2L6DA

Solution structure of desulfothioredoxin from desulfovibrio vulgaris hildenborough in its reduced form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Structural and mechanistic insights into unusual thiol disulfide oxidoreductase.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxidoreductase
total genus 28
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2l6dA00
2FWEA 1JLVA 4NAXA 1FAAA 8GSSA 3E3EA 3KTLA 1TU7A 2JSZA 3MWHA 4TN8A 4LLRA 2AUVA 2GZYA 4AJ7A 1AQVA 2LQQA 2K6VA 2WFCA 1Z7RA 3NIVA 1SK0A 3KD0A 4QL7A 1OC9B 2LKUA 4YQMA 2HE3A 1GNEA 1G6WA 2DJJA 2V32A 2WULA 3D22A 5IMDA 1YDKA 4I8BA 2IMIA 4ULXA 1GSFA 1JFUA 3LEFA 3IA1A 2JZSA 5CNWA 4JU5A 4KUNA 5CYYA 2VCQA 5KN3A 4WBJA 3LFLA 1WMJA 4NHZA 4DSSB 2GGTA 2TIRA 7GSSA 2VCWA 1Z7PA 4ZBDA 1K0BA 5G30A 1PX7A 1VF3A 1JZOA 1KEBA 1SYXA 4GSTA 1M2AA 4KCAA 1PN9A 5G31A 1B8XA 1PQNA 1UC7A 5G1LA 3TUEA 4K1FA 2XPEA 5B6MA 5JWQB 3A5WA 1ON4A 4I2TA 4TXVA 2VL2C 1GNWA 3KZQA 2PERA 3GTUB 4MJAA 1BYEA 3F3QA 3M9KA 1ZCPA 4MH2A 1O81A 2YWIA 3FR3A 3A3TA 1F6MC 2VLVA 4IP1A 2H19A 2YZHA 5DVBA 4TXOA 2VLUA 1GSQA 3FKFA 1PKZA 1GULA 2HFDA 4ID0A 1K3LA 2ON7A 1OE8A 1GSUA 2HRNA 2M80A 1OC8A 3G7YA 3RHBA 1YJ6A 3BCKA 4GCIA 4DVCA 4CDOA 10GSA 4WEYA 3GKXA 2X99A 5F06A 1XW6A 3I69A 1WWJA 4ECBA 4GRFA 1VF2A 4LL4B 1F3BA 2PVQA 1TJDA 2OBKA 1V57A 5HQPA 2H75A 5G5EA 2MMZA 2C80A 2C1YA 3GHAA 4YQVA 2LUSA 1K0MA 1NM3A 5B6NA 2P0GA 2WB9A 1X9SB 1R5PA 3MDKA 3RPNA 1NSWA 3EC3A 3QFAC 3ZITA 5E4WA 3HY2A 4OMVA 5B7CA 1N2AA 2IMFA 5IMFA 2R5GA 1F9MA 5A4UA 3ZMKA 1PL1A 5JCUA 4ZB6A 4IJ3A 3BJ5A 4PNGA 4HU9A 2YOIA 1TRSA 2P5RA 3QPMA 4DSQA 1ML6A 1PD21 3IDVA 3DRNA 2WGRA 3A2WA 1GH2A 3VWXA 1SENA 4XS4A 3KEBA 3N9JA 3FEUA 4WF4A 2FHEA 2O89A 2YZUA 2H0IA 5L71A 1ERVA 1X9WB 3L4NA 4WKWA 4CHSA 2HZFA 3DWVA 4O92A 5INYA 4NWYA 3BBYA 3QCPA 1SJZA 1VF4A 5D9VA 3C1SA 2DMMA 1XW9A 2HSHA 2L6DA 6GSXA 3KMOA 1W4VA 3IPZA 5F07A 3KXOA 3BOAA 4L5LA 4BPYA 2HNLA 4XS1A 2IMEA 2DJKA 2R37A 1PX6A 1XXUA 4V2MA 4FYUA 1WE0A 2B5XA 5ELGA 1R4WA 4WXTA 2YP6A 3S9FA 3FZ4A 1FB6A 2V2GA 3DKSA 2R2JA 3CRUA 1RW1A 3Q6OA 5E59A 2X8CA 4PXOA 2BTOT 2DJ3A 4HOJA 1FO5A 2YNXA 2XBQA 4MLYA 2VM1A 3IE3A 1BJXA 3LQ7A 1O7UA 4K9ZA 1VF1A 4KA0A 3RPPA 1AUCA 2B1KA 1MDIA 1K0NA 4ML1A 1CQGA 1QK8A 3LG6A 2FGXA 2I4AA 2C3NA 4MF6A 2QC7A 1FVJA 2YANA 5ELAA 3HVSA 5IOXA 5KEJA 3H4KA 1S3AA 2GQMA 2B7KA 5HR0A 2HI7A 5D93A 5IO0A 4HEA2 5DAKB 2KLXA 4F9ZA 4LL1B 1XIYA 3ERGA 2L5LA 2QGVA 3APSA 1AC1A 4DEJA 3IAM2 3VPTA 1B48A 2VO4A 3QAWA 1WP0A 4ZL8A 3HD5A 1A8LA 2FWFA 3QAGA 2PN8A 2HRFA 3P2AA 3DEXA 2PMTA 5CRGA 1ST9A 4JE1A 2B5YA 3GH9A 3TJKA 2FWHA 4G10A 1TRWA 1A2JA 4NHWA 4GWRA 3K8NA 2CA8A 5ECKB 2EIOA 1SKSB 3HXSA 3CTFA 2TRCP 4HS1A 4D73A 6GSSA 2X8HA 2IIYA 2E7PA 5D9TA 3UL3A 5LD0A 3UIWA 3UARA 2GQKA 3US3A 3FR9A 2RLIA 2BJXA 2HT9A 5DALA 4POMA 4O5RA 4XRAA 2D2ZA 1MD4A 1ZL9A 3F4SA 3W8JA 2ZCTA 1Y6EA 1SU9A 1Z9HA 3GV1A 4OO4A 3LXTA 1B4PA 5ECOB 5IMVA 1K0CA 2I3YA 2LNSA 6GSVA 1EV4A 3HZ8A 1R26A 3GX0A 4N30A 3H8QA 3ME8A 4HI7A 2GSTA 2J9HA 1RQMA 2VL3A 2LTKA 1J0FA 4TR1B 4YAPA 1YEPA 1GSEA 2YV9A 3P90A 19GSA 5AIXA 1TRVA 2LQOA 5DCHA 2C3TA 5IO2A 4KAEA 4PGTA 2YWOA 2VD0A 4POBA 1OAZA 5ECSA 3ZFLA 3L78A 2NTOA 3VWVA 2DIZA 2KOKA 3TJBA 5AIVA 3P8WA 3C8EA 4LA1A 2H01A 4Z7XA 2V1MA 4TXOB 1EOGA 3TJGA 1XZOA 3UBKA 2VL9A 3WGDA 4F0BA 2H30A 5GAPD 4G19A 1EV9A 1A2MA 3HJOA 1SKRB 3SWLA 3TKSC 4JEDA 5F05A 3NZNA 1EEMA 2ALBA 1W89A 5J4UA 1X5CA 16GSA 3WT1A 3DVXA 1HNCA 2PPTA 2DJ2A 3Q18A 4EC0A 2AJQB 1GTUA 1U3IA 4K7NA 4N10A 1VRSD 1XOBA 1TI1A 4QQ7A 3IBHA 4ZBBA 5D73A 2VCZA 4KGIA 1SL0B 4TVEA 4OFTA 4FYBA 2DSAA 1M9BA 2ES7A 5ID2A 1XWCA 2DMLA 3HYPA 3A2XA 1SD9A 3A2VA 2V41A 3R2QA 3F9UA 1SL2B 3GH6A 2H76A 3H93A 3ZVJA 4KSOA 3VWUA 1JZWA 1XVWA 2JACA 4XTSA 4V2LA 4NPBA 4XS4B 2JSYA 2WDUA 2Z9SA 2RUEA 1XOAA 20GSA 4TOPA 2HZEB 1T1VA 1ZGNA 3WD6A 1M7TA 2MMAA 2IMDA 4N0VA 3EE2A 4KX4A 3ZZXA 1MDKA 4J57E 5CP1A 2L5OA 4X1UA 1TXXA 3F4TA 2FWGA 1ACVA 2LNTA 3F3RA 3HVXA 3Q74A 2C8UA 2GTUA 2DIYA 1FG4A 4J2FA 2CZ3A 4ZB9A 1ERUA 1ZZYA 3D4MA 4KW6A 3D5JA 1M99A 4GSNA 5LNKe 3GSSA 3FK8A 1EGOA 5J9BA 4KE3A 2K8VA 3O6TA 4EE0A 4FYCA 2CVKA 3BCIA 2VL2A 4MDCA 2J23A 1QQ2A 2CX3A 2B1LA 2MMNA 4KH7A 1A0FA 4Q5QA 4BWSA 1XWKA 4K8MA 4NV5A 1GTAA 2YPMA 2M46A 4OCEA 3E9JB 2XC2A 1O85A 1IYHA 5AN1A 5G2ZA 2YCDA 3HVVA 1SK1A 4PQ1A 3TJFA 5H5QA 5IM9A 2F51A 3OR5A 1K0DA 4IELA 1WPIA 3TOUA 3RDWA 1V40A 5IOWA 1YF1A 3TDGA 3ZIVA 2CAIA 4FH8A 3VWWA 4KDYA 1C72A 2OBIA 3HDCA 18GSA 4IBPA 3TCOA 2VD1A 4HJMA 3NOFA 4XCSA 3U5RE 3MNGA 1AW9A 3UOMA 4K0NA 3TKSE 3LGCA 4V1Ag 1ZYEA 4MZBA 4MH3A 14GSA 3Q19A 1K3OA 1BQ7A 4HQZA 4TKYA 3CXGA 1ZMAA 4EO3A 3ZL5A 4K7IA 4GSSA 3L9VA 2M72A 1F3AA 1T00A 5CRWA 4MP4A 2PU9C 5DQYA 3FW2A 1PA3A 5HR3A 3M8NA 4MCUA 3H1NA 2IL3A 2GT5A 3VI5A 1WRYA 4BVYA 3G7JA 2IFQB 4D73B 2E2MA 4TR3A 2H73A 5ABRA 2GDRA 1QGVA 4TRXA 5IIZA 4RQXA 1TI3A 2C0FA 2H0GA 2OJLA 1KNGA 3I43A 2YWMA 1GSDA 1DSBA 1O8XA 3LJRA 2A4VA 4E8HA 2V6OA 4K7OA 1T7PB 1YZXA 3IAS2 4Q5NA 4PNFA 3IR4A 3VK9A 4EVMA 3HCZA 1QUWA 2QKEA 1N8JA 5CREA 4F0CA 4P3YB 1OC9A 4MF5A 4POLA 3C1RA 1UVZA 5GZZB 1HQOA 1J08A 2CZ2A 3VLNA 5ECMB 1TP9A 3VFIA 1QXHA 4ECIA 3FHKA 3TOTA 2NVLA 3H79A 2B7JA 2C0EA 1GUHA 2H1DA 3KM6A 3C73A 2WJUA 1GLQA 5HFIA 3CYNA 1MEKA 4DSSA 5IPGA 3D0ZA 1JLWA 1M2BA 1OE7A 1O8WA 2AAWA 3EMPA 2MMOA 1OVNA 2CVDA 1NHYA 1USBA 4AF2A 3KGKA 1EWXA 2BMXA 2H1AA 4MABA 2GSQA 2FUG2 3GFKA 4HZ2A 5GSTA 4DSRA 1B9XC 4WETA 4L8EA 1X5EA 1T8EB 3E0UA 4HDEA 4KCEA 4F03A 3APQA 4BA7A 3UBLA 4K0GA 4NMUA 2N5AA 4IW9A 2IN3A 1Y25A 2FLSA 1TKDB 3G9BA 3GTUA 4OD7A 2X64A 4MMMA 5A4WA 2EC4A 1URMA 4Q5RA 6GSYA 3QAVA 2H1BA 4O7HA 2H6XA 5IPHA 2R3XA 3TGZA 5CRDA 2FCHA 3BD2A 2O87A 3EMXA 2R6KA 4NXIA 4Q5FA 4ZL9A 4QL9A 2KUCA 5ID2B 2L59A 2H70A 2LRNA 1O6JA 2V6KA 3F63A 4GLTA 4JZQA 4WR5A 1LU4A 3JCML 1ILOA 2OA7A 2LJRA 1SL1B 4ILFA 3EYTA 5CAXA 1A24A 3VPQA 4ECJA 2ZNMA 3KP9A 4JBBA 3QD9A 3PR8A 4HU7A 2C4JA 1XW5A 2C0GA 5CRHA 2YJHA 2N5FA 3EWLA 2HXKA 2H6YA 4XRDA 2AV4A 2YN1A 2LRTA 1M2DA 3GIXA 3DXBA 5FWGA 3O76A 1K0AA 1X0RA 1KBNA 3GUSA 3GRXA 4E8EA 2GZZA 1MD3A 3P7XA 4JRRA 4ECCA 2F9SA 3GX8A 1TTZA 1YF0A 2PGTA 3CSHA 3GKMA 1A23A 1K0OA 3VI7A 3KJYA 3M0FA 1FVKA 3M3MA 3GNJA 3ZTLA 2HLSA 3IRAA 1GSSA 4JR4A 4L0UA 2B5EA 3KIJA 4HQSA 1AQWA 3M1GA 4TR4A 2YJ7A 3GL5A 1TK0B 4POKA 4K2DA 4OWYA 4PURA 1AXDA 1U88A 4G9HA 5D8IA 1DBYA 4I6XA 1TK5B 3HZ4A 2H66A 2FY6A 4GTUA 3PH9A 4ZXGA 1YY7A 2LS5A 2NPBA 1OKTA 3M9JA 6GSWA 2K18A 4MF7A 11GSA 1FB0A 1FHEA 1Q4JA 2AHEA 2P5QA 3RAZA 1E2YA 4PUAA 3CSIA 3L9UA 1H4OA 2EIRA 1QMVA 2GS3A 4NV2A 1O73A 3ISOA 2F8FA 4EKZA 1KTEA 3HKRA 4MZCA 2WCIA 4IQAA 2L4CA 4HJ2A 1DE1A 12GSA 2HSYA 2O7KA 1ZYQB 1EGRA 5H5SA 2VAFA 1F37A 2WS2A 3KCMA 3FZAA 1YEXA 3CTGA 1TDIA 4BWQA 3KH7A 3QFBC 1JZDA 4V1Ap 1EP8A 3EURA 2WZ9A 4MPGA 3G7IA 5J41A 5KN2A 1DE2A 2GVPA 1E6BA 3DVWA 2AB6A 5J5NA 2GSSA 5ECHB 2JL4A 2DC5A 3F6DA 6GSUA 4BVXA 2JZRA 2IMKA 3AY8A 4L5OA 3LYKA 1GTIA 5DAKA 2JZTA 5ENUA 2DJ0A 1ZOFA 5AGYA 4O32A 4ZIJA 4XIHA 4IQ1A 1NW2A 3LSZA 17GSA 1A2LA 5ECLB 3LXZA 3TRPA 3CMIA 3EVIA 5B8BA 3J7Yb 3W6GA 4AJ6A 4EXJA 2RIIA 1WOUA 1HNAA 3I9V2 5EVOA 5FT3A 1GP1A 1JZRA 1SD8A 1YKCA 5EL8A 1OKDA 1T4ZA 2VCVA 1TK8B 5ECQB 1M0UA 3LORA 1UN2A 2G2QA 4YQUA 2KP2A 5G1KA 1Z6NA 3UMAA 1K3YA 3ERFA 3CSJA 4L0WA 1TU8A 3F6FA 1FOVA 3ZYWA 3UJ1A 2DBCA 3ZLPA 1EOHA 2GLRA 2H6ZA 3HA9A 4OO5A 1MDJA 4ZILA 3C71A 1I9DA 3D4TA 2PVOC 2PWJA 2H71A 1Z3EA 1H75A 4KDUA 3GURA 3TRQA 4YH2A 2B3SA 2KP1A 2REMA 4TR1A 2MZCA 3FYGA 4IKHA 1S3CA 1WIKA 3N5OA 5JWOB 2H0HA 4N0ZA 1SYRA 4TR0A 3L0HA 2MYGA 4RQRA 1SKWB 3DMLA 5D9XA 5D96A 3GKKA 2I1UA 4H86A 4I2UA 5HR1A 3KH9A 5CO3A 2P31A 4ML6A 2ON5A 2O85A 2XBIA 3GSTA 4XS6A 1U6TA 1UA5A 1EZKA 1XWGA 2ZUPA 1BG5A 3ZIJA 1SK2A 3D21A 1Z5YE 3LWAA 1ERTA 3IV4A 4HZ4A 2OKAA 5F8BA 3ZRDA 5D9WA 1SJ6A 4IN0A 2C3QA 5H5RA 2LSTA 2LV3A 2E2GA 3O3TA 5B8AA 4FO5A 1XWAA 3ZMLA 3ME7A 4WBRD 1R5AA 1XPVA 5KN0A 4V2NA 2GT6A 3UEMA 1LBKA 4I97A 3DYRA 1PGTA 1G7OA 3DGQA 3C7MA 3IXRA 3QDNA 4EL1A 5DALB 2N5BA 4MJCA 2OADA 1GSYA 5GAND 3GKNA 3KTBA 4FIWA 2YV7A 4KSMA 2HZEA 1TW9A 6GSTA 5A4VA 5IMZA 3SBCA 4PX1A 1U87A 1GUMA 3FRCA 4PQIA 3IHQA 3WYWA 2KHPA 1B4QA 2OE3A 4MJBA 1EP7A 3HJPA 2CX4A 2IPAA 3RHCA 4I5QA 4K6XA 4IGJA 1XCCA 2OE0A 3IK9A 4KNDA 1B9YC 1LJRA 4IJIA 4J56E 4PUFC 1BAYA 2VLTA 3DIEA 1HNBA 4MZWA 4RI7A 3MAKA 5DDLA 3APOA 4ZBAA 4GF0A 5IQYA 2PUKC 1BX9A 1V98A 5HFGA 1G0TA 5JCGA 2VM2A 1GTBA 1DUGA 3GN3A 4RI6A 2K8SA 1HYUA 1QFNA 1VGLA 1FW1A 4AJ8A 1J9BA 2C0DA 2G0FA 1OC3A 2O8VB 3UVTA 2QSIA 4BL7A 1XVQA 1PSQA 1PMTA 2VCXA 3DD3A 4WF5A 4EDYA 4OFNA 2LJAA 3QR6A 1PL2A 2NBSA 3GA4A 5JWRB 4MK3A 3TKPA 2LEGA 1Z6MA 3KP8A 3UVHA 3EINA 2H8LA 1THOA 2LRCA 4HUAA 4ZB8A 4IHUA 3PGTA 2K9FA 1A8YA 1U3AA 3U6VA 4X43A 4G2EA 2F3MA 3IK7A 2NDOA 2IJYA 1V2AA 5AISA 3ERWA 2DLXA 4XHMA 2FA8A 5EPFA 3FY7A 4YAVA 4GQCA 2CVBA 1JHBA 2XHFA 1NHOA 3D6IA 2RM6A 1CQHA 4F2IA 9GSSA 3PINA 1T3BA 5DCGA 4CW9A 1GUKA 1ERWA 1ABAA 3GMFA 3HJMA 5JCWA 4X0XA 1AQXA 4ISDA 1YKAA 1XFLA 3EU3A 3VURA 5F0GA 2FNOA 2RUFA 5COHA 5GSSA 5C00A 1PKWA 2FA4A 2CT6A 1A0RP 3TJJA 1GWCA 2FD3A 3F0IA 1EEJA 1GLPA 1T4YA 2A2SA 2OE1A 2TRXA 3F8UA 4IVFA 3CBUA 4TW5A 2GQLA 3TRXA 3FZ9A 4EUYA 1G7EA 2IFQA 1GRXA 3ZVJD 1AIUA 2X8GA 4MA9A 3L9SA 2L6CA 3HHVA 4PQHA 4ZL7A 4KB3A 1BEDA 5DJMA 4RUVA 1YQ1A 2E0QA 1V58A 4N11A 3EU4A 2L4QA 2MBTA 3ED3A 3TKRA 3W8SA 1XWBA 13GSA 4EDZA 2AYTA 1OYJA 2H74A 5FHIA 4OCFA 3WGXA 2RM5A 5A5KA 2I81A 2VIMA 1MTCA 2CV4A 3V1WA 3TKSA 2OACA 3I6AA 5DQSA 5HFKA 3ZFBA 5IMAA 4WR4A 5HR2A 2H72A 5J3RA 3QOUA 5J9CA 3IOSA 4OFMA 2GZPA 3WT2A 2DJ1A 2VCTA 2WRTA 1X5DA 2L57A 3TKQA 1HD2A 1Q98A 4MPFA 1G6YA 4EF0A 5C04A 2A2RA 2VOCA 4LMVA 3RBTA 1RK4A 3UAPA 1I5GA 2JADA 1TRUA 1PRXA 3KMNA 3WGEA 4ACSA 2I9HA 3LYPA 3QMXA 2YWNA 2IWTA 3GL3A 2XPDA 1THXA 1S3DA 2R4VA 4IS0A 2B6MA 1SJIA 2HYXA 1XBSA 2JU5A 4LMWA 5LCZA 2PBJA 5ECIB 5DJLA 4F82A 3CRTA 1R7HA 22GSA 1WJKA 3TB2A 4KDXA 4AGSA 4JR6A 1IYIA 2GSRA 2CQ9A 1X9MB 2CAQA 1V9WA 1TOFA 5DBQA 2MBSA 2EIQA 5KN1A 3IC4A 5ECPB 3GYKA 3FZ5A 1F2EA 1GL8A 3J7Yk 3MSZA 5EY6A 3ZREA 2VUPA 4MJEA 4GQFA 1M9AA 2F8AA 4GXZA 1AAZA 5ECRB 3F4RA 2H1GA 3FR6A 5G5FA 2LJKA 4IP6A 5IMCA 5ECNB
chains in the Genus database with same CATH superfamily
2FWEA 1JLVA 4NAXA 1FAAA 8GSSA 3E3EA 3KTLA 1TU7A 2JSZA 3MWHA 4TN8A 4G0KA 4LLRA 2AUVA 2GZYA 4AJ7A 1AQVA 2LQQA 2K6VA 2WFCA 1Z7RA 3NIVA 1SK0A 3KD0A 4QL7A 1OC9B 2LKUA 4YQMA 2HE3A 1GNEA 1G6WA 2DJJA 2QA1A 2V32A 2WULA 3D22A 5IMDA 1YDKA 4I8BA 2IMIA 4ULXA 1GSFA 1JFUA 3LEFA 3IA1A 2JZSA 5CNWA 4JU5A 4KUNA 5CYYA 2VCQA 5KN3A 4WBJA 3LFLA 1WMJA 4NHZA 4DSSB 2GGTA 2TIRA 7GSSA 2VCWA 1Z7PA 4ZBDA 1K0BA 5G30A 1PX7A 1VF3A 1JZOA 1KEBA 1SYXA 4GSTA 1M2AA 4KCAA 1PN9A 5G31A 2R0PA 1B8XA 1PQNA 4BL7B 1UC7A 3IC8A 5G1LA 3TUEA 4K1FA 2XPEA 5B6MA 5JWQB 3A5WA 1ON4A 1M3IA 4I2TA 4TXVA 2VL2C 1GNWA 3KZQA 2PERA 3GTUB 4MJAA 1BYEA 3F3QA 3M9KA 1ZCPA 4MH2A 2DKHA 1O81A 2YWIA 3FR3A 3A3TA 1F6MC 2VLVA 4IP1A 1PFOA 2H19A 2HRKA 2YZHA 5DVBA 4TXOA 2VLUA 1GSQA 3FKFA 1PKZA 1GULA 2HFDA 4ID0A 1K3LA 2ON7A 1OE8A 1GSUA 2HRNA 2M80A 1OC8A 3G7YA 3RHBA 1YJ6A 3BCKA 4GCIA 4DVCA 4CDOA 10GSA 4WEYA 3GKXA 2X99A 5F06A 1XW6A 3I69A 1WWJA 4ECBA 4GRFA 1VF2A 4LL4B 1F3BA 2PVQA 1TJDA 2OBKA 1V57A 5HQPA 2H75A 5G5EA 2MMZA 2C80A 2C1YA 3GHAA 4YQVA 2LUSA 2QA2A 1K0MA 1NM3A 5B6NA 2P0GA 2WB9A 1X9SB 1R5PA 3MDKA 3RPNA 1NSWA 3EC3A 3QFAC 3ZITA 5E4WA 3HY2A 4OMVA 5B7CA 1N2AA 2IMFA 5IMFA 2R5GA 1F9MA 1PN0A 5A4UA 3ZMKA 1PL1A 5JCUA 4ZB6A 4IJ3A 3BJ5A 2X49A 4PNGA 4HU9A 2YOIA 1TRSA 2P5RA 3QPMA 4DSQA 1ML6A 1PD21 3IDVA 3DRNA 2WGRA 3EPTA 3A2WA 1GH2A 3VWXA 1SENA 4XS4A 3KEBA 3N9JA 3FEUA 4WF4A 2FHEA 2O89A 2YZUA 2H0IA 5L71A 1ERVA 1X9WB 3L4NA 4WKWA 4CHSA 2HRAA 2HZFA 3DWVA 4O92A 5INYA 4NWYA 3BBYA 3QCPA 1SJZA 1VF4A 5D9VA 3C1SA 2DMMA 1XW9A 2HSHA 2L6DA 6GSXA 3KMOA 1W4VA 3IPZA 5F07A 3KXOA 3BOAA 4L5LA 4BPYA 2HNLA 4XS1A 2IMEA 4O5UA 2DJKA 2R37A 1PX6A 1XXUA 4V2MA 4FYUA 1WE0A 2B5XA 5ELGA 1R4WA 4WXTA 2YP6A 3S9FA 3FZ4A 1FB6A 2V2GA 3DKSA 2R2JA 3CRUA 1RW1A 3Q6OA 5E59A 2X8CA 4PXOA 2BTOT 2DJ3A 4HOJA 1FO5A 2YNXA 2XBQA 4MLYA 2VM1A 3IE3A 1BJXA 3LQ7A 1O7UA 4K9ZA 1VF1A 4KA0A 3RPPA 1AUCA 2B1KA 1MDIA 1K0NA 4ML1A 1CQGA 1QK8A 3LG6A 2FGXA 2I4AA 2C3NA 4MF6A 2QC7A 1FVJA 2YANA 5ELAA 3HVSA 5IOXA 5KEJA 3H4KA 1S3AA 2GQMA 2B7KA 5HR0A 2HI7A 5D93A 5IO0A 4HEA2 5DAKB 2KLXA 4F9ZA 4LL1B 1XIYA 3ERGA 2L5LA 2QGVA 3APSA 1AC1A 4DEJA 3IAM2 3VPTA 1B48A 2VO4A 3QAWA 1WP0A 4ZL8A 3HD5A 1A8LA 2FWFA 3QAGA 2PN8A 2HRFA 3P2AA 3DEXA 2PMTA 5CRGA 1ST9A 4JE1A 2B5YA 3GH9A 3TJKA 2FWHA 4G10A 1TRWA 1A2JA 4NHWA 4GWRA 3K8NA 2CA8A 5ECKB 2EIOA 1SKSB 3HXSA 3CTFA 2TRCP 4HS1A 4D73A 6GSSA 2X8HA 2IIYA 2E7PA 5D9TA 3UL3A 5LD0A 3UIWA 3UARA 2GQKA 3US3A 3FR9A 2RLIA 2BJXA 2HT9A 4MNNA 5DALA 4POMA 4O5RA 4XRAA 2D2ZA 1MD4A 1ZL9A 3F4SA 3W8JA 2ZCTA 1Y6EA 1SU9A 1Z9HA 3GV1A 4OO4A 3LXTA 4CY6A 1B4PA 5ECOB 5IMVA 1K0CA 2I3YA 2LNSA 6GSVA 1EV4A 3HZ8A 1R26A 3GX0A 4N30A 3H8QA 3ME8A 4HI7A 2GSTA 2J9HA 1RQMA 2VL3A 2UZ8A 2LTKA 1J0FA 4TR1B 4YAPA 1YEPA 1GSEA 2YV9A 3P90A 19GSA 5AIXA 1TRVA 2LQOA 5DCHA 2C3TA 5IO2A 4KAEA 4PGTA 2YWOA 2VD0A 4POBA 1OAZA 5ECSA 3ZFLA 3L78A 2NTOA 3VWVA 2DIZA 2KOKA 3PPUA 3TJBA 5AIVA 3P8WA 3C8EA 4LA1A 2H01A 4Z7XA 2V1MA 4TXOB 1EOGA 3TJGA 1XZOA 3UBKA 2VL9A 3WGDA 4F0BA 2H30A 5GAPD 4G19A 1EV9A 1A2MA 3HJOA 1SKRB 3SWLA 3TKSC 4JEDA 5F05A 3NZNA 1EEMA 2ALBA 1W89A 5J4UA 1X5CA 16GSA 3WT1A 3DVXA 1HNCA 2PPTA 2DJ2A 3Q18A 4EC0A 2AJQB 1GTUA 1U3IA 4K7NA 4N10A 1VRSD 1XOBA 1TI1A 4Z2RA 4QQ7A 3IBHA 4ZBBA 5D73A 2VCZA 4KGIA 1SL0B 4TVEA 4OFTA 4FYBA 2DSAA 1M9BA 2ES7A 5ID2A 1XWCA 2DMLA 3HYPA 3A2XA 1SD9A 3A2VA 2V41A 3R2QA 3F9UA 1SL2B 3GH6A 2H76A 3H93A 3ZVJA 4KSOA 3VWUA 1JZWA 1XVWA 2JACA 4XTSA 4USSA 4V2LA 4NPBA 4XS4B 2JSYA 2WDUA 2Z9SA 2RUEA 1XOAA 20GSA 4TOPA 2HZEB 1T1VA 1ZGNA 3WD6A 1M7TA 2MMAA 2IMDA 4N0VA 3EE2A 4KX4A 3ZZXA 1MDKA 4J57E 5CP1A 2L5OA 4X1UA 1TXXA 3F4TA 2FWGA 1ACVA 2LNTA 3F3RA 3HVXA 3Q74A 2C8UA 2GTUA 2DIYA 1FG4A 4J2FA 2CZ3A 4ZB9A 4Z2TA 1ERUA 1ZZYA 3D4MA 4KW6A 3D5JA 1M99A 4GSNA 5LNKe 3GSSA 3FK8A 4O5QA 1EGOA 5J9BA 4KE3A 2K8VA 3O6TA 4EE0A 4FYCA 2CVKA 3BCIA 2VL2A 4MDCA 2J23A 1QQ2A 2CX3A 2B1LA 2MMNA 4KH7A 1A0FA 4Q5QA 4BWSA 1XWKA 4K8MA 4NV5A 1GTAA 2YPMA 2M46A 4OCEA 3E9JB 2XC2A 1O85A 1IYHA 5AN1A 5G2ZA 2YCDA 3HVVA 1XG8A 1SK1A 4PQ1A 3TJFA 5H5QA 5IM9A 2F51A 3OR5A 1K0DA 4IELA 4KF9A 1WPIA 3TOUA 3RDWA 1V40A 5IOWA 1YF1A 3TDGA 3ZIVA 2CAIA 4FH8A 3VWWA 4KDYA 1C72A 2OBIA 3HDCA 18GSA 4IBPA 3TCOA 2VD1A 4HJMA 3NOFA 4XCSA 3U5RE 2A4HA 3MNGA 1AW9A 3UOMA 4K0NA 3TKSE 3LGCA 4V1Ag 1ZYEA 4MZBA 4MH3A 14GSA 3Q19A 1K3OA 1BQ7A 4HQZA 4TKYA 3CXGA 1ZMAA 4EO3A 3ZL5A 4K7IA 4GSSA 3L9VA 2M72A 1F3AA 1T00A 5CRWA 4MP4A 2PU9C 5DQYA 3FW2A 1PA3A 5HR3A 3M8NA 4MCUA 3H1NA 2IL3A 2GT5A 3VI5A 1WRYA 4BVYA 3G7JA 2IFQB 4D73B 2E2MA 4TR3A 2H73A 5ABRA 2GDRA 1QGVA 4TRXA 5IIZA 4RQXA 1TI3A 2C0FA 2H0GA 2OJLA 1KNGA 3I43A 2YWMA 1GSDA 1DSBA 1O8XA 3LJRA 2A4VA 4E8HA 2V6OA 4K7OA 1T7PB 1YZXA 3IAS2 4Q5NA 4PNFA 3IR4A 3VK9A 4EVMA 4PTSA 3HCZA 1QUWA 2QKEA 1N8JA 5CREA 4F0CA 4P3YB 1OC9A 4MF5A 4POLA 3C1RA 1UVZA 5GZZB 1HQOA 1J08A 2CZ2A 3VLNA 2DKIA 5ECMB 1TP9A 3VFIA 1QXHA 4ECIA 3FHKA 3TOTA 2NVLA 3H79A 2B7JA 5KOWA 5BMUA 2C0EA 1GUHA 2H1DA 3KM6A 3C73A 2WJUA 1GLQA 5HFIA 3CYNA 1MEKA 4DSSA 5IPGA 3D0ZA 1JLWA 1M2BA 1OE7A 1O8WA 2AAWA 3EMPA 2MMOA 1OVNA 2CVDA 1NHYA 1USBA 4AF2A 5ECNB 3KGKA 1M3JA 1EWXA 2BMXA 2H1AA 4MABA 2GSQA 2FUG2 3GFKA 4HZ2A 5GSTA 4DSRA 1B9XC 4WETA 4L8EA 1X5EA 1T8EB 3E0UA 4HDEA 4KCEA 4F03A 3APQA 4BA7A 3UBLA 4K0GA 4NMUA 2N5AA 4IW9A 2IN3A 1Y25A 2FLSA 4X4JA 1TKDB 3G9BA 3GTUA 4OD7A 2X64A 4MMMA 5A4WA 2EC4A 1URMA 4Q5RA 6GSYA 3QAVA 2H1BA 4O7HA 2H6XA 5IPHA 2R3XA 3TGZA 5CRDA 4K5RA 2FCHA 3BD2A 2O87A 4EIQA 3EMXA 2R6KA 4NXIA 4Q5FA 4ZL9A 4QL9A 5ID2B 2L59A 2H70A 2LRNA 1O6JA 2V6KA 3F63A 4GLTA 3IHGA 4JZQA 4WR5A 1LU4A 3JCML 1ILOA 2OA7A 2LJRA 1SL1B 4ILFA 3EYTA 5CAXA 1A24A 2A2PA 3VPQA 4ECJA 2ZNMA 3KP9A 4ICYA 4JBBA 3QD9A 3PR8A 4HU7A 2C4JA 1XW5A 2C0GA 5CRHA 2YJHA 2N5FA 3EWLA 2HXKA 4K2XA 2H6YA 4XRDA 2AV4A 2YN1A 2LRTA 1M2DA 3GIXA 3DXBA 5FWGA 3O76A 1K0AA 1X0RA 1KBNA 3GUSA 3GRXA 4E8EA 2GZZA 1MD3A 3P7XA 4JRRA 4ECCA 2F9SA 3GX8A 1TTZA 1YF0A 2PGTA 4YKFA 1FOHA 3CSHA 3GKMA 1A23A 1K0OA 3VI7A 3KJYA 3M0FA 1FVKA 3M3MA 3GNJA 3ZTLA 2HLSA 3IRAA 1GSSA 4JR4A 4L0UA 2B5EA 3KIJA 4HQSA 1AQWA 4FQUA 3M1GA 4TR4A 2YJ7A 3GL5A 1TK0B 4POKA 4K2DA 4OWYA 4PURA 1AXDA 1U88A 4G9HA 5D8IA 1DBYA 4I6XA 1TK5B 3HZ4A 2H66A 2FY6A 4GTUA 3PH9A 4CY8A 4ZXGA 1YY7A 2LS5A 2NPBA 1OKTA 3M9JA 6GSWA 2K18A 4MF7A 11GSA 4Z2UA 2R0GA 1FB0A 1FHEA 1Q4JA 2AHEA 2P5QA 3RAZA 1E2YA 4PUAA 3CSIA 3L9UA 1H4OA 2EIRA 1QMVA 2GS3A 4NV2A 1O73A 3ISOA 3FMWA 2F8FA 4EKZA 1KTEA 3HKRA 4MZCA 2WCIA 4IQAA 2L4CA 4HJ2A 1DE1A 12GSA 2HSYA 2O7KA 1ZYQB 1EGRA 5H5SA 2VAFA 1F37A 2WS2A 3KCMA 3FZAA 1YEXA 3CTGA 1TDIA 4BWQA 3KH7A 3QFBC 1JZDA 4V1Ap 1EP8A 3EURA 2WZ9A 4MPGA 3G7IA 5J41A 5KN2A 1DE2A 2GVPA 1E6BA 3DVWA 2AB6A 5J5NA 2GSSA 5ECHB 2JL4A 2DC5A 3F6DA 6GSUA 4BVXA 3CQFA 2JZRA 4G0IA 2IMKA 3AY8A 4L5OA 3LYKA 1GTIA 5DAKA 2JZTA 5ENUA 2DJ0A 1ZOFA 5AGYA 4O32A 4ZIJA 4XIHA 4IQ1A 1ZYPA 1NW2A 3LSZA 17GSA 1A2LA 5ECLB 3LXZA 3TRPA 3CMIA 3EVIA 5B8BA 4EIPA 3J7Yb 3W6GA 4AJ6A 4EXJA 2RIIA 1WOUA 1HNAA 3I9V2 5EVOA 5FT3A 3MYDA 1GP1A 1JZRA 5KOXA 1SD8A 1YKCA 5EL8A 1OKDA 1T4ZA 2VCVA 1TK8B 5ECQB 1M0UA 3LORA 1UN2A 3LW9A 2G2QA 4YQUA 2KP2A 5G1KA 1Z6NA 3UMAA 1K3YA 3ERFA 3CSJA 4L0WA 1TU8A 3F6FA 1FOVA 3ZYWA 3UJ1A 2DBCA 3ZLPA 1EOHA 2GLRA 2H6ZA 3HA9A 4OO5A 1MDJA 4G0LA 4ZILA 3C71A 1I9DA 3D4TA 2PVOC 2PWJA 2H71A 1Z3EA 1H75A 4KDUA 3GURA 3TRQA 4YH2A 2B3SA 2KP1A 2REMA 4TR1A 2MZCA 3FYGA 4IKHA 1S3CA 1WIKA 4K5SA 3N5OA 5JWOB 2H0HA 3A5IA 4N0ZA 1SYRA 4TR0A 4HSCX 3L0HA 2MYGA 4RQRA 1SKWB 3DMLA 5D9XA 5D96A 3GKKA 2I1UA 4H86A 4I2UA 5HR1A 3KH9A 5CO3A 2P31A 4ML6A 2ON5A 2O85A 2XBIA 3GSTA 4XS6A 1U6TA 1UA5A 1EZKA 2HSMA 1XWGA 2ZUPA 1BG5A 3ZIJA 1SK2A 3D21A 2R0CA 1Z5YE 3LWAA 1ERTA 3IV4A 4HZ4A 2OKAA 5F8BA 3ZRDA 5D9WA 1SJ6A 4IN0A 2C3QA 5H5RA 2LSTA 2LV3A 2E2GA 3O3TA 5B8AA 4FO5A 1XWAA 3ZMLA 3ME7A 4WBRD 1R5AA 1XPVA 5KN0A 4V2NA 2GT6A 3UEMA 1LBKA 4I97A 3DYRA 1PGTA 1G7OA 3DGQA 2X4AA 3C7MA 3IXRA 3QDNA 4EL1A 5DALB 2N5BA 4MJCA 2OADA 1S3RA 1GSYA 5GAND 3GKNA 3KTBA 4FIWA 2YV7A 4KSMA 2HZEA 1TW9A 6GSTA 5A4VA 5IMZA 3SBCA 4PX1A 1U87A 3MIXA 1GUMA 3FRCA 4PQIA 3IHQA 3WYWA 2KHPA 1B4QA 2OE3A 4MJBA 4BIKA 1EP7A 3HJPA 2CX4A 2IPAA 3RHCA 4I5QA 4K6XA 4IGJA 1XCCA 2OE0A 3IK9A 4KNDA 1B9YC 1LJRA 4IJIA 4J56E 4PUFC 1BAYA 2VLTA 3DIEA 3HVNA 1HNBA 4MZWA 4RI7A 3MAKA 5DDLA 3APOA 4ZBAA 4GF0A 5IQYA 2PUKC 1BX9A 1V98A 5HFGA 1G0TA 5JCGA 2VM2A 1GTBA 1DUGA 3GN3A 4RI6A 2K8SA 1HYUA 1QFNA 1VGLA 1FW1A 4AJ8A 1J9BA 2C0DA 2G0FA 1OC3A 2O8VB 3UVTA 2QSIA 4BL7A 1XVQA 1PSQA 1PMTA 2VCXA 3DD3A 4WF5A 4EDYA 4OFNA 5BRTA 2LJAA 3QR6A 1PL2A 2NBSA 3GA4A 5JWRB 4MK3A 3TKPA 2LEGA 1Z6MA 3KP8A 3UVHA 3EINA 2H8LA 1THOA 2LRCA 4HUAA 4ZB8A 4IHUA 3PGTA 2K9FA 1A8YA 1U3AA 3U6VA 4X43A 4G2EA 2F3MA 3IK7A 2NDOA 2IJYA 1V2AA 5AISA 4BVXB 3ERWA 2DLXA 4XHMA 2FA8A 5EPFA 3FY7A 4YAVA 4GQCA 2CVBA 1JHBA 2XHFA 1NHOA 3D6IA 2RM6A 1CQHA 4F2IA 9GSSA 3PINA 1T3BA 5DCGA 4CW9A 1GUKA 1ERWA 1ABAA 3GMFA 3HJMA 5JCWA 4X0XA 1AQXA 4ISDA 1YKAA 1XFLA 3EU3A 3VURA 5F0GA 2FNOA 2RUFA 5COHA 5GSSA 5C00A 1PKWA 2FA4A 2CT6A 1A0RP 3TJJA 1GWCA 2FD3A 3F0IA 1EEJA 1GLPA 1T4YA 2A2SA 2OE1A 2TRXA 3F8UA 4IVFA 3CBUA 4TW5A 2GQLA 3TRXA 3FZ9A 4EUYA 1G7EA 2IFQA 1GRXA 3ZVJD 1AIUA 2X8GA 4MA9A 3L9SA 2L6CA 3HHVA 4PQHA 4ZL7A 4KB3A 1BEDA 5DJMA 4RUVA 1YQ1A 2E0QA 1V58A 4N11A 3EU4A 1ZYNA 2L4QA 2MBTA 3ED3A 3TKRA 3W8SA 1XWBA 13GSA 4EDZA 2AYTA 1OYJA 2H74A 5FHIA 4OCFA 3WGXA 2RM5A 5A5KA 2I81A 2VIMA 1MTCA 2CV4A 3V1WA 3TKSA 2OACA 3I6AA 5DQSA 5HFKA 3ZFBA 5IMAA 4WR4A 5HR2A 4A5PA 2H72A 5J3RA 3QOUA 5J9CA 3IOSA 4OFMA 2GZPA 3WT2A 2DJ1A 2VCTA 2WRTA 1X5DA 2L57A 3TKQA 1HD2A 1Q98A 4MPFA 1G6YA 4EF0A 5C04A 2A2RA 2VOCA 4LMVA 3RBTA 1RK4A 3UAPA 1I5GA 2JADA 1TRUA 1PRXA 3KMNA 3WGEA 4ACSA 2I9HA 3LYPA 3QMXA 2YWNA 2IWTA 4YKGA 3GL3A 2XPDA 1THXA 1S3DA 2R4VA 4IS0A 2B6MA 1SJIA 2HYXA 1XBSA 2JU5A 4LMWA 5LCZA 2PBJA 5ECIB 5DJLA 4F82A 3CRTA 1R7HA 22GSA 1WJKA 3TB2A 4KDXA 4AGSA 4JR6A 1IYIA 2GSRA 2CQ9A 1X9MB 2CAQA 1V9WA 1TOFA 5DBQA 2MBSA 2EIQA 5KN1A 3IC4A 5ECPB 3GYKA 3FZ5A 1F2EA 4BVYB 1GL8A 3J7Yk 3MSZA 3R3EA 5EY6A 3ZREA 2VUPA 4MJEA 4GQFA 1M9AA 2F8AA 4GXZA 1AAZA 5ECRB 3F4RA 2H1GA 3FR6A 5G5FA 2LJKA 4IP6A 5IMCA 2KUCA
chains in the Genus database with same CATH topology
2FWEA 1JLVA 4NAXA 1FAAA 8GSSA 3E3EA 3KTLA 1TU7A 2JSZA 3MWHA 4TN8A 4G0KA 4LLRA 2AUVA 2GZYA 4AJ7A 1AQVA 2LQQA 2K6VA 2WFCA 1Z7RA 3NIVA 1SK0A 3KD0A 4QL7A 1OC9B 2LKUA 4YQMA 2HE3A 1GNEA 1G6WA 2DJJA 2QA1A 2V32A 2WULA 3D22A 5IMDA 1YDKA 4I8BA 2IMIA 4ULXA 1GSFA 1JFUA 3LEFA 3IA1A 2JZSA 5CNWA 4JU5A 4KUNA 5CYYA 2VCQA 5KN3A 4WBJA 3LFLA 1WMJA 4NHZA 4DSSB 2GGTA 2TIRA 7GSSA 2VCWA 1Z7PA 4ZBDA 1K0BA 5G30A 1PX7A 1VF3A 1JZOA 1KEBA 1SYXA 4GSTA 1M2AA 4KCAA 1PN9A 5G31A 2R0PA 1B8XA 1PQNA 4BL7B 1UC7A 3IC8A 5G1LA 3TUEA 4K1FA 2XPEA 5B6MA 5JWQB 3A5WA 1ON4A 4I2TA 4TXVA 2VL2C 1GNWA 3KZQA 2PERA 3GTUB 4MJAA 1BYEA 3F3QA 3M9KA 1ZCPA 4MH2A 2DKHA 1O81A 2YWIA 3FR3A 3A3TA 1F6MC 2VLVA 4IP1A 2H19A 2HRKA 2YZHA 5DVBA 4TXOA 2VLUA 1GSQA 3FKFA 1PKZA 1GULA 2HFDA 4ID0A 1K3LA 2ON7A 1OE8A 1GSUA 2HRNA 2M80A 1OC8A 3G7YA 3RHBA 1YJ6A 3BCKA 4GCIA 4DVCA 4CDOA 10GSA 4WEYA 3GKXA 2X99A 5F06A 1XW6A 3I69A 1WWJA 4ECBA 4GRFA 1VF2A 4LL4B 1F3BA 2PVQA 1TJDA 2OBKA 1V57A 5HQPA 2H75A 5G5EA 2MMZA 2C80A 2C1YA 3GHAA 4YQVA 2LUSA 2QA2A 1K0MA 1NM3A 5B6NA 2P0GA 2WB9A 1X9SB 1R5PA 3MDKA 3RPNA 1NSWA 3EC3A 3QFAC 3ZITA 5E4WA 3HY2A 4OMVA 5B7CA 1N2AA 2IMFA 5IMFA 2R5GA 1F9MA 1PN0A 5A4UA 3ZMKA 1PL1A 5JCUA 4ZB6A 4IJ3A 3BJ5A 2X49A 4PNGA 4HU9A 2YOIA 1TRSA 2P5RA 3QPMA 4DSQA 1ML6A 1PD21 3IDVA 3DRNA 2WGRA 3EPTA 3A2WA 1GH2A 3VWXA 1SENA 4XS4A 3KEBA 3N9JA 3FEUA 4WF4A 2FHEA 2O89A 2YZUA 2H0IA 5L71A 1ERVA 1X9WB 3L4NA 4WKWA 4CHSA 2HRAA 2HZFA 3DWVA 4O92A 5INYA 4NWYA 3BBYA 3QCPA 1SJZA 1VF4A 5D9VA 3C1SA 2DMMA 1XW9A 2HSHA 2L6DA 6GSXA 3KMOA 1W4VA 3IPZA 5F07A 3KXOA 3BOAA 4L5LA 4BPYA 2HNLA 4XS1A 2IMEA 4O5UA 2DJKA 2R37A 1PX6A 1XXUA 4V2MA 4FYUA 1WE0A 2B5XA 5ELGA 1R4WA 4WXTA 2YP6A 3S9FA 3FZ4A 1FB6A 2V2GA 3DKSA 2R2JA 3CRUA 1RW1A 3Q6OA 5E59A 2X8CA 4PXOA 2BTOT 2DJ3A 4HOJA 1FO5A 2YNXA 2XBQA 4MLYA 2VM1A 3IE3A 1BJXA 3LQ7A 1O7UA 4K9ZA 1VF1A 4KA0A 3RPPA 1AUCA 2B1KA 1MDIA 1K0NA 4ML1A 1CQGA 1QK8A 3LG6A 2FGXA 2I4AA 2C3NA 4MF6A 2QC7A 1FVJA 2YANA 5ELAA 3HVSA 5IOXA 5KEJA 3H4KA 1S3AA 2GQMA 2B7KA 5HR0A 2HI7A 5D93A 5IO0A 4HEA2 5DAKB 2KLXA 4F9ZA 4LL1B 1XIYA 3ERGA 2L5LA 2QGVA 3APSA 1AC1A 4DEJA 3IAM2 3VPTA 1B48A 2VO4A 3QAWA 1WP0A 4ZL8A 3HD5A 1A8LA 2FWFA 3QAGA 2PN8A 2HRFA 3P2AA 3DEXA 2PMTA 5CRGA 1ST9A 4JE1A 2B5YA 3GH9A 3TJKA 2FWHA 4G10A 1TRWA 1A2JA 4NHWA 4GWRA 3K8NA 2CA8A 5ECKB 2EIOA 1SKSB 3HXSA 3CTFA 2TRCP 4HS1A 4D73A 6GSSA 2X8HA 2IIYA 2E7PA 5D9TA 3UL3A 5LD0A 3UIWA 3UARA 2GQKA 3US3A 3FR9A 2RLIA 2BJXA 2HT9A 4MNNA 5DALA 4POMA 4O5RA 4XRAA 2D2ZA 1MD4A 1ZL9A 3F4SA 3W8JA 2ZCTA 1Y6EA 1SU9A 1Z9HA 3GV1A 4OO4A 3LXTA 4CY6A 1B4PA 5ECOB 5IMVA 1K0CA 2I3YA 2LNSA 6GSVA 1EV4A 3HZ8A 1R26A 3GX0A 4N30A 3H8QA 3ME8A 4HI7A 2GSTA 2J9HA 1RQMA 2VL3A 2UZ8A 2LTKA 1J0FA 4TR1B 4YAPA 1YEPA 1GSEA 2YV9A 3P90A 19GSA 5AIXA 1TRVA 2LQOA 5DCHA 2C3TA 5IO2A 4KAEA 4PGTA 2YWOA 2VD0A 4POBA 1OAZA 5ECSA 3ZFLA 3L78A 2NTOA 3VWVA 2DIZA 2KOKA 3PPUA 3TJBA 5AIVA 3P8WA 3C8EA 4LA1A 2H01A 4Z7XA 2V1MA 4TXOB 1EOGA 3TJGA 1XZOA 3UBKA 2VL9A 3WGDA 4F0BA 2H30A 5GAPD 4G19A 1EV9A 1A2MA 3HJOA 1SKRB 3SWLA 3TKSC 4JEDA 5F05A 3NZNA 1EEMA 2ALBA 1W89A 5J4UA 1X5CA 16GSA 3WT1A 3DVXA 1HNCA 2PPTA 2DJ2A 3Q18A 4EC0A 2AJQB 1GTUA 1U3IA 4K7NA 4N10A 1VRSD 1XOBA 1TI1A 4Z2RA 4QQ7A 3IBHA 4ZBBA 5D73A 2VCZA 4KGIA 1SL0B 4TVEA 4OFTA 4FYBA 2DSAA 1M9BA 2ES7A 5ID2A 1XWCA 2DMLA 3HYPA 3A2XA 1SD9A 3A2VA 2V41A 3R2QA 3F9UA 1SL2B 3GH6A 2H76A 3H93A 3ZVJA 4KSOA 3VWUA 1JZWA 1XVWA 2JACA 4XTSA 4USSA 4V2LA 4NPBA 4XS4B 2JSYA 2WDUA 2Z9SA 2RUEA 1XOAA 20GSA 4TOPA 2HZEB 1T1VA 1ZGNA 3WD6A 1M7TA 2MMAA 2IMDA 4N0VA 3EE2A 4KX4A 3ZZXA 1MDKA 4J57E 5CP1A 2L5OA 4X1UA 1TXXA 3F4TA 2FWGA 1ACVA 2LNTA 3F3RA 3HVXA 3Q74A 2C8UA 2GTUA 2DIYA 1FG4A 4J2FA 2CZ3A 4ZB9A 4Z2TA 1ERUA 1ZZYA 3D4MA 4KW6A 3D5JA 1M99A 4GSNA 5LNKe 3GSSA 3FK8A 4O5QA 1EGOA 5J9BA 4KE3A 2K8VA 3O6TA 4EE0A 4FYCA 2CVKA 3BCIA 2VL2A 4MDCA 2J23A 1QQ2A 2CX3A 2B1LA 2MMNA 4KH7A 1A0FA 4Q5QA 4BWSA 1XWKA 4K8MA 4NV5A 1GTAA 2YPMA 2M46A 4OCEA 3E9JB 2XC2A 1O85A 1IYHA 5AN1A 5G2ZA 2YCDA 3HVVA 1SK1A 4PQ1A 3TJFA 5H5QA 5IM9A 2F51A 3OR5A 1K0DA 4IELA 4KF9A 1WPIA 3TOUA 3RDWA 1V40A 5IOWA 1YF1A 3TDGA 3ZIVA 2CAIA 4FH8A 3VWWA 4KDYA 1C72A 2OBIA 3HDCA 18GSA 4IBPA 3TCOA 2VD1A 4HJMA 3NOFA 4XCSA 3U5RE 2A4HA 3MNGA 1AW9A 3UOMA 4K0NA 3TKSE 3LGCA 4V1Ag 1ZYEA 4MZBA 4MH3A 14GSA 3Q19A 1K3OA 1BQ7A 4HQZA 4TKYA 3CXGA 1ZMAA 4EO3A 3ZL5A 4K7IA 4GSSA 3L9VA 2M72A 1F3AA 1T00A 5CRWA 4MP4A 2PU9C 5DQYA 3FW2A 1PA3A 5HR3A 3M8NA 4MCUA 3H1NA 2IL3A 2GT5A 3VI5A 1WRYA 4BVYA 3G7JA 2IFQB 4D73B 2E2MA 4TR3A 2H73A 5ABRA 2GDRA 1QGVA 4TRXA 5IIZA 4RQXA 1TI3A 2C0FA 2H0GA 2OJLA 1KNGA 3I43A 2YWMA 1GSDA 1DSBA 1O8XA 3LJRA 2A4VA 4E8HA 2V6OA 4K7OA 1T7PB 1YZXA 3IAS2 4Q5NA 4PNFA 3IR4A 3VK9A 4EVMA 4PTSA 3HCZA 1QUWA 2QKEA 1N8JA 5CREA 4F0CA 4P3YB 1OC9A 4MF5A 4POLA 3C1RA 1UVZA 5GZZB 1HQOA 1J08A 2CZ2A 3VLNA 2DKIA 5ECMB 1TP9A 3VFIA 1QXHA 4ECIA 3FHKA 3TOTA 2NVLA 3H79A 2B7JA 5KOWA 5BMUA 2C0EA 1GUHA 2H1DA 3KM6A 3C73A 2WJUA 1GLQA 5HFIA 3CYNA 1MEKA 4DSSA 5IPGA 3D0ZA 1JLWA 1M2BA 1OE7A 1O8WA 2AAWA 3EMPA 2MMOA 1OVNA 2CVDA 1NHYA 1USBA 4AF2A 5ECNB 3KGKA 1EWXA 2BMXA 2H1AA 4MABA 2GSQA 2FUG2 3GFKA 4HZ2A 5GSTA 4DSRA 1B9XC 4WETA 4L8EA 1X5EA 1T8EB 3E0UA 4HDEA 4KCEA 4F03A 3APQA 4BA7A 3UBLA 4K0GA 4NMUA 2N5AA 4IW9A 2IN3A 1Y25A 2FLSA 4X4JA 1TKDB 3G9BA 3GTUA 4OD7A 2X64A 4MMMA 5A4WA 2EC4A 1URMA 4Q5RA 6GSYA 3QAVA 2H1BA 4O7HA 2H6XA 5IPHA 2R3XA 3TGZA 5CRDA 4K5RA 2FCHA 3BD2A 2O87A 4EIQA 3EMXA 2R6KA 4NXIA 4Q5FA 4ZL9A 4QL9A 5ID2B 2L59A 2H70A 2LRNA 1O6JA 2V6KA 3F63A 4GLTA 3IHGA 4JZQA 4WR5A 1LU4A 3JCML 1ILOA 2OA7A 2LJRA 1SL1B 4ILFA 3EYTA 5CAXA 1A24A 2A2PA 3VPQA 4ECJA 2ZNMA 3KP9A 4ICYA 4JBBA 3QD9A 3PR8A 4HU7A 2C4JA 1XW5A 2C0GA 5CRHA 2YJHA 2N5FA 3EWLA 2HXKA 4K2XA 2H6YA 4XRDA 2AV4A 2YN1A 2LRTA 1M2DA 3GIXA 3DXBA 5FWGA 3O76A 1K0AA 1X0RA 1KBNA 3GUSA 3GRXA 4E8EA 2GZZA 1MD3A 3P7XA 4JRRA 4ECCA 2F9SA 3GX8A 1TTZA 1YF0A 2PGTA 4YKFA 1FOHA 3CSHA 3GKMA 1A23A 1K0OA 3VI7A 3KJYA 3M0FA 1FVKA 3M3MA 3GNJA 3ZTLA 2HLSA 3IRAA 1GSSA 4JR4A 4L0UA 2B5EA 3KIJA 4HQSA 1AQWA 4FQUA 3M1GA 4TR4A 2YJ7A 3GL5A 1TK0B 4POKA 4K2DA 4OWYA 4PURA 1AXDA 1U88A 4G9HA 5D8IA 1DBYA 4I6XA 1TK5B 3HZ4A 2H66A 2FY6A 4GTUA 3PH9A 4CY8A 4ZXGA 1YY7A 2LS5A 2NPBA 1OKTA 3M9JA 6GSWA 2K18A 4MF7A 11GSA 4Z2UA 2R0GA 1FB0A 1FHEA 1Q4JA 2AHEA 2P5QA 3RAZA 1E2YA 4PUAA 3CSIA 3L9UA 1H4OA 2EIRA 1QMVA 2GS3A 4NV2A 1O73A 3ISOA 3FMWA 2F8FA 4EKZA 1KTEA 3HKRA 4MZCA 2WCIA 4IQAA 2L4CA 4HJ2A 1DE1A 12GSA 2HSYA 2O7KA 1ZYQB 1EGRA 5H5SA 2VAFA 1F37A 2WS2A 3KCMA 3FZAA 1YEXA 3CTGA 1TDIA 4BWQA 3KH7A 3QFBC 1JZDA 4V1Ap 1EP8A 3EURA 2WZ9A 4MPGA 3G7IA 5J41A 5KN2A 1DE2A 2GVPA 1E6BA 3DVWA 2AB6A 5J5NA 2GSSA 5ECHB 2JL4A 2DC5A 3F6DA 6GSUA 4BVXA 2JZRA 4G0IA 2IMKA 3AY8A 4L5OA 3LYKA 1GTIA 5DAKA 2JZTA 5ENUA 2DJ0A 1ZOFA 5AGYA 4O32A 4ZIJA 4XIHA 4IQ1A 1ZYPA 1NW2A 3LSZA 17GSA 1A2LA 5ECLB 3LXZA 3TRPA 3CMIA 3EVIA 5B8BA 4EIPA 3J7Yb 3W6GA 4AJ6A 4EXJA 2RIIA 1WOUA 1HNAA 3I9V2 5EVOA 5FT3A 3MYDA 1GP1A 1JZRA 5KOXA 1SD8A 1YKCA 5EL8A 1OKDA 1T4ZA 2VCVA 1TK8B 5ECQB 1M0UA 3LORA 1UN2A 3LW9A 2G2QA 4YQUA 2KP2A 5G1KA 1Z6NA 3UMAA 1K3YA 3ERFA 3CSJA 4L0WA 1TU8A 3F6FA 1FOVA 3ZYWA 3UJ1A 2DBCA 3ZLPA 1EOHA 2GLRA 2H6ZA 3HA9A 4OO5A 1MDJA 4G0LA 4ZILA 3C71A 1I9DA 3D4TA 2PVOC 2PWJA 2H71A 1Z3EA 1H75A 4KDUA 3GURA 3TRQA 4YH2A 2B3SA 2KP1A 2REMA 4TR1A 2MZCA 3FYGA 4IKHA 1S3CA 1WIKA 4K5SA 3N5OA 5JWOB 2H0HA 3A5IA 4N0ZA 1SYRA 4TR0A 3L0HA 2MYGA 4RQRA 1SKWB 3DMLA 5D9XA 5D96A 3GKKA 2I1UA 4H86A 4I2UA 5HR1A 3KH9A 5CO3A 2P31A 4ML6A 2ON5A 2O85A 2XBIA 3GSTA 4XS6A 1U6TA 1UA5A 1EZKA 2HSMA 1XWGA 2ZUPA 1BG5A 3ZIJA 1SK2A 3D21A 2R0CA 1Z5YE 3LWAA 1ERTA 3IV4A 4HZ4A 2OKAA 5F8BA 3ZRDA 5D9WA 1SJ6A 4IN0A 2C3QA 5H5RA 2LSTA 2LV3A 2E2GA 3O3TA 5B8AA 4FO5A 1XWAA 3ZMLA 3ME7A 4WBRD 1R5AA 1XPVA 5KN0A 4V2NA 2GT6A 3UEMA 1LBKA 4I97A 3DYRA 1PGTA 1G7OA 3DGQA 2X4AA 3C7MA 3IXRA 3QDNA 4EL1A 5DALB 2N5BA 4MJCA 2OADA 1GSYA 5GAND 3GKNA 3KTBA 4FIWA 2YV7A 4KSMA 2HZEA 1TW9A 6GSTA 5A4VA 5IMZA 3SBCA 4PX1A 1U87A 3MIXA 1GUMA 3FRCA 4PQIA 3IHQA 3WYWA 2KHPA 1B4QA 2OE3A 4MJBA 1EP7A 3HJPA 2CX4A 2IPAA 3RHCA 4I5QA 4K6XA 4IGJA 1XCCA 2OE0A 3IK9A 4KNDA 1B9YC 1LJRA 4IJIA 4J56E 4PUFC 1BAYA 2VLTA 3DIEA 1HNBA 4MZWA 4RI7A 3MAKA 5DDLA 3APOA 4ZBAA 4GF0A 5IQYA 2PUKC 1BX9A 1V98A 5HFGA 1G0TA 5JCGA 2VM2A 1GTBA 1DUGA 3GN3A 4RI6A 2K8SA 1HYUA 1QFNA 1VGLA 1FW1A 4AJ8A 1J9BA 2C0DA 2G0FA 1OC3A 2O8VB 3UVTA 2QSIA 4BL7A 1XVQA 1PSQA 1PMTA 2VCXA 3DD3A 4WF5A 4EDYA 4OFNA 5BRTA 2LJAA 3QR6A 1PL2A 2NBSA 3GA4A 5JWRB 4MK3A 3TKPA 2LEGA 1Z6MA 3KP8A 3UVHA 3EINA 2H8LA 1THOA 2LRCA 4HUAA 4ZB8A 4IHUA 3PGTA 2K9FA 1A8YA 1U3AA 3U6VA 4X43A 4G2EA 2F3MA 3IK7A 2NDOA 2IJYA 1V2AA 5AISA 4BVXB 3ERWA 2DLXA 4XHMA 2FA8A 5EPFA 3FY7A 4YAVA 4GQCA 2CVBA 1JHBA 2XHFA 1NHOA 3D6IA 2RM6A 1CQHA 4F2IA 9GSSA 3PINA 1T3BA 5DCGA 4CW9A 1GUKA 1ERWA 1ABAA 3GMFA 3HJMA 5JCWA 4X0XA 1AQXA 4ISDA 1YKAA 1XFLA 3EU3A 3VURA 5F0GA 2FNOA 2RUFA 5COHA 5GSSA 5C00A 1PKWA 2FA4A 2CT6A 1A0RP 3TJJA 1GWCA 2FD3A 3F0IA 1EEJA 1GLPA 1T4YA 2A2SA 2OE1A 2TRXA 3F8UA 4IVFA 3CBUA 4TW5A 2GQLA 3TRXA 3FZ9A 4EUYA 1G7EA 2IFQA 1GRXA 3ZVJD 1AIUA 2X8GA 4MA9A 3L9SA 2L6CA 3HHVA 4PQHA 4ZL7A 4KB3A 1BEDA 5DJMA 4RUVA 1YQ1A 2E0QA 1V58A 4N11A 3EU4A 1ZYNA 2L4QA 2MBTA 3ED3A 3TKRA 3W8SA 1XWBA 13GSA 4EDZA 2AYTA 1OYJA 2H74A 5FHIA 4OCFA 3WGXA 2RM5A 5A5KA 2I81A 2VIMA 1MTCA 2CV4A 3V1WA 3TKSA 2OACA 3I6AA 5DQSA 5HFKA 3ZFBA 5IMAA 4WR4A 5HR2A 4A5PA 2H72A 5J3RA 3QOUA 5J9CA 3IOSA 4OFMA 2GZPA 3WT2A 2DJ1A 2VCTA 2WRTA 1X5DA 2L57A 3TKQA 1HD2A 1Q98A 4MPFA 1G6YA 4EF0A 5C04A 2A2RA 2VOCA 4LMVA 3RBTA 1RK4A 3UAPA 1I5GA 2JADA 1TRUA 1PRXA 3KMNA 3WGEA 4ACSA 2I9HA 3LYPA 3QMXA 2YWNA 2IWTA 4YKGA 3GL3A 2XPDA 1THXA 1S3DA 2R4VA 4IS0A 2B6MA 1SJIA 2HYXA 1XBSA 2JU5A 4LMWA 5LCZA 2PBJA 5ECIB 5DJLA 4F82A 3CRTA 1R7HA 22GSA 1WJKA 3TB2A 4KDXA 4AGSA 4JR6A 1IYIA 2GSRA 2CQ9A 1X9MB 2CAQA 1V9WA 1TOFA 5DBQA 2MBSA 2EIQA 5KN1A 3IC4A 5ECPB 3GYKA 3FZ5A 1F2EA 4BVYB 1GL8A 3J7Yk 3MSZA 3R3EA 5EY6A 3ZREA 2VUPA 4MJEA 4GQFA 1M9AA 2F8AA 4GXZA 1AAZA 5ECRB 3F4RA 2H1GA 3FR6A 5G5FA 2LJKA 4IP6A 5IMCA 2KUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FWE A;  1JLV A;  4NAX A;  1FAA A;  8GSS A;  3E3E A;  3KTL A;  1TU7 A;  2JSZ A;  3MWH A;  4TN8 A;  4LLR A;  2AUV A;  2GZY A;  4AJ7 A;  1AQV A;  2LQQ A;  2K6V A;  2WFC A;  1Z7R A;  3NIV A;  1SK0 A;  3KD0 A;  4QL7 A;  1OC9 B;  2LKU A;  4YQM A;  2HE3 A;  1GNE A;  1G6W A;  2DJJ A;  2V32 A;  2WUL A;  3D22 A;  5IMD A;  1YDK A;  4I8B A;  2IMI A;  4ULX A;  1GSF A;  1JFU A;  3LEF A;  3IA1 A;  2JZS A;  5CNW A;  4JU5 A;  4KUN A;  5CYY A;  2VCQ A;  5KN3 A;  4WBJ A;  3LFL A;  1WMJ A;  4NHZ A;  4DSS B;  2GGT A;  2TIR A;  7GSS A;  2VCW A;  1Z7P A;  4ZBD A;  1K0B A;  5G30 A;  1PX7 A;  1VF3 A;  1JZO A;  1KEB A;  1SYX A;  4GST A;  1M2A A;  4KCA A;  1PN9 A;  5G31 A;  1B8X A;  1PQN A;  1UC7 A;  5G1L A;  3TUE A;  4K1F A;  2XPE A;  5B6M A;  5JWQ B;  3A5W A;  1ON4 A;  4I2T A;  4TXV A;  2VL2 C;  1GNW A;  3KZQ A;  2PER A;  3GTU B;  4MJA A;  1BYE A;  3F3Q A;  3M9K A;  1ZCP A;  4MH2 A;  1O81 A;  2YWI A;  3FR3 A;  3A3T A;  1F6M C;  2VLV A;  4IP1 A;  2H19 A;  2YZH A;  5DVB A;  4TXO A;  2VLU A;  1GSQ A;  3FKF A;  1PKZ A;  1GUL A;  2HFD A;  4ID0 A;  1K3L A;  2ON7 A;  1OE8 A;  1GSU A;  2HRN A;  2M80 A;  1OC8 A;  3G7Y A;  3RHB A;  1YJ6 A;  3BCK A;  4GCI A;  4DVC A;  4CDO A;  10GS A;  4WEY A;  3GKX A;  2X99 A;  5F06 A;  1XW6 A;  3I69 A;  1WWJ A;  4ECB A;  4GRF A;  1VF2 A;  4LL4 B;  1F3B A;  2PVQ A;  1TJD A;  2OBK A;  1V57 A;  5HQP A;  2H75 A;  5G5E A;  2MMZ A;  2C80 A;  2C1Y A;  3GHA A;  4YQV A;  2LUS A;  1K0M A;  1NM3 A;  5B6N A;  2P0G A;  2WB9 A;  1X9S B;  1R5P A;  3MDK A;  3RPN A;  1NSW A;  3EC3 A;  3QFA C;  3ZIT A;  5E4W A;  3HY2 A;  4OMV A;  5B7C A;  1N2A A;  2IMF A;  5IMF A;  2R5G A;  1F9M A;  5A4U A;  3ZMK A;  1PL1 A;  5JCU A;  4ZB6 A;  4IJ3 A;  3BJ5 A;  4PNG A;  4HU9 A;  2YOI A;  1TRS A;  2P5R A;  3QPM A;  4DSQ A;  1ML6 A;  1PD2 1;  3IDV A;  3DRN A;  2WGR A;  3A2W A;  1GH2 A;  3VWX A;  1SEN A;  4XS4 A;  3KEB A;  3N9J A;  3FEU A;  4WF4 A;  2FHE A;  2O89 A;  2YZU A;  2H0I A;  5L71 A;  1ERV A;  1X9W B;  3L4N A;  4WKW A;  4CHS A;  2HZF A;  3DWV A;  4O92 A;  5INY A;  4NWY A;  3BBY A;  3QCP A;  1SJZ A;  1VF4 A;  5D9V A;  3C1S A;  2DMM A;  1XW9 A;  2HSH A;  2L6D A;  6GSX A;  3KMO A;  1W4V A;  3IPZ A;  5F07 A;  3KXO A;  3BOA A;  4L5L A;  4BPY A;  2HNL A;  4XS1 A;  2IME A;  2DJK A;  2R37 A;  1PX6 A;  1XXU A;  4V2M A;  4FYU A;  1WE0 A;  2B5X A;  5ELG A;  1R4W A;  4WXT A;  2YP6 A;  3S9F A;  3FZ4 A;  1FB6 A;  2V2G A;  3DKS A;  2R2J A;  3CRU A;  1RW1 A;  3Q6O A;  5E59 A;  2X8C A;  4PXO A;  2BTO T;  2DJ3 A;  4HOJ A;  1FO5 A;  2YNX A;  2XBQ A;  4MLY A;  2VM1 A;  3IE3 A;  1BJX A;  3LQ7 A;  1O7U A;  4K9Z A;  1VF1 A;  4KA0 A;  3RPP A;  1AUC A;  2B1K A;  1MDI A;  1K0N A;  4ML1 A;  1CQG A;  1QK8 A;  3LG6 A;  2FGX A;  2I4A A;  2C3N A;  4MF6 A;  2QC7 A;  1FVJ A;  2YAN A;  5ELA A;  3HVS A;  5IOX A;  5KEJ A;  3H4K A;  1S3A A;  2GQM A;  2B7K A;  5HR0 A;  2HI7 A;  5D93 A;  5IO0 A;  4HEA 2;  5DAK B;  2KLX A;  4F9Z A;  4LL1 B;  1XIY A;  3ERG A;  2L5L A;  2QGV A;  3APS A;  1AC1 A;  4DEJ A;  3IAM 2;  3VPT A;  1B48 A;  2VO4 A;  3QAW A;  1WP0 A;  4ZL8 A;  3HD5 A;  1A8L A;  2FWF A;  3QAG A;  2PN8 A;  2HRF A;  3P2A A;  3DEX A;  2PMT A;  5CRG A;  1ST9 A;  4JE1 A;  2B5Y A;  3GH9 A;  3TJK A;  2FWH A;  4G10 A;  1TRW A;  1A2J A;  4NHW A;  4GWR A;  3K8N A;  2CA8 A;  5ECK B;  2EIO A;  1SKS B;  3HXS A;  3CTF A;  2TRC P;  4HS1 A;  4D73 A;  6GSS A;  2X8H A;  2IIY A;  2E7P A;  5D9T A;  3UL3 A;  5LD0 A;  3UIW A;  3UAR A;  2GQK A;  3US3 A;  3FR9 A;  2RLI A;  2BJX A;  2HT9 A;  5DAL A;  4POM A;  4O5R A;  4XRA A;  2D2Z A;  1MD4 A;  1ZL9 A;  3F4S A;  3W8J A;  2ZCT A;  1Y6E A;  1SU9 A;  1Z9H A;  3GV1 A;  4OO4 A;  3LXT A;  1B4P A;  5ECO B;  5IMV A;  1K0C A;  2I3Y A;  2LNS A;  6GSV A;  1EV4 A;  3HZ8 A;  1R26 A;  3GX0 A;  4N30 A;  3H8Q A;  3ME8 A;  4HI7 A;  2GST A;  2J9H A;  1RQM A;  2VL3 A;  2LTK A;  1J0F A;  4TR1 B;  4YAP A;  1YEP A;  1GSE A;  2YV9 A;  3P90 A;  19GS A;  5AIX A;  1TRV A;  2LQO A;  5DCH A;  2C3T A;  5IO2 A;  4KAE A;  4PGT A;  2YWO A;  2VD0 A;  4POB A;  1OAZ A;  5ECS A;  3ZFL A;  3L78 A;  2NTO A;  3VWV A;  2DIZ A;  2KOK A;  3TJB A;  5AIV A;  3P8W A;  3C8E A;  4LA1 A;  2H01 A;  4Z7X A;  2V1M A;  4TXO B;  1EOG A;  3TJG A;  1XZO A;  3UBK A;  2VL9 A;  3WGD A;  4F0B A;  2H30 A;  5GAP D;  4G19 A;  1EV9 A;  1A2M A;  3HJO A;  1SKR B;  3SWL A;  3TKS C;  4JED A;  5F05 A;  3NZN A;  1EEM A;  2ALB A;  1W89 A;  5J4U A;  1X5C A;  16GS A;  3WT1 A;  3DVX A;  1HNC A;  2PPT A;  2DJ2 A;  3Q18 A;  4EC0 A;  2AJQ B;  1GTU A;  1U3I A;  4K7N A;  4N10 A;  1VRS D;  1XOB A;  1TI1 A;  4QQ7 A;  3IBH A;  4ZBB A;  5D73 A;  2VCZ A;  4KGI A;  1SL0 B;  4TVE A;  4OFT A;  4FYB A;  2DSA A;  1M9B A;  2ES7 A;  5ID2 A;  1XWC A;  2DML A;  3HYP A;  3A2X A;  1SD9 A;  3A2V A;  2V41 A;  3R2Q A;  3F9U A;  1SL2 B;  3GH6 A;  2H76 A;  3H93 A;  3ZVJ A;  4KSO A;  3VWU A;  1JZW A;  1XVW A;  2JAC A;  4XTS A;  4V2L A;  4NPB A;  4XS4 B;  2JSY A;  2WDU A;  2Z9S A;  2RUE A;  1XOA A;  20GS A;  4TOP A;  2HZE B;  1T1V A;  1ZGN A;  3WD6 A;  1M7T A;  2MMA A;  2IMD A;  4N0V A;  3EE2 A;  4KX4 A;  3ZZX A;  1MDK A;  4J57 E;  5CP1 A;  2L5O A;  4X1U A;  1TXX A;  3F4T A;  2FWG A;  1ACV A;  2LNT A;  3F3R A;  3HVX A;  3Q74 A;  2C8U A;  2GTU A;  2DIY A;  1FG4 A;  4J2F A;  2CZ3 A;  4ZB9 A;  1ERU A;  1ZZY A;  3D4M A;  4KW6 A;  3D5J A;  1M99 A;  4GSN A;  5LNK e;  3GSS A;  3FK8 A;  1EGO A;  5J9B A;  4KE3 A;  2K8V A;  3O6T A;  4EE0 A;  4FYC A;  2CVK A;  3BCI A;  2VL2 A;  4MDC A;  2J23 A;  1QQ2 A;  2CX3 A;  2B1L A;  2MMN A;  4KH7 A;  1A0F A;  4Q5Q A;  4BWS A;  1XWK A;  4K8M A;  4NV5 A;  1GTA A;  2YPM A;  2M46 A;  4OCE A;  3E9J B;  2XC2 A;  1O85 A;  1IYH A;  5AN1 A;  5G2Z A;  2YCD A;  3HVV A;  1SK1 A;  4PQ1 A;  3TJF A;  5H5Q A;  5IM9 A;  2F51 A;  3OR5 A;  1K0D A;  4IEL A;  1WPI A;  3TOU A;  3RDW A;  1V40 A;  5IOW A;  1YF1 A;  3TDG A;  3ZIV A;  2CAI A;  4FH8 A;  3VWW A;  4KDY A;  1C72 A;  2OBI A;  3HDC A;  18GS A;  4IBP A;  3TCO A;  2VD1 A;  4HJM A;  3NOF A;  4XCS A;  3U5R E;  3MNG A;  1AW9 A;  3UOM A;  4K0N A;  3TKS E;  3LGC A;  4V1A g;  1ZYE A;  4MZB A;  4MH3 A;  14GS A;  3Q19 A;  1K3O A;  1BQ7 A;  4HQZ A;  4TKY A;  3CXG A;  1ZMA A;  4EO3 A;  3ZL5 A;  4K7I A;  4GSS A;  3L9V A;  2M72 A;  1F3A A;  1T00 A;  5CRW A;  4MP4 A;  2PU9 C;  5DQY A;  3FW2 A;  1PA3 A;  5HR3 A;  3M8N A;  4MCU A;  3H1N A;  2IL3 A;  2GT5 A;  3VI5 A;  1WRY A;  4BVY A;  3G7J A;  2IFQ B;  4D73 B;  2E2M A;  4TR3 A;  2H73 A;  5ABR A;  2GDR A;  1QGV A;  4TRX A;  5IIZ A;  4RQX A;  1TI3 A;  2C0F A;  2H0G A;  2OJL A;  1KNG A;  3I43 A;  2YWM A;  1GSD A;  1DSB A;  1O8X A;  3LJR A;  2A4V A;  4E8H A;  2V6O A;  4K7O A;  1T7P B;  1YZX A;  3IAS 2;  4Q5N A;  4PNF A;  3IR4 A;  3VK9 A;  4EVM A;  3HCZ A;  1QUW A;  2QKE A;  1N8J A;  5CRE A;  4F0C A;  4P3Y B;  1OC9 A;  4MF5 A;  4POL A;  3C1R A;  1UVZ A;  5GZZ B;  1HQO A;  1J08 A;  2CZ2 A;  3VLN A;  5ECM B;  1TP9 A;  3VFI A;  1QXH A;  4ECI A;  3FHK A;  3TOT A;  2NVL A;  3H79 A;  2B7J A;  2C0E A;  1GUH A;  2H1D A;  3KM6 A;  3C73 A;  2WJU A;  1GLQ A;  5HFI A;  3CYN A;  1MEK A;  4DSS A;  5IPG A;  3D0Z A;  1JLW A;  1M2B A;  1OE7 A;  1O8W A;  2AAW A;  3EMP A;  2MMO A;  1OVN A;  2CVD A;  1NHY A;  1USB A;  4AF2 A;  3KGK A;  1EWX A;  2BMX A;  2H1A A;  4MAB A;  2GSQ A;  2FUG 2;  3GFK A;  4HZ2 A;  5GST A;  4DSR A;  1B9X C;  4WET A;  4L8E A;  1X5E A;  1T8E B;  3E0U A;  4HDE A;  4KCE A;  4F03 A;  3APQ A;  4BA7 A;  3UBL A;  4K0G A;  4NMU A;  2N5A A;  4IW9 A;  2IN3 A;  1Y25 A;  2FLS A;  1TKD B;  3G9B A;  3GTU A;  4OD7 A;  2X64 A;  4MMM A;  5A4W A;  2EC4 A;  1URM A;  4Q5R A;  6GSY A;  3QAV A;  2H1B A;  4O7H A;  2H6X A;  5IPH A;  2R3X A;  3TGZ A;  5CRD A;  2FCH A;  3BD2 A;  2O87 A;  3EMX A;  2R6K A;  4NXI A;  4Q5F A;  4ZL9 A;  4QL9 A;  2KUC A;  5ID2 B;  2L59 A;  2H70 A;  2LRN A;  1O6J A;  2V6K A;  3F63 A;  4GLT A;  4JZQ A;  4WR5 A;  1LU4 A;  3JCM L;  1ILO A;  2OA7 A;  2LJR A;  1SL1 B;  4ILF A;  3EYT A;  5CAX A;  1A24 A;  3VPQ A;  4ECJ A;  2ZNM A;  3KP9 A;  4JBB A;  3QD9 A;  3PR8 A;  4HU7 A;  2C4J A;  1XW5 A;  2C0G A;  5CRH A;  2YJH A;  2N5F A;  3EWL A;  2HXK A;  2H6Y A;  4XRD A;  2AV4 A;  2YN1 A;  2LRT A;  1M2D A;  3GIX A;  3DXB A;  5FWG A;  3O76 A;  1K0A A;  1X0R A;  1KBN A;  3GUS A;  3GRX A;  4E8E A;  2GZZ A;  1MD3 A;  3P7X A;  4JRR A;  4ECC A;  2F9S A;  3GX8 A;  1TTZ A;  1YF0 A;  2PGT A;  3CSH A;  3GKM A;  1A23 A;  1K0O A;  3VI7 A;  3KJY A;  3M0F A;  1FVK A;  3M3M A;  3GNJ A;  3ZTL A;  2HLS A;  3IRA A;  1GSS A;  4JR4 A;  4L0U A;  2B5E A;  3KIJ A;  4HQS A;  1AQW A;  3M1G A;  4TR4 A;  2YJ7 A;  3GL5 A;  1TK0 B;  4POK A;  4K2D A;  4OWY A;  4PUR A;  1AXD A;  1U88 A;  4G9H A;  5D8I A;  1DBY A;  4I6X A;  1TK5 B;  3HZ4 A;  2H66 A;  2FY6 A;  4GTU A;  3PH9 A;  4ZXG A;  1YY7 A;  2LS5 A;  2NPB A;  1OKT A;  3M9J A;  6GSW A;  2K18 A;  4MF7 A;  11GS A;  1FB0 A;  1FHE A;  1Q4J A;  2AHE A;  2P5Q A;  3RAZ A;  1E2Y A;  4PUA A;  3CSI A;  3L9U A;  1H4O A;  2EIR A;  1QMV A;  2GS3 A;  4NV2 A;  1O73 A;  3ISO A;  2F8F A;  4EKZ A;  1KTE A;  3HKR A;  4MZC A;  2WCI A;  4IQA A;  2L4C A;  4HJ2 A;  1DE1 A;  12GS A;  2HSY A;  2O7K A;  1ZYQ B;  1EGR A;  5H5S A;  2VAF A;  1F37 A;  2WS2 A;  3KCM A;  3FZA A;  1YEX A;  3CTG A;  1TDI A;  4BWQ A;  3KH7 A;  3QFB C;  1JZD A;  4V1A p;  1EP8 A;  3EUR A;  2WZ9 A;  4MPG A;  3G7I A;  5J41 A;  5KN2 A;  1DE2 A;  2GVP A;  1E6B A;  3DVW A;  2AB6 A;  5J5N A;  2GSS A;  5ECH B;  2JL4 A;  2DC5 A;  3F6D A;  6GSU A;  4BVX A;  2JZR A;  2IMK A;  3AY8 A;  4L5O A;  3LYK A;  1GTI A;  5DAK A;  2JZT A;  5ENU A;  2DJ0 A;  1ZOF A;  5AGY A;  4O32 A;  4ZIJ A;  4XIH A;  4IQ1 A;  1NW2 A;  3LSZ A;  17GS A;  1A2L A;  5ECL B;  3LXZ A;  3TRP A;  3CMI A;  3EVI A;  5B8B A;  3J7Y b;  3W6G A;  4AJ6 A;  4EXJ A;  2RII A;  1WOU A;  1HNA A;  3I9V 2;  5EVO A;  5FT3 A;  1GP1 A;  1JZR A;  1SD8 A;  1YKC A;  5EL8 A;  1OKD A;  1T4Z A;  2VCV A;  1TK8 B;  5ECQ B;  1M0U A;  3LOR A;  1UN2 A;  2G2Q A;  4YQU A;  2KP2 A;  5G1K A;  1Z6N A;  3UMA A;  1K3Y A;  3ERF A;  3CSJ A;  4L0W A;  1TU8 A;  3F6F A;  1FOV A;  3ZYW A;  3UJ1 A;  2DBC A;  3ZLP A;  1EOH A;  2GLR A;  2H6Z A;  3HA9 A;  4OO5 A;  1MDJ A;  4ZIL A;  3C71 A;  1I9D A;  3D4T A;  2PVO C;  2PWJ A;  2H71 A;  1Z3E A;  1H75 A;  4KDU A;  3GUR A;  3TRQ A;  4YH2 A;  2B3S A;  2KP1 A;  2REM A;  4TR1 A;  2MZC A;  3FYG A;  4IKH A;  1S3C A;  1WIK A;  3N5O A;  5JWO B;  2H0H A;  4N0Z A;  1SYR A;  4TR0 A;  3L0H A;  2MYG A;  4RQR A;  1SKW B;  3DML A;  5D9X A;  5D96 A;  3GKK A;  2I1U A;  4H86 A;  4I2U A;  5HR1 A;  3KH9 A;  5CO3 A;  2P31 A;  4ML6 A;  2ON5 A;  2O85 A;  2XBI A;  3GST A;  4XS6 A;  1U6T A;  1UA5 A;  1EZK A;  1XWG A;  2ZUP A;  1BG5 A;  3ZIJ A;  1SK2 A;  3D21 A;  1Z5Y E;  3LWA A;  1ERT A;  3IV4 A;  4HZ4 A;  2OKA A;  5F8B A;  3ZRD A;  5D9W A;  1SJ6 A;  4IN0 A;  2C3Q A;  5H5R A;  2LST A;  2LV3 A;  2E2G A;  3O3T A;  5B8A A;  4FO5 A;  1XWA A;  3ZML A;  3ME7 A;  4WBR D;  1R5A A;  1XPV A;  5KN0 A;  4V2N A;  2GT6 A;  3UEM A;  1LBK A;  4I97 A;  3DYR A;  1PGT A;  1G7O A;  3DGQ A;  3C7M A;  3IXR A;  3QDN A;  4EL1 A;  5DAL B;  2N5B A;  4MJC A;  2OAD A;  1GSY A;  5GAN D;  3GKN A;  3KTB A;  4FIW A;  2YV7 A;  4KSM A;  2HZE A;  1TW9 A;  6GST A;  5A4V A;  5IMZ A;  3SBC A;  4PX1 A;  1U87 A;  1GUM A;  3FRC A;  4PQI A;  3IHQ A;  3WYW A;  2KHP A;  1B4Q A;  2OE3 A;  4MJB A;  1EP7 A;  3HJP A;  2CX4 A;  2IPA A;  3RHC A;  4I5Q A;  4K6X A;  4IGJ A;  1XCC A;  2OE0 A;  3IK9 A;  4KND A;  1B9Y C;  1LJR A;  4IJI A;  4J56 E;  4PUF C;  1BAY A;  2VLT A;  3DIE A;  1HNB A;  4MZW A;  4RI7 A;  3MAK A;  5DDL A;  3APO A;  4ZBA A;  4GF0 A;  5IQY A;  2PUK C;  1BX9 A;  1V98 A;  5HFG A;  1G0T A;  5JCG A;  2VM2 A;  1GTB A;  1DUG A;  3GN3 A;  4RI6 A;  2K8S A;  1HYU A;  1QFN A;  1VGL A;  1FW1 A;  4AJ8 A;  1J9B A;  2C0D A;  2G0F A;  1OC3 A;  2O8V B;  3UVT A;  2QSI A;  4BL7 A;  1XVQ A;  1PSQ A;  1PMT A;  2VCX A;  3DD3 A;  4WF5 A;  4EDY A;  4OFN A;  2LJA A;  3QR6 A;  1PL2 A;  2NBS A;  3GA4 A;  5JWR B;  4MK3 A;  3TKP A;  2LEG A;  1Z6M A;  3KP8 A;  3UVH A;  3EIN A;  2H8L A;  1THO A;  2LRC A;  4HUA A;  4ZB8 A;  4IHU A;  3PGT A;  2K9F A;  1A8Y A;  1U3A A;  3U6V A;  4X43 A;  4G2E A;  2F3M A;  3IK7 A;  2NDO A;  2IJY A;  1V2A A;  5AIS A;  3ERW A;  2DLX A;  4XHM A;  2FA8 A;  5EPF A;  3FY7 A;  4YAV A;  4GQC A;  2CVB A;  1JHB A;  2XHF A;  1NHO A;  3D6I A;  2RM6 A;  1CQH A;  4F2I A;  9GSS A;  3PIN A;  1T3B A;  5DCG A;  4CW9 A;  1GUK A;  1ERW A;  1ABA A;  3GMF A;  3HJM A;  5JCW A;  4X0X A;  1AQX A;  4ISD A;  1YKA A;  1XFL A;  3EU3 A;  3VUR A;  5F0G A;  2FNO A;  2RUF A;  5COH A;  5GSS A;  5C00 A;  1PKW A;  2FA4 A;  2CT6 A;  1A0R P;  3TJJ A;  1GWC A;  2FD3 A;  3F0I A;  1EEJ A;  1GLP A;  1T4Y A;  2A2S A;  2OE1 A;  2TRX A;  3F8U A;  4IVF A;  3CBU A;  4TW5 A;  2GQL A;  3TRX A;  3FZ9 A;  4EUY A;  1G7E A;  2IFQ A;  1GRX A;  3ZVJ D;  1AIU A;  2X8G A;  4MA9 A;  3L9S A;  2L6C A;  3HHV A;  4PQH A;  4ZL7 A;  4KB3 A;  1BED A;  5DJM A;  4RUV A;  1YQ1 A;  2E0Q A;  1V58 A;  4N11 A;  3EU4 A;  2L4Q A;  2MBT A;  3ED3 A;  3TKR A;  3W8S A;  1XWB A;  13GS A;  4EDZ A;  2AYT A;  1OYJ A;  2H74 A;  5FHI A;  4OCF A;  3WGX A;  2RM5 A;  5A5K A;  2I81 A;  2VIM A;  1MTC A;  2CV4 A;  3V1W A;  3TKS A;  2OAC A;  3I6A A;  5DQS A;  5HFK A;  3ZFB A;  5IMA A;  4WR4 A;  5HR2 A;  2H72 A;  5J3R A;  3QOU A;  5J9C A;  3IOS A;  4OFM A;  2GZP A;  3WT2 A;  2DJ1 A;  2VCT A;  2WRT A;  1X5D A;  2L57 A;  3TKQ A;  1HD2 A;  1Q98 A;  4MPF A;  1G6Y A;  4EF0 A;  5C04 A;  2A2R A;  2VOC A;  4LMV A;  3RBT A;  1RK4 A;  3UAP A;  1I5G A;  2JAD A;  1TRU A;  1PRX A;  3KMN A;  3WGE A;  4ACS A;  2I9H A;  3LYP A;  3QMX A;  2YWN A;  2IWT A;  3GL3 A;  2XPD A;  1THX A;  1S3D A;  2R4V A;  4IS0 A;  2B6M A;  1SJI A;  2HYX A;  1XBS A;  2JU5 A;  4LMW A;  5LCZ A;  2PBJ A;  5ECI B;  5DJL A;  4F82 A;  3CRT A;  1R7H A;  22GS A;  1WJK A;  3TB2 A;  4KDX A;  4AGS A;  4JR6 A;  1IYI A;  2GSR A;  2CQ9 A;  1X9M B;  2CAQ A;  1V9W A;  1TOF A;  5DBQ A;  2MBS A;  2EIQ A;  5KN1 A;  3IC4 A;  5ECP B;  3GYK A;  3FZ5 A;  1F2E A;  1GL8 A;  3J7Y k;  3MSZ A;  5EY6 A;  3ZRE A;  2VUP A;  4MJE A;  4GQF A;  1M9A A;  2F8A A;  4GXZ A;  1AAZ A;  5ECR B;  3F4R A;  2H1G A;  3FR6 A;  5G5F A;  2LJK A;  4IP6 A;  5IMC A;  5ECN B; 
#chains in the Genus database with same CATH topology
 2FWE A;  1JLV A;  4NAX A;  1FAA A;  8GSS A;  3E3E A;  3KTL A;  1TU7 A;  2JSZ A;  3MWH A;  4TN8 A;  4G0K A;  4LLR A;  2AUV A;  2GZY A;  4AJ7 A;  1AQV A;  2LQQ A;  2K6V A;  2WFC A;  1Z7R A;  3NIV A;  1SK0 A;  3KD0 A;  4QL7 A;  1OC9 B;  2LKU A;  4YQM A;  2HE3 A;  1GNE A;  1G6W A;  2DJJ A;  2QA1 A;  2V32 A;  2WUL A;  3D22 A;  5IMD A;  1YDK A;  4I8B A;  2IMI A;  4ULX A;  1GSF A;  1JFU A;  3LEF A;  3IA1 A;  2JZS A;  5CNW A;  4JU5 A;  4KUN A;  5CYY A;  2VCQ A;  5KN3 A;  4WBJ A;  3LFL A;  1WMJ A;  4NHZ A;  4DSS B;  2GGT A;  2TIR A;  7GSS A;  2VCW A;  1Z7P A;  4ZBD A;  1K0B A;  5G30 A;  1PX7 A;  1VF3 A;  1JZO A;  1KEB A;  1SYX A;  4GST A;  1M2A A;  4KCA A;  1PN9 A;  5G31 A;  2R0P A;  1B8X A;  1PQN A;  4BL7 B;  1UC7 A;  3IC8 A;  5G1L A;  3TUE A;  4K1F A;  2XPE A;  5B6M A;  5JWQ B;  3A5W A;  1ON4 A;  1M3I A;  4I2T A;  4TXV A;  2VL2 C;  1GNW A;  3KZQ A;  2PER A;  3GTU B;  4MJA A;  1BYE A;  3F3Q A;  3M9K A;  1ZCP A;  4MH2 A;  2DKH A;  1O81 A;  2YWI A;  3FR3 A;  3A3T A;  1F6M C;  2VLV A;  4IP1 A;  1PFO A;  2H19 A;  2HRK A;  2YZH A;  5DVB A;  4TXO A;  2VLU A;  1GSQ A;  3FKF A;  1PKZ A;  1GUL A;  2HFD A;  4ID0 A;  1K3L A;  2ON7 A;  1OE8 A;  1GSU A;  2HRN A;  2M80 A;  1OC8 A;  3G7Y A;  3RHB A;  1YJ6 A;  3BCK A;  4GCI A;  4DVC A;  4CDO A;  10GS A;  4WEY A;  3GKX A;  2X99 A;  5F06 A;  1XW6 A;  3I69 A;  1WWJ A;  4ECB A;  4GRF A;  1VF2 A;  4LL4 B;  1F3B A;  2PVQ A;  1TJD A;  2OBK A;  1V57 A;  5HQP A;  2H75 A;  5G5E A;  2MMZ A;  2C80 A;  2C1Y A;  3GHA A;  4YQV A;  2LUS A;  2QA2 A;  1K0M A;  1NM3 A;  5B6N A;  2P0G A;  2WB9 A;  1X9S B;  1R5P A;  3MDK A;  3RPN A;  1NSW A;  3EC3 A;  3QFA C;  3ZIT A;  5E4W A;  3HY2 A;  4OMV A;  5B7C A;  1N2A A;  2IMF A;  5IMF A;  2R5G A;  1F9M A;  1PN0 A;  5A4U A;  3ZMK A;  1PL1 A;  5JCU A;  4ZB6 A;  4IJ3 A;  3BJ5 A;  2X49 A;  4PNG A;  4HU9 A;  2YOI A;  1TRS A;  2P5R A;  3QPM A;  4DSQ A;  1ML6 A;  1PD2 1;  3IDV A;  3DRN A;  2WGR A;  3EPT A;  3A2W A;  1GH2 A;  3VWX A;  1SEN A;  4XS4 A;  3KEB A;  3N9J A;  3FEU A;  4WF4 A;  2FHE A;  2O89 A;  2YZU A;  2H0I A;  5L71 A;  1ERV A;  1X9W B;  3L4N A;  4WKW A;  4CHS A;  2HRA A;  2HZF A;  3DWV A;  4O92 A;  5INY A;  4NWY A;  3BBY A;  3QCP A;  1SJZ A;  1VF4 A;  5D9V A;  3C1S A;  2DMM A;  1XW9 A;  2HSH A;  2L6D A;  6GSX A;  3KMO A;  1W4V A;  3IPZ A;  5F07 A;  3KXO A;  3BOA A;  4L5L A;  4BPY A;  2HNL A;  4XS1 A;  2IME A;  4O5U A;  2DJK A;  2R37 A;  1PX6 A;  1XXU A;  4V2M A;  4FYU A;  1WE0 A;  2B5X A;  5ELG A;  1R4W A;  4WXT A;  2YP6 A;  3S9F A;  3FZ4 A;  1FB6 A;  2V2G A;  3DKS A;  2R2J A;  3CRU A;  1RW1 A;  3Q6O A;  5E59 A;  2X8C A;  4PXO A;  2BTO T;  2DJ3 A;  4HOJ A;  1FO5 A;  2YNX A;  2XBQ A;  4MLY A;  2VM1 A;  3IE3 A;  1BJX A;  3LQ7 A;  1O7U A;  4K9Z A;  1VF1 A;  4KA0 A;  3RPP A;  1AUC A;  2B1K A;  1MDI A;  1K0N A;  4ML1 A;  1CQG A;  1QK8 A;  3LG6 A;  2FGX A;  2I4A A;  2C3N A;  4MF6 A;  2QC7 A;  1FVJ A;  2YAN A;  5ELA A;  3HVS A;  5IOX A;  5KEJ A;  3H4K A;  1S3A A;  2GQM A;  2B7K A;  5HR0 A;  2HI7 A;  5D93 A;  5IO0 A;  4HEA 2;  5DAK B;  2KLX A;  4F9Z A;  4LL1 B;  1XIY A;  3ERG A;  2L5L A;  2QGV A;  3APS A;  1AC1 A;  4DEJ A;  3IAM 2;  3VPT A;  1B48 A;  2VO4 A;  3QAW A;  1WP0 A;  4ZL8 A;  3HD5 A;  1A8L A;  2FWF A;  3QAG A;  2PN8 A;  2HRF A;  3P2A A;  3DEX A;  2PMT A;  5CRG A;  1ST9 A;  4JE1 A;  2B5Y A;  3GH9 A;  3TJK A;  2FWH A;  4G10 A;  1TRW A;  1A2J A;  4NHW A;  4GWR A;  3K8N A;  2CA8 A;  5ECK B;  2EIO A;  1SKS B;  3HXS A;  3CTF A;  2TRC P;  4HS1 A;  4D73 A;  6GSS A;  2X8H A;  2IIY A;  2E7P A;  5D9T A;  3UL3 A;  5LD0 A;  3UIW A;  3UAR A;  2GQK A;  3US3 A;  3FR9 A;  2RLI A;  2BJX A;  2HT9 A;  4MNN A;  5DAL A;  4POM A;  4O5R A;  4XRA A;  2D2Z A;  1MD4 A;  1ZL9 A;  3F4S A;  3W8J A;  2ZCT A;  1Y6E A;  1SU9 A;  1Z9H A;  3GV1 A;  4OO4 A;  3LXT A;  4CY6 A;  1B4P A;  5ECO B;  5IMV A;  1K0C A;  2I3Y A;  2LNS A;  6GSV A;  1EV4 A;  3HZ8 A;  1R26 A;  3GX0 A;  4N30 A;  3H8Q A;  3ME8 A;  4HI7 A;  2GST A;  2J9H A;  1RQM A;  2VL3 A;  2UZ8 A;  2LTK A;  1J0F A;  4TR1 B;  4YAP A;  1YEP A;  1GSE A;  2YV9 A;  3P90 A;  19GS A;  5AIX A;  1TRV A;  2LQO A;  5DCH A;  2C3T A;  5IO2 A;  4KAE A;  4PGT A;  2YWO A;  2VD0 A;  4POB A;  1OAZ A;  5ECS A;  3ZFL A;  3L78 A;  2NTO A;  3VWV A;  2DIZ A;  2KOK A;  3PPU A;  3TJB A;  5AIV A;  3P8W A;  3C8E A;  4LA1 A;  2H01 A;  4Z7X A;  2V1M A;  4TXO B;  1EOG A;  3TJG A;  1XZO A;  3UBK A;  2VL9 A;  3WGD A;  4F0B A;  2H30 A;  5GAP D;  4G19 A;  1EV9 A;  1A2M A;  3HJO A;  1SKR B;  3SWL A;  3TKS C;  4JED A;  5F05 A;  3NZN A;  1EEM A;  2ALB A;  1W89 A;  5J4U A;  1X5C A;  16GS A;  3WT1 A;  3DVX A;  1HNC A;  2PPT A;  2DJ2 A;  3Q18 A;  4EC0 A;  2AJQ B;  1GTU A;  1U3I A;  4K7N A;  4N10 A;  1VRS D;  1XOB A;  1TI1 A;  4Z2R A;  4QQ7 A;  3IBH A;  4ZBB A;  5D73 A;  2VCZ A;  4KGI A;  1SL0 B;  4TVE A;  4OFT A;  4FYB A;  2DSA A;  1M9B A;  2ES7 A;  5ID2 A;  1XWC A;  2DML A;  3HYP A;  3A2X A;  1SD9 A;  3A2V A;  2V41 A;  3R2Q A;  3F9U A;  1SL2 B;  3GH6 A;  2H76 A;  3H93 A;  3ZVJ A;  4KSO A;  3VWU A;  1JZW A;  1XVW A;  2JAC A;  4XTS A;  4USS A;  4V2L A;  4NPB A;  4XS4 B;  2JSY A;  2WDU A;  2Z9S A;  2RUE A;  1XOA A;  20GS A;  4TOP A;  2HZE B;  1T1V A;  1ZGN A;  3WD6 A;  1M7T A;  2MMA A;  2IMD A;  4N0V A;  3EE2 A;  4KX4 A;  3ZZX A;  1MDK A;  4J57 E;  5CP1 A;  2L5O A;  4X1U A;  1TXX A;  3F4T A;  2FWG A;  1ACV A;  2LNT A;  3F3R A;  3HVX A;  3Q74 A;  2C8U A;  2GTU A;  2DIY A;  1FG4 A;  4J2F A;  2CZ3 A;  4ZB9 A;  4Z2T A;  1ERU A;  1ZZY A;  3D4M A;  4KW6 A;  3D5J A;  1M99 A;  4GSN A;  5LNK e;  3GSS A;  3FK8 A;  4O5Q A;  1EGO A;  5J9B A;  4KE3 A;  2K8V A;  3O6T A;  4EE0 A;  4FYC A;  2CVK A;  3BCI A;  2VL2 A;  4MDC A;  2J23 A;  1QQ2 A;  2CX3 A;  2B1L A;  2MMN A;  4KH7 A;  1A0F A;  4Q5Q A;  4BWS A;  1XWK A;  4K8M A;  4NV5 A;  1GTA A;  2YPM A;  2M46 A;  4OCE A;  3E9J B;  2XC2 A;  1O85 A;  1IYH A;  5AN1 A;  5G2Z A;  2YCD A;  3HVV A;  1XG8 A;  1SK1 A;  4PQ1 A;  3TJF A;  5H5Q A;  5IM9 A;  2F51 A;  3OR5 A;  1K0D A;  4IEL A;  4KF9 A;  1WPI A;  3TOU A;  3RDW A;  1V40 A;  5IOW A;  1YF1 A;  3TDG A;  3ZIV A;  2CAI A;  4FH8 A;  3VWW A;  4KDY A;  1C72 A;  2OBI A;  3HDC A;  18GS A;  4IBP A;  3TCO A;  2VD1 A;  4HJM A;  3NOF A;  4XCS A;  3U5R E;  2A4H A;  3MNG A;  1AW9 A;  3UOM A;  4K0N A;  3TKS E;  3LGC A;  4V1A g;  1ZYE A;  4MZB A;  4MH3 A;  14GS A;  3Q19 A;  1K3O A;  1BQ7 A;  4HQZ A;  4TKY A;  3CXG A;  1ZMA A;  4EO3 A;  3ZL5 A;  4K7I A;  4GSS A;  3L9V A;  2M72 A;  1F3A A;  1T00 A;  5CRW A;  4MP4 A;  2PU9 C;  5DQY A;  3FW2 A;  1PA3 A;  5HR3 A;  3M8N A;  4MCU A;  3H1N A;  2IL3 A;  2GT5 A;  3VI5 A;  1WRY A;  4BVY A;  3G7J A;  2IFQ B;  4D73 B;  2E2M A;  4TR3 A;  2H73 A;  5ABR A;  2GDR A;  1QGV A;  4TRX A;  5IIZ A;  4RQX A;  1TI3 A;  2C0F A;  2H0G A;  2OJL A;  1KNG A;  3I43 A;  2YWM A;  1GSD A;  1DSB A;  1O8X A;  3LJR A;  2A4V A;  4E8H A;  2V6O A;  4K7O A;  1T7P B;  1YZX A;  3IAS 2;  4Q5N A;  4PNF A;  3IR4 A;  3VK9 A;  4EVM A;  4PTS A;  3HCZ A;  1QUW A;  2QKE A;  1N8J A;  5CRE A;  4F0C A;  4P3Y B;  1OC9 A;  4MF5 A;  4POL A;  3C1R A;  1UVZ A;  5GZZ B;  1HQO A;  1J08 A;  2CZ2 A;  3VLN A;  2DKI A;  5ECM B;  1TP9 A;  3VFI A;  1QXH A;  4ECI A;  3FHK A;  3TOT A;  2NVL A;  3H79 A;  2B7J A;  5KOW A;  5BMU A;  2C0E A;  1GUH A;  2H1D A;  3KM6 A;  3C73 A;  2WJU A;  1GLQ A;  5HFI A;  3CYN A;  1MEK A;  4DSS A;  5IPG A;  3D0Z A;  1JLW A;  1M2B A;  1OE7 A;  1O8W A;  2AAW A;  3EMP A;  2MMO A;  1OVN A;  2CVD A;  1NHY A;  1USB A;  4AF2 A;  5ECN B;  3KGK A;  1M3J A;  1EWX A;  2BMX A;  2H1A A;  4MAB A;  2GSQ A;  2FUG 2;  3GFK A;  4HZ2 A;  5GST A;  4DSR A;  1B9X C;  4WET A;  4L8E A;  1X5E A;  1T8E B;  3E0U A;  4HDE A;  4KCE A;  4F03 A;  3APQ A;  4BA7 A;  3UBL A;  4K0G A;  4NMU A;  2N5A A;  4IW9 A;  2IN3 A;  1Y25 A;  2FLS A;  4X4J A;  1TKD B;  3G9B A;  3GTU A;  4OD7 A;  2X64 A;  4MMM A;  5A4W A;  2EC4 A;  1URM A;  4Q5R A;  6GSY A;  3QAV A;  2H1B A;  4O7H A;  2H6X A;  5IPH A;  2R3X A;  3TGZ A;  5CRD A;  4K5R A;  2FCH A;  3BD2 A;  2O87 A;  4EIQ A;  3EMX A;  2R6K A;  4NXI A;  4Q5F A;  4ZL9 A;  4QL9 A;  5ID2 B;  2L59 A;  2H70 A;  2LRN A;  1O6J A;  2V6K A;  3F63 A;  4GLT A;  3IHG A;  4JZQ A;  4WR5 A;  1LU4 A;  3JCM L;  1ILO A;  2OA7 A;  2LJR A;  1SL1 B;  4ILF A;  3EYT A;  5CAX A;  1A24 A;  2A2P A;  3VPQ A;  4ECJ A;  2ZNM A;  3KP9 A;  4ICY A;  4JBB A;  3QD9 A;  3PR8 A;  4HU7 A;  2C4J A;  1XW5 A;  2C0G A;  5CRH A;  2YJH A;  2N5F A;  3EWL A;  2HXK A;  4K2X A;  2H6Y A;  4XRD A;  2AV4 A;  2YN1 A;  2LRT A;  1M2D A;  3GIX A;  3DXB A;  5FWG A;  3O76 A;  1K0A A;  1X0R A;  1KBN A;  3GUS A;  3GRX A;  4E8E A;  2GZZ A;  1MD3 A;  3P7X A;  4JRR A;  4ECC A;  2F9S A;  3GX8 A;  1TTZ A;  1YF0 A;  2PGT A;  4YKF A;  1FOH A;  3CSH A;  3GKM A;  1A23 A;  1K0O A;  3VI7 A;  3KJY A;  3M0F A;  1FVK A;  3M3M A;  3GNJ A;  3ZTL A;  2HLS A;  3IRA A;  1GSS A;  4JR4 A;  4L0U A;  2B5E A;  3KIJ A;  4HQS A;  1AQW A;  4FQU A;  3M1G A;  4TR4 A;  2YJ7 A;  3GL5 A;  1TK0 B;  4POK A;  4K2D A;  4OWY A;  4PUR A;  1AXD A;  1U88 A;  4G9H A;  5D8I A;  1DBY A;  4I6X A;  1TK5 B;  3HZ4 A;  2H66 A;  2FY6 A;  4GTU A;  3PH9 A;  4CY8 A;  4ZXG A;  1YY7 A;  2LS5 A;  2NPB A;  1OKT A;  3M9J A;  6GSW A;  2K18 A;  4MF7 A;  11GS A;  4Z2U A;  2R0G A;  1FB0 A;  1FHE A;  1Q4J A;  2AHE A;  2P5Q A;  3RAZ A;  1E2Y A;  4PUA A;  3CSI A;  3L9U A;  1H4O A;  2EIR A;  1QMV A;  2GS3 A;  4NV2 A;  1O73 A;  3ISO A;  3FMW A;  2F8F A;  4EKZ A;  1KTE A;  3HKR A;  4MZC A;  2WCI A;  4IQA A;  2L4C A;  4HJ2 A;  1DE1 A;  12GS A;  2HSY A;  2O7K A;  1ZYQ B;  1EGR A;  5H5S A;  2VAF A;  1F37 A;  2WS2 A;  3KCM A;  3FZA A;  1YEX A;  3CTG A;  1TDI A;  4BWQ A;  3KH7 A;  3QFB C;  1JZD A;  4V1A p;  1EP8 A;  3EUR A;  2WZ9 A;  4MPG A;  3G7I A;  5J41 A;  5KN2 A;  1DE2 A;  2GVP A;  1E6B A;  3DVW A;  2AB6 A;  5J5N A;  2GSS A;  5ECH B;  2JL4 A;  2DC5 A;  3F6D A;  6GSU A;  4BVX A;  3CQF A;  2JZR A;  4G0I A;  2IMK A;  3AY8 A;  4L5O A;  3LYK A;  1GTI A;  5DAK A;  2JZT A;  5ENU A;  2DJ0 A;  1ZOF A;  5AGY A;  4O32 A;  4ZIJ A;  4XIH A;  4IQ1 A;  1ZYP A;  1NW2 A;  3LSZ A;  17GS A;  1A2L A;  5ECL B;  3LXZ A;  3TRP A;  3CMI A;  3EVI A;  5B8B A;  4EIP A;  3J7Y b;  3W6G A;  4AJ6 A;  4EXJ A;  2RII A;  1WOU A;  1HNA A;  3I9V 2;  5EVO A;  5FT3 A;  3MYD A;  1GP1 A;  1JZR A;  5KOX A;  1SD8 A;  1YKC A;  5EL8 A;  1OKD A;  1T4Z A;  2VCV A;  1TK8 B;  5ECQ B;  1M0U A;  3LOR A;  1UN2 A;  3LW9 A;  2G2Q A;  4YQU A;  2KP2 A;  5G1K A;  1Z6N A;  3UMA A;  1K3Y A;  3ERF A;  3CSJ A;  4L0W A;  1TU8 A;  3F6F A;  1FOV A;  3ZYW A;  3UJ1 A;  2DBC A;  3ZLP A;  1EOH A;  2GLR A;  2H6Z A;  3HA9 A;  4OO5 A;  1MDJ A;  4G0L A;  4ZIL A;  3C71 A;  1I9D A;  3D4T A;  2PVO C;  2PWJ A;  2H71 A;  1Z3E A;  1H75 A;  4KDU A;  3GUR A;  3TRQ A;  4YH2 A;  2B3S A;  2KP1 A;  2REM A;  4TR1 A;  2MZC A;  3FYG A;  4IKH A;  1S3C A;  1WIK A;  4K5S A;  3N5O A;  5JWO B;  2H0H A;  3A5I A;  4N0Z A;  1SYR A;  4TR0 A;  4HSC X;  3L0H A;  2MYG A;  4RQR A;  1SKW B;  3DML A;  5D9X A;  5D96 A;  3GKK A;  2I1U A;  4H86 A;  4I2U A;  5HR1 A;  3KH9 A;  5CO3 A;  2P31 A;  4ML6 A;  2ON5 A;  2O85 A;  2XBI A;  3GST A;  4XS6 A;  1U6T A;  1UA5 A;  1EZK A;  2HSM A;  1XWG A;  2ZUP A;  1BG5 A;  3ZIJ A;  1SK2 A;  3D21 A;  2R0C A;  1Z5Y E;  3LWA A;  1ERT A;  3IV4 A;  4HZ4 A;  2OKA A;  5F8B A;  3ZRD A;  5D9W A;  1SJ6 A;  4IN0 A;  2C3Q A;  5H5R A;  2LST A;  2LV3 A;  2E2G A;  3O3T A;  5B8A A;  4FO5 A;  1XWA A;  3ZML A;  3ME7 A;  4WBR D;  1R5A A;  1XPV A;  5KN0 A;  4V2N A;  2GT6 A;  3UEM A;  1LBK A;  4I97 A;  3DYR A;  1PGT A;  1G7O A;  3DGQ A;  2X4A A;  3C7M A;  3IXR A;  3QDN A;  4EL1 A;  5DAL B;  2N5B A;  4MJC A;  2OAD A;  1S3R A;  1GSY A;  5GAN D;  3GKN A;  3KTB A;  4FIW A;  2YV7 A;  4KSM A;  2HZE A;  1TW9 A;  6GST A;  5A4V A;  5IMZ A;  3SBC A;  4PX1 A;  1U87 A;  3MIX A;  1GUM A;  3FRC A;  4PQI A;  3IHQ A;  3WYW A;  2KHP A;  1B4Q A;  2OE3 A;  4MJB A;  4BIK A;  1EP7 A;  3HJP A;  2CX4 A;  2IPA A;  3RHC A;  4I5Q A;  4K6X A;  4IGJ A;  1XCC A;  2OE0 A;  3IK9 A;  4KND A;  1B9Y C;  1LJR A;  4IJI A;  4J56 E;  4PUF C;  1BAY A;  2VLT A;  3DIE A;  3HVN A;  1HNB A;  4MZW A;  4RI7 A;  3MAK A;  5DDL A;  3APO A;  4ZBA A;  4GF0 A;  5IQY A;  2PUK C;  1BX9 A;  1V98 A;  5HFG A;  1G0T A;  5JCG A;  2VM2 A;  1GTB A;  1DUG A;  3GN3 A;  4RI6 A;  2K8S A;  1HYU A;  1QFN A;  1VGL A;  1FW1 A;  4AJ8 A;  1J9B A;  2C0D A;  2G0F A;  1OC3 A;  2O8V B;  3UVT A;  2QSI A;  4BL7 A;  1XVQ A;  1PSQ A;  1PMT A;  2VCX A;  3DD3 A;  4WF5 A;  4EDY A;  4OFN A;  5BRT A;  2LJA A;  3QR6 A;  1PL2 A;  2NBS A;  3GA4 A;  5JWR B;  4MK3 A;  3TKP A;  2LEG A;  1Z6M A;  3KP8 A;  3UVH A;  3EIN A;  2H8L A;  1THO A;  2LRC A;  4HUA A;  4ZB8 A;  4IHU A;  3PGT A;  2K9F A;  1A8Y A;  1U3A A;  3U6V A;  4X43 A;  4G2E A;  2F3M A;  3IK7 A;  2NDO A;  2IJY A;  1V2A A;  5AIS A;  4BVX B;  3ERW A;  2DLX A;  4XHM A;  2FA8 A;  5EPF A;  3FY7 A;  4YAV A;  4GQC A;  2CVB A;  1JHB A;  2XHF A;  1NHO A;  3D6I A;  2RM6 A;  1CQH A;  4F2I A;  9GSS A;  3PIN A;  1T3B A;  5DCG A;  4CW9 A;  1GUK A;  1ERW A;  1ABA A;  3GMF A;  3HJM A;  5JCW A;  4X0X A;  1AQX A;  4ISD A;  1YKA A;  1XFL A;  3EU3 A;  3VUR A;  5F0G A;  2FNO A;  2RUF A;  5COH A;  5GSS A;  5C00 A;  1PKW A;  2FA4 A;  2CT6 A;  1A0R P;  3TJJ A;  1GWC A;  2FD3 A;  3F0I A;  1EEJ A;  1GLP A;  1T4Y A;  2A2S A;  2OE1 A;  2TRX A;  3F8U A;  4IVF A;  3CBU A;  4TW5 A;  2GQL A;  3TRX A;  3FZ9 A;  4EUY A;  1G7E A;  2IFQ A;  1GRX A;  3ZVJ D;  1AIU A;  2X8G A;  4MA9 A;  3L9S A;  2L6C A;  3HHV A;  4PQH A;  4ZL7 A;  4KB3 A;  1BED A;  5DJM A;  4RUV A;  1YQ1 A;  2E0Q A;  1V58 A;  4N11 A;  3EU4 A;  1ZYN A;  2L4Q A;  2MBT A;  3ED3 A;  3TKR A;  3W8S A;  1XWB A;  13GS A;  4EDZ A;  2AYT A;  1OYJ A;  2H74 A;  5FHI A;  4OCF A;  3WGX A;  2RM5 A;  5A5K A;  2I81 A;  2VIM A;  1MTC A;  2CV4 A;  3V1W A;  3TKS A;  2OAC A;  3I6A A;  5DQS A;  5HFK A;  3ZFB A;  5IMA A;  4WR4 A;  5HR2 A;  4A5P A;  2H72 A;  5J3R A;  3QOU A;  5J9C A;  3IOS A;  4OFM A;  2GZP A;  3WT2 A;  2DJ1 A;  2VCT A;  2WRT A;  1X5D A;  2L57 A;  3TKQ A;  1HD2 A;  1Q98 A;  4MPF A;  1G6Y A;  4EF0 A;  5C04 A;  2A2R A;  2VOC A;  4LMV A;  3RBT A;  1RK4 A;  3UAP A;  1I5G A;  2JAD A;  1TRU A;  1PRX A;  3KMN A;  3WGE A;  4ACS A;  2I9H A;  3LYP A;  3QMX A;  2YWN A;  2IWT A;  4YKG A;  3GL3 A;  2XPD A;  1THX A;  1S3D A;  2R4V A;  4IS0 A;  2B6M A;  1SJI A;  2HYX A;  1XBS A;  2JU5 A;  4LMW A;  5LCZ A;  2PBJ A;  5ECI B;  5DJL A;  4F82 A;  3CRT A;  1R7H A;  22GS A;  1WJK A;  3TB2 A;  4KDX A;  4AGS A;  4JR6 A;  1IYI A;  2GSR A;  2CQ9 A;  1X9M B;  2CAQ A;  1V9W A;  1TOF A;  5DBQ A;  2MBS A;  2EIQ A;  5KN1 A;  3IC4 A;  5ECP B;  3GYK A;  3FZ5 A;  1F2E A;  4BVY B;  1GL8 A;  3J7Y k;  3MSZ A;  3R3E A;  5EY6 A;  3ZRE A;  2VUP A;  4MJE A;  4GQF A;  1M9A A;  2F8A A;  4GXZ A;  1AAZ A;  5ECR B;  3F4R A;  2H1G A;  3FR6 A;  5G5F A;  2LJK A;  4IP6 A;  5IMC A;  2KUC A; 
#chains in the Genus database with same CATH homology
 2FWE A;  1JLV A;  4NAX A;  1FAA A;  8GSS A;  3E3E A;  3KTL A;  1TU7 A;  2JSZ A;  3MWH A;  4TN8 A;  4G0K A;  4LLR A;  2AUV A;  2GZY A;  4AJ7 A;  1AQV A;  2LQQ A;  2K6V A;  2WFC A;  1Z7R A;  3NIV A;  1SK0 A;  3KD0 A;  4QL7 A;  1OC9 B;  2LKU A;  4YQM A;  2HE3 A;  1GNE A;  1G6W A;  2DJJ A;  2QA1 A;  2V32 A;  2WUL A;  3D22 A;  5IMD A;  1YDK A;  4I8B A;  2IMI A;  4ULX A;  1GSF A;  1JFU A;  3LEF A;  3IA1 A;  2JZS A;  5CNW A;  4JU5 A;  4KUN A;  5CYY A;  2VCQ A;  5KN3 A;  4WBJ A;  3LFL A;  1WMJ A;  4NHZ A;  4DSS B;  2GGT A;  2TIR A;  7GSS A;  2VCW A;  1Z7P A;  4ZBD A;  1K0B A;  5G30 A;  1PX7 A;  1VF3 A;  1JZO A;  1KEB A;  1SYX A;  4GST A;  1M2A A;  4KCA A;  1PN9 A;  5G31 A;  2R0P A;  1B8X A;  1PQN A;  4BL7 B;  1UC7 A;  3IC8 A;  5G1L A;  3TUE A;  4K1F A;  2XPE A;  5B6M A;  5JWQ B;  3A5W A;  1ON4 A;  4I2T A;  4TXV A;  2VL2 C;  1GNW A;  3KZQ A;  2PER A;  3GTU B;  4MJA A;  1BYE A;  3F3Q A;  3M9K A;  1ZCP A;  4MH2 A;  2DKH A;  1O81 A;  2YWI A;  3FR3 A;  3A3T A;  1F6M C;  2VLV A;  4IP1 A;  2H19 A;  2HRK A;  2YZH A;  5DVB A;  4TXO A;  2VLU A;  1GSQ A;  3FKF A;  1PKZ A;  1GUL A;  2HFD A;  4ID0 A;  1K3L A;  2ON7 A;  1OE8 A;  1GSU A;  2HRN A;  2M80 A;  1OC8 A;  3G7Y A;  3RHB A;  1YJ6 A;  3BCK A;  4GCI A;  4DVC A;  4CDO A;  10GS A;  4WEY A;  3GKX A;  2X99 A;  5F06 A;  1XW6 A;  3I69 A;  1WWJ A;  4ECB A;  4GRF A;  1VF2 A;  4LL4 B;  1F3B A;  2PVQ A;  1TJD A;  2OBK A;  1V57 A;  5HQP A;  2H75 A;  5G5E A;  2MMZ A;  2C80 A;  2C1Y A;  3GHA A;  4YQV A;  2LUS A;  2QA2 A;  1K0M A;  1NM3 A;  5B6N A;  2P0G A;  2WB9 A;  1X9S B;  1R5P A;  3MDK A;  3RPN A;  1NSW A;  3EC3 A;  3QFA C;  3ZIT A;  5E4W A;  3HY2 A;  4OMV A;  5B7C A;  1N2A A;  2IMF A;  5IMF A;  2R5G A;  1F9M A;  1PN0 A;  5A4U A;  3ZMK A;  1PL1 A;  5JCU A;  4ZB6 A;  4IJ3 A;  3BJ5 A;  2X49 A;  4PNG A;  4HU9 A;  2YOI A;  1TRS A;  2P5R A;  3QPM A;  4DSQ A;  1ML6 A;  1PD2 1;  3IDV A;  3DRN A;  2WGR A;  3EPT A;  3A2W A;  1GH2 A;  3VWX A;  1SEN A;  4XS4 A;  3KEB A;  3N9J A;  3FEU A;  4WF4 A;  2FHE A;  2O89 A;  2YZU A;  2H0I A;  5L71 A;  1ERV A;  1X9W B;  3L4N A;  4WKW A;  4CHS A;  2HRA A;  2HZF A;  3DWV A;  4O92 A;  5INY A;  4NWY A;  3BBY A;  3QCP A;  1SJZ A;  1VF4 A;  5D9V A;  3C1S A;  2DMM A;  1XW9 A;  2HSH A;  2L6D A;  6GSX A;  3KMO A;  1W4V A;  3IPZ A;  5F07 A;  3KXO A;  3BOA A;  4L5L A;  4BPY A;  2HNL A;  4XS1 A;  2IME A;  4O5U A;  2DJK A;  2R37 A;  1PX6 A;  1XXU A;  4V2M A;  4FYU A;  1WE0 A;  2B5X A;  5ELG A;  1R4W A;  4WXT A;  2YP6 A;  3S9F A;  3FZ4 A;  1FB6 A;  2V2G A;  3DKS A;  2R2J A;  3CRU A;  1RW1 A;  3Q6O A;  5E59 A;  2X8C A;  4PXO A;  2BTO T;  2DJ3 A;  4HOJ A;  1FO5 A;  2YNX A;  2XBQ A;  4MLY A;  2VM1 A;  3IE3 A;  1BJX A;  3LQ7 A;  1O7U A;  4K9Z A;  1VF1 A;  4KA0 A;  3RPP A;  1AUC A;  2B1K A;  1MDI A;  1K0N A;  4ML1 A;  1CQG A;  1QK8 A;  3LG6 A;  2FGX A;  2I4A A;  2C3N A;  4MF6 A;  2QC7 A;  1FVJ A;  2YAN A;  5ELA A;  3HVS A;  5IOX A;  5KEJ A;  3H4K A;  1S3A A;  2GQM A;  2B7K A;  5HR0 A;  2HI7 A;  5D93 A;  5IO0 A;  4HEA 2;  5DAK B;  2KLX A;  4F9Z A;  4LL1 B;  1XIY A;  3ERG A;  2L5L A;  2QGV A;  3APS A;  1AC1 A;  4DEJ A;  3IAM 2;  3VPT A;  1B48 A;  2VO4 A;  3QAW A;  1WP0 A;  4ZL8 A;  3HD5 A;  1A8L A;  2FWF A;  3QAG A;  2PN8 A;  2HRF A;  3P2A A;  3DEX A;  2PMT A;  5CRG A;  1ST9 A;  4JE1 A;  2B5Y A;  3GH9 A;  3TJK A;  2FWH A;  4G10 A;  1TRW A;  1A2J A;  4NHW A;  4GWR A;  3K8N A;  2CA8 A;  5ECK B;  2EIO A;  1SKS B;  3HXS A;  3CTF A;  2TRC P;  4HS1 A;  4D73 A;  6GSS A;  2X8H A;  2IIY A;  2E7P A;  5D9T A;  3UL3 A;  5LD0 A;  3UIW A;  3UAR A;  2GQK A;  3US3 A;  3FR9 A;  2RLI A;  2BJX A;  2HT9 A;  4MNN A;  5DAL A;  4POM A;  4O5R A;  4XRA A;  2D2Z A;  1MD4 A;  1ZL9 A;  3F4S A;  3W8J A;  2ZCT A;  1Y6E A;  1SU9 A;  1Z9H A;  3GV1 A;  4OO4 A;  3LXT A;  4CY6 A;  1B4P A;  5ECO B;  5IMV A;  1K0C A;  2I3Y A;  2LNS A;  6GSV A;  1EV4 A;  3HZ8 A;  1R26 A;  3GX0 A;  4N30 A;  3H8Q A;  3ME8 A;  4HI7 A;  2GST A;  2J9H A;  1RQM A;  2VL3 A;  2UZ8 A;  2LTK A;  1J0F A;  4TR1 B;  4YAP A;  1YEP A;  1GSE A;  2YV9 A;  3P90 A;  19GS A;  5AIX A;  1TRV A;  2LQO A;  5DCH A;  2C3T A;  5IO2 A;  4KAE A;  4PGT A;  2YWO A;  2VD0 A;  4POB A;  1OAZ A;  5ECS A;  3ZFL A;  3L78 A;  2NTO A;  3VWV A;  2DIZ A;  2KOK A;  3PPU A;  3TJB A;  5AIV A;  3P8W A;  3C8E A;  4LA1 A;  2H01 A;  4Z7X A;  2V1M A;  4TXO B;  1EOG A;  3TJG A;  1XZO A;  3UBK A;  2VL9 A;  3WGD A;  4F0B A;  2H30 A;  5GAP D;  4G19 A;  1EV9 A;  1A2M A;  3HJO A;  1SKR B;  3SWL A;  3TKS C;  4JED A;  5F05 A;  3NZN A;  1EEM A;  2ALB A;  1W89 A;  5J4U A;  1X5C A;  16GS A;  3WT1 A;  3DVX A;  1HNC A;  2PPT A;  2DJ2 A;  3Q18 A;  4EC0 A;  2AJQ B;  1GTU A;  1U3I A;  4K7N A;  4N10 A;  1VRS D;  1XOB A;  1TI1 A;  4Z2R A;  4QQ7 A;  3IBH A;  4ZBB A;  5D73 A;  2VCZ A;  4KGI A;  1SL0 B;  4TVE A;  4OFT A;  4FYB A;  2DSA A;  1M9B A;  2ES7 A;  5ID2 A;  1XWC A;  2DML A;  3HYP A;  3A2X A;  1SD9 A;  3A2V A;  2V41 A;  3R2Q A;  3F9U A;  1SL2 B;  3GH6 A;  2H76 A;  3H93 A;  3ZVJ A;  4KSO A;  3VWU A;  1JZW A;  1XVW A;  2JAC A;  4XTS A;  4USS A;  4V2L A;  4NPB A;  4XS4 B;  2JSY A;  2WDU A;  2Z9S A;  2RUE A;  1XOA A;  20GS A;  4TOP A;  2HZE B;  1T1V A;  1ZGN A;  3WD6 A;  1M7T A;  2MMA A;  2IMD A;  4N0V A;  3EE2 A;  4KX4 A;  3ZZX A;  1MDK A;  4J57 E;  5CP1 A;  2L5O A;  4X1U A;  1TXX A;  3F4T A;  2FWG A;  1ACV A;  2LNT A;  3F3R A;  3HVX A;  3Q74 A;  2C8U A;  2GTU A;  2DIY A;  1FG4 A;  4J2F A;  2CZ3 A;  4ZB9 A;  4Z2T A;  1ERU A;  1ZZY A;  3D4M A;  4KW6 A;  3D5J A;  1M99 A;  4GSN A;  5LNK e;  3GSS A;  3FK8 A;  4O5Q A;  1EGO A;  5J9B A;  4KE3 A;  2K8V A;  3O6T A;  4EE0 A;  4FYC A;  2CVK A;  3BCI A;  2VL2 A;  4MDC A;  2J23 A;  1QQ2 A;  2CX3 A;  2B1L A;  2MMN A;  4KH7 A;  1A0F A;  4Q5Q A;  4BWS A;  1XWK A;  4K8M A;  4NV5 A;  1GTA A;  2YPM A;  2M46 A;  4OCE A;  3E9J B;  2XC2 A;  1O85 A;  1IYH A;  5AN1 A;  5G2Z A;  2YCD A;  3HVV A;  1SK1 A;  4PQ1 A;  3TJF A;  5H5Q A;  5IM9 A;  2F51 A;  3OR5 A;  1K0D A;  4IEL A;  4KF9 A;  1WPI A;  3TOU A;  3RDW A;  1V40 A;  5IOW A;  1YF1 A;  3TDG A;  3ZIV A;  2CAI A;  4FH8 A;  3VWW A;  4KDY A;  1C72 A;  2OBI A;  3HDC A;  18GS A;  4IBP A;  3TCO A;  2VD1 A;  4HJM A;  3NOF A;  4XCS A;  3U5R E;  2A4H A;  3MNG A;  1AW9 A;  3UOM A;  4K0N A;  3TKS E;  3LGC A;  4V1A g;  1ZYE A;  4MZB A;  4MH3 A;  14GS A;  3Q19 A;  1K3O A;  1BQ7 A;  4HQZ A;  4TKY A;  3CXG A;  1ZMA A;  4EO3 A;  3ZL5 A;  4K7I A;  4GSS A;  3L9V A;  2M72 A;  1F3A A;  1T00 A;  5CRW A;  4MP4 A;  2PU9 C;  5DQY A;  3FW2 A;  1PA3 A;  5HR3 A;  3M8N A;  4MCU A;  3H1N A;  2IL3 A;  2GT5 A;  3VI5 A;  1WRY A;  4BVY A;  3G7J A;  2IFQ B;  4D73 B;  2E2M A;  4TR3 A;  2H73 A;  5ABR A;  2GDR A;  1QGV A;  4TRX A;  5IIZ A;  4RQX A;  1TI3 A;  2C0F A;  2H0G A;  2OJL A;  1KNG A;  3I43 A;  2YWM A;  1GSD A;  1DSB A;  1O8X A;  3LJR A;  2A4V A;  4E8H A;  2V6O A;  4K7O A;  1T7P B;  1YZX A;  3IAS 2;  4Q5N A;  4PNF A;  3IR4 A;  3VK9 A;  4EVM A;  4PTS A;  3HCZ A;  1QUW A;  2QKE A;  1N8J A;  5CRE A;  4F0C A;  4P3Y B;  1OC9 A;  4MF5 A;  4POL A;  3C1R A;  1UVZ A;  5GZZ B;  1HQO A;  1J08 A;  2CZ2 A;  3VLN A;  2DKI A;  5ECM B;  1TP9 A;  3VFI A;  1QXH A;  4ECI A;  3FHK A;  3TOT A;  2NVL A;  3H79 A;  2B7J A;  5KOW A;  5BMU A;  2C0E A;  1GUH A;  2H1D A;  3KM6 A;  3C73 A;  2WJU A;  1GLQ A;  5HFI A;  3CYN A;  1MEK A;  4DSS A;  5IPG A;  3D0Z A;  1JLW A;  1M2B A;  1OE7 A;  1O8W A;  2AAW A;  3EMP A;  2MMO A;  1OVN A;  2CVD A;  1NHY A;  1USB A;  4AF2 A;  5ECN B;  3KGK A;  1EWX A;  2BMX A;  2H1A A;  4MAB A;  2GSQ A;  2FUG 2;  3GFK A;  4HZ2 A;  5GST A;  4DSR A;  1B9X C;  4WET A;  4L8E A;  1X5E A;  1T8E B;  3E0U A;  4HDE A;  4KCE A;  4F03 A;  3APQ A;  4BA7 A;  3UBL A;  4K0G A;  4NMU A;  2N5A A;  4IW9 A;  2IN3 A;  1Y25 A;  2FLS A;  4X4J A;  1TKD B;  3G9B A;  3GTU A;  4OD7 A;  2X64 A;  4MMM A;  5A4W A;  2EC4 A;  1URM A;  4Q5R A;  6GSY A;  3QAV A;  2H1B A;  4O7H A;  2H6X A;  5IPH A;  2R3X A;  3TGZ A;  5CRD A;  4K5R A;  2FCH A;  3BD2 A;  2O87 A;  4EIQ A;  3EMX A;  2R6K A;  4NXI A;  4Q5F A;  4ZL9 A;  4QL9 A;  5ID2 B;  2L59 A;  2H70 A;  2LRN A;  1O6J A;  2V6K A;  3F63 A;  4GLT A;  3IHG A;  4JZQ A;  4WR5 A;  1LU4 A;  3JCM L;  1ILO A;  2OA7 A;  2LJR A;  1SL1 B;  4ILF A;  3EYT A;  5CAX A;  1A24 A;  2A2P A;  3VPQ A;  4ECJ A;  2ZNM A;  3KP9 A;  4ICY A;  4JBB A;  3QD9 A;  3PR8 A;  4HU7 A;  2C4J A;  1XW5 A;  2C0G A;  5CRH A;  2YJH A;  2N5F A;  3EWL A;  2HXK A;  4K2X A;  2H6Y A;  4XRD A;  2AV4 A;  2YN1 A;  2LRT A;  1M2D A;  3GIX A;  3DXB A;  5FWG A;  3O76 A;  1K0A A;  1X0R A;  1KBN A;  3GUS A;  3GRX A;  4E8E A;  2GZZ A;  1MD3 A;  3P7X A;  4JRR A;  4ECC A;  2F9S A;  3GX8 A;  1TTZ A;  1YF0 A;  2PGT A;  4YKF A;  1FOH A;  3CSH A;  3GKM A;  1A23 A;  1K0O A;  3VI7 A;  3KJY A;  3M0F A;  1FVK A;  3M3M A;  3GNJ A;  3ZTL A;  2HLS A;  3IRA A;  1GSS A;  4JR4 A;  4L0U A;  2B5E A;  3KIJ A;  4HQS A;  1AQW A;  4FQU A;  3M1G A;  4TR4 A;  2YJ7 A;  3GL5 A;  1TK0 B;  4POK A;  4K2D A;  4OWY A;  4PUR A;  1AXD A;  1U88 A;  4G9H A;  5D8I A;  1DBY A;  4I6X A;  1TK5 B;  3HZ4 A;  2H66 A;  2FY6 A;  4GTU A;  3PH9 A;  4CY8 A;  4ZXG A;  1YY7 A;  2LS5 A;  2NPB A;  1OKT A;  3M9J A;  6GSW A;  2K18 A;  4MF7 A;  11GS A;  4Z2U A;  2R0G A;  1FB0 A;  1FHE A;  1Q4J A;  2AHE A;  2P5Q A;  3RAZ A;  1E2Y A;  4PUA A;  3CSI A;  3L9U A;  1H4O A;  2EIR A;  1QMV A;  2GS3 A;  4NV2 A;  1O73 A;  3ISO A;  3FMW A;  2F8F A;  4EKZ A;  1KTE A;  3HKR A;  4MZC A;  2WCI A;  4IQA A;  2L4C A;  4HJ2 A;  1DE1 A;  12GS A;  2HSY A;  2O7K A;  1ZYQ B;  1EGR A;  5H5S A;  2VAF A;  1F37 A;  2WS2 A;  3KCM A;  3FZA A;  1YEX A;  3CTG A;  1TDI A;  4BWQ A;  3KH7 A;  3QFB C;  1JZD A;  4V1A p;  1EP8 A;  3EUR A;  2WZ9 A;  4MPG A;  3G7I A;  5J41 A;  5KN2 A;  1DE2 A;  2GVP A;  1E6B A;  3DVW A;  2AB6 A;  5J5N A;  2GSS A;  5ECH B;  2JL4 A;  2DC5 A;  3F6D A;  6GSU A;  4BVX A;  2JZR A;  4G0I A;  2IMK A;  3AY8 A;  4L5O A;  3LYK A;  1GTI A;  5DAK A;  2JZT A;  5ENU A;  2DJ0 A;  1ZOF A;  5AGY A;  4O32 A;  4ZIJ A;  4XIH A;  4IQ1 A;  1ZYP A;  1NW2 A;  3LSZ A;  17GS A;  1A2L A;  5ECL B;  3LXZ A;  3TRP A;  3CMI A;  3EVI A;  5B8B A;  4EIP A;  3J7Y b;  3W6G A;  4AJ6 A;  4EXJ A;  2RII A;  1WOU A;  1HNA A;  3I9V 2;  5EVO A;  5FT3 A;  3MYD A;  1GP1 A;  1JZR A;  5KOX A;  1SD8 A;  1YKC A;  5EL8 A;  1OKD A;  1T4Z A;  2VCV A;  1TK8 B;  5ECQ B;  1M0U A;  3LOR A;  1UN2 A;  3LW9 A;  2G2Q A;  4YQU A;  2KP2 A;  5G1K A;  1Z6N A;  3UMA A;  1K3Y A;  3ERF A;  3CSJ A;  4L0W A;  1TU8 A;  3F6F A;  1FOV A;  3ZYW A;  3UJ1 A;  2DBC A;  3ZLP A;  1EOH A;  2GLR A;  2H6Z A;  3HA9 A;  4OO5 A;  1MDJ A;  4G0L A;  4ZIL A;  3C71 A;  1I9D A;  3D4T A;  2PVO C;  2PWJ A;  2H71 A;  1Z3E A;  1H75 A;  4KDU A;  3GUR A;  3TRQ A;  4YH2 A;  2B3S A;  2KP1 A;  2REM A;  4TR1 A;  2MZC A;  3FYG A;  4IKH A;  1S3C A;  1WIK A;  4K5S A;  3N5O A;  5JWO B;  2H0H A;  3A5I A;  4N0Z A;  1SYR A;  4TR0 A;  3L0H A;  2MYG A;  4RQR A;  1SKW B;  3DML A;  5D9X A;  5D96 A;  3GKK A;  2I1U A;  4H86 A;  4I2U A;  5HR1 A;  3KH9 A;  5CO3 A;  2P31 A;  4ML6 A;  2ON5 A;  2O85 A;  2XBI A;  3GST A;  4XS6 A;  1U6T A;  1UA5 A;  1EZK A;  2HSM A;  1XWG A;  2ZUP A;  1BG5 A;  3ZIJ A;  1SK2 A;  3D21 A;  2R0C A;  1Z5Y E;  3LWA A;  1ERT A;  3IV4 A;  4HZ4 A;  2OKA A;  5F8B A;  3ZRD A;  5D9W A;  1SJ6 A;  4IN0 A;  2C3Q A;  5H5R A;  2LST A;  2LV3 A;  2E2G A;  3O3T A;  5B8A A;  4FO5 A;  1XWA A;  3ZML A;  3ME7 A;  4WBR D;  1R5A A;  1XPV A;  5KN0 A;  4V2N A;  2GT6 A;  3UEM A;  1LBK A;  4I97 A;  3DYR A;  1PGT A;  1G7O A;  3DGQ A;  2X4A A;  3C7M A;  3IXR A;  3QDN A;  4EL1 A;  5DAL B;  2N5B A;  4MJC A;  2OAD A;  1GSY A;  5GAN D;  3GKN A;  3KTB A;  4FIW A;  2YV7 A;  4KSM A;  2HZE A;  1TW9 A;  6GST A;  5A4V A;  5IMZ A;  3SBC A;  4PX1 A;  1U87 A;  3MIX A;  1GUM A;  3FRC A;  4PQI A;  3IHQ A;  3WYW A;  2KHP A;  1B4Q A;  2OE3 A;  4MJB A;  1EP7 A;  3HJP A;  2CX4 A;  2IPA A;  3RHC A;  4I5Q A;  4K6X A;  4IGJ A;  1XCC A;  2OE0 A;  3IK9 A;  4KND A;  1B9Y C;  1LJR A;  4IJI A;  4J56 E;  4PUF C;  1BAY A;  2VLT A;  3DIE A;  1HNB A;  4MZW A;  4RI7 A;  3MAK A;  5DDL A;  3APO A;  4ZBA A;  4GF0 A;  5IQY A;  2PUK C;  1BX9 A;  1V98 A;  5HFG A;  1G0T A;  5JCG A;  2VM2 A;  1GTB A;  1DUG A;  3GN3 A;  4RI6 A;  2K8S A;  1HYU A;  1QFN A;  1VGL A;  1FW1 A;  4AJ8 A;  1J9B A;  2C0D A;  2G0F A;  1OC3 A;  2O8V B;  3UVT A;  2QSI A;  4BL7 A;  1XVQ A;  1PSQ A;  1PMT A;  2VCX A;  3DD3 A;  4WF5 A;  4EDY A;  4OFN A;  5BRT A;  2LJA A;  3QR6 A;  1PL2 A;  2NBS A;  3GA4 A;  5JWR B;  4MK3 A;  3TKP A;  2LEG A;  1Z6M A;  3KP8 A;  3UVH A;  3EIN A;  2H8L A;  1THO A;  2LRC A;  4HUA A;  4ZB8 A;  4IHU A;  3PGT A;  2K9F A;  1A8Y A;  1U3A A;  3U6V A;  4X43 A;  4G2E A;  2F3M A;  3IK7 A;  2NDO A;  2IJY A;  1V2A A;  5AIS A;  4BVX B;  3ERW A;  2DLX A;  4XHM A;  2FA8 A;  5EPF A;  3FY7 A;  4YAV A;  4GQC A;  2CVB A;  1JHB A;  2XHF A;  1NHO A;  3D6I A;  2RM6 A;  1CQH A;  4F2I A;  9GSS A;  3PIN A;  1T3B A;  5DCG A;  4CW9 A;  1GUK A;  1ERW A;  1ABA A;  3GMF A;  3HJM A;  5JCW A;  4X0X A;  1AQX A;  4ISD A;  1YKA A;  1XFL A;  3EU3 A;  3VUR A;  5F0G A;  2FNO A;  2RUF A;  5COH A;  5GSS A;  5C00 A;  1PKW A;  2FA4 A;  2CT6 A;  1A0R P;  3TJJ A;  1GWC A;  2FD3 A;  3F0I A;  1EEJ A;  1GLP A;  1T4Y A;  2A2S A;  2OE1 A;  2TRX A;  3F8U A;  4IVF A;  3CBU A;  4TW5 A;  2GQL A;  3TRX A;  3FZ9 A;  4EUY A;  1G7E A;  2IFQ A;  1GRX A;  3ZVJ D;  1AIU A;  2X8G A;  4MA9 A;  3L9S A;  2L6C A;  3HHV A;  4PQH A;  4ZL7 A;  4KB3 A;  1BED A;  5DJM A;  4RUV A;  1YQ1 A;  2E0Q A;  1V58 A;  4N11 A;  3EU4 A;  1ZYN A;  2L4Q A;  2MBT A;  3ED3 A;  3TKR A;  3W8S A;  1XWB A;  13GS A;  4EDZ A;  2AYT A;  1OYJ A;  2H74 A;  5FHI A;  4OCF A;  3WGX A;  2RM5 A;  5A5K A;  2I81 A;  2VIM A;  1MTC A;  2CV4 A;  3V1W A;  3TKS A;  2OAC A;  3I6A A;  5DQS A;  5HFK A;  3ZFB A;  5IMA A;  4WR4 A;  5HR2 A;  4A5P A;  2H72 A;  5J3R A;  3QOU A;  5J9C A;  3IOS A;  4OFM A;  2GZP A;  3WT2 A;  2DJ1 A;  2VCT A;  2WRT A;  1X5D A;  2L57 A;  3TKQ A;  1HD2 A;  1Q98 A;  4MPF A;  1G6Y A;  4EF0 A;  5C04 A;  2A2R A;  2VOC A;  4LMV A;  3RBT A;  1RK4 A;  3UAP A;  1I5G A;  2JAD A;  1TRU A;  1PRX A;  3KMN A;  3WGE A;  4ACS A;  2I9H A;  3LYP A;  3QMX A;  2YWN A;  2IWT A;  4YKG A;  3GL3 A;  2XPD A;  1THX A;  1S3D A;  2R4V A;  4IS0 A;  2B6M A;  1SJI A;  2HYX A;  1XBS A;  2JU5 A;  4LMW A;  5LCZ A;  2PBJ A;  5ECI B;  5DJL A;  4F82 A;  3CRT A;  1R7H A;  22GS A;  1WJK A;  3TB2 A;  4KDX A;  4AGS A;  4JR6 A;  1IYI A;  2GSR A;  2CQ9 A;  1X9M B;  2CAQ A;  1V9W A;  1TOF A;  5DBQ A;  2MBS A;  2EIQ A;  5KN1 A;  3IC4 A;  5ECP B;  3GYK A;  3FZ5 A;  1F2E A;  4BVY B;  1GL8 A;  3J7Y k;  3MSZ A;  3R3E A;  5EY6 A;  3ZRE A;  2VUP A;  4MJE A;  4GQF A;  1M9A A;  2F8A A;  4GXZ A;  1AAZ A;  5ECR B;  3F4R A;  2H1G A;  3FR6 A;  5G5F A;  2LJK A;  4IP6 A;  5IMC A;  2KUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...