKA 4MA9A 3QAGA 2LUSA 3PH9A 3QAVA 4Q5RA 1PN9A 4EVMA 4NMUA 1BJXA 3GKNA 2FUG2 2H70A 3QCPA 3GSTA 3KZQA 2BTOT 1FVJA 2OADA 2GSRA 4MPGA 4EXJA 2MMZA 4Q5NA 2VCVA 2VL9A 3APQA 1HYUA 2CA8A 1VF1A 2H6YA 4TR1B 5B6MA 1ZOFA 1T1VA 4DSRA 1EOGA 2Z9SA 2YWMA 3UVTA 4O32A 1A0FA 3VWUA 1O7UA 3GX0A 3EMXA 2QA2A 1A8LA 2A4HA 1X9SB 5ECOB 2DMLA 4MP4A 3CSHA 4D73B 4MLYA 1TTZA 2FWHA 4ML1A 1PL1A 3FZ5A 2L4CA 2L5OA 2GGTA 1MD4A 4KSOA 4F2IA 4KSMA 1QMVA 1BG5A 3H4KA 4IHUA 5D9VA 2H74A 3MIXA 1ERWA 2RUEA 2FD3A 2HNLA 3D5JA 2VD0A 1M7TA 5DJMA 3R3EA 4K9ZA 2A4VA 3ZREA 2YZUA 3TGZA 2GSSA 3KIJA 2O8VB 4I5QA 1V9WA 4KF9A 1TI1A 4POMA 2CT6A 5KOWA 3GHAA 5ECSA 1PRXA 2M46A 4HDEA 4HI7A 3PPUA 1DSBA 1X5DA 5J4UA 3UAPA 4BVXB 4CDOA 3G9BA 4KDYA 4J56E 1T4YA 2JZTA 3C1RA 3GV1A 1UA5A 4MZBA 3SWLA 4EC0A 1VF4A 4KGIA 2XHFA 3CTFA 4K7NA 2DSAA 2MZCA 3FR3A 3FR9A 3A3TA 3GL5A 4HU7A 1FAAA 4J57E 2CAQA 14GSA 3IK7A 2X8GA 4N10A 4QL7A 2RM6A 3NOFA 2VL3A 4Q5FA 3TJBA 5DAKA 2DJ3A 4IQ1A 2C0GA 6GSTA 2V41A 4EE0A 1AXDA 4PUFC 3TJJA 4MZCA 1SK2A 5FWGA 5IMAA 3QR6A 2M72A 1R5PA 1OVNA 5CRWA 4EIQA 2WS2A 4A5PA 1MDJA 1GSSA 3UBLA 4QL9A 1I9DA 3E9JB 5INYA 3IAM2 5HR2A 4HQSA 2DBCA 5AGYA 3ERWA 3F4SA 4PGTA 5D9XA 1W4VA 7GSSA 1SKRB 5IMVA 5ELAA 4V1Ag 3A2XA 5B8AA 1Q98A 3TJFA 1GUMA 4XS4A 4TR3A 1EP7A 2HXKA 5L71A 1I5GA 3HVSA 4G0KA 3LYPA 4HJMA 2B7JA 3IC8A 3TKQA 1YY7A 5AIXA 5ECRB 4BL7A 3NZNA 1GSDA 5DBQA 2L6CA 2I9HA 4NAXA 5COHA 1EOHA 4YQVA 4WXTA 2H1GA 2YWOA 3EC3A 4MDCA 3IC4A 5F8BA 2IPAA 1K0AA 2J23A 4XCSA 3R2QA 3H1NA 3GTUA 3ZL5A 1SJIA 3BCIA 3IXRA 4BPYA 2DKHA 2F9SA 1JLVA 2GS3A 3ERGA 2VLUA 1GH2A 4CW9A 4YKFA 3HCZA 1JLWA 1RW1A 3S9FA 3N9JA 5IMDA 2OBIA 3APOA 2C0FA 1YJ6A 1HNAA 4X1UA 4MMMA 1XBSA 5JWRB 5CO3A 2HLSA 1CQHA 4YKGA 2N5BA 1CQGA 1Y6EA 2E2GA 5J3RA 6GSYA 2OACA 4K2XA 4ZBDA 5GSTA 5ECKB 1M2AA 2NDOA 3ME7A 4CY8A 4NXIA 3DKSA 2VL2C 3VK9A 2B5XA 4DVCA 2K8VA 2A2RA 2R37A 4L8EA 3C71A 2OJLA 3RHCA 2C3NA 5J9BA 4RI6A 2DJ1A 2WB9A 3QD9A 2ON5A 2AHEA 2A2PA 4WETA 5FHIA 5CREA 4EL1A 2YCDA 2XC2A 5F06A 1GULA 4O7HA 4KDUA 4K1FA 4I8BA 3QDNA 4J2FA 4BVYB 4Z7XA 5KN0A 4N30A 3VWXA 1YF0A 3D22A 2HRAA 1FO5A 2C0EA 3LEFA 4TR1A 1NHOA 1WWJA 1GNEA 2ES7A 5ELGA 1OC8A 2H8LA 1A8YA 4CY6A 3TUEA 4JU5A 3QFBC 4L5LA 1JZDA 1GLQA 4IQAA 1TK8B 2H30A 3MAKA 2LRCA 1Q4JA 3GUSA 2AAWA 1AC1A 3K8NA 4POLA 2RUFA 3IK9A 2JZRA 1N2AA 1PX7A 3L4NA 4L5OA 5CNWA 1OYJA 2H0GA 2VUPA 2R5GA 4I6XA 2QA1A 5A4VA 5HR0A 4K7IA 1Z6MA 2LS5A 4XS6A 3M3MA 1BQ7A 2ZNMA 5G5FA 4N0ZA 1K0MA 2LV3A 2PVOC 2EIRA 2PWJA 1H75A 3H79A 2O7KA 1J9BA 4BVXA 1YDKA 18GSA 3GA4A 4POBA 3VI5A 1SU9A 1DBYA 1MDIA 3Q6OA 1V2AA 1GL8A 2PBJA 4Z2RA 1KTEA 3A2WA 4HQZA 5EPFA 1XW6A 1V40A 1V57A 2YZHA 1GLPA 3D0ZA 3CMIA 5IMCA 1T7PB 1SKWB 5A4WA 3QOUA 4PNGA 1V98A 1DE1A 1B48A 3KJYA 4MZWA 3ZFBA 2WRTA 3IBHA 3EYTA 5DCHA 3M9KA 4JRRA 2OKAA 5D73A 1U87A 1TRSA 2WGRA 3TB2A 5EVOA 3VWWA 4IELA 3HJPA 3EE2A 3ERFA 5LD0A 2YP6A 1F3AA 4RQRA 4KE3A 2PU9C 1ACVA 2FWGA 4MF7A 1GP1A 13GSA 1PMTA 1K0OA 3MWHA 1GUKA 2C0DA 3MDKA 1FG4A 4IN0A 5GAND 1M2BA 1B4PA 4KDXA 2OE3A 4OFTA 3BCKA 2V2GA 1XXUA 4E8HA 3L9UA 4HEA2 1XOAA 1PA3A 2C1YA 1URMA 3I6AA 1JZRA 4GRFA 1ZYNA 1SK0A 4TVEA 2IWTA 4IJIA 1PSQA 1WIKA 4YQUA 1LBKA 9GSSA 3IE3A 1FHEA 2XBQA 3IV4A 3MSZA 5ECQB 3LG6A 1EEMA 2PUKC 2LQQA 1JZWA 3P2AA 4XRAA 5C04A 3TRPA 4PNFA 5AIVA 1DUGA 4GF0A 3UJ1A 1IYIA 2IMFA 3O3TA 4TKYA 3KH9A 4MF6A 20GSA 5G5EA 5IIZA 1J0FA 4EO3A 2XBIA 3ZVJD 4RI7A 2DKIA 3F0IA 4K5SA 1LJRA 2VM2A 3FR6A 1AQXA 1K0NA 3TJGA 2X49A 5JWOB 2DIZA 2L5LA 1U6TA 4GLTA 2VLTA 3GSSA 3TKSE 2O85A 4G9HA 1TXXA 3WGXA 4OFNA 3L0HA 4MNNA 3H8QA 3DD3A 4IGJA 4HOJA 5CRHA 5H5RA 3SBCA 1OE7A 4HS1A 5ID2B 1GSFA 1HNCA 1AQWA 3IR4A 4IJ3A 4N0VA 2PVQA 1XPVA 2K9FA 2LTKA 3CTGA 2NVLA 1YF1A 2VCZA 1X0RA 4FYUA 2YV9A 3EWLA 2BMXA 2LJRA 3KD0A 1W89A 2JADA 3LXZA 1SJZA 2HZFA 3TCOA 4O5RA 1GSEA 1UVZA 3M9JA 3HD5A 3HYPA 3BD2A 1N8JA 4IVFA 4GSSA 19GSA 4KA0A 2LKUA 2FWEA 4BVYA 3GURA 3IDVA 2JSYA 3ED3A 5EL8A 2CVDA 3DEXA 2JU5A 1WOUA 5GZZB 1R4WA 3TRQA 4ECCA 1YEPA 3IA1A 4HZ4A 2YJHA 4OFMA 1M2DA 2TRXA 4NPBA 2H73A 4FH8A 1R26A 3HY2A 2MYGA 1SYXA 2K6VA 3GH9A 1ZYEA 2VD1A 3EU4A 2AYTA 2LQOA 2RLIA 1PKZA 1G7EA 1RK4A 3KP9A 5DCGA 2RIIA 1GTUA 3VURA 4MPFA 3WT2A 4ECJA 3CSIA 1O81A 3KTLA 1B8XA 3ZYWA 5IPGA 3Q19A 5H5SA 2JACA 2F8FA 5CRGA 3DVXA 2I81A 5A5KA 2VOCA 4PQHA 5ECNB 4ECIA 3VPTA 2GQMA 1XW9A 3Q18A 4HU9A 3PINA 3UL3A 1ZYQB 3KEBA 4PTSA 1PKWA 5IQYA 4LA1A 2DJKA 2X64A 1GTBA 3FY7A 2XPEA 3WD6A 4XS1A 1FVKA 4JBBA 6GSVA 1B4QA 3GN3A 2FA4A 1Z6NA 3FW2A 1Z7PA 5JCGA 1TU7A 1GSYA 1TI3A 3C7MA 1OC3A 3GYKA 4G19A 1AAZA 1THXA 1TRVA 3G7IA 5D9WA 3ME8A 3IHGA 3FZ9A 5DQSA 1R5AA 4ZB8A 3TRXA 2H6ZA 1FB6A 4MK3A 1B9XC 2WZ9A 4TXOB 1A24A 4FYBA 2G2QA 1NHYA 2K8SA 2X4AA 2MMAA 1BEDA 1F3BA 2FLSA 1M9BA 1USBA 4IP6A 4WBJA 2B6MA 4NV5A 4ZBAA 2CZ3A 2KP2A 2CX4A 2XPDA 4OMVA 4GSNA 1XWAA 3VFIA 3FYGA 2L6DA 2WJUA 2GLRA 2B3SA 1TP9A 4EIPA 2MBTA 4EDYA 5BMUA 2AJQB 1GTIA 1PX6A 2VCQA 2AB6A 4JZQA 4TW5A 4WBRD 4KAEA 2ZUPA 2LNTA 1XIYA 2H72A 5HQPA 3VI7A 1O8XA 1OAZA 3US3A 2VIMA 6GSXA 1QUWA 1ZL9A 4K2DA 2O89A 1GWCA 1MDKA 5DDLA 5DVBA 3VLNA 4EF0A 3W6GA 1EEJA 3GKXA 4G10A 5HFIA 3P8WA 3ISOA 1F6MC 3IHQA 3P7XA 1SL2B 4DSQA 2OBKA 5J5NA 4AF2A 2JZSA 3F4TA 3RPPA 4LMWA 1YKAA 4IP1A 3ZIJA 5C00A 5DJLA 2FGXA 3MYDA 2GZZA 3FRCA 2YV7A 2QSIA 3D4MA 3PGTA 3CRUA 3KGKA 1WE0A 2YN1A 1MTCA 4X0XA 2HT9A 1WMJA 1XVWA 3WGEA 4P3YB 5ECHB 1AQVA 2RM5A 1EZKA 3KMNA 1S3AA 2YNXA 4QQ7A 2IJYA 2DJ0A 1YKCA 2O87A 2V1MA 1K3YA 2B7KA 1T00A 2TIRA 3F6DA 2C4JA 4FO5A 5HR1A 4KH7A 5B8BA 2R0GA 5ID2A 2LNSA 4MH2A 1FB0A 5ECIB 2R0PA 3UIWA 3ZLPA 1PGTA 5JCWA 3FK8A 3A5IA 1U3IA 2GZPA 1YQ1A 4XHMA 2HRFA 3M1GA 2FHEA 3D4TA 2GQKA 4AGSA 4ECBA 2X8CA 5F0GA 2EIOA 3EPTA 3QPMA 3HZ4A 4ZL9A 3LQ7A 5D9TA 3HDCA 1F37A 3BJ5A 5IM9A 4HZ2A 3AY8A 4O92A 4GQFA 3L9VA 4OWYA 4HUAA 4KNDA 3RAZA 1AW9A 3D21A 4TRXA 1K0BA 5CYYA 2CX3A 3EMPA 4RUVA 3UBKA 2V6KA 4DSSA 2B5YA 3LXTA 4OCFA 2AUVA 2CAIA 2QGVA 1E2YA 3F3RA 3FZ4A 4LLRA 5IPHA 2VM1A 1J08A 5F05A 1E6BA 2HRNA 4TR0A 2GZYA 5J9CA 5CP1A 3A5WA 2N5FA 3U5RE 3GL3A 3WGDA 2ALBA 5GAPD 1MD3A 2H6XA 1SK1A 4OCEA 3C73A 1T4ZA 1X5CA 4F0CA 1OKTA 1UC7A 5CAXA 3KP8A 4TN8A 2H75A 4TXVA 2H1AA 3BOAA 5G1LA 3UEMA 1TRWA 3PR8A 4CHSA 1PL2A 2HYXA 2CV4A 1QK8A 1IYHA 3QMXA 4NHWA 5CRDA 2H1DA 3GKKA 3JCML 2IIYA 3WYWA 1V58A 1YEXA 5ENUA 1UN2A 8GSSA 1S3CA 1XVQA 3TKSA 17GSA 2QKEA 2I1UA 3J7Yk 6GSSA 2N5AA 2HFDA 2H71A 1JFUA 4WF5A 1SENA 1THOA 3UMAA 2OE0A 1R7HA 1YZXA 3RBTA 4MCUA 3GRXA 1M99A 5E4WA 5A4UA 2IMIA 3LJRA 4TXOA 4ZB9A 1O8WA 4V2LA 4YH2A 2YANA 1OC9B 4ZBBA 4LL1B 1BX9A 4ZB6A 4RQXA 4IW9A 4PURA 2OA7A 1WRYA 3ZVJA 5IMFA 3F63A 2R0CA 5AISA 3J7Yb 4WR4A 4LMVA 4ZL7A 1M9AA 2H76A 6GSUA 4TOPA 3KXOA 2VL2A 3CXGA 4PUAA 2GT6A 4X43A 2R4VA 3F6FA 1A2LA 5LCZA 3DIEA 2L57A 3CBUA 2X99A 2G0FA 3EURA 4FQUA 4V2NA 2AV4A 4WKWA 3RHBA 2CVBA 2OE1A 3IOSA 1EWXA 4F82A 1GNWA 1X9MB 2I4AA 2L4QA 2GDRA 2HE3A 3FZAA 4ACSA 3P90A 3W8JA 3TOTA 4JR4A 1XOBA 4MJEA 3HA9A 22GSA 2FA8A 2J9HA 4GCIA 1GSQA 4I2TA 4N11A 3GIXA 2KLXA 4YQMA 4K8MA 2DIYA 3DWVA 4ILFA 1KBNA 3M0FA 2L59A 4BWQA 5D93A 1U3AA 3GNJA 3HVVA 3DYRA 1ERVA 1GSUA 3GFKA 1K3OA 3IAS2 2NTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFG A;  1WPI A;  5D96 A;  4DEJ A;  3IRA A;  2IFQ B;  1ON4 A;  1TRU A;  2VCW A;  2VLV A;  4MJB A;  4GWR A;  3VWV A;  1PD2 1;  2CZ2 A;  4MAB A;  4DSS B;  2P5R A;  1A0R P;  2PN8 A;  2GSQ A;  3I43 A;  2LST A;  2C3T A;  2F8A A;  3DML A;  3GMF A;  4ML6 A;  1K0D A;  3F9U A;  4BA7 A;  3KCM A;  3UOM A;  1TJD A;  2H66 A;  2P31 A;  1EP8 A;  5HFK A;  2TRC P;  2E7P A;  3HJO A;  3HJM A;  2DMM A;  4AJ6 A;  4KW6 A;  3HHV A;  4MJA A;  4V1A p;  2LJK A;  1GTA A;  1X5E A;  1XWK A;  4ID0 A;  2KP1 A;  3LGC A;  1QXH A;  4JE1 A;  4PQ1 A;  1Z9H A;  5DAL B;  5DQY A;  2ON7 A;  5FT3 A;  1SL1 B;  1ABA A;  1TK5 B;  1SD8 A;  4HJ2 A;  5EY6 A;  2ZCT A;  5JCU A;  3C8E A;  3W8S A;  4MH3 A;  2P0G A;  4GXZ A;  5ECP B;  5G2Z A;  4GQC A;  6GSW A;  3DVW A;  3LWA A;  5AN1 A;  1HNB A;  4YAP A;  1FOV A;  2EC4 A;  2C3Q A;  3KMO A;  3ZMK A;  3RDW A;  2FCH A;  4WF4 A;  1FW1 A;  2HZE B;  2LRT A;  2E0Q A;  3KH7 A;  2C8U A;  1S3D A;  3KM6 A;  3GH6 A;  2VCT A;  2VO4 A;  2JL4 A;  1Z3E A;  2LJA A;  3TOU A;  1OKD A;  1XWB A;  4V2M A;  4IS0 A;  2V32 A;  4GST A;  1QFN A;  2K18 A;  3ZIT A;  5IOX A;  5IO2 A;  3U6V A;  1SYR A;  2REM A;  1O85 A;  1WP0 A;  5JWQ B;  1U88 A;  2IN3 A;  4OD7 A;  1F2E A;  1M0U A;  4XTS A;  2KOK A;  5HR3 A;  5F07 A;  4WR5 A;  4K6X A;  1A2J A;  1K0C A;  3KTB A;  2MMN A;  4Q5Q A;  2IL3 A;  3TKS C;  3EIN A;  1EV9 A;  5B7C A;  3ZRD A;  1WJK A;  3BBY A;  2DJ2 A;  3HKR A;  1G7O A;  1XW5 A;  5E59 A;  4ZXG A;  3V1W A;  12GS A;  3I9V 2;  2EIQ A;  2NBS A;  1ZGN A;  5G1K A;  3ZZX A;  1HD2 A;  1SD9 A;  1Z5Y E;  2GVP A;  2IMK A;  3VPQ A;  3FHK A;  2B5E A;  2IMD A;  1EV4 A;  3F3Q A;  4NWY A;  4ZIL A;  2B1L A;  1ZMA A;  1KNG A;  1T3B A;  2YOI A;  4MJC A;  5ECL B;  3CYN A;  2H01 A;  5GSS A;  1JHB A;  3TJK A;  2A2S A;  5B6N A;  2HSH A;  3TKP A;  2F51 A;  1VF3 A;  2YWN A;  4YAV A;  2JSZ A;  2PGT A;  4PXO A;  2FY6 A;  1C72 A;  3H93 A;  3E3E A;  1ILO A;  3APS A;  1TW9 A;  4ULX A;  2WFC A;  2NPB A;  4ZIJ A;  1NW2 A;  2V6O A;  4IBP A;  16GS A;  4FYC A;  1TKD B;  2VAF A;  2HI7 A;  2FNO A;  2IME A;  1G6Y A;  1F9M A;  2YWI A;  1OC9 A;  4F9Z A;  2F3M A;  3F4R A;  2LRN A;  3ZFL A;  3Q74 A;  3UVH A;  5D8I A;  5IMZ A;  2DC5 A;  2LEG A;  2KHP A;  4NHZ A;  2QC7 A;  3A2V A;  10GS A;  5G30 A;  2WUL A;  1A2M A;  4AJ8 A;  3O6T A;  3TDG A;  4GTU A;  1EGR A;  2PPT A;  4AJ7 A;  1LU4 A;  1QQ2 A;  3HXS A;  3F8U A;  1VF2 A;  4PX1 A;  4IKH A;  2B1K A;  5IO0 A;  3EU3 A;  1SL0 B;  2I3Y A;  4EUY A;  3FKF A;  2GTU A;  5J41 A;  3IPZ A;  3UAR A;  2KUC A;  3QAW A;  1OE8 A;  1T8E B;  1BAY A;  1RQM A;  4BWS A;  1ZCP A;  5LNK e;  1TU8 A;  1XWC A;  3DXB A;  3NIV A;  5ABR A;  3TKR A;  4OO5 A;  1ML6 A;  1TK0 B;  1Y25 A;  3L9S A;  2E2M A;  1ERU A;  5H5Q A;  4KCA A;  11GS A;  1XWG A;  2MBS A;  5KN1 A;  4D73 A;  4L0W A;  4XIH A;  4KUN A;  1TOF A;  2MMO A;  2YPM A;  3G7J A;  4K0N A;  4F03 A;  1Z7R A;  5DAK B;  2BJX A;  1NSW A;  3LFL A;  3G7Y A;  1ZZY A;  3N5O A;  4LL4 B;  1H4O A;  2C80 A;  2IFQ A;  4JED A;  2R3X A;  1K3L A;  4MF5 A;  1AIU A;  4I97 A;  1O6J A;  4EDZ A;  1G0T A;  2D2Z A;  2X8H A;  1JZO A;  3DGQ A;  2P5Q A;  3L78 A;  2H19 A;  1SJ6 A;  3GKM A;  5KEJ A;  1SKS B;  4OO4 A;  2DLX A;  1G6W A;  2GT5 A;  5IOW A;  4H86 A;  3LSZ A;  3LOR A;  1TDI A;  1X9W B;  1XZO A;  1PQN A;  2GST A;  2WCI A;  4E8E A;  2H0H A;  2VCX A;  5KN3 A;  4L0U A;  4XS4 B;  4WEY A;  5G31 A;  3CSJ A;  3RPN A;  1B9Y C;  1VGL A;  3CRT A;  4NV2 A;  1GUH A;  1NM3 A;  3HZ8 A;  1KEB A;  4TR4 A;  4POK A;  4KX4 A;  3LYK A;  5DAL A;  4F0B A;  3QFA C;  4ISD A;  1MEK A;  3ZML A;  1A23 A;  4ZL8 A;  1XCC A;  1VRS D;  2R6K A;  5ECM B;  4KB3 A;  3OR5 A;  4PQI A;  5KN2 A;  2FWF A;  4EKZ A;  1QGV A;  4XRD A;  4G2E A;  3EVI A;  2PMT A;  3GTU B;  4KCE A;  4K0G A;  4JR6 A;  3D6I A;  2H0I A;  1O73 A;  2H1B A;  1ST9 A;  1EGO A;  2HZE A;  3O76 A;  3WT1 A;  1ERT A;  2HSY A;  2PER A;  2M80 A;  2DJJ A;  2CQ9 A;  4I2U A;  2WDU A;  3M8N A;  2YJ7 A;  3MNG A;  3C1S A;  3FEU A;  3GX8 A;  3HVX A;  1BYE A;  4FIW A;  3E0U A;  3I69 A;  2GQL A;  3DRN A;  3ZTL A;  2R2J A;  1HQO A;  4K7O A;  1GRX A;  1AUC A;  3ZIV A;  1DE2 A;  1XFL A;  2CVK A;  4MA9 A;  3QAG A;  2LUS A;  3PH9 A;  3QAV A;  4Q5R A;  1PN9 A;  4EVM A;  4NMU A;  1BJX A;  3GKN A;  2FUG 2;  2H70 A;  3QCP A;  3GST A;  3KZQ A;  2BTO T;  1FVJ A;  2OAD A;  2GSR A;  4MPG A;  4EXJ A;  2MMZ A;  4Q5N A;  2VCV A;  2VL9 A;  3APQ A;  1HYU A;  2CA8 A;  1VF1 A;  2H6Y A;  4TR1 B;  5B6M A;  1ZOF A;  1T1V A;  4DSR A;  1EOG A;  2Z9S A;  2YWM A;  3UVT A;  4O32 A;  1A0F A;  3VWU A;  1O7U A;  3GX0 A;  3EMX A;  1A8L A;  1X9S B;  5ECO B;  2DML A;  4MP4 A;  3CSH A;  4D73 B;  4MLY A;  1TTZ A;  2FWH A;  4ML1 A;  1PL1 A;  3FZ5 A;  2L4C A;  2L5O A;  2GGT A;  1MD4 A;  4KSO A;  4F2I A;  4KSM A;  1QMV A;  1BG5 A;  3H4K A;  4IHU A;  5D9V A;  2H74 A;  1ERW A;  2RUE A;  2FD3 A;  2HNL A;  3D5J A;  2VD0 A;  1M7T A;  5DJM A;  4K9Z A;  2A4V A;  3ZRE A;  2YZU A;  3TGZ A;  2GSS A;  3KIJ A;  2O8V B;  4I5Q A;  1V9W A;  1TI1 A;  4POM A;  2CT6 A;  3GHA A;  5ECS A;  1PRX A;  2M46 A;  4HDE A;  4HI7 A;  1DSB A;  1X5D A;  5J4U A;  3UAP A;  4CDO A;  3G9B A;  4KDY A;  4J56 E;  1T4Y A;  2JZT A;  3C1R A;  3GV1 A;  1UA5 A;  4MZB A;  3SWL A;  4EC0 A;  1VF4 A;  4KGI A;  2XHF A;  3CTF A;  4K7N A;  2DSA A;  2MZC A;  3FR3 A;  3FR9 A;  3A3T A;  3GL5 A;  4HU7 A;  1FAA A;  4J57 E;  2CAQ A;  14GS A;  3IK7 A;  2X8G A;  4N10 A;  4QL7 A;  2RM6 A;  3NOF A;  2VL3 A;  4Q5F A;  3TJB A;  5DAK A;  2DJ3 A;  4IQ1 A;  2C0G A;  6GST A;  2V41 A;  4EE0 A;  1AXD A;  4PUF C;  3TJJ A;  4MZC A;  1SK2 A;  5FWG A;  5IMA A;  3QR6 A;  2M72 A;  1R5P A;  1OVN A;  5CRW A;  2WS2 A;  1MDJ A;  1GSS A;  3UBL A;  4QL9 A;  1I9D A;  3E9J B;  5INY A;  3IAM 2;  5HR2 A;  4HQS A;  2DBC A;  5AGY A;  3ERW A;  3F4S A;  4PGT A;  5D9X A;  1W4V A;  7GSS A;  1SKR B;  5IMV A;  5ELA A;  4V1A g;  3A2X A;  5B8A A;  1Q98 A;  3TJF A;  1GUM A;  4XS4 A;  4TR3 A;  1EP7 A;  2HXK A;  5L71 A;  1I5G A;  3HVS A;  3LYP A;  4HJM A;  2B7J A;  3TKQ A;  1YY7 A;  5AIX A;  5ECR B;  4BL7 A;  3NZN A;  1GSD A;  5DBQ A;  2L6C A;  2I9H A;  4NAX A;  5COH A;  1EOH A;  4YQV A;  4WXT A;  2H1G A;  2YWO A;  3EC3 A;  4MDC A;  3IC4 A;  5F8B A;  2IPA A;  1K0A A;  2J23 A;  4XCS A;  3R2Q A;  3H1N A;  3GTU A;  3ZL5 A;  1SJI A;  3BCI A;  3IXR A;  4BPY A;  2F9S A;  1JLV A;  2GS3 A;  3ERG A;  2VLU A;  1GH2 A;  4CW9 A;  3HCZ A;  1JLW A;  1RW1 A;  3S9F A;  3N9J A;  5IMD A;  2OBI A;  3APO A;  2C0F A;  1YJ6 A;  1HNA A;  4X1U A;  4MMM A;  1XBS A;  5JWR B;  5CO3 A;  2HLS A;  1CQH A;  2N5B A;  1CQG A;  1Y6E A;  2E2G A;  5J3R A;  6GSY A;  2OAC A;  4ZBD A;  5GST A;  5ECK B;  1M2A A;  2NDO A;  3ME7 A;  4NXI A;  3DKS A;  2VL2 C;  3VK9 A;  2B5X A;  4DVC A;  2K8V A;  2A2R A;  2R37 A;  4L8E A;  3C71 A;  2OJL A;  3RHC A;  2C3N A;  5J9B A;  4RI6 A;  2DJ1 A;  2WB9 A;  3QD9 A;  2ON5 A;  2AHE A;  4WET A;  5FHI A;  5CRE A;  4EL1 A;  2YCD A;  2XC2 A;  5F06 A;  1GUL A;  4O7H A;  4KDU A;  4K1F A;  4I8B A;  3QDN A;  4J2F A;  4Z7X A;  5KN0 A;  4N30 A;  3VWX A;  1YF0 A;  3D22 A;  1FO5 A;  2C0E A;  3LEF A;  4TR1 A;  1NHO A;  1WWJ A;  1GNE A;  2ES7 A;  5ELG A;  1OC8 A;  2H8L A;  1A8Y A;  3TUE A;  4JU5 A;  3QFB C;  4L5L A;  1JZD A;  1GLQ A;  4IQA A;  1TK8 B;  2H30 A;  3MAK A;  2LRC A;  1Q4J A;  3GUS A;  2AAW A;  1AC1 A;  3K8N A;  4POL A;  2RUF A;  3IK9 A;  2JZR A;  1N2A A;  1PX7 A;  3L4N A;  4L5O A;  5CNW A;  1OYJ A;  2H0G A;  2VUP A;  2R5G A;  4I6X A;  5A4V A;  5HR0 A;  4K7I A;  1Z6M A;  2LS5 A;  4XS6 A;  3M3M A;  1BQ7 A;  2ZNM A;  5G5F A;  4N0Z A;  1K0M A;  2LV3 A;  2PVO C;  2EIR A;  2PWJ A;  1H75 A;  3H79 A;  2O7K A;  1J9B A;  4BVX A;  1YDK A;  18GS A;  3GA4 A;  4POB A;  3VI5 A;  1SU9 A;  1DBY A;  1MDI A;  3Q6O A;  1V2A A;  1GL8 A;  2PBJ A;  1KTE A;  3A2W A;  4HQZ A;  5EPF A;  1XW6 A;  1V40 A;  1V57 A;  2YZH A;  1GLP A;  3D0Z A;  3CMI A;  5IMC A;  1T7P B;  1SKW B;  5A4W A;  3QOU A;  4PNG A;  1V98 A;  1DE1 A;  1B48 A;  3KJY A;  4MZW A;  3ZFB A;  2WRT A;  3IBH A;  3EYT A;  5DCH A;  3M9K A;  4JRR A;  2OKA A;  5D73 A;  1U87 A;  1TRS A;  2WGR A;  3TB2 A;  5EVO A;  3VWW A;  4IEL A;  3HJP A;  3EE2 A;  3ERF A;  5LD0 A;  2YP6 A;  1F3A A;  4RQR A;  4KE3 A;  2PU9 C;  1ACV A;  2FWG A;  4MF7 A;  1GP1 A;  13GS A;  1PMT A;  1K0O A;  3MWH A;  1GUK A;  2C0D A;  3MDK A;  1FG4 A;  4IN0 A;  5GAN D;  1M2B A;  1B4P A;  4KDX A;  2OE3 A;  4OFT A;  3BCK A;  2V2G A;  1XXU A;  4E8H A;  3L9U A;  4HEA 2;  1XOA A;  1PA3 A;  2C1Y A;  1URM A;  3I6A A;  1JZR A;  4GRF A;  1SK0 A;  4TVE A;  2IWT A;  4IJI A;  1PSQ A;  1WIK A;  4YQU A;  1LBK A;  9GSS A;  3IE3 A;  1FHE A;  2XBQ A;  3IV4 A;  3MSZ A;  5ECQ B;  3LG6 A;  1EEM A;  2PUK C;  2LQQ A;  1JZW A;  3P2A A;  4XRA A;  5C04 A;  3TRP A;  4PNF A;  5AIV A;  1DUG A;  4GF0 A;  3UJ1 A;  1IYI A;  2IMF A;  3O3T A;  4TKY A;  3KH9 A;  4MF6 A;  20GS A;  5G5E A;  5IIZ A;  1J0F A;  4EO3 A;  2XBI A;  3ZVJ D;  4RI7 A;  3F0I A;  1LJR A;  2VM2 A;  3FR6 A;  1AQX A;  1K0N A;  3TJG A;  5JWO B;  2DIZ A;  2L5L A;  1U6T A;  4GLT A;  2VLT A;  3GSS A;  3TKS E;  2O85 A;  4G9H A;  1TXX A;  3WGX A;  4OFN A;  3L0H A;  3H8Q A;  3DD3 A;  4IGJ A;  4HOJ A;  5CRH A;  5H5R A;  3SBC A;  1OE7 A;  4HS1 A;  5ID2 B;  1GSF A;  1HNC A;  1AQW A;  3IR4 A;  4IJ3 A;  4N0V A;  2PVQ A;  1XPV A;  2K9F A;  2LTK A;  3CTG A;  2NVL A;  1YF1 A;  2VCZ A;  1X0R A;  4FYU A;  2YV9 A;  3EWL A;  2BMX A;  2LJR A;  3KD0 A;  1W89 A;  2JAD A;  3LXZ A;  1SJZ A;  2HZF A;  3TCO A;  4O5R A;  1GSE A;  1UVZ A;  3M9J A;  3HD5 A;  3HYP A;  3BD2 A;  1N8J A;  4IVF A;  4GSS A;  19GS A;  4KA0 A;  2LKU A;  2FWE A;  4BVY A;  3GUR A;  3IDV A;  2JSY A;  3ED3 A;  5EL8 A;  2CVD A;  3DEX A;  2JU5 A;  1WOU A;  5GZZ B;  1R4W A;  3TRQ A;  4ECC A;  1YEP A;  3IA1 A;  4HZ4 A;  2YJH A;  4OFM A;  1M2D A;  2TRX A;  4NPB A;  2H73 A;  4FH8 A;  1R26 A;  3HY2 A;  2MYG A;  1SYX A;  2K6V A;  3GH9 A;  1ZYE A;  2VD1 A;  3EU4 A;  2AYT A;  2LQO A;  2RLI A;  1PKZ A;  1G7E A;  1RK4 A;  3KP9 A;  5DCG A;  2RII A;  1GTU A;  3VUR A;  4MPF A;  3WT2 A;  4ECJ A;  3CSI A;  1O81 A;  3KTL A;  1B8X A;  3ZYW A;  5IPG A;  3Q19 A;  5H5S A;  2JAC A;  2F8F A;  5CRG A;  3DVX A;  2I81 A;  5A5K A;  2VOC A;  4PQH A;  5ECN B;  4ECI A;  3VPT A;  2GQM A;  1XW9 A;  3Q18 A;  4HU9 A;  3PIN A;  3UL3 A;  1ZYQ B;  3KEB A;  1PKW A;  5IQY A;  4LA1 A;  2DJK A;  2X64 A;  1GTB A;  3FY7 A;  2XPE A;  3WD6 A;  4XS1 A;  1FVK A;  4JBB A;  6GSV A;  1B4Q A;  3GN3 A;  2FA4 A;  1Z6N A;  3FW2 A;  1Z7P A;  5JCG A;  1TU7 A;  1GSY A;  1TI3 A;  3C7M A;  1OC3 A;  3GYK A;  4G19 A;  1AAZ A;  1THX A;  1TRV A;  3G7I A;  5D9W A;  3ME8 A;  3FZ9 A;  5DQS A;  1R5A A;  4ZB8 A;  3TRX A;  2H6Z A;  1FB6 A;  4MK3 A;  1B9X C;  2WZ9 A;  4TXO B;  1A24 A;  4FYB A;  2G2Q A;  1NHY A;  2K8S A;  2MMA A;  1BED A;  1F3B A;  2FLS A;  1M9B A;  1USB A;  4IP6 A;  4WBJ A;  2B6M A;  4NV5 A;  4ZBA A;  2CZ3 A;  2KP2 A;  2CX4 A;  2XPD A;  4OMV A;  4GSN A;  1XWA A;  3VFI A;  3FYG A;  2L6D A;  2WJU A;  2GLR A;  2B3S A;  1TP9 A;  2MBT A;  4EDY A;  2AJQ B;  1GTI A;  1PX6 A;  2VCQ A;  2AB6 A;  4JZQ A;  4TW5 A;  4WBR D;  4KAE A;  2ZUP A;  2LNT A;  1XIY A;  2H72 A;  5HQP A;  3VI7 A;  1O8X A;  1OAZ A;  3US3 A;  2VIM A;  6GSX A;  1QUW A;  1ZL9 A;  4K2D A;  2O89 A;  1GWC A;  1MDK A;  5DDL A;  5DVB A;  3VLN A;  4EF0 A;  3W6G A;  1EEJ A;  3GKX A;  4G10 A;  5HFI A;  3P8W A;  3ISO A;  1F6M C;  3IHQ A;  3P7X A;  1SL2 B;  4DSQ A;  2OBK A;  5J5N A;  4AF2 A;  2JZS A;  3F4T A;  3RPP A;  4LMW A;  1YKA A;  4IP1 A;  3ZIJ A;  5C00 A;  5DJL A;  2FGX A;  2GZZ A;  3FRC A;  2YV7 A;  2QSI A;  3D4M A;  3PGT A;  3CRU A;  3KGK A;  1WE0 A;  2YN1 A;  1MTC A;  4X0X A;  2HT9 A;  1WMJ A;  1XVW A;  3WGE A;  4P3Y B;  5ECH B;  1AQV A;  2RM5 A;  1EZK A;  3KMN A;  1S3A A;  2YNX A;  4QQ7 A;  2IJY A;  2DJ0 A;  1YKC A;  2O87 A;  2V1M A;  1K3Y A;  2B7K A;  1T00 A;  2TIR A;  3F6D A;  2C4J A;  4FO5 A;  5HR1 A;  4KH7 A;  5B8B A;  5ID2 A;  2LNS A;  4MH2 A;  1FB0 A;  5ECI B;  3UIW A;  3ZLP A;  1PGT A;  5JCW A;  3FK8 A;  1U3I A;  2GZP A;  1YQ1 A;  4XHM A;  2HRF A;  3M1G A;  2FHE A;  3D4T A;  2GQK A;  4AGS A;  4ECB A;  2X8C A;  5F0G A;  2EIO A;  3QPM A;  3HZ4 A;  4ZL9 A;  3LQ7 A;  5D9T A;  3HDC A;  1F37 A;  3BJ5 A;  5IM9 A;  4HZ2 A;  3AY8 A;  4O92 A;  4GQF A;  3L9V A;  4OWY A;  4HUA A;  4KND A;  3RAZ A;  1AW9 A;  3D21 A;  4TRX A;  1K0B A;  5CYY A;  2CX3 A;  3EMP A;  4RUV A;  3UBK A;  2V6K A;  4DSS A;  2B5Y A;  3LXT A;  4OCF A;  2AUV A;  2CAI A;  2QGV A;  1E2Y A;  3F3R A;  3FZ4 A;  4LLR A;  5IPH A;  2VM1 A;  1J08 A;  5F05 A;  1E6B A;  2HRN A;  4TR0 A;  2GZY A;  5J9C A;  5CP1 A;  3A5W A;  2N5F A;  3U5R E;  3GL3 A;  3WGD A;  2ALB A;  5GAP D;  1MD3 A;  2H6X A;  1SK1 A;  4OCE A;  3C73 A;  1T4Z A;  1X5C A;  4F0C A;  1OKT A;  1UC7 A;  5CAX A;  3KP8 A;  4TN8 A;  2H75 A;  4TXV A;  2H1A A;  3BOA A;  5G1L A;  3UEM A;  1TRW A;  3PR8 A;  4CHS A;  1PL2 A;  2HYX A;  2CV4 A;  1QK8 A;  1IYH A;  3QMX A;  4NHW A;  5CRD A;  2H1D A;  3GKK A;  3JCM L;  2IIY A;  3WYW A;  1V58 A;  1YEX A;  5ENU A;  1UN2 A;  8GSS A;  1S3C A;  1XVQ A;  3TKS A;  17GS A;  2QKE A;  2I1U A;  3J7Y k;  6GSS A;  2N5A A;  2HFD A;  2H71 A;  1JFU A;  4WF5 A;  1SEN A;  1THO A;  3UMA A;  2OE0 A;  1R7H A;  1YZX A;  3RBT A;  4MCU A;  3GRX A;  1M99 A;  5E4W A;  5A4U A;  2IMI A;  3LJR A;  4TXO A;  4ZB9 A;  1O8W A;  4V2L A;  4YH2 A;  2YAN A;  1OC9 B;  4ZBB A;  4LL1 B;  1BX9 A;  4ZB6 A;  4RQX A;  4IW9 A;  4PUR A;  2OA7 A;  1WRY A;  3ZVJ A;  5IMF A;  3F63 A;  5AIS A;  3J7Y b;  4WR4 A;  4LMV A;  4ZL7 A;  1M9A A;  2H76 A;  6GSU A;  4TOP A;  3KXO A;  2VL2 A;  3CXG A;  4PUA A;  2GT6 A;  4X43 A;  2R4V A;  3F6F A;  1A2L A;  5LCZ A;  3DIE A;  2L57 A;  3CBU A;  2X99 A;  2G0F A;  3EUR A;  4V2N A;  2AV4 A;  4WKW A;  3RHB A;  2CVB A;  2OE1 A;  3IOS A;  1EWX A;  4F82 A;  1GNW A;  1X9M B;  2I4A A;  2L4Q A;  2GDR A;  2HE3 A;  3FZA A;  4ACS A;  3P90 A;  3W8J A;  3TOT A;  4JR4 A;  1XOB A;  4MJE A;  3HA9 A;  22GS A;  2FA8 A;  2J9H A;  4GCI A;  1GSQ A;  4I2T A;  4N11 A;  3GIX A;  2KLX A;  4YQM A;  4K8M A;  2DIY A;  3DWV A;  4ILF A;  1KBN A;  3M0F A;  2L59 A;  4BWQ A;  5D93 A;  1U3A A;  3GNJ A;  3HVV A;  3DYR A;  1ERV A;  1GSU A;  3GFK A;  1K3O A;  3IAS 2;  2NTO A; 
#chains in the Genus database with same CATH topology
 5HFG A;  1WPI A;  5D96 A;  4DEJ A;  3IRA A;  2IFQ B;  1ON4 A;  1TRU A;  2VCW A;  2VLV A;  4MJB A;  4GWR A;  3VWV A;  1PD2 1;  2CZ2 A;  4MAB A;  4DSS B;  2P5R A;  1A0R P;  4USS A;  2PN8 A;  2GSQ A;  3I43 A;  2LST A;  2C3T A;  2F8A A;  3DML A;  3GMF A;  4ML6 A;  1K0D A;  3F9U A;  4BA7 A;  3KCM A;  3UOM A;  1TJD A;  2H66 A;  2P31 A;  1EP8 A;  3LW9 A;  5HFK A;  2TRC P;  2E7P A;  3HJO A;  3HJM A;  2DMM A;  4AJ6 A;  4KW6 A;  3HHV A;  4MJA A;  4V1A p;  2LJK A;  1GTA A;  1X5E A;  1XWK A;  4ID0 A;  2KP1 A;  3LGC A;  1QXH A;  4JE1 A;  4PQ1 A;  1Z9H A;  5DAL B;  5DQY A;  2ON7 A;  5FT3 A;  1SL1 B;  1ABA A;  1TK5 B;  1SD8 A;  4HJ2 A;  5EY6 A;  2ZCT A;  5JCU A;  3C8E A;  3W8S A;  4MH3 A;  2P0G A;  4GXZ A;  5ECP B;  5G2Z A;  4GQC A;  6GSW A;  3DVW A;  5BRT A;  3LWA A;  5AN1 A;  1HNB A;  4YAP A;  1FOV A;  2EC4 A;  2C3Q A;  3KMO A;  3ZMK A;  3RDW A;  2FCH A;  4WF4 A;  1FW1 A;  2HZE B;  2LRT A;  2E0Q A;  3KH7 A;  2C8U A;  1S3D A;  3KM6 A;  3GH6 A;  2VCT A;  2VO4 A;  2JL4 A;  1Z3E A;  2LJA A;  3TOU A;  1OKD A;  1XWB A;  4V2M A;  4IS0 A;  2V32 A;  4GST A;  1QFN A;  2K18 A;  3ZIT A;  5IOX A;  5IO2 A;  3U6V A;  1SYR A;  2REM A;  1O85 A;  1WP0 A;  5JWQ B;  1U88 A;  2IN3 A;  4OD7 A;  1F2E A;  1M0U A;  4XTS A;  2KOK A;  5HR3 A;  5F07 A;  4WR5 A;  4K6X A;  1A2J A;  1PN0 A;  1K0C A;  3KTB A;  2MMN A;  4Q5Q A;  5KOX A;  2IL3 A;  3TKS C;  3EIN A;  1EV9 A;  5B7C A;  3ZRD A;  1WJK A;  3BBY A;  2DJ2 A;  3HKR A;  1G7O A;  1XW5 A;  5E59 A;  4ZXG A;  3V1W A;  12GS A;  3I9V 2;  2EIQ A;  2NBS A;  1ZGN A;  5G1K A;  3ZZX A;  1HD2 A;  1SD9 A;  1Z5Y E;  2GVP A;  2IMK A;  3VPQ A;  3FHK A;  2B5E A;  2IMD A;  1EV4 A;  3F3Q A;  4NWY A;  4ZIL A;  2B1L A;  1ZMA A;  1KNG A;  1T3B A;  2YOI A;  4X4J A;  4MJC A;  5ECL B;  3CYN A;  2H01 A;  5GSS A;  1JHB A;  3TJK A;  2A2S A;  5B6N A;  2HSH A;  3TKP A;  2F51 A;  1VF3 A;  2YWN A;  4YAV A;  2JSZ A;  2PGT A;  4PXO A;  2FY6 A;  1C72 A;  3H93 A;  3E3E A;  1ILO A;  3APS A;  1TW9 A;  4ULX A;  2WFC A;  2NPB A;  4ZIJ A;  1NW2 A;  2V6O A;  4IBP A;  16GS A;  4FYC A;  1TKD B;  2VAF A;  2HI7 A;  4K5R A;  2FNO A;  2IME A;  1G6Y A;  1F9M A;  2YWI A;  1OC9 A;  4F9Z A;  2F3M A;  3F4R A;  2LRN A;  3ZFL A;  3Q74 A;  3UVH A;  5D8I A;  5IMZ A;  2DC5 A;  2LEG A;  2KHP A;  4NHZ A;  2QC7 A;  3A2V A;  10GS A;  5G30 A;  2WUL A;  4ICY A;  1A2M A;  4AJ8 A;  3O6T A;  3TDG A;  4GTU A;  1EGR A;  2PPT A;  4AJ7 A;  1LU4 A;  1QQ2 A;  3HXS A;  3F8U A;  1VF2 A;  4PX1 A;  4IKH A;  2B1K A;  5IO0 A;  3EU3 A;  1SL0 B;  2I3Y A;  4EUY A;  3FKF A;  2GTU A;  5J41 A;  3IPZ A;  3UAR A;  2KUC A;  3QAW A;  1OE8 A;  1T8E B;  1BAY A;  1RQM A;  4BWS A;  1ZCP A;  5LNK e;  1TU8 A;  1XWC A;  3DXB A;  3NIV A;  5ABR A;  3TKR A;  4OO5 A;  4Z2T A;  1ML6 A;  1TK0 B;  1Y25 A;  3FMW A;  3L9S A;  2E2M A;  1ERU A;  5H5Q A;  4KCA A;  1FOH A;  11GS A;  1XWG A;  2MBS A;  4Z2U A;  5KN1 A;  4D73 A;  4L0W A;  4XIH A;  4KUN A;  1TOF A;  2MMO A;  2YPM A;  3G7J A;  4K0N A;  4F03 A;  1Z7R A;  5DAK B;  2BJX A;  1NSW A;  3LFL A;  3G7Y A;  1ZZY A;  3N5O A;  4LL4 B;  1H4O A;  2C80 A;  2IFQ A;  4JED A;  2R3X A;  1K3L A;  4MF5 A;  1AIU A;  4I97 A;  1O6J A;  4EDZ A;  1G0T A;  2D2Z A;  2X8H A;  1JZO A;  3DGQ A;  2P5Q A;  3L78 A;  2H19 A;  1SJ6 A;  3GKM A;  5KEJ A;  1SKS B;  4OO4 A;  2DLX A;  1G6W A;  2GT5 A;  5IOW A;  4H86 A;  3LSZ A;  3LOR A;  1TDI A;  1X9W B;  1XZO A;  1PQN A;  2GST A;  2WCI A;  4E8E A;  2H0H A;  2VCX A;  5KN3 A;  4L0U A;  4XS4 B;  4WEY A;  5G31 A;  3CSJ A;  3RPN A;  1B9Y C;  1VGL A;  3CRT A;  4NV2 A;  1GUH A;  1NM3 A;  3HZ8 A;  1KEB A;  4TR4 A;  4POK A;  4KX4 A;  4BL7 B;  3LYK A;  5DAL A;  4F0B A;  3QFA C;  4ISD A;  1MEK A;  3ZML A;  1A23 A;  4ZL8 A;  1XCC A;  1VRS D;  2R6K A;  5ECM B;  4KB3 A;  3OR5 A;  4PQI A;  5KN2 A;  2UZ8 A;  2FWF A;  4EKZ A;  1QGV A;  4XRD A;  4G0L A;  4G2E A;  3EVI A;  2PMT A;  3GTU B;  4KCE A;  4K0G A;  4JR6 A;  3D6I A;  2H0I A;  1O73 A;  4G0I A;  2H1B A;  2HSM A;  1ST9 A;  2HRK A;  1EGO A;  2HZE A;  3O76 A;  3WT1 A;  1ERT A;  2HSY A;  2PER A;  2M80 A;  2DJJ A;  2CQ9 A;  4I2U A;  2WDU A;  3M8N A;  2YJ7 A;  3MNG A;  3C1S A;  3FEU A;  3GX8 A;  3HVX A;  1BYE A;  4FIW A;  3E0U A;  3I69 A;  2GQL A;  1ZYP A;  3DRN A;  3ZTL A;  2R2J A;  1HQO A;  4K7O A;  1GRX A;  4O5U A;  4O5Q A;  1AUC A;  3ZIV A;  1DE2 A;  1XFL A;  2CVK A;  4MA9 A;  3QAG A;  2LUS A;  3PH9 A;  3QAV A;  4Q5R A;  1PN9 A;  4EVM A;  4NMU A;  1BJX A;  3GKN A;  2FUG 2;  2H70 A;  3QCP A;  3GST A;  3KZQ A;  2BTO T;  1FVJ A;  2OAD A;  2GSR A;  4MPG A;  4EXJ A;  2MMZ A;  4Q5N A;  2VCV A;  4BIK A;  2VL9 A;  3APQ A;  1HYU A;  2CA8 A;  1VF1 A;  2H6Y A;  4TR1 B;  5B6M A;  4HSC X;  1ZOF A;  1T1V A;  4DSR A;  1EOG A;  2Z9S A;  2YWM A;  3UVT A;  4O32 A;  1A0F A;  3VWU A;  1O7U A;  3GX0 A;  3EMX A;  2QA2 A;  1A8L A;  2A4H A;  1X9S B;  5ECO B;  2DML A;  4MP4 A;  3CSH A;  4D73 B;  4MLY A;  1TTZ A;  2FWH A;  4ML1 A;  1PL1 A;  3FZ5 A;  2L4C A;  2L5O A;  2GGT A;  1MD4 A;  4KSO A;  4F2I A;  4KSM A;  1QMV A;  1BG5 A;  3H4K A;  4IHU A;  5D9V A;  2H74 A;  3MIX A;  1ERW A;  2RUE A;  2FD3 A;  2HNL A;  3D5J A;  2VD0 A;  1M7T A;  5DJM A;  3R3E A;  4K9Z A;  2A4V A;  3ZRE A;  2YZU A;  3TGZ A;  2GSS A;  3KIJ A;  2O8V B;  4I5Q A;  1V9W A;  4KF9 A;  1TI1 A;  4POM A;  2CT6 A;  5KOW A;  3GHA A;  5ECS A;  1PRX A;  2M46 A;  4HDE A;  4HI7 A;  3PPU A;  1DSB A;  1X5D A;  5J4U A;  3UAP A;  4BVX B;  4CDO A;  3G9B A;  4KDY A;  4J56 E;  1T4Y A;  2JZT A;  3C1R A;  3GV1 A;  1UA5 A;  4MZB A;  3SWL A;  4EC0 A;  1VF4 A;  4KGI A;  2XHF A;  3CTF A;  4K7N A;  2DSA A;  2MZC A;  3FR3 A;  3FR9 A;  3A3T A;  3GL5 A;  4HU7 A;  1FAA A;  4J57 E;  2CAQ A;  14GS A;  3IK7 A;  2X8G A;  4N10 A;  4QL7 A;  2RM6 A;  3NOF A;  2VL3 A;  4Q5F A;  3TJB A;  5DAK A;  2DJ3 A;  4IQ1 A;  2C0G A;  6GST A;  3CQF A;  2V41 A;  4EE0 A;  1AXD A;  4PUF C;  3TJJ A;  4MZC A;  1SK2 A;  5FWG A;  5IMA A;  3QR6 A;  2M72 A;  1R5P A;  1OVN A;  5CRW A;  4EIQ A;  2WS2 A;  4A5P A;  1MDJ A;  1GSS A;  3UBL A;  4QL9 A;  1I9D A;  3E9J B;  5INY A;  3IAM 2;  5HR2 A;  4HQS A;  2DBC A;  5AGY A;  3ERW A;  3F4S A;  4PGT A;  5D9X A;  1W4V A;  7GSS A;  1SKR B;  5IMV A;  5ELA A;  4V1A g;  3A2X A;  5B8A A;  1Q98 A;  3TJF A;  1GUM A;  4XS4 A;  4TR3 A;  1EP7 A;  2HXK A;  5L71 A;  1I5G A;  3HVS A;  4G0K A;  3LYP A;  4HJM A;  2B7J A;  3IC8 A;  3TKQ A;  1YY7 A;  5AIX A;  5ECR B;  4BL7 A;  3NZN A;  1GSD A;  5DBQ A;  2L6C A;  2I9H A;  4NAX A;  5COH A;  1EOH A;  4YQV A;  4WXT A;  2H1G A;  2YWO A;  3EC3 A;  4MDC A;  3IC4 A;  5F8B A;  2IPA A;  1K0A A;  2J23 A;  4XCS A;  3R2Q A;  3H1N A;  3GTU A;  3ZL5 A;  1SJI A;  3BCI A;  3IXR A;  4BPY A;  2DKH A;  2F9S A;  1JLV A;  2GS3 A;  3ERG A;  2VLU A;  1GH2 A;  4CW9 A;  4YKF A;  3HCZ A;  1JLW A;  1RW1 A;  3S9F A;  3N9J A;  5IMD A;  2OBI A;  3APO A;  2C0F A;  1YJ6 A;  1HNA A;  4X1U A;  4MMM A;  1XBS A;  5JWR B;  5CO3 A;  2HLS A;  1CQH A;  4YKG A;  2N5B A;  1CQG A;  1Y6E A;  2E2G A;  1S3R A;  5J3R A;  6GSY A;  2OAC A;  4K2X A;  4ZBD A;  1M3I A;  5GST A;  5ECK B;  1M2A A;  2NDO A;  3ME7 A;  4CY8 A;  4NXI A;  3DKS A;  2VL2 C;  3VK9 A;  2B5X A;  4DVC A;  2K8V A;  2A2R A;  2R37 A;  4L8E A;  3C71 A;  2OJL A;  3RHC A;  2C3N A;  5J9B A;  4RI6 A;  3HVN A;  2DJ1 A;  2WB9 A;  3QD9 A;  2ON5 A;  2AHE A;  2A2P A;  4WET A;  5FHI A;  5CRE A;  4EL1 A;  2YCD A;  2XC2 A;  5F06 A;  1GUL A;  4O7H A;  4KDU A;  4K1F A;  4I8B A;  3QDN A;  4J2F A;  4BVY B;  4Z7X A;  5KN0 A;  4N30 A;  3VWX A;  1YF0 A;  3D22 A;  2HRA A;  1FO5 A;  2C0E A;  3LEF A;  4TR1 A;  1NHO A;  1WWJ A;  1GNE A;  2ES7 A;  5ELG A;  1OC8 A;  2H8L A;  1A8Y A;  4CY6 A;  3TUE A;  4JU5 A;  3QFB C;  4L5L A;  1JZD A;  1GLQ A;  4IQA A;  1TK8 B;  2H30 A;  3MAK A;  2LRC A;  1Q4J A;  3GUS A;  2AAW A;  1AC1 A;  3K8N A;  4POL A;  2RUF A;  3IK9 A;  2JZR A;  1N2A A;  1PX7 A;  3L4N A;  4L5O A;  5CNW A;  1OYJ A;  2H0G A;  2VUP A;  2R5G A;  4I6X A;  2QA1 A;  5A4V A;  5HR0 A;  4K7I A;  1Z6M A;  2LS5 A;  4XS6 A;  3M3M A;  1BQ7 A;  2ZNM A;  5G5F A;  4N0Z A;  1K0M A;  2LV3 A;  2PVO C;  2EIR A;  2PWJ A;  1H75 A;  3H79 A;  2O7K A;  1J9B A;  4BVX A;  1YDK A;  18GS A;  3GA4 A;  4POB A;  3VI5 A;  1SU9 A;  1DBY A;  1MDI A;  3Q6O A;  1V2A A;  1GL8 A;  2PBJ A;  4Z2R A;  1KTE A;  3A2W A;  4HQZ A;  5EPF A;  1XW6 A;  1V40 A;  1V57 A;  2YZH A;  1GLP A;  3D0Z A;  3CMI A;  5IMC A;  1T7P B;  1SKW B;  5A4W A;  3QOU A;  4PNG A;  1V98 A;  1DE1 A;  1B48 A;  3KJY A;  4MZW A;  3ZFB A;  2WRT A;  3IBH A;  3EYT A;  5DCH A;  3M9K A;  4JRR A;  2OKA A;  5D73 A;  1U87 A;  1TRS A;  2WGR A;  3TB2 A;  5EVO A;  3VWW A;  4IEL A;  3HJP A;  3EE2 A;  3ERF A;  5LD0 A;  2YP6 A;  1F3A A;  4RQR A;  4KE3 A;  2PU9 C;  1ACV A;  2FWG A;  4MF7 A;  1GP1 A;  13GS A;  1PMT A;  1K0O A;  3MWH A;  1GUK A;  2C0D A;  3MDK A;  1FG4 A;  4IN0 A;  5GAN D;  1M2B A;  1B4P A;  4KDX A;  2OE3 A;  4OFT A;  3BCK A;  2V2G A;  1XXU A;  4E8H A;  3L9U A;  4HEA 2;  1XOA A;  1PA3 A;  2C1Y A;  1URM A;  3I6A A;  1JZR A;  4GRF A;  1ZYN A;  1SK0 A;  4TVE A;  2IWT A;  4IJI A;  1PSQ A;  1WIK A;  4YQU A;  1LBK A;  9GSS A;  3IE3 A;  1FHE A;  2XBQ A;  3IV4 A;  3MSZ A;  5ECQ B;  3LG6 A;  1EEM A;  2PUK C;  2LQQ A;  1JZW A;  3P2A A;  4XRA A;  5C04 A;  3TRP A;  4PNF A;  5AIV A;  1DUG A;  4GF0 A;  3UJ1 A;  1IYI A;  2IMF A;  3O3T A;  4TKY A;  3KH9 A;  4MF6 A;  20GS A;  5G5E A;  5IIZ A;  1J0F A;  4EO3 A;  2XBI A;  3ZVJ D;  4RI7 A;  2DKI A;  3F0I A;  4K5S A;  1LJR A;  2VM2 A;  3FR6 A;  1AQX A;  1K0N A;  3TJG A;  2X49 A;  5JWO B;  2DIZ A;  2L5L A;  1U6T A;  4GLT A;  2VLT A;  3GSS A;  3TKS E;  2O85 A;  4G9H A;  1TXX A;  3WGX A;  4OFN A;  3L0H A;  4MNN A;  3H8Q A;  3DD3 A;  4IGJ A;  4HOJ A;  5CRH A;  5H5R A;  3SBC A;  1OE7 A;  4HS1 A;  5ID2 B;  1GSF A;  1HNC A;  1AQW A;  3IR4 A;  4IJ3 A;  4N0V A;  2PVQ A;  1XPV A;  2K9F A;  2LTK A;  3CTG A;  2NVL A;  1YF1 A;  2VCZ A;  1X0R A;  4FYU A;  2YV9 A;  3EWL A;  2BMX A;  2LJR A;  3KD0 A;  1W89 A;  2JAD A;  3LXZ A;  1SJZ A;  2HZF A;  3TCO A;  4O5R A;  1GSE A;  1UVZ A;  3M9J A;  3HD5 A;  3HYP A;  3BD2 A;  1N8J A;  4IVF A;  4GSS A;  19GS A;  4KA0 A;  2LKU A;  2FWE A;  4BVY A;  3GUR A;  3IDV A;  2JSY A;  3ED3 A;  5EL8 A;  2CVD A;  3DEX A;  2JU5 A;  1WOU A;  5GZZ B;  1R4W A;  3TRQ A;  4ECC A;  1YEP A;  3IA1 A;  4HZ4 A;  2YJH A;  4OFM A;  1M2D A;  2TRX A;  4NPB A;  2H73 A;  4FH8 A;  1R26 A;  3HY2 A;  2MYG A;  1SYX A;  2K6V A;  3GH9 A;  1ZYE A;  2VD1 A;  3EU4 A;  2AYT A;  2LQO A;  2RLI A;  1PKZ A;  1G7E A;  1RK4 A;  3KP9 A;  5DCG A;  2RII A;  1GTU A;  3VUR A;  4MPF A;  3WT2 A;  4ECJ A;  3CSI A;  1O81 A;  3KTL A;  1B8X A;  3ZYW A;  5IPG A;  3Q19 A;  5H5S A;  2JAC A;  2F8F A;  5CRG A;  3DVX A;  2I81 A;  5A5K A;  2VOC A;  4PQH A;  5ECN B;  4ECI A;  3VPT A;  2GQM A;  1XW9 A;  3Q18 A;  4HU9 A;  3PIN A;  3UL3 A;  1ZYQ B;  1PFO A;  3KEB A;  4PTS A;  1PKW A;  5IQY A;  4LA1 A;  2DJK A;  2X64 A;  1GTB A;  3FY7 A;  2XPE A;  3WD6 A;  4XS1 A;  1FVK A;  4JBB A;  6GSV A;  1B4Q A;  3GN3 A;  2FA4 A;  1Z6N A;  3FW2 A;  1Z7P A;  5JCG A;  1TU7 A;  1GSY A;  1TI3 A;  3C7M A;  1OC3 A;  3GYK A;  4G19 A;  1AAZ A;  1THX A;  1TRV A;  3G7I A;  5D9W A;  3ME8 A;  3IHG A;  3FZ9 A;  5DQS A;  1R5A A;  4ZB8 A;  3TRX A;  2H6Z A;  1FB6 A;  4MK3 A;  1B9X C;  2WZ9 A;  4TXO B;  1A24 A;  4FYB A;  2G2Q A;  1NHY A;  2K8S A;  2X4A A;  2MMA A;  1BED A;  1F3B A;  2FLS A;  1M9B A;  1USB A;  4IP6 A;  4WBJ A;  2B6M A;  4NV5 A;  4ZBA A;  2CZ3 A;  2KP2 A;  2CX4 A;  2XPD A;  4OMV A;  4GSN A;  1XWA A;  3VFI A;  3FYG A;  2L6D A;  2WJU A;  2GLR A;  2B3S A;  1TP9 A;  4EIP A;  2MBT A;  4EDY A;  5BMU A;  2AJQ B;  1GTI A;  1PX6 A;  2VCQ A;  2AB6 A;  4JZQ A;  4TW5 A;  4WBR D;  4KAE A;  2ZUP A;  2LNT A;  1XIY A;  2H72 A;  5HQP A;  3VI7 A;  1O8X A;  1OAZ A;  1XG8 A;  3US3 A;  2VIM A;  6GSX A;  1QUW A;  1ZL9 A;  4K2D A;  2O89 A;  1GWC A;  1MDK A;  5DDL A;  5DVB A;  3VLN A;  4EF0 A;  3W6G A;  1EEJ A;  3GKX A;  4G10 A;  5HFI A;  3P8W A;  3ISO A;  1F6M C;  3IHQ A;  3P7X A;  1SL2 B;  4DSQ A;  2OBK A;  5J5N A;  4AF2 A;  2JZS A;  3F4T A;  3RPP A;  4LMW A;  1YKA A;  4IP1 A;  3ZIJ A;  5C00 A;  5DJL A;  2FGX A;  3MYD A;  2GZZ A;  3FRC A;  2YV7 A;  2QSI A;  3D4M A;  3PGT A;  3CRU A;  3KGK A;  1WE0 A;  2YN1 A;  1MTC A;  4X0X A;  2HT9 A;  1WMJ A;  1XVW A;  3WGE A;  4P3Y B;  5ECH B;  1AQV A;  2RM5 A;  1EZK A;  3KMN A;  1S3A A;  2YNX A;  4QQ7 A;  2IJY A;  2DJ0 A;  1YKC A;  2O87 A;  2V1M A;  1K3Y A;  2B7K A;  1T00 A;  2TIR A;  3F6D A;  2C4J A;  4FO5 A;  5HR1 A;  4KH7 A;  5B8B A;  2R0G A;  5ID2 A;  2LNS A;  1M3J A;  4MH2 A;  1FB0 A;  5ECI B;  2R0P A;  3UIW A;  3ZLP A;  1PGT A;  5JCW A;  3FK8 A;  3A5I A;  1U3I A;  2GZP A;  1YQ1 A;  4XHM A;  2HRF A;  3M1G A;  2FHE A;  3D4T A;  2GQK A;  4AGS A;  4ECB A;  2X8C A;  5F0G A;  2EIO A;  3EPT A;  3QPM A;  3HZ4 A;  4ZL9 A;  3LQ7 A;  5D9T A;  3HDC A;  1F37 A;  3BJ5 A;  5IM9 A;  4HZ2 A;  3AY8 A;  4O92 A;  4GQF A;  3L9V A;  4OWY A;  4HUA A;  4KND A;  3RAZ A;  1AW9 A;  3D21 A;  4TRX A;  1K0B A;  5CYY A;  2CX3 A;  3EMP A;  4RUV A;  3UBK A;  2V6K A;  4DSS A;  2B5Y A;  3LXT A;  4OCF A;  2AUV A;  2CAI A;  2QGV A;  1E2Y A;  3F3R A;  3FZ4 A;  4LLR A;  5IPH A;  2VM1 A;  1J08 A;  5F05 A;  1E6B A;  2HRN A;  4TR0 A;  2GZY A;  5J9C A;  5CP1 A;  3A5W A;  2N5F A;  3U5R E;  3GL3 A;  3WGD A;  2ALB A;  5GAP D;  1MD3 A;  2H6X A;  1SK1 A;  4OCE A;  3C73 A;  1T4Z A;  1X5C A;  4F0C A;  1OKT A;  1UC7 A;  5CAX A;  3KP8 A;  4TN8 A;  2H75 A;  4TXV A;  2H1A A;  3BOA A;  5G1L A;  3UEM A;  1TRW A;  3PR8 A;  4CHS A;  1PL2 A;  2HYX A;  2CV4 A;  1QK8 A;  1IYH A;  3QMX A;  4NHW A;  5CRD A;  2H1D A;  3GKK A;  3JCM L;  2IIY A;  3WYW A;  1V58 A;  1YEX A;  5ENU A;  1UN2 A;  8GSS A;  1S3C A;  1XVQ A;  3TKS A;  17GS A;  2QKE A;  2I1U A;  3J7Y k;  6GSS A;  2N5A A;  2HFD A;  2H71 A;  1JFU A;  4WF5 A;  1SEN A;  1THO A;  3UMA A;  2OE0 A;  1R7H A;  1YZX A;  3RBT A;  4MCU A;  3GRX A;  1M99 A;  5E4W A;  5A4U A;  2IMI A;  3LJR A;  4TXO A;  4ZB9 A;  1O8W A;  4V2L A;  4YH2 A;  2YAN A;  1OC9 B;  4ZBB A;  4LL1 B;  1BX9 A;  4ZB6 A;  4RQX A;  4IW9 A;  4PUR A;  2OA7 A;  1WRY A;  3ZVJ A;  5IMF A;  3F63 A;  2R0C A;  5AIS A;  3J7Y b;  4WR4 A;  4LMV A;  4ZL7 A;  1M9A A;  2H76 A;  6GSU A;  4TOP A;  3KXO A;  2VL2 A;  3CXG A;  4PUA A;  2GT6 A;  4X43 A;  2R4V A;  3F6F A;  1A2L A;  5LCZ A;  3DIE A;  2L57 A;  3CBU A;  2X99 A;  2G0F A;  3EUR A;  4FQU A;  4V2N A;  2AV4 A;  4WKW A;  3RHB A;  2CVB A;  2OE1 A;  3IOS A;  1EWX A;  4F82 A;  1GNW A;  1X9M B;  2I4A A;  2L4Q A;  2GDR A;  2HE3 A;  3FZA A;  4ACS A;  3P90 A;  3W8J A;  3TOT A;  4JR4 A;  1XOB A;  4MJE A;  3HA9 A;  22GS A;  2FA8 A;  2J9H A;  4GCI A;  1GSQ A;  4I2T A;  4N11 A;  3GIX A;  2KLX A;  4YQM A;  4K8M A;  2DIY A;  3DWV A;  4ILF A;  1KBN A;  3M0F A;  2L59 A;  4BWQ A;  5D93 A;  1U3A A;  3GNJ A;  3HVV A;  3DYR A;  1ERV A;  1GSU A;  3GFK A;  1K3O A;  3IAS 2;  2NTO A; 
#chains in the Genus database with same CATH homology
 5HFG A;  1WPI A;  5D96 A;  4DEJ A;  3IRA A;  2IFQ B;  1ON4 A;  1TRU A;  2VCW A;  2VLV A;  4MJB A;  4GWR A;  3VWV A;  1PD2 1;  2CZ2 A;  4MAB A;  4DSS B;  2P5R A;  1A0R P;  4USS A;  2PN8 A;  2GSQ A;  3I43 A;  2LST A;  2C3T A;  2F8A A;  3DML A;  3GMF A;  4ML6 A;  1K0D A;  3F9U A;  4BA7 A;  3KCM A;  3UOM A;  1TJD A;  2H66 A;  2P31 A;  1EP8 A;  3LW9 A;  5HFK A;  2TRC P;  2E7P A;  3HJO A;  3HJM A;  2DMM A;  4AJ6 A;  4KW6 A;  3HHV A;  4MJA A;  4V1A p;  2LJK A;  1GTA A;  1X5E A;  1XWK A;  4ID0 A;  2KP1 A;  3LGC A;  1QXH A;  4JE1 A;  4PQ1 A;  1Z9H A;  5DAL B;  5DQY A;  2ON7 A;  5FT3 A;  1SL1 B;  1ABA A;  1TK5 B;  1SD8 A;  4HJ2 A;  5EY6 A;  2ZCT A;  5JCU A;  3C8E A;  3W8S A;  4MH3 A;  2P0G A;  4GXZ A;  5ECP B;  5G2Z A;  4GQC A;  6GSW A;  3DVW A;  5BRT A;  3LWA A;  5AN1 A;  1HNB A;  4YAP A;  1FOV A;  2EC4 A;  2C3Q A;  3KMO A;  3ZMK A;  3RDW A;  2FCH A;  4WF4 A;  1FW1 A;  2HZE B;  2LRT A;  2E0Q A;  3KH7 A;  2C8U A;  1S3D A;  3KM6 A;  3GH6 A;  2VCT A;  2VO4 A;  2JL4 A;  1Z3E A;  2LJA A;  3TOU A;  1OKD A;  1XWB A;  4V2M A;  4IS0 A;  2V32 A;  4GST A;  1QFN A;  2K18 A;  3ZIT A;  5IOX A;  5IO2 A;  3U6V A;  1SYR A;  2REM A;  1O85 A;  1WP0 A;  5JWQ B;  1U88 A;  2IN3 A;  4OD7 A;  1F2E A;  1M0U A;  4XTS A;  2KOK A;  5HR3 A;  5F07 A;  4WR5 A;  4K6X A;  1A2J A;  1PN0 A;  1K0C A;  3KTB A;  2MMN A;  4Q5Q A;  5KOX A;  2IL3 A;  3TKS C;  3EIN A;  1EV9 A;  5B7C A;  3ZRD A;  1WJK A;  3BBY A;  2DJ2 A;  3HKR A;  1G7O A;  1XW5 A;  5E59 A;  4ZXG A;  3V1W A;  12GS A;  3I9V 2;  2EIQ A;  2NBS A;  1ZGN A;  5G1K A;  3ZZX A;  1HD2 A;  1SD9 A;  1Z5Y E;  2GVP A;  2IMK A;  3VPQ A;  3FHK A;  2B5E A;  2IMD A;  1EV4 A;  3F3Q A;  4NWY A;  4ZIL A;  2B1L A;  1ZMA A;  1KNG A;  1T3B A;  2YOI A;  4X4J A;  4MJC A;  5ECL B;  3CYN A;  2H01 A;  5GSS A;  1JHB A;  3TJK A;  2A2S A;  5B6N A;  2HSH A;  3TKP A;  2F51 A;  1VF3 A;  2YWN A;  4YAV A;  2JSZ A;  2PGT A;  4PXO A;  2FY6 A;  1C72 A;  3H93 A;  3E3E A;  1ILO A;  3APS A;  1TW9 A;  4ULX A;  2WFC A;  2NPB A;  4ZIJ A;  1NW2 A;  2V6O A;  4IBP A;  16GS A;  4FYC A;  1TKD B;  2VAF A;  2HI7 A;  4K5R A;  2FNO A;  2IME A;  1G6Y A;  1F9M A;  2YWI A;  1OC9 A;  4F9Z A;  2F3M A;  3F4R A;  2LRN A;  3ZFL A;  3Q74 A;  3UVH A;  5D8I A;  5IMZ A;  2DC5 A;  2LEG A;  2KHP A;  4NHZ A;  2QC7 A;  3A2V A;  10GS A;  5G30 A;  2WUL A;  4ICY A;  1A2M A;  4AJ8 A;  3O6T A;  3TDG A;  4GTU A;  1EGR A;  2PPT A;  4AJ7 A;  1LU4 A;  1QQ2 A;  3HXS A;  3F8U A;  1VF2 A;  4PX1 A;  4IKH A;  2B1K A;  5IO0 A;  3EU3 A;  1SL0 B;  2I3Y A;  4EUY A;  3FKF A;  2GTU A;  5J41 A;  3IPZ A;  3UAR A;  2KUC A;  3QAW A;  1OE8 A;  1T8E B;  1BAY A;  1RQM A;  4BWS A;  1ZCP A;  5LNK e;  1TU8 A;  1XWC A;  3DXB A;  3NIV A;  5ABR A;  3TKR A;  4OO5 A;  4Z2T A;  1ML6 A;  1TK0 B;  1Y25 A;  3FMW A;  3L9S A;  2E2M A;  1ERU A;  5H5Q A;  4KCA A;  1FOH A;  11GS A;  1XWG A;  2MBS A;  4Z2U A;  5KN1 A;  4D73 A;  4L0W A;  4XIH A;  4KUN A;  1TOF A;  2MMO A;  2YPM A;  3G7J A;  4K0N A;  4F03 A;  1Z7R A;  5DAK B;  2BJX A;  1NSW A;  3LFL A;  3G7Y A;  1ZZY A;  3N5O A;  4LL4 B;  1H4O A;  2C80 A;  2IFQ A;  4JED A;  2R3X A;  1K3L A;  4MF5 A;  1AIU A;  4I97 A;  1O6J A;  4EDZ A;  1G0T A;  2D2Z A;  2X8H A;  1JZO A;  3DGQ A;  2P5Q A;  3L78 A;  2H19 A;  1SJ6 A;  3GKM A;  5KEJ A;  1SKS B;  4OO4 A;  2DLX A;  1G6W A;  2GT5 A;  5IOW A;  4H86 A;  3LSZ A;  3LOR A;  1TDI A;  1X9W B;  1XZO A;  1PQN A;  2GST A;  2WCI A;  4E8E A;  2H0H A;  2VCX A;  5KN3 A;  4L0U A;  4XS4 B;  4WEY A;  5G31 A;  3CSJ A;  3RPN A;  1B9Y C;  1VGL A;  3CRT A;  4NV2 A;  1GUH A;  1NM3 A;  3HZ8 A;  1KEB A;  4TR4 A;  4POK A;  4KX4 A;  4BL7 B;  3LYK A;  5DAL A;  4F0B A;  3QFA C;  4ISD A;  1MEK A;  3ZML A;  1A23 A;  4ZL8 A;  1XCC A;  1VRS D;  2R6K A;  5ECM B;  4KB3 A;  3OR5 A;  4PQI A;  5KN2 A;  2UZ8 A;  2FWF A;  4EKZ A;  1QGV A;  4XRD A;  4G0L A;  4G2E A;  3EVI A;  2PMT A;  3GTU B;  4KCE A;  4K0G A;  4JR6 A;  3D6I A;  2H0I A;  1O73 A;  4G0I A;  2H1B A;  2HSM A;  1ST9 A;  2HRK A;  1EGO A;  2HZE A;  3O76 A;  3WT1 A;  1ERT A;  2HSY A;  2PER A;  2M80 A;  2DJJ A;  2CQ9 A;  4I2U A;  2WDU A;  3M8N A;  2YJ7 A;  3MNG A;  3C1S A;  3FEU A;  3GX8 A;  3HVX A;  1BYE A;  4FIW A;  3E0U A;  3I69 A;  2GQL A;  1ZYP A;  3DRN A;  3ZTL A;  2R2J A;  1HQO A;  4K7O A;  1GRX A;  4O5U A;  4O5Q A;  1AUC A;  3ZIV A;  1DE2 A;  1XFL A;  2CVK A;  4MA9 A;  3QAG A;  2LUS A;  3PH9 A;  3QAV A;  4Q5R A;  1PN9 A;  4EVM A;  4NMU A;  1BJX A;  3GKN A;  2FUG 2;  2H70 A;  3QCP A;  3GST A;  3KZQ A;  2BTO T;  1FVJ A;  2OAD A;  2GSR A;  4MPG A;  4EXJ A;  2MMZ A;  4Q5N A;  2VCV A;  2VL9 A;  3APQ A;  1HYU A;  2CA8 A;  1VF1 A;  2H6Y A;  4TR1 B;  5B6M A;  1ZOF A;  1T1V A;  4DSR A;  1EOG A;  2Z9S A;  2YWM A;  3UVT A;  4O32 A;  1A0F A;  3VWU A;  1O7U A;  3GX0 A;  3EMX A;  2QA2 A;  1A8L A;  2A4H A;  1X9S B;  5ECO B;  2DML A;  4MP4 A;  3CSH A;  4D73 B;  4MLY A;  1TTZ A;  2FWH A;  4ML1 A;  1PL1 A;  3FZ5 A;  2L4C A;  2L5O A;  2GGT A;  1MD4 A;  4KSO A;  4F2I A;  4KSM A;  1QMV A;  1BG5 A;  3H4K A;  4IHU A;  5D9V A;  2H74 A;  3MIX A;  1ERW A;  2RUE A;  2FD3 A;  2HNL A;  3D5J A;  2VD0 A;  1M7T A;  5DJM A;  3R3E A;  4K9Z A;  2A4V A;  3ZRE A;  2YZU A;  3TGZ A;  2GSS A;  3KIJ A;  2O8V B;  4I5Q A;  1V9W A;  4KF9 A;  1TI1 A;  4POM A;  2CT6 A;  5KOW A;  3GHA A;  5ECS A;  1PRX A;  2M46 A;  4HDE A;  4HI7 A;  3PPU A;  1DSB A;  1X5D A;  5J4U A;  3UAP A;  4BVX B;  4CDO A;  3G9B A;  4KDY A;  4J56 E;  1T4Y A;  2JZT A;  3C1R A;  3GV1 A;  1UA5 A;  4MZB A;  3SWL A;  4EC0 A;  1VF4 A;  4KGI A;  2XHF A;  3CTF A;  4K7N A;  2DSA A;  2MZC A;  3FR3 A;  3FR9 A;  3A3T A;  3GL5 A;  4HU7 A;  1FAA A;  4J57 E;  2CAQ A;  14GS A;  3IK7 A;  2X8G A;  4N10 A;  4QL7 A;  2RM6 A;  3NOF A;  2VL3 A;  4Q5F A;  3TJB A;  5DAK A;  2DJ3 A;  4IQ1 A;  2C0G A;  6GST A;  2V41 A;  4EE0 A;  1AXD A;  4PUF C;  3TJJ A;  4MZC A;  1SK2 A;  5FWG A;  5IMA A;  3QR6 A;  2M72 A;  1R5P A;  1OVN A;  5CRW A;  4EIQ A;  2WS2 A;  4A5P A;  1MDJ A;  1GSS A;  3UBL A;  4QL9 A;  1I9D A;  3E9J B;  5INY A;  3IAM 2;  5HR2 A;  4HQS A;  2DBC A;  5AGY A;  3ERW A;  3F4S A;  4PGT A;  5D9X A;  1W4V A;  7GSS A;  1SKR B;  5IMV A;  5ELA A;  4V1A g;  3A2X A;  5B8A A;  1Q98 A;  3TJF A;  1GUM A;  4XS4 A;  4TR3 A;  1EP7 A;  2HXK A;  5L71 A;  1I5G A;  3HVS A;  4G0K A;  3LYP A;  4HJM A;  2B7J A;  3IC8 A;  3TKQ A;  1YY7 A;  5AIX A;  5ECR B;  4BL7 A;  3NZN A;  1GSD A;  5DBQ A;  2L6C A;  2I9H A;  4NAX A;  5COH A;  1EOH A;  4YQV A;  4WXT A;  2H1G A;  2YWO A;  3EC3 A;  4MDC A;  3IC4 A;  5F8B A;  2IPA A;  1K0A A;  2J23 A;  4XCS A;  3R2Q A;  3H1N A;  3GTU A;  3ZL5 A;  1SJI A;  3BCI A;  3IXR A;  4BPY A;  2DKH A;  2F9S A;  1JLV A;  2GS3 A;  3ERG A;  2VLU A;  1GH2 A;  4CW9 A;  4YKF A;  3HCZ A;  1JLW A;  1RW1 A;  3S9F A;  3N9J A;  5IMD A;  2OBI A;  3APO A;  2C0F A;  1YJ6 A;  1HNA A;  4X1U A;  4MMM A;  1XBS A;  5JWR B;  5CO3 A;  2HLS A;  1CQH A;  4YKG A;  2N5B A;  1CQG A;  1Y6E A;  2E2G A;  5J3R A;  6GSY A;  2OAC A;  4K2X A;  4ZBD A;  5GST A;  5ECK B;  1M2A A;  2NDO A;  3ME7 A;  4CY8 A;  4NXI A;  3DKS A;  2VL2 C;  3VK9 A;  2B5X A;  4DVC A;  2K8V A;  2A2R A;  2R37 A;  4L8E A;  3C71 A;  2OJL A;  3RHC A;  2C3N A;  5J9B A;  4RI6 A;  2DJ1 A;  2WB9 A;  3QD9 A;  2ON5 A;  2AHE A;  2A2P A;  4WET A;  5FHI A;  5CRE A;  4EL1 A;  2YCD A;  2XC2 A;  5F06 A;  1GUL A;  4O7H A;  4KDU A;  4K1F A;  4I8B A;  3QDN A;  4J2F A;  4BVY B;  4Z7X A;  5KN0 A;  4N30 A;  3VWX A;  1YF0 A;  3D22 A;  2HRA A;  1FO5 A;  2C0E A;  3LEF A;  4TR1 A;  1NHO A;  1WWJ A;  1GNE A;  2ES7 A;  5ELG A;  1OC8 A;  2H8L A;  1A8Y A;  4CY6 A;  3TUE A;  4JU5 A;  3QFB C;  4L5L A;  1JZD A;  1GLQ A;  4IQA A;  1TK8 B;  2H30 A;  3MAK A;  2LRC A;  1Q4J A;  3GUS A;  2AAW A;  1AC1 A;  3K8N A;  4POL A;  2RUF A;  3IK9 A;  2JZR A;  1N2A A;  1PX7 A;  3L4N A;  4L5O A;  5CNW A;  1OYJ A;  2H0G A;  2VUP A;  2R5G A;  4I6X A;  2QA1 A;  5A4V A;  5HR0 A;  4K7I A;  1Z6M A;  2LS5 A;  4XS6 A;  3M3M A;  1BQ7 A;  2ZNM A;  5G5F A;  4N0Z A;  1K0M A;  2LV3 A;  2PVO C;  2EIR A;  2PWJ A;  1H75 A;  3H79 A;  2O7K A;  1J9B A;  4BVX A;  1YDK A;  18GS A;  3GA4 A;  4POB A;  3VI5 A;  1SU9 A;  1DBY A;  1MDI A;  3Q6O A;  1V2A A;  1GL8 A;  2PBJ A;  4Z2R A;  1KTE A;  3A2W A;  4HQZ A;  5EPF A;  1XW6 A;  1V40 A;  1V57 A;  2YZH A;  1GLP A;  3D0Z A;  3CMI A;  5IMC A;  1T7P B;  1SKW B;  5A4W A;  3QOU A;  4PNG A;  1V98 A;  1DE1 A;  1B48 A;  3KJY A;  4MZW A;  3ZFB A;  2WRT A;  3IBH A;  3EYT A;  5DCH A;  3M9K A;  4JRR A;  2OKA A;  5D73 A;  1U87 A;  1TRS A;  2WGR A;  3TB2 A;  5EVO A;  3VWW A;  4IEL A;  3HJP A;  3EE2 A;  3ERF A;  5LD0 A;  2YP6 A;  1F3A A;  4RQR A;  4KE3 A;  2PU9 C;  1ACV A;  2FWG A;  4MF7 A;  1GP1 A;  13GS A;  1PMT A;  1K0O A;  3MWH A;  1GUK A;  2C0D A;  3MDK A;  1FG4 A;  4IN0 A;  5GAN D;  1M2B A;  1B4P A;  4KDX A;  2OE3 A;  4OFT A;  3BCK A;  2V2G A;  1XXU A;  4E8H A;  3L9U A;  4HEA 2;  1XOA A;  1PA3 A;  2C1Y A;  1URM A;  3I6A A;  1JZR A;  4GRF A;  1ZYN A;  1SK0 A;  4TVE A;  2IWT A;  4IJI A;  1PSQ A;  1WIK A;  4YQU A;  1LBK A;  9GSS A;  3IE3 A;  1FHE A;  2XBQ A;  3IV4 A;  3MSZ A;  5ECQ B;  3LG6 A;  1EEM A;  2PUK C;  2LQQ A;  1JZW A;  3P2A A;  4XRA A;  5C04 A;  3TRP A;  4PNF A;  5AIV A;  1DUG A;  4GF0 A;  3UJ1 A;  1IYI A;  2IMF A;  3O3T A;  4TKY A;  3KH9 A;  4MF6 A;  20GS A;  5G5E A;  5IIZ A;  1J0F A;  4EO3 A;  2XBI A;  3ZVJ D;  4RI7 A;  2DKI A;  3F0I A;  4K5S A;  1LJR A;  2VM2 A;  3FR6 A;  1AQX A;  1K0N A;  3TJG A;  2X49 A;  5JWO B;  2DIZ A;  2L5L A;  1U6T A;  4GLT A;  2VLT A;  3GSS A;  3TKS E;  2O85 A;  4G9H A;  1TXX A;  3WGX A;  4OFN A;  3L0H A;  4MNN A;  3H8Q A;  3DD3 A;  4IGJ A;  4HOJ A;  5CRH A;  5H5R A;  3SBC A;  1OE7 A;  4HS1 A;  5ID2 B;  1GSF A;  1HNC A;  1AQW A;  3IR4 A;  4IJ3 A;  4N0V A;  2PVQ A;  1XPV A;  2K9F A;  2LTK A;  3CTG A;  2NVL A;  1YF1 A;  2VCZ A;  1X0R A;  4FYU A;  2YV9 A;  3EWL A;  2BMX A;  2LJR A;  3KD0 A;  1W89 A;  2JAD A;  3LXZ A;  1SJZ A;  2HZF A;  3TCO A;  4O5R A;  1GSE A;  1UVZ A;  3M9J A;  3HD5 A;  3HYP A;  3BD2 A;  1N8J A;  4IVF A;  4GSS A;  19GS A;  4KA0 A;  2LKU A;  2FWE A;  4BVY A;  3GUR A;  3IDV A;  2JSY A;  3ED3 A;  5EL8 A;  2CVD A;  3DEX A;  2JU5 A;  1WOU A;  5GZZ B;  1R4W A;  3TRQ A;  4ECC A;  1YEP A;  3IA1 A;  4HZ4 A;  2YJH A;  4OFM A;  1M2D A;  2TRX A;  4NPB A;  2H73 A;  4FH8 A;  1R26 A;  3HY2 A;  2MYG A;  1SYX A;  2K6V A;  3GH9 A;  1ZYE A;  2VD1 A;  3EU4 A;  2AYT A;  2LQO A;  2RLI A;  1PKZ A;  1G7E A;  1RK4 A;  3KP9 A;  5DCG A;  2RII A;  1GTU A;  3VUR A;  4MPF A;  3WT2 A;  4ECJ A;  3CSI A;  1O81 A;  3KTL A;  1B8X A;  3ZYW A;  5IPG A;  3Q19 A;  5H5S A;  2JAC A;  2F8F A;  5CRG A;  3DVX A;  2I81 A;  5A5K A;  2VOC A;  4PQH A;  5ECN B;  4ECI A;  3VPT A;  2GQM A;  1XW9 A;  3Q18 A;  4HU9 A;  3PIN A;  3UL3 A;  1ZYQ B;  3KEB A;  4PTS A;  1PKW A;  5IQY A;  4LA1 A;  2DJK A;  2X64 A;  1GTB A;  3FY7 A;  2XPE A;  3WD6 A;  4XS1 A;  1FVK A;  4JBB A;  6GSV A;  1B4Q A;  3GN3 A;  2FA4 A;  1Z6N A;  3FW2 A;  1Z7P A;  5JCG A;  1TU7 A;  1GSY A;  1TI3 A;  3C7M A;  1OC3 A;  3GYK A;  4G19 A;  1AAZ A;  1THX A;  1TRV A;  3G7I A;  5D9W A;  3ME8 A;  3IHG A;  3FZ9 A;  5DQS A;  1R5A A;  4ZB8 A;  3TRX A;  2H6Z A;  1FB6 A;  4MK3 A;  1B9X C;  2WZ9 A;  4TXO B;  1A24 A;  4FYB A;  2G2Q A;  1NHY A;  2K8S A;  2X4A A;  2MMA A;  1BED A;  1F3B A;  2FLS A;  1M9B A;  1USB A;  4IP6 A;  4WBJ A;  2B6M A;  4NV5 A;  4ZBA A;  2CZ3 A;  2KP2 A;  2CX4 A;  2XPD A;  4OMV A;  4GSN A;  1XWA A;  3VFI A;  3FYG A;  2L6D A;  2WJU A;  2GLR A;  2B3S A;  1TP9 A;  4EIP A;  2MBT A;  4EDY A;  5BMU A;  2AJQ B;  1GTI A;  1PX6 A;  2VCQ A;  2AB6 A;  4JZQ A;  4TW5 A;  4WBR D;  4KAE A;  2ZUP A;  2LNT A;  1XIY A;  2H72 A;  5HQP A;  3VI7 A;  1O8X A;  1OAZ A;  3US3 A;  2VIM A;  6GSX A;  1QUW A;  1ZL9 A;  4K2D A;  2O89 A;  1GWC A;  1MDK A;  5DDL A;  5DVB A;  3VLN A;  4EF0 A;  3W6G A;  1EEJ A;  3GKX A;  4G10 A;  5HFI A;  3P8W A;  3ISO A;  1F6M C;  3IHQ A;  3P7X A;  1SL2 B;  4DSQ A;  2OBK A;  5J5N A;  4AF2 A;  2JZS A;  3F4T A;  3RPP A;  4LMW A;  1YKA A;  4IP1 A;  3ZIJ A;  5C00 A;  5DJL A;  2FGX A;  3MYD A;  2GZZ A;  3FRC A;  2YV7 A;  2QSI A;  3D4M A;  3PGT A;  3CRU A;  3KGK A;  1WE0 A;  2YN1 A;  1MTC A;  4X0X A;  2HT9 A;  1WMJ A;  1XVW A;  3WGE A;  4P3Y B;  5ECH B;  1AQV A;  2RM5 A;  1EZK A;  3KMN A;  1S3A A;  2YNX A;  4QQ7 A;  2IJY A;  2DJ0 A;  1YKC A;  2O87 A;  2V1M A;  1K3Y A;  2B7K A;  1T00 A;  2TIR A;  3F6D A;  2C4J A;  4FO5 A;  5HR1 A;  4KH7 A;  5B8B A;  2R0G A;  5ID2 A;  2LNS A;  4MH2 A;  1FB0 A;  5ECI B;  2R0P A;  3UIW A;  3ZLP A;  1PGT A;  5JCW A;  3FK8 A;  3A5I A;  1U3I A;  2GZP A;  1YQ1 A;  4XHM A;  2HRF A;  3M1G A;  2FHE A;  3D4T A;  2GQK A;  4AGS A;  4ECB A;  2X8C A;  5F0G A;  2EIO A;  3EPT A;  3QPM A;  3HZ4 A;  4ZL9 A;  3LQ7 A;  5D9T A;  3HDC A;  1F37 A;  3BJ5 A;  5IM9 A;  4HZ2 A;  3AY8 A;  4O92 A;  4GQF A;  3L9V A;  4OWY A;  4HUA A;  4KND A;  3RAZ A;  1AW9 A;  3D21 A;  4TRX A;  1K0B A;  5CYY A;  2CX3 A;  3EMP A;  4RUV A;  3UBK A;  2V6K A;  4DSS A;  2B5Y A;  3LXT A;  4OCF A;  2AUV A;  2CAI A;  2QGV A;  1E2Y A;  3F3R A;  3FZ4 A;  4LLR A;  5IPH A;  2VM1 A;  1J08 A;  5F05 A;  1E6B A;  2HRN A;  4TR0 A;  2GZY A;  5J9C A;  5CP1 A;  3A5W A;  2N5F A;  3U5R E;  3GL3 A;  3WGD A;  2ALB A;  5GAP D;  1MD3 A;  2H6X A;  1SK1 A;  4OCE A;  3C73 A;  1T4Z A;  1X5C A;  4F0C A;  1OKT A;  1UC7 A;  5CAX A;  3KP8 A;  4TN8 A;  2H75 A;  4TXV A;  2H1A A;  3BOA A;  5G1L A;  3UEM A;  1TRW A;  3PR8 A;  4CHS A;  1PL2 A;  2HYX A;  2CV4 A;  1QK8 A;  1IYH A;  3QMX A;  4NHW A;  5CRD A;  2H1D A;  3GKK A;  3JCM L;  2IIY A;  3WYW A;  1V58 A;  1YEX A;  5ENU A;  1UN2 A;  8GSS A;  1S3C A;  1XVQ A;  3TKS A;  17GS A;  2QKE A;  2I1U A;  3J7Y k;  6GSS A;  2N5A A;  2HFD A;  2H71 A;  1JFU A;  4WF5 A;  1SEN A;  1THO A;  3UMA A;  2OE0 A;  1R7H A;  1YZX A;  3RBT A;  4MCU A;  3GRX A;  1M99 A;  5E4W A;  5A4U A;  2IMI A;  3LJR A;  4TXO A;  4ZB9 A;  1O8W A;  4V2L A;  4YH2 A;  2YAN A;  1OC9 B;  4ZBB A;  4LL1 B;  1BX9 A;  4ZB6 A;  4RQX A;  4IW9 A;  4PUR A;  2OA7 A;  1WRY A;  3ZVJ A;  5IMF A;  3F63 A;  2R0C A;  5AIS A;  3J7Y b;  4WR4 A;  4LMV A;  4ZL7 A;  1M9A A;  2H76 A;  6GSU A;  4TOP A;  3KXO A;  2VL2 A;  3CXG A;  4PUA A;  2GT6 A;  4X43 A;  2R4V A;  3F6F A;  1A2L A;  5LCZ A;  3DIE A;  2L57 A;  3CBU A;  2X99 A;  2G0F A;  3EUR A;  4FQU A;  4V2N A;  2AV4 A;  4WKW A;  3RHB A;  2CVB A;  2OE1 A;  3IOS A;  1EWX A;  4F82 A;  1GNW A;  1X9M B;  2I4A A;  2L4Q A;  2GDR A;  2HE3 A;  3FZA A;  4ACS A;  3P90 A;  3W8J A;  3TOT A;  4JR4 A;  1XOB A;  4MJE A;  3HA9 A;  22GS A;  2FA8 A;  2J9H A;  4GCI A;  1GSQ A;  4I2T A;  4N11 A;  3GIX A;  2KLX A;  4YQM A;  4K8M A;  2DIY A;  3DWV A;  4ILF A;  1KBN A;  3M0F A;  2L59 A;  4BWQ A;  5D93 A;  1U3A A;  3GNJ A;  3HVV A;  3DYR A;  1ERV A;  1GSU A;  3GFK A;  1K3O A;  3IAS 2;  2NTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...