2L7MP

Solution structure of the pitx2 homeodomain r24h mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNHYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Pitx2 Homeodomain R24H mutant
rcsb
molecule keywords Pituitary homeobox 2
molecule tags Transcription
source organism Homo sapiens
total genus 25
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l7mP00
5F0CA 3S1RJ 1AHDP 2XGCA 2CQQA 4L5EA 1WPKA 1UHSA 1B8IA 4EEFG 2YUSA 4BKXA 3F0CA 1A5JA 1FJLA 5F1JA 4QSHA 2PMZN 1BW6A 5M5YJ 3PO2J 1T33A 3JRBA 1IGNA 2XB0X 3FK7A 3S14J 2Y0SN 2XRLA 2HOSA 1OCTC 1YRNA 4XRMA 1JKRC 4V2GA 1BL0A 4BBSJ 4DZPA 1QRYA 1I6HJ 3CDLA 2EZIA 5FKOA 1SFOJ 5IP9J 2LTPA 4JX5A 3TW7A 4QIWN 4A3FJ 4A69C 2GLOA 5C4XJ 3BQZA 4DZJA 5EYRA 1AKHB 1ETVA 3E7LA 3D1NI 4HNVA 4IEJA 4X6AJ 3ZQHA 1LE8B 5DS9A 2HXOA 1ITYA 3NAUA 1MBEA 2L7MP 5M5XJ 1W0TA 2HDDA 1I3QJ 3TP3A 4B1RA 1MBKA 2JN6A 1TWHJ 5DTDA 2KDZA 1UG2A 1MBHA 1NK2P 5GPAA 3I4MJ 2L7FP 4BXXJ 2TRTA 4FE4A 1R9TJ 4B4CA 4QTRA 1ETXA 2D5VA 2DMNA 1BJZA 1POGA 3JREA 4A3CJ 5EEAA 1D5YA 2LY9A 2ECBA 1ORKA 2NS7A 9ANTA 3C2BA 2ECCA 3BR5A 2L9RA 4M6VA 3BTIA 2NOGA 2EBIA 1MBJA 4Y7NJ 1IDYA 3HOUJ 1HCRA 2ID6A 3BTLA 3MKLA 5FJ8J 1IV6A 5IYBJ 1RR7A 4A3GJ 3Q0UA 1Z0XA 3BR2A 3QQAA 5F08A 1RESA 2COBA 2I10A 3K7AJ 3OIOA 1MNMC 3L1PA 4FE7A 1B8IB 4XIDA 4X1EA 3HM5A 2NS8A 1HF0A 1IRZA 1H88C 1JT6A 3A03A 3HOVJ 1Y1VJ 4JX4A 2R5YA 2IEKA 1JUPA 1FIAA 2XGEA 2ELKA 3SFIA 1LFUP 1B72A 3RZDJ 3BTCA 1GV5A 3GTJJ 3IH2A 4MLOA 3PM1A 3G1MA 2DN0A 1S7EA 1BA5A 2NVTJ 4JP0A 4JYKA 4NDLA 4A93J 3CMYA 3TP0A 1GVDA 1Y1WJ 3Q0WA 1QVUA 4MFDA 3HOZJ 2MGQA 1ETYA 3HOYJ 1WH5A 3DCFA 4M3BA 2K9SA 1T56A 2YS9A 4D5FA 3HEFA 2ME0A 3S17J 2ID3A 4W1UA 1LFBA 2LLKA 1H89C 3JRGA 2CRGA 3JR9A 2IAIA 1FIPA 1Q1VA 5IP7J 5IYCJ 1XS9A 4A3LJ 3SDGA 2GM4A 3FKIJ 4A3BJ 4A3MJ 2XB5A 2CU7A 5F04A 3G1LA 2VKEA 2G0EA 4DW6A 2B63J 3BR3A 3O8HA 3JRFA 5FKNA 1O4XA 4UUTA 2R5ZA 5IOYA 2HXIA 4BY1J 3M4OJ 5HODA 5J1YA 1JUSA 2CJJA 4LOCA 4C2MJ 1ETOA 2AO9A 5K7FA 3IH4A 2CQXA 3BG3A 1X58A 2IBDA 1Z77A 3LSRA 3PO3J 2LP0A 3BR6A 5M3FJ 4A3JJ 4IHWA 1TWAJ 1ZGWA 3BTJA 2M8GX 3LOCA 5EF6A 2R92J 2E1OA 3BR1A 3NARA 4A3KJ 4A3DJ 2Y30A 3A01A 3GTKJ 4DYRA 5JLXA 1GDTA 2EZHA 2OF7A 1TWFJ 2EZLA 1E3OC 2JJ7A 3WHBA 3ZQLA 2DA6A 2DJNA 3JRAA 5EG0A 3O8GA 3ZQIA 3S1NJ 3OSFA 2E2JJ 5K7HA 2Y2ZA 2R5YB 4XRSG 5M5WJ 2KT0A 2WAQN 3WHCA 4AC0A 1JTYA 1B72B 2QCOA 1IDZA 2R7ZJ 1VFCA 3GTQJ 1TWGJ 2W48A 2LFBA 2QF7A 1JTXA 1JGGA 1ZQ3P 3HGYA 2HYJA 2FQ4A 2DA2A 2X9DA 2JWTA 2N8GA 2FX0A 1TWCJ 2NVXJ 3B6AA 3DEWA 3RQIA 4S0HB 2L0KA 3UKGA 2L7ZA 2E2HJ 4XRSA 3ZQGA 1HOMA 2XGDA 5F0HA 1IUFA 2EZKA 1ZR4A 4UUSA 5EDNA 5E3LA 3LSJA 2VPRA 3JRHA 3FISA 1UMQA 3IH3A 1HDDC 5IYDJ 4M3DA 2M2EA 4C3HJ 3S15J 4ABZA 1HDPA 4MO7A 1P7IA 1MSEC 1OCPA 5C44J 2X6OA 4DYQA 1RKWA 2LVSA 1ZK8A 2LKXA 3TW6A 2VI6A 2R5ZB 1IC8A 3CQZJ 1W0UA 2O7OA 2O9LA 4V2FA 3BQYA 5E3OA 1VF9A 1ZTRA 4M3FA 5C4JJ 3B6CA 2XPWA 3CCYA 2DMQA 3Q3SA 1BW5A 2ME6A 1NTCA 3LSGA 3K2AA 3HKZN 4W97A 2JA5J 1PUFA 1ETKA 2DA1A 2E2IJ 1EF4A 1MBGA 1XC5A 4M3GA 3G1OA 1H8AC 3OOUA 5EZGA 2R93J 3QPSA 3A01B 1F43A 2Y9YA 3S16J 1G2HA 5EGOB 2M9HA 3JRIA 2GBYA 3SJMA 5EG0B 5FLMJ 5FKLA 2XPUA 3LNQA 2EH3A 2WB1N 1XG1A 4FCYA 2M34A 1HLVA 1ZR2A 1QPIA 3MVPA 1FTTA 1CQTA 2EQRA 3GBGA 5E3NA 2DTZA 4J19A 3GTLJ 1IG7A 4RBOA 4AUXA 3H3VK 1AU7A 1APLC 5M3MJ 3JRDA 2OPTA 4I6ZA 5C3EJ 1ENHA 1QVTA 1I50J 2HQ5A 4Y52J 2DMPA 1JKOC 1ETQA 3QPLA 1GV2A 1ETWA 1GT0C 4I76A 1RKTA 2CUFA 1MH3A 2AHQA 1MSFC 1FTZA 5FLVA 2MG4A 2DA3A 3BT9A 3HOXJ 3BG9A 2RAEA 4MIMA 3S2DJ 5EGOA 2FD5A 4UUSB 5FKMA 4B3AA 3JRCA 1WI3A 4IHXA 1VNDA 2Y31A 1ZKGA 3GTMJ 1X2MA 4CYCA 5F27A 4JX6A 3BR0A 3S1MJ 2XPVA 2VUMJ 1JUMA 2VKVA 2JA6J 3HB9A 4A3EJ 1TC3C 5J1UA 2LR8A 2M0CA 2JMWA 5J1RA 1RPWA 2K40A 4BY7J 3H0GJ 5IP6A 3LSPA 3ZQCA 2K9QA 4G12A 4C3JJ 3HBLA 4C3IJ 5GP9A 4MFEA 3S1QJ 2TCTA 4BBRJ 2X48A 3FIWA 5E3MA 2WV1A 2H1KA 2NVYJ 2LD5A 4RDUA 2JA8J 5IPAA 1F36A 2MSYA 5EZHA 3IV5A 1PUFB 2DA7A 3S2HJ 3RKQA 5JLWA 3VPRA 2JK3A 2O8KA 3ZOBA 1NK3P 1FEXA 4D5CA 1GUUA 1IJWC 3GTGJ 1K83J 2HOAA 3GTOJ 1AKHA 1U9NA 1U8BA 3GTPJ 1VI0A 5F0FA 1OJLA 3HGGA 2DMUA 4FTHA 5K7ZA 2DA4A 5BNGA 1LE8A 2MW8A 2LK2A 3BG5A 3I4NJ 2E19A 3FK6A 1MBFA 4IHYA 1SANA 3MN2A 1WCMJ 2CUEA 5FKKA 4A3IJ 2FJ1A 4D7MA 2YU9J 4XICA 2Y9ZA 3A02A 4FISA 4DYCA 2JA7J 5J3LA 2K9NA 1JKPC 2HI3A 2DA5A 3Q0VA 1OFCX 1JKQC 4GFBA 3OSGA 3TEDA 3HDDA 3W6VA 3RZOJ 4IHVA 1YRNB 1JT0A 1U78A 2H8RA 5GPCA 1DU6A 3M3YJ 2DMTA 1WGXA 4D7NA 1RETA 1JJ6C 1U9OA 4XK4A 2NVQJ 4M3EA 1DU0A 2R0QC 4AYBN 1K61A 2HOTA 2XSDC 1WH7A 1MH4A 2ZB9A 1X2NA 1A6IA 1P7JA 2P81A 5IOZA 3HOWJ 1JJ8C 3ZQFA 4CYCB
chains in the Genus database with same CATH superfamily
1K6OA 4L9TA 4IO9F 2L7KA 5BMZA 4NNJA 1N75A 3ASOH 3F72A 4GCVA 3SXYA 4L5EA 4EEFG 5DDGA 2UV1A 3ECHA 3AL0B 1XN7A 4QSHA 1TQPA 1FNNA 5TISC 3HPHA 2CV2A 3MWMA 3QP5A 1IGNA 4N0BA 5FLXZ 3F23A 5HLHA 1EKEA 3CP2A 4HX4A 3VOEA 4NQWB 3KEYA 1KYZA 1JKRC 5D6EA 4I7HA 3BDDA 1ULYA 4YRVA 1T38A 1BL0A 4BBSJ 1QRYA 1HC8A 2VASA 4QPOA 1TT5B 5IP9J 1V5GA 1D0XA 2E5ZA 3TW7A 4A69C 4EMSA 3F6OA 1UG0A 2LBFB 2ZKZA 3VYRB 3ASNH 3M8FA 2X0LA 4KMUX 3HSEA 5IT9K 3AG1H 4Y13A 4XKBA 2F4OB 4XSZF 3K1MA 2KIUA 1LE8B 4ZYDA 4XL9A 3NAUA 3SFZA 4CICA 2L7MP 4A6EA 2EB7A 2DTRA 1HW2A 1MBKA 2JN6A 1HW5A 2KDZA 1S7AA 1HQCA 4PGGA 5GPAA 4KT6A 2NAZA 5HLIA 2F5EA 2K9LA 4NQWA 1B1BA 1ZH5A 4FE4A 2DK5A 2X6WA 4QTRA 1STZA 2A6TA 2IGKA 2MFZA 1S9HA 1USSA 1XSVA 3F6VA 1I1SA 1PVEA 2W24A 1BJZA 1POGA 4QWQA 3HSFA 2DT5A 2LY9A 3BROA 2ECBA 4ESBA 1ORKA 4K2EA 9ANTA 2PJRA 2GWRA 2ECCA 2RNJA 3BR5A 2L9RA 3FBIB 5D5VB 1MBJA 3MKLA 3W2VA 1O7FA 1IV6A 2KFDA 3F8MA 4XSXF 3M9AA 1WJBA 3WTSC 4E7KA 1Z21A 4OMZA 3DLAA 2I10A 4AD9A 2NS0A 5B5EC 3D5LA 1J75A 2CFOA 2WTEA 2TDXA 4FE7A 2QSHX 4XIDA 1YQAA 2MA3A 4X1EA 3ZRGA 3BY6A 1ON1A 4IKFA 3TDUC 1XDUA 5E1ZB 4U0VA 1QO0D 1Z6RA 2M0MA 2OTJI 4U7DA 1MMSA 1WRJA 3A03A 2LKSA 1IW7F 3FXLA 2X6YA 1S72I 4Q48A 1OCCH 4E7IA 3PSIA 3EPZA 1LFUP 4XMYA 3SHFA 3IH2A 4MLOA 5D5XB 4XN0A 4ETSA 5HDNA 2HS5A 4JP0A 1FC3A 2M4KA 4ITVA 1Y1WJ 1L3LA 2QENA 4Y33A 4U87A 2Z99A 2QZ8A 4P55A 5B1BH 4MHGA 4ZTJA 3CUQA 1AOYA 1IV8A 1KQ8A 1WH5A 2DXIA 2V4JC 2JRTA 2K9SA 4EQQA 5ILVA 2YS9A 1IXCA 2PN6A 1G3WA 1DGRM 1W5SA 2ID3A 3MQ0A 3LQQA 1XMAA 2DK8A 1NH3A 2FA5A 2FXAA 2EA2A 2IAIA 1FIPA 4LITA 5H6RA 3WGIA 2ZXHA 2FU4A 4OU0A 3FKJA 2DO7A 4UB8C 2B63J 3OYAA 3O8HA 2K7LA 3AG4H 3JRFA 5EEHA 1YS7A 1FLIA 2XF6A 2JTVA 3CLOA 3OIPA 3DFGA 2BY0A 3VWBA 2IS6A 1FMWA 1OYYA 3I54A 4YEJA 2CW0F 1KQ9A 1ETOA 2MLKA 3BG3A 5LHIA 2L9SA 2IBDA 4KIFA 4BUPA 3PO3J 2PG4A 1A36A 4OWRB 3T1BA 2E7WA 2KJCA 5CVVA 1QZEA 3QU6A 3LQRA 3CJNA 2E1NA 5DD8A 3RTRA 1BI3A 2ELJA 3OYDA 2NVUB 2IT0A 2MYSA 5F6FA 4A3KJ 2L2OA 4GGGA 1SD7A 3A01A 2WWYA 4G7OF 3GEZA 3GTKJ 4PCQA 4HPQA 1GDTA 1WJFA 4XLEA 4AU7A 3KP2A 3TL4X 3EUHA 1Z6TA 4ZDPA 2PLYA 1E3OC 2KHMA 2L02A 3E6DA 2DJNA 3JSPA 1ZRCA 5EG0A 1MMDA 2RGVA 3A2KA 4XORA 2R7UA 2K3FA 4RB1A 3LA3A 3S93A 1S7OA 2V79A 1UELB 5J8CA 3CCJI 2OA4A 1OYWA 1GHCA 1B72B 2VOOA 1TQMA 2Y0SA 3ELKA 1RI7A 1VFCA 5ICCA 5IY5H 1U5TA 3GTQJ 1TWGJ 1F9NA 4WK8F 3MCZA 4HA8A 2LFBA 4NC8A 2HYGD 5ICEA 3OIQA 3F3XA 3HGYA 3HXLA 2ZFUA 5CKTA 2HVRA 2Y48A 1D3YA 2N8GA 3OY9A 1X1DA 1TWCJ 3WG9A 3OYCA 1BR2A 2VOPA 2HQRA 1NHAA 3RQIA 4S0HB 2HU9A 2OQRA 4XRSA 1HOMA 3H92A 2W25A 2VJJA 5F0HA 1WHUA 5L3GA 1R5HA 2EZKA 3QPHA 4S04A 4CXFA 5E8IA 1ZG3A 1UJ8A 3LSJA 4GYIA 2KISA 1TP4A 3JRHA 4HDVA 1SEUA 1FMVA 1WJAA 4XLFA 4CZCA 2DQLA 4KJZA 3GFIA 2F2EA 3F8CA 3FXOA 2VODA 1XX5A 2IGOA 4IZZA 1P7IA 3P5JA 4NC7A 2XF7A 1MSEC 2EFOA 2VE8A 3MFKA 1IRGA 3K0LA 4MTEA 3TW6A 1QNTA 4BQNA 3WU2C 2XAJA 3FF5A 1NG6A 3OL4A 2QQ8A 1VF9A 2F5VA 2M3AA 3G6EI 1KU7A 1ODDA 2GA1A 4HW0A 3GX4X 1QA6A 2VBYA 4L18B 3HOSA 5HVQC 1K79A 3W2WA 1VQNI 3N05A 1PUFA 3QYBA 3PIOF 3T0YA 2UUZA 3R4KA 1H8AC 4UNOA 3R0JA 2R93J 1BM9A 2DAOA 4HOBA 1JGSA 3JCUC 4KISA 2KZVA 3VYTB 1G8XA 4G9YA 3NQOA 4BEHB 2F5FA 2XAFA 3JTHA 2OZ6A 4I98B 5EGOB 2FNAA 2A5WA 1BC7C 4UV9A 1QBJA 5FLMJ 1RUOA 4G6TB 3LNQA 3O2PE 2WB1N 3FXRA 5E79C 2WADA 1HLVA 2D2WA 2RREA 3WTWC 4FQGA 2K85A 3I56I 3AL0C 2EQRA 2DYRH 4J19A 3GTLJ 1IG7A 1F1ZA 1Z3XA 4AUXA 3OYHA 3H3VK 3V7SA 2OV7A 3EDPA 3OS1A 3WE3A 3JRDA 2W85A 3T8TA 4ESJA 1ZLJA 4A0XA 2IGMA 5C3EJ 1ZN2A 1XCBA 5TGTA 3HOTA 4H4KC 5AIQA 2P8TA 1PDNC 3LAPA 2CO5A 4PDKA 2DMPA 2VPLA 4RAZA 2P6SA 2DJIA 1HSJA 1FBUA 3LSIA 1XGOA 4I76A 2VT2A 2CUFA 2F5CA 5FRNA 4EATA 3HOXJ 1MJBA 4KICA 3S2DJ 2M7BA 5EGOA 2FD5A 3IL2A 2PI0A 1DPUA 4IHXA 1VNDA 4LIVA 4M73A 2VJ5A 1QQIA 3GTMJ 2V1UA 3OYMA 4YIIA 5F27A 4YG2F 3ERMA 5FB2A 2A05A 2VUMJ 1JUMA 2PJPA 2JA6J 1OR7A 4A3EJ 2W4SA 1IN5A 2X1EA 4DQ2A 1PP7U 2M0CA 4CHUA 5A2QK 3DEEA 2ZNZA 2CG4A 3KZZA 2DFIA 5IP6A 2O8XA 3LMMA 4Z2YA 1LUJB 1JI8A 4G12A 1MKMA 2STWA 3HBLA 3QP6A 5GP9A 4I09A 2E60A 3A4CA 3L9FA 5JVGF 5BPDA 4I2OA 4BAYA 3E5QA 2QWWA 4XKCA 2RKHA 5CJ9A 1BR1A 2Z5UA 3IV5A 1BIAA 3FXMA 3TDZC 3OYJA 3S2HJ 5JLWA 4RM2A 4LG3A 2J5PA 4BHPA 4NC6A 1P6RA 1WJEA 2DDBA 1JE8A 1NK3P 2OUMA 1WJCA 4HDUA 1IUYA 4CCNA 4KUMA 4I99C 3E3VA 3LAJA 1DGWY 1U9NA 1EH7A 3V8LA 3GTPJ 4E7LA 1D8JA 2EIMH 2A3SA 3H5NA 2W7NA 2M4GA 4FTHA 2DA4A 3CCSI 1XGSA 4EM0B 1WJDA 3DLLF 2I8DA 3WU0A 2KDOA 4ZDOA 1V4RA 1HKSA 4XLAA 4IHYA 1WCMJ 4ZH4F 4BL0B 2O3FA 3P7NA 2MD0A 3W2AA 1J7KA 1W5CC 4P1WA 3TQNA 3CD6I 2Y9ZA 5JHFA 2NNYA 1R71A 3K4KA 4DYCA 1FSHA 4R8HA 2DOEA 3HJEA 4U88A 2EIJH 3CJQB 3IKVA 1JKQC 3OSGA 1NG7A 3KFWX 3HDDA 3RKXA 4IHSA 1IF1A 1YRNB 3H9GA 5K5RA 2KP6A 3CC7I 2ZMEB 3OYBA 2HR3A 3HHGA 4D7NA 1RETA 3FHNA 2FOKA 2NVQJ 1DU0A 3AG2H 3DBLB 1K61A 3FXJA 4E4HA 2XSDC 1UAAA 1MJAA 4B8XA 1P7JA 4UY8I 4IRGA 1R7JA 1FP1D 2LYCA 3DTKA 3CCLI 5D4SA 1T6SA 3ZPLA 4LB6B 2FRHA 3KEOA 2LSOA 1CF7A 1SVOA 1LDKB 2FF4A 1B8IA 4BKXA 1FX7A 1VQ6I 1U2WA 4KIBA 4PSWA 1A5JA 2NRAC 1BW6A 5E8GA 4PUSA 3VB2A 3ML6A 1T2KA 3FK7A 4MGRA 2I5UA 4KN4X 2XRLA 3BG7A 2QQBA 1SAUA 3CF5F 1YRNA 1Y0UA 5DM6F 1TBXA 3I3LA 1KGSA 4Y3OA 3NRVA 2G7HA 1XPXA 3CCEI 1A35A 2EFNA 1I6HJ 4BJ6C 5FKOA 3SYTA 1YW7A 1W7PD 3HYIA 1S3JA 3X2QH 2R7OA 2CWEA 2BY1A 3J81K 2GLOA 3WU1B 1OQYA 5C4XJ 4F55A 3HRSA 4BXFA 5EYRA 1DPRA 1WKMA 1UHMA 2VQCA 4BYYA 1DDNA 2D45A 1K78A 4BGDA 3DTIA 5CVJA 2HXOA 1X4OA 2KIQA 2M5WA 2GZWA 3DXJF 4DGWB 2X51A 5HLTA 1MMNA 1TWHJ 4AIDA 4KDPA 3GZ5A 4FX4A 4HZFA 2A69F 3PNYA 1A6QA 3R61A 1LEBA 4BXXJ 2MC3A 4CYDA 4E7SA 1R9TJ 3ABTA 4B4CA 3GO5A 4ASNA 1R4MB 2K5CA 2D5VA 1J09A 1VQPI 4MEXF 2DMNA 2KRFA 2H6BA 2LRDA 2O0YA 3MD2A 1LB2A 4OAZA 5D6FA 1XB4A 5EEAA 5JFRA 2XKPA 5IT9Z 5CVIA 2EV0A 4L9VA 2XVCA 3C2BA 5LRSA 4BE2A 3BTIA 4PJNA 5H6QA 2EBIA 2A6HF 3K4MA 3KLNA 4GYGA 3BTLA 5FJ8J 4RGXA 2M87A 1RR7A 3H3UA 5J4VA 3OYKA 4A3GJ 2CH0A 3BR2A 4C30A 3ESWB 1RESA 3I59A 5H20A 3K7AJ 4PJLA 5GAGJ 3DEUA 3L1PA 1K4SA 1MNMC 5JVTA 5L3DA 3ZMTA 5HDGA 2HQNA 5LGUA 3EUKL 2Y0MA 3N97A 2QQ9A 2VT3A 5LLQA 1SAXA 4LMYA 1HF0A 4XLCA 2K3PA 2WAQA 1H88C 3GCMA 1T08B 1JT6A 3V7RA 3HOVJ 2P5KA 1VQLI 4I0AA 4HX8A 4JX4A 3MZ8A 2XGEA 2V1XA 4DIQA 4BXUA 1LKXA 3BTCA 2RNGA 1GV5A 4G94A 3KP7A 4AVZA 3G1MA 2JUGA 1GXQA 1S7EA 1BA5A 4AIJA 4JYKA 4NDLA 5DYMA 3C3WA 4OIRF 1GVDA 3M8JA 2FMYA 1YO5C 4XR6A 3MEXA 3I64A 2FE3A 1XTAA 3BJ6A 3Q0WA 4L5JA 5D5UB 3DV8A 4MFDA 3HOZJ 1REPC 4HLYA 4KYWA 4B48A 3HOYJ 3DCFA 4EGYA 3WTZA 1LQ1A 1O57A 3S17J 1XGNA 5F64A 2V6CA 1LFBA 2JQ7A 2LLKA 5KNLA 1DP3A 1GVJA 2VJ4A 1E17A 2KQRA 1YW8A 1E2XA 3KP3A 4AVPA 2V9VA 4II3A 2CU7A 5F04A 3QRFF 3RYRA 5DUIA 3K69A 2G0EA 4GRIA 2BY2A 4X0GA 1FYLA 3CESA 2XC7A 3VSLA 3I71A 1O4XA 1UFMA 4UUTA 2R5ZA 5CVUA 2HXIA 1HKTA 1U6GA 3IAM2 4KT5C 3RKWA 5HODA 4LLNA 2R7XA 5J1YA 1JUSA 2EJRA 2PX9A 2BXZA 3IH4A 2CQXA 2ICWG 3HKZA 5ED4A 3G73A 1Z77A 3BR6A 4A12A 2IA1A 2CYYA 4KNYA 3BTJA 2M8GX 3G4SI 2PJRB 3BG6A 3L2RA 2R92J 2NOJB 4N9IA 4J00A 1A31A 2BW3A 4RB0A 4DBQA 2AXTC 1M1EB 1PUEE 2Y30A 5GAHJ 2HDWA 2JSPA 1VQKI 2Q1ZB 2XGXA 5LHHA 4DYRA 3RPUD 3CP8A 1T0FA 4HF1A 1UB9A 3QU3A 4L0YB 4LJZF 4ZYGA 2JJ7A 2FUG2 2UXXA 3LFUA 4UHTA 2R7SA 3OL3A 3I0TA 3ZQIA 2D1VA 2EK5A 3MKYB 1DP7P 2VQLA 4UVCA 3OSFA 2E2JJ 5K7HA 1X1BA 2JVHA 1VZ0A 5LEJA 2WBMA 4IF4A 4AC0A 3WHCA 2HDCA 2O61A 4ZTFA 2QBYA 5LHGA 4PGHA 1Y8RB 1OISA 4Q4ZF 4OIOF 4RGRA 2R7ZJ 3BPVA 4CGZA 3IRRA 3V8KA 3KCCA 3VFZA 1OCZH 4HNTA 2VKDA 4Q5SF 1O3RA 3KIOA 3CUQB 3NWTA 5L3EA 4IHTA 2V1DA 4LIUA 3FM5A 4F93B 2CMPA 4RGUA 2FX0A 4XNFA 3DEWA 2L0KA 3ABUA 3UKGA 2HKXA 3V42A 3ZQGA 4IL6C 1IZ1A 2FSWA 3K1NA 1YIOA 3QYEA 3G3ZA 3GFMA 3ERED 2F6CA 4OIQF 4S05A 5IYDJ 3BP8A 4M9SA 2HTSA 4ABZA 4MO7A 5GADJ 4HX7A 1MMGA 1OCPA 2K86A 2X6OA 2LVSA 4FETA 4NUBA 4DYQA 4NBQA 2VI6A 1IC8A 3CQZJ 2HNHA 4QLCU 4CZZA 1TT0A 4RGSA 1EA3A 4LD5A 2O9LA 1MD0A 3S3NA 1ZTRA 4M3FA 5C4JJ 3B6CA 3DKWA 4WF2A 1Y39A 2XPWA 3A0HC 3Q3SA 1BW5A 3G71I 1X1AA 2ME6A 2F48A 1WJ5A 3LSGA 1X1PA 3TKYA 2ZMEC 2JA5J 2QSGX 3J7AY 2DA1A 2E2IJ 2EFWA 3L2VA 2JSCA 2HEOA 5EZGA 3OYNA 2OZUA 3KETA 2DFHA 2WAEA 1H9GA 2DFEA 3A01B 2A07F 4PSXA 3I9V2 3K4CA 2CGPA 3S16J 3SZTA 2LG4A 3SQNA 2BVLA 1KONA 3JRIA 2VXDA 3SJMA 3GW2A 5EG0B 2PBIA 2XPUA 1JHHA 3ZN0A 3U2RA 1LDJA 2ZXJA 3RIRA 1MDMA 2CQ7A 3GLXA 2HVQA 4A5NA 1QPIA 2E36A 2L5QA 1LPQA 3SEQA 4BE0A 2AXLA 1CQTA 3GBGA 4L9JA 2DTZA 4XONA 5E3NA 4G7ZF 4HQEA 1AU7A 3PQJA 1G4DA 5H2FC 1U5TB 2E1MB 4I6ZA 2ETHA 4YFKF 5J47A 2XSJC 1ENHA 3FDYA 4HG2A 4EJOA 1QVTA 2L4MA 4UV8A 1SVLA 1W1WE 4YIRX 1ZREA 2P5VA 3CUOA 3ECOA 5DCFA 1JXSA 2GOMA 4AYBA 2HWVA 2DI3A 1RKTA 1I5ZA 1MH3A 2QKMB 1FTZA 4B47A 1QPMA 3CTAA 1G59A 1P2FA 3BT9A 2B0LA 2K4BA 3RDIA 3BG9A 2KRHA 4MIMA 4BQQA 2EIKH 4F52A 1KYWA 2YPRA 1WI3A 1OLTA 3WTTC 4RAYA 1D0YA 3WTYC 1X2MA 3KZYA 1WWXA 4CYCA 3T5XA 3K2ZA 3SZGA 3O3KA 2NNNA 3BR0A 2XPVA 2ZXIA 4XLNF 2PMZA 4WWCA 5TJJA 1ONVA 3DBHB 3H36A 3JSOA 1TC3C 5J1UA 2JMWA 3KYLA 4BY7J 2DU9A 2DT6A 3M07A 5D8KB 3ZQCA 3EETA 3LFKA 3S2WA 3DKYA 4DJAA 2JZYA 4IQ4A 3ZGKA 4MFEA 2DPDA 3OS2A 3QODA 4BBRJ 2X48A 1SMTA 3FIWA 1P4XA 3IC7A 3KE2A 2NVYJ 2JA8J 2G7UA 5IPAA 1F36A 2MSYA 5B3SH 3R60A 2Y69H 5D5WB 1PUFB 3PJRA 2DQRA 1IXRC 2X4HA 2XHKA 1Y6IA 1C0WA 1S8NA 4PJJA 1ZRFA 3BZCA 4D5CA 1GUUA 4ENJA 3GZ6A 5JHUA 2DBBA 1Z05A 1RRJA 3GTOJ 1AKHA 2W84A 4MQVA 1YS6A 4UVBA 1VI0A 5A2QZ 3AAFA 1OJLA 3VYUB 1FP2A 3OYGA 1IRXA 2DMUA 3FXQA 4E70A 5K7ZA 3VSKA 2Q8KA 5BNGA 3ZN1A 1LNWA 1EH6A 4A0ZA 1BJAA 3PUBA 1YJ9I 2H27A 3MN2A 4XRFA 2R3SA 2LNBA 2R7QA 1QU3A 3P9CA 2FJ1A 2VC1A 1D1CA 1D0ZA 3DP7A 3A02A 1X3UA 1J9IA 2EILH 2JA7J 1BBYA 4YELA 2HI3A 1O3SA 2DA5A 1FYKA 4JBAA 2FQ3A 1T98A 2XUBA 3Q9SA 3K4LA 2BGCA 4FT8A 4CUGA 4HNUA 1U78A 1DU6A 5LEKA 5FROA 2QKLB 1BC8C 1ON2A 4KFCA 1U9OA 2E71A 1H0MA 3E6CC 3RJPA 2FBHA 1XMXA 2HOTA 1RR8C 2BXYA 5HS8A 1WH7A 2ZB9A 3BZKA 1X2NA 1A6IA 1BN5A 2BYVE 2M1BA 4UXNA 2EPFA 3PNVA 1JJ8C 1IAWA 2KRCA 3M7GA 5F0CA 1SFEA 3OYEA 2VQHA 1KU9A 5K1YA 3HTUA 2XGCA 4E7ZA 3JAMK 1T0FC 3U1KA 5TRDA 4C2UA 1IO2A 1WPKA 4FASD 2YUSA 1UCRA 2AQFA 3LSHA 4ZC3A 4LG0A 3REOA 1SFUA 1FJLA 5F1JA 3PFIA 1T33A 3JRBA 2XB0X 3BZ6A 3L2QA 4B43A 1P9QC 3CC4I 1OCTC 5J8FA 1Z9CA 5LBQA 4IVNA 4BHCA 4E7HA 3DF8A 2CW8A 4XM3A 2XF5A 1RNLA 4V2GA 3K4BA 2WY8Q 5HLGA 4JOMA 1T8IA 3KYDB 4I0BA 3K70C 4HBLA 2LTPA 3Q5FA 3FM3A 3HL2A 5ILSA 3LSMA 4QIWN 1IN4A 1YFHA 2V1NA 2ZC2A 4BE1A 5AONA 3H35A 1ETVA 1QHHD 3DU5A 3E7LA 4HNVA 1VQ8I 3S8PA 4IEJA 3IP4B 4G7HF 4HSTA 2ZBKA 2QGUA 3GLLA 3VYSB 4DBRA 3D5SC 4GXOA 3RQ4A 2HPIA 1ITYA 3OV8A 2LF7A 4E6KG 4O6JA 1MBEA 4CDGA 1YX5A 3CCRI 3CDHA 1W0TA 4PJMA 1I3QJ 3TP3A 1BI2A 1P4AA 4Y17A 5DTDA 1UG2A 3F8FA 1FOKA 4OIPF 5JR3A 1NK2P 2MH9A 3I4MJ 2L7FP 1P4WA 2OC6A 4BACA 2PEXA 2Q2EA 1EH8A 4LLGF 1VQOI 5KAIC 2HKOA 1DQUA 1W7PA 1ETXA 4ENMA 5KK1A 3J81Z 2ZJ2A 3AFHA 2EWNA 3P9IA 1CGPA 4QPQA 3C18A 1UZCA 3JREA 2ESHA 1MW7A 2QA4I 1VQMI 2NS7A 1B6AA 3CUQC 3GVAA 1FBQA 1SFXA 4M6VA 2A68F 3HRTA 5GAEJ 2YU3A 3WTUC 2ISZA 4Y7NJ 1IDYA 4PFPA 3FX3A 1HCRA 3W6KB 2ID6A 3CDIA 1FWZA 3TOAA 1T95A 5CPRB 2BVMA 2HVSA 1ZG1A 2LOOA 3Q0UA 1Z0XA 1FSEA 2CQNA 3C7JA 3QQAA 3KP5A 2QEXI 3L09A 2COBA 4ESFA 3E97A 3CCQI 3OIOA 3R6SA 2JPCA 1CF7B 1Z91A 1X3ZB 2H1LA 1B8IB 2AS5F 2QUFA 3HM5A 5LGNA 1WFXA 2VN2A 1I3AA 2K27A 2KJBA 5B1AH 2XAUA 3I53A 4AM3A 5HS9A 1Y1VJ 1D1AA 3A0BC 2R5YA 1JUPA 1MIJA 2DPUA 1OCRH 4IOCF 3CLQA 5ILUA 4WX9A 4ZZLA 1D8KA 3PM1A 1SFKA 2QQAA 3KPHA 1YHQI 2NVTJ 4WXHA 3E6BA 3AKZA 3CMYA 4A93J 3IWFA 1LVAA 2FNPA 2L9NA 3IRQA 3QAHA 3IWZA 4OMYA 4HRIA 5LD2C 1S6LA 2MGQA 1ETYA 2IS1A 3HEFA 4F7ZA 4YFXF 1OPCA 3KLOA 1R58A 1KU3A 2K9MA 1K78B 4LK1F 3TMOA 3EUHC 2EFPA 3EYIA 2MC4A 1H89C 2CRGA 5IP7J 5IYCJ 2IGNA 4A3LJ 3HRMA 4J01A 3SDGA 1O3QA 2GM4A 2QSFX 4ENKA 4A3BJ 4A3MJ 1YW9A 3E6MA 4BNCA 5LGTA 2WY7Q 3VDXA 2VKEA 4DW6A 3OYFA 1MNEA 1OMIA 3C1DA 4G8XA 2IP2A 4XKVA 5FKNA 2ZCWA 2WC2A 3PUFA 4MQ9F 5FD6A 3K4NA 4BY1J 1R4NB 3M4OJ 1U0JA 3V4GA 3J7YJ 4KIGA 6PAXA 4XQFA 1U5TC 1Z67A 2E1MC 1Z1DA 3ZQQA 1X4PA 3FZVA 2LP0A 5M3FJ 1XSDA 1VQ9I 2XKOA 4IHWA 1TWAJ 1ZGWA 3F8NA 3FXUA 3LOCA 5D4RA 3CCUI 5EF6A 4U0WA 3L00A 3ZMSA 3LA2A 2E7XA 3I5UA 2JVGA 4ENNA 3E5UA 3R0AA 2FMLA 4A3DJ 1OCOH 5CYVA 3W3CA 3I59B 3OWTA 4XBFA 2EZHA 2Y75A 3WGGA 2OF7A 2EZLA 3EYYA 3WHBA 3ZQLA 2VE9A 1K4TA 3O8GA 2LF8A 2DDAA 3S1NJ 1BOAA 5DUKA 5CVRA 1YTYA 3UR3C 4A6DA 2UZKA 2OBPA 3QOEA 1JHFA 2CV1A 2WAQN 1V5FA 2IW5A 1ZELA 4P9UA 1W36C 4CH7A 3CJRB 1ZARA 2W48A 2GXAA 2XV4S 5BQTA 4IJAA 2ADUA 2V9KA 3JTGA 1MNDA 2FQ4A 2JWTA 3RPUA 4B09A 2VJIA 3B6AA 4ZZDA 1HW1A 5DV5A 1I39A 2B9SA 3CZ6A 3MKZA 2O6GE 2L7ZA 3GFLA 1UHWA 2OD5A 2XGDA 1IUFA 1SC7A 1ZR4A 2MH2A 3BJOA 4UUSA 2VIXA 2E1CA 2V26A 5E3LA 4HQMA 4RLFA 1GXPA 2VPRA 1R23A 2VL8A 4M3DA 5HDKA 1RC9A 2ZJQF 4C3HJ 3S15J 3KP4A 3ZMVA 1HDPA 3TGNA 3H1CA 3PL8A 1G3SA 2OQGA 1ZK8A 1B9MA 1PJRA 2R5ZB 4G6DA 3DBRB 1K7AA 3BQYA 1YYVA 3HC7A 1YIJI 4P5OA 4D0PA 1S5LC 3ROUA 1Z3YA 3IAS2 3CCYA 2DMQA 2PMHA 2KMUA 3BJAA 1EV7A 1NTCA 3OS0A 3K2AA 3H9QA 3HKZN 4LGWA 4BJTA 2L01A 2Z16A 5DCMB 2BW3B 1MBGA 1ZYRF 3FMSA 5DM7F 2HPMA 1XC5A 3UNGC 1N25A 3QPSA 1K6YA 4RMNA 4R79A 1F43A 1MMAA 2HZDA 2L54A 2ESNA 4RAGA 2M9HA 3DKXA 2BV6A 4NB5A 4M9ZA 2FBKA 5FRMA 1OR7C 2EH3A 4D1QA 2M34A 4PZJA 4HYEA 3BPXA 5FGMA 1G3TA 3MVPA 2R7RA 2MABA 3F9KA 3HZJA 1V3FA 4RBOA 2QBYB 3BLYA 3MZHA 5M3MJ 1APLC 2VBWA 1TNTA 1BOBA 4O5VA 5DCMA 1ETQA 3QPLA 5HS7A 1SVMA 3AG3H 2IJLA 4N9HA 1ETWA 4G6QA 1KU2A 1QGPA 2ELHA 2H8WA 2AHQA 3EQLF 3GYHX 5FLVA 2ZXWH 2DA3A 5HNFA 3RCOA 2RAEA 1YLFA 3PFYA 4II2A 4B3AA 2CSOA 2O03A 2Y31A 1ZKGA 1B9NA 3LSTA 4A2UA 1XMKA 1S29A 2XRNA 4JX6A 2XIGA 2BZTA 2YR2A 3S1MJ 2W57A 1USTA 1ZAOA 2VKVA 5KHDA 1WQ2A 5J40A 1ZLKA 3J80K 4MTDA 4IX7A 2Z2SB 5J1RA 1RPWA 2K40A 3RSNA 3E5XA 1XDSA 4ZYAA 3GZNB 4ZYHA 5AIPA 1Y8QB 2JRMA 2K9QA 3BOQA 4C3JJ 3DPLC 2HGCA 4C3IJ 2W00A 1YX3A 3WGHA 3I55I 2TCTA 2H1KA 2GXBA 2LD5A 3V8JA 1A04A 3VEPA 4PFOA 4KITB 2DA7A 4M71A 3SEZA 3VPRA 2GIZA 4LLLA 2LKPA 5KCMA 1SD4A 3ZOBA 1LJ9A 3NWSA 3EUAA 3BWGA 1FEXA 3GTGJ 2XASA 3OR2C 2HFHA 1K83J 2LBFA 4JQFA 1U8BA 2HTJA 1FY7A 5F0FA 1KZHA 3GXOA 1TTYA 3I4PA 2KLOA 2O5RA 1XGMA 2OJED 2E5NA 2WA0A 3S3OA 3S32A 1R49A 4EJVA 3ULQB 1LE8A 4RA2A 1MDMB 1R00A 2LK2A 3BG5A 3I4NJ 2DLLA 2BHZA 3ZMDA 1J2XA 3FK6A 1MBFA 4CCJA 1SANA 3RYPA 2GXGA 3BCBA 3FBNB 3G2BA 4JK1X 5FKKA 4A3IJ 4LFUA 2KIFA 4D7MA 1WVRA 3MZYA 3QYFA 2ZFWA 4XICA 1ZRDA 5LFAA 5FFXA 3H9JA 3L2UA 3U9GA 1JKPC 4IRIA 3Q0VA 3J7ZI 1OFCX 1FOWA 4Q47A 1I6XA 2QVOA 4GFBA 3TEDA 2R7WA 3W6VA 3RZOJ 4IHVA 3ZCOA 2QLZA 2FBIA 1JT0A 2H8RA 5FLXK 4OOIA 3I58A 1I1GA 1LFPA 2E34A 4BU2A 1JJ6C 1IXSB 4M3EA 2R0QC 5CQEA 4AYBN 3CJTB 2IPQX 1LVKA 1MH4A 1O7LA 2RDPA 2Q0OA 5IOZA 2ZSHB 3HOWJ 1QZYA 3C2HA 3DQVC 4BJ5C 5E1XA 3ZQFA 4XLHA 4AIHA 4CYCB 3S1RJ 1J59A 3SZPA 1EJ9A 1AHDP 2P0WA 4Z6YA 3TO6A 5L3CA 2FOWA 3CF2A 1TLHB 1V54H 3M1CA 2CQQA 3IUOA 1UHSA 1KA8A 4A5MA 1PP8F 1W4MA 3GWZA 5BS6A 3F0CA 1FOYA 3D0SA 4I01A 2PMZN 5M5YJ 3FHZA 4XOPA 3PO2J 1ZHFA 3H5AA 3ZMUA 1G3YA 3S14J 2VQGA 2NYXA 2Y0SN 1IRFA 2HOSA 4C9YA 2Z9OA 4XRMA 4TV7A 3O6BB 3L2WA 3HSRA 2JT1A 3PQKA 4V19K 4DZPA 2VXZA 3H3ZA 1IN7A 3CDLA 2EZIA 2F4IA 1SFOJ 5KAFC 4JX5A 3T8RA 4A3FJ 3W6JB 1E0EA 1Z7UA 4RM3A 2DCEA 1G6NA 4UUVA 3BQZA 4DZJA 3JAMZ 4U0YA 3L7WA 1AKHB 2HYFA 4ZDLA 3K1PA 3D1NI 4HLXA 2D1HA 5CQGA 1FOXA 1PYVA 4HV5A 3WTVC 3K70D 4X6AJ 2RN7A 4A0YA 1J0RA 3ZQHA 4L0ZB 5DS9A 5KVRA 2RV8A 2CQKA 3M1EA 4BHBA 4M6YA 2VONA 5M5XJ 1L0OC 1LDDA 2HDDA 1GLNA 3DU6A 4B1RA 5ERIA 5K5OA 4UVAA 2OAZA 3TOBA 2XAHA 1MBHA 5DEQA 3E1SA 2R4GA 1TQIA 2F4MB 3RKYA 4BS9A 1D1BA 2ACJA 2IRFG 1XSXA 3HTSB 4ANJA 2TRTA 3KX2A 3TBIA 3OOPA 1R22A 1T39A 3HHHA 2QM3A 2KKOA 3N4MA 3J7AO 2PMUA 1ACIA 2KPMA 4IQJA 2BHYA 4A3CJ 4M9XA 5CLSA 1D5YA 2VBZA 3OR1C 2G9WA 4KN7X 2EA4A 2J5OA 2RQQA 2NOGA 4FHTA 3HOUJ 1BIBA 3B73A 2M45A 5E18F 5IYBJ 3OYIA 1TL8A 2P7CB 5JI6A 1X3WB 4LK0F 3ZP5A 3RI4A 3FMQA 5F08A 2UWMA 2P7VB 2VC0A 4BDZA 1VQ5I 1RUNA 1E3HA 4BH9A 4IRHA 2OCEA 5E17F 1SMYF 2NS8A 4LG0B 3A1YA 2Z33A 3JW4A 4EGZA 1IRZA 4ZYEA 3F21A 4WXCA 5E1WA 1AA7A 3Q9VA 3GUDA 2QYOA 5L3BA 3CMAI 2GA2A 5BPIA 2IEKA 1FIAA 2ZJRF 2ELKA 3SFIA 1B72A 3RZDJ 4HEA2 3GTJJ 4P96A 4RB2C 4IPAA 1WI9A 2DN0A 2P6TA 2RVCA 4FX0A 4CCMA 3TP0A 2LMDA 1IN8A 5EEGA 1QVUA 2W1OA 5ICGA 4XKWA 1N78A 4IOAF 1R5ID 2X6XA 4M3BA 1T56A 2CV0A 2AQEA 4D5FA 5HNHA 2ME0A 4XN3A 3KZIC 4W1UA 5D8LB 4CA0A 1V55H 4DNCA 1VTNC 1TZLA 2OTLI 1MZBA 3TO7A 2DT7B 5FD5A 3ZQ7A 3LSKA 2L9VA 3JRGA 1XS9A 3JR9A 1Q1VA 2RQPA 1Z7LA 3D5RC 3CC2I 4YFNF 3FKIJ 5LRRA 1U8RA 1FBSA 1SD5A 2JUCA 3S3MA 1VQ7I 2OU2A 2XB5A 3G1LA 4CCLA 1FPQA 1D5VA 3U21A 4U7BA 2A61A 3BR3A 1F5TA 4L9NA 4KMFA 1J5YA 2Q2EB 3QOPA 2HQAA 1WSUA 5IOYA 1O3TA 1N77A 2L4AA 1YITI 1XCVA 1ERDA 1W7PB 2GOXB 3DWLE 2CJJA 4LOCA 4M72A 2K4JA 4C2MJ 2AO9A 5K7FA 1X58A 3LSRA 4BQOA 3L2CA 2R7VA 1W5TA 3KEQA 4A3JJ 4M74A 2E35A 3KYCB 1Q1HA 2PFBA 2NXNB 2DODA 4P9FA 4BDYA 5F1RA 5IT3A 2E1OA 1YJWI 3BR1A 4OINF 3MAJA 4Y4RA 1R5GA 3NARA 2LREA 3K4JA 2IS4A 2LY1A 2GAUA 4MNUA 5JLXA 3PSFA 4BEHA 4O3MA 2WB1A 4CO8A 2M8EA 1TWFJ 4OAYA 1U3EM 1H9TA 2CUJA 2L3DA 2LH9A 1BR4A 2DA6A 3JRAA 4PK4A 2V9PA 2P4WA 2EV6A 3K10A 3GMEA 4XOTA 2XAGA 2Y2ZA 2H6CA 2BE5F 2R5YB 4XRSG 4M6XA 4D9JA 3M8EA 4RB3C 5M5WJ 2KT0A 4EJUA 1JTYA 2GIVA 2QCOA 5J4YA 2YSRA 1IDZA 5FO5A 2DYSH 3CCMI 2BY3A 1TW3A 3DPUA 3COAC 4LB5A 2P5LC 2QF7A 1YE9A 3U1DA 2W82A 1JTXA 3PIPF 1JGGA 1R1UA 1ZQ3P 2HYJA 2DA2A 2X9DA 1FT9A 3B02A 1W36D 2NVXJ 2ZO4A 2E2HJ 1V5EA 5E20A 1F4KA 2UXNA 1MGTA 3ZMZA 2ZSIB 4CSWA 2WV0A 5EDNA 2DW4A 1HSTA 3GF2A 3LA7A 1KQ0A 3FISA 1UMQA 3IH3A 1HDDC 2FEZA 1QHGA 3K9TA 5DD4A 2X85A 2LDUA 3LWFA 2M2EA 2B7EA 3OYLA 2VB6A 2IA2A 4EJWA 5C44J 3P9KA 2LKXA 1RKWA 3WG7H 5GTIC 3BCAA 1W0UA 5K5QA 3ZR8X 5B66C 1OKRA 2O7OA 3KP6A 3MMYB 2BBYA 4V2FA 2DFFA 5E3OA 1BI0A 3CO6C 2BOLA 3CO7C 3WE2A 1BI1A 3DTEA 3H5RA 1IN6A 2V7FA 4W97A 3HG9A 2R7DA 4DOZA 4HF2A 1ETKA 2HOEA 4IXAA 1OYIA 3LL7A 4HAMA 2R7FA 1EF4A 3PNTA 1WZ2A 4M3GA 3G1OA 2EINH 3OOUA 2RC4A 1XD7A 2Y9YA 2MD5A 3DPTA 4KA4A 3F8BA 1HKQA 3IHUA 1FZPB 1G2HA 3TO9A 1RZ4A 2HZTA 2GBYA 4F3QA 3FWEA 4E7JA 3VODA 3ABMH 5FKLA 1AWCA 3CMMA 1XG1A 4FCYA 1LEAA 1ZR2A 2JPBA 3FXKA 1SD6A 1FTTA 2XDVA 4MEYF 3OMYA 3QWLA 2XROA 1DUXC 4UB6C 2OPTA 4L5IA 4B3XA 4B44A 1B59A 4H0EA 1HA8A 2Z3YA 3ONQA 4I02A 1I50J 3HRUA 2HQ5A 2PQ8A 4N4NB 4Y52J 2LY2A 4R1HA 5EJCA 4EM2A 2GQQA 1JKOC 1GV2A 1HXDA 1Y56A 4HSRA 2ZMEA 4CCKA 5BOXA 1GT0C 3ABLH 1X1CA 1MSFC 2MG4A 2A6EF 4XLPF 3MKWB 1FYMA 1R1VA 4UUSB 5FKMA 1TNSA 4EV0A 3JRCA 4C2TA 4HF0A 1YI2I 4ZJZA 4Y15A 3CCVI 2DOAA 4WXDA 2M30A 2IA0A 4EVIA 2ZNYA 5GTHC 4CCOA 2STTA 3HB9A 2CFXA 4F91B 2LR8A 2Z1DA 2EV5A 1I27A 2KZGA 2ZJPF 2X1CA 3H0GJ 3LSPA 1VQ4I 4NHJA 1MJ9A 3WODF 5ICFA 2DOFA 2KIMA 2KL4A 4WCGA 3S1QJ 1B4AA 1R6RA 2LC2A 1ZG5A 4F92B 2BEOA 2WV1A 5E3MA 4RDUA 1YJNI 2A5YB 1TW2A 1YG2A 5EZHA 3RKQA 1ZGAA 4EM1A 3NEUA 2JK3A 3K6GA 2O8KA 3WTXC 1E3PA 4EJTA 5FFZA 2H09A 1IJWC 1QZZA 4RAFA 3V7CA 2YX7A 2ISYA 1ZGJA 2HOAA 2M7AA 5L3FA 2MLGA 3GFJA 3J80Z 4RLQA 1X19A 2YX4A 3HGGA 3HUGB 2R7TA 2V6EA 2C6YA 2CUZA 4GO1A 2MW8A 1YOVB 2E19A 2VBXA 1P92A 3RPQA 2CUEA 3ZXSA 2WAFA 3ABKH 2VLAA 2OCCH 2EFQA 2YU9J 4BQAA 1R1TA 4FISA 3HPGA 1Y0NA 5J6XA 2IXSA 3E0JB 4YIFA 5J3LA 2K9NA 3SDBA 5HOOA 2VKHA 4GDFA 1R36A 1HBXG 2IVMA 3HIFA 3H0DA 3IKTA 2XAQA 2CW7A 2CS3A 2K02A 5GPCA 2MBFA 3M3YJ 2DMTA 2JA2A 1WGXA 2X1DA 4HV6A 3QPTA 4PJ0C 4XK4A 3C2GA 4AWXB 3ISPA 4AIKA 3F22A 2IS2A 2COMA 2F5DA 4RS8A 3FMRA 2H94A 1RIOH 3CMEI 4ON0A 2P81A 3HUGA 4N4OB 3BC8A
chains in the Genus database with same CATH topology
5F0CA 3S1RJ 1AHDP 2XGCA 2CQQA 4L5EA 1WPKA 1UHSA 1B8IA 4EEFG 2YUSA 4BKXA 3F0CA 1A5JA 1FJLA 5F1JA 4QSHA 2PMZN 1BW6A 5M5YJ 3PO2J 1T33A 3JRBA 1IGNA 2XB0X 3FK7A 3S14J 2Y0SN 2XRLA 2HOSA 1OCTC 1YRNA 4XRMA 1JKRC 4V2GA 1BL0A 4BBSJ 4DZPA 1QRYA 1I6HJ 3CDLA 2EZIA 5FKOA 1SFOJ 5IP9J 2LTPA 4JX5A 3TW7A 4QIWN 4A3FJ 4A69C 2GLOA 5C4XJ 3BQZA 4DZJA 5EYRA 1AKHB 1ETVA 3E7LA 3D1NI 4HNVA 4IEJA 4X6AJ 3ZQHA 1LE8B 5DS9A 2HXOA 1ITYA 3NAUA 1MBEA 2L7MP 5M5XJ 1W0TA 2HDDA 1I3QJ 3TP3A 4B1RA 1MBKA 2JN6A 1TWHJ 5DTDA 2KDZA 1UG2A 1MBHA 1NK2P 5GPAA 3I4MJ 2L7FP 4BXXJ 2TRTA 4FE4A 1R9TJ 4B4CA 4QTRA 1ETXA 2D5VA 2DMNA 1BJZA 1POGA 3JREA 4A3CJ 5EEAA 1D5YA 2LY9A 2ECBA 1ORKA 2NS7A 9ANTA 3C2BA 2ECCA 3BR5A 2L9RA 4M6VA 3BTIA 2NOGA 2EBIA 1MBJA 4Y7NJ 1IDYA 3HOUJ 1HCRA 2ID6A 3BTLA 3MKLA 5FJ8J 1IV6A 5IYBJ 1RR7A 4A3GJ 3Q0UA 1Z0XA 3BR2A 3QQAA 5F08A 1RESA 2COBA 2I10A 3K7AJ 3OIOA 1MNMC 3L1PA 4FE7A 1B8IB 4XIDA 4X1EA 3HM5A 2NS8A 1HF0A 1IRZA 1H88C 1JT6A 3A03A 3HOVJ 1Y1VJ 4JX4A 2R5YA 2IEKA 1JUPA 1FIAA 2XGEA 2ELKA 3SFIA 1LFUP 1B72A 3RZDJ 3BTCA 1GV5A 3GTJJ 3IH2A 4MLOA 3PM1A 3G1MA 2DN0A 1S7EA 1BA5A 2NVTJ 4JP0A 4JYKA 4NDLA 4A93J 3CMYA 3TP0A 1GVDA 1Y1WJ 3Q0WA 1QVUA 4MFDA 3HOZJ 2MGQA 1ETYA 3HOYJ 1WH5A 3DCFA 4M3BA 2K9SA 1T56A 2YS9A 4D5FA 3HEFA 2ME0A 3S17J 2ID3A 4W1UA 1LFBA 2LLKA 1H89C 3JRGA 2CRGA 3JR9A 2IAIA 1FIPA 1Q1VA 5IP7J 5IYCJ 1XS9A 4A3LJ 3SDGA 2GM4A 3FKIJ 4A3BJ 4A3MJ 2XB5A 2CU7A 5F04A 3G1LA 2VKEA 2G0EA 4DW6A 2B63J 3BR3A 3O8HA 3JRFA 5FKNA 1O4XA 4UUTA 2R5ZA 5IOYA 2HXIA 4BY1J 3M4OJ 5HODA 5J1YA 1JUSA 2CJJA 4LOCA 4C2MJ 1ETOA 2AO9A 5K7FA 3IH4A 2CQXA 3BG3A 1X58A 2IBDA 1Z77A 3LSRA 3PO3J 2LP0A 3BR6A 5M3FJ 4A3JJ 4IHWA 1TWAJ 1ZGWA 3BTJA 2M8GX 3LOCA 5EF6A 2R92J 2E1OA 3BR1A 3NARA 4A3KJ 4A3DJ 2Y30A 3A01A 3GTKJ 4DYRA 5JLXA 1GDTA 2EZHA 2OF7A 1TWFJ 2EZLA 1E3OC 2JJ7A 3WHBA 3ZQLA 2DA6A 2DJNA 3JRAA 5EG0A 3O8GA 3ZQIA 3S1NJ 3OSFA 2E2JJ 5K7HA 2Y2ZA 2R5YB 4XRSG 5M5WJ 2KT0A 2WAQN 3WHCA 4AC0A 1JTYA 1B72B 2QCOA 1IDZA 2R7ZJ 1VFCA 3GTQJ 1TWGJ 2W48A 2LFBA 2QF7A 1JTXA 1JGGA 1ZQ3P 3HGYA 2HYJA 2FQ4A 2DA2A 2X9DA 2JWTA 2N8GA 2FX0A 1TWCJ 2NVXJ 3B6AA 3DEWA 3RQIA 4S0HB 2L0KA 3UKGA 2L7ZA 2E2HJ 4XRSA 3ZQGA 1HOMA 2XGDA 5F0HA 1IUFA 2EZKA 1ZR4A 4UUSA 5EDNA 5E3LA 3LSJA 2VPRA 3JRHA 3FISA 1UMQA 3IH3A 1HDDC 5IYDJ 4M3DA 2M2EA 4C3HJ 3S15J 4ABZA 1HDPA 4MO7A 1P7IA 1MSEC 1OCPA 5C44J 2X6OA 4DYQA 1RKWA 2LVSA 1ZK8A 2LKXA 3TW6A 2VI6A 2R5ZB 1IC8A 3CQZJ 1W0UA 2O7OA 2O9LA 4V2FA 3BQYA 5E3OA 1VF9A 1ZTRA 4M3FA 5C4JJ 3B6CA 2XPWA 3CCYA 2DMQA 3Q3SA 1BW5A 2ME6A 1NTCA 3LSGA 3K2AA 3HKZN 4W97A 2JA5J 1PUFA 1ETKA 2DA1A 2E2IJ 1EF4A 1MBGA 1XC5A 4M3GA 3G1OA 1H8AC 3OOUA 5EZGA 2R93J 3QPSA 3A01B 1F43A 2Y9YA 3S16J 1G2HA 5EGOB 2M9HA 3JRIA 2GBYA 3SJMA 5EG0B 5FLMJ 5FKLA 2XPUA 3LNQA 2EH3A 2WB1N 1XG1A 4FCYA 2M34A 1HLVA 1ZR2A 1QPIA 3MVPA 1FTTA 1CQTA 2EQRA 3GBGA 5E3NA 2DTZA 4J19A 3GTLJ 1IG7A 4RBOA 4AUXA 3H3VK 1AU7A 1APLC 5M3MJ 3JRDA 2OPTA 4I6ZA 5C3EJ 1ENHA 1QVTA 1I50J 2HQ5A 4Y52J 2DMPA 1JKOC 1ETQA 3QPLA 1GV2A 1ETWA 1GT0C 4I76A 1RKTA 2CUFA 1MH3A 2AHQA 1MSFC 1FTZA 5FLVA 2MG4A 2DA3A 3BT9A 3HOXJ 3BG9A 2RAEA 4MIMA 3S2DJ 5EGOA 2FD5A 4UUSB 5FKMA 4B3AA 3JRCA 1WI3A 4IHXA 1VNDA 2Y31A 1ZKGA 3GTMJ 1X2MA 4CYCA 5F27A 4JX6A 3BR0A 3S1MJ 2XPVA 2VUMJ 1JUMA 2VKVA 2JA6J 3HB9A 4A3EJ 1TC3C 5J1UA 2LR8A 2M0CA 2JMWA 5J1RA 1RPWA 2K40A 4BY7J 3H0GJ 5IP6A 3LSPA 3ZQCA 2K9QA 4G12A 4C3JJ 3HBLA 4C3IJ 5GP9A 4MFEA 3S1QJ 2TCTA 4BBRJ 2X48A 3FIWA 5E3MA 2WV1A 2H1KA 2NVYJ 2LD5A 4RDUA 2JA8J 5IPAA 1F36A 2MSYA 5EZHA 3IV5A 1PUFB 2DA7A 3S2HJ 3RKQA 5JLWA 3VPRA 2JK3A 2O8KA 3ZOBA 1NK3P 1FEXA 4D5CA 1GUUA 1IJWC 3GTGJ 1K83J 2HOAA 3GTOJ 1AKHA 1U9NA 1U8BA 3GTPJ 1VI0A 5F0FA 1OJLA 3HGGA 2DMUA 4FTHA 5K7ZA 2DA4A 5BNGA 1LE8A 2MW8A 2LK2A 3BG5A 3I4NJ 2E19A 3FK6A 1MBFA 4IHYA 1SANA 3MN2A 1WCMJ 2CUEA 5FKKA 4A3IJ 2FJ1A 4D7MA 2YU9J 4XICA 2Y9ZA 3A02A 4FISA 4DYCA 2JA7J 5J3LA 2K9NA 1JKPC 2HI3A 2DA5A 3Q0VA 1OFCX 1JKQC 4GFBA 3OSGA 3TEDA 3HDDA 3W6VA 3RZOJ 4IHVA 1YRNB 1JT0A 1U78A 2H8RA 5GPCA 1DU6A 3M3YJ 2DMTA 1WGXA 4D7NA 1RETA 1JJ6C 1U9OA 4XK4A 2NVQJ 4M3EA 1DU0A 2R0QC 4AYBN 1K61A 2HOTA 2XSDC 1WH7A 1MH4A 2ZB9A 1X2NA 1A6IA 1P7JA 2P81A 5IOZA 3HOWJ 1JJ8C 3ZQFA 4CYCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0C A;  3S1R J;  1AHD P;  2XGC A;  2CQQ A;  4L5E A;  1WPK A;  1UHS A;  1B8I A;  4EEF G;  2YUS A;  4BKX A;  3F0C A;  1A5J A;  1FJL A;  5F1J A;  4QSH A;  2PMZ N;  1BW6 A;  5M5Y J;  3PO2 J;  1T33 A;  3JRB A;  1IGN A;  2XB0 X;  3FK7 A;  3S14 J;  2Y0S N;  2XRL A;  2HOS A;  1OCT C;  1YRN A;  4XRM A;  1JKR C;  4V2G A;  1BL0 A;  4BBS J;  4DZP A;  1QRY A;  1I6H J;  3CDL A;  2EZI A;  5FKO A;  1SFO J;  5IP9 J;  2LTP A;  4JX5 A;  3TW7 A;  4QIW N;  4A3F J;  4A69 C;  2GLO A;  5C4X J;  3BQZ A;  4DZJ A;  5EYR A;  1AKH B;  1ETV A;  3E7L A;  3D1N I;  4HNV A;  4IEJ A;  4X6A J;  3ZQH A;  1LE8 B;  5DS9 A;  2HXO A;  1ITY A;  3NAU A;  1MBE A;  2L7M P;  5M5X J;  1W0T A;  2HDD A;  1I3Q J;  3TP3 A;  4B1R A;  1MBK A;  2JN6 A;  1TWH J;  5DTD A;  2KDZ A;  1UG2 A;  1MBH A;  1NK2 P;  5GPA A;  3I4M J;  2L7F P;  4BXX J;  2TRT A;  4FE4 A;  1R9T J;  4B4C A;  4QTR A;  1ETX A;  2D5V A;  2DMN A;  1BJZ A;  1POG A;  3JRE A;  4A3C J;  5EEA A;  1D5Y A;  2LY9 A;  2ECB A;  1ORK A;  2NS7 A;  9ANT A;  3C2B A;  2ECC A;  3BR5 A;  2L9R A;  4M6V A;  3BTI A;  2NOG A;  2EBI A;  1MBJ A;  4Y7N J;  1IDY A;  3HOU J;  1HCR A;  2ID6 A;  3BTL A;  3MKL A;  5FJ8 J;  1IV6 A;  5IYB J;  1RR7 A;  4A3G J;  3Q0U A;  1Z0X A;  3BR2 A;  3QQA A;  5F08 A;  1RES A;  2COB A;  2I10 A;  3K7A J;  3OIO A;  1MNM C;  3L1P A;  4FE7 A;  1B8I B;  4XID A;  4X1E A;  3HM5 A;  2NS8 A;  1HF0 A;  1IRZ A;  1H88 C;  1JT6 A;  3A03 A;  3HOV J;  1Y1V J;  4JX4 A;  2R5Y A;  2IEK A;  1JUP A;  1FIA A;  2XGE A;  2ELK A;  3SFI A;  1LFU P;  1B72 A;  3RZD J;  3BTC A;  1GV5 A;  3GTJ J;  3IH2 A;  4MLO A;  3PM1 A;  3G1M A;  2DN0 A;  1S7E A;  1BA5 A;  2NVT J;  4JP0 A;  4JYK A;  4NDL A;  4A93 J;  3CMY A;  3TP0 A;  1GVD A;  1Y1W J;  3Q0W A;  1QVU A;  4MFD A;  3HOZ J;  2MGQ A;  1ETY A;  3HOY J;  1WH5 A;  3DCF A;  4M3B A;  2K9S A;  1T56 A;  2YS9 A;  4D5F A;  3HEF A;  2ME0 A;  3S17 J;  2ID3 A;  4W1U A;  1LFB A;  2LLK A;  1H89 C;  3JRG A;  2CRG A;  3JR9 A;  2IAI A;  1FIP A;  1Q1V A;  5IP7 J;  5IYC J;  1XS9 A;  4A3L J;  3SDG A;  2GM4 A;  3FKI J;  4A3B J;  4A3M J;  2XB5 A;  2CU7 A;  5F04 A;  3G1L A;  2VKE A;  2G0E A;  4DW6 A;  2B63 J;  3BR3 A;  3O8H A;  3JRF A;  5FKN A;  1O4X A;  4UUT A;  2R5Z A;  5IOY A;  2HXI A;  4BY1 J;  3M4O J;  5HOD A;  5J1Y A;  1JUS A;  2CJJ A;  4LOC A;  4C2M J;  1ETO A;  2AO9 A;  5K7F A;  3IH4 A;  2CQX A;  3BG3 A;  1X58 A;  2IBD A;  1Z77 A;  3LSR A;  3PO3 J;  2LP0 A;  3BR6 A;  5M3F J;  4A3J J;  4IHW A;  1TWA J;  1ZGW A;  3BTJ A;  2M8G X;  3LOC A;  5EF6 A;  2R92 J;  2E1O A;  3BR1 A;  3NAR A;  4A3K J;  4A3D J;  2Y30 A;  3A01 A;  3GTK J;  4DYR A;  5JLX A;  1GDT A;  2EZH A;  2OF7 A;  1TWF J;  2EZL A;  1E3O C;  2JJ7 A;  3WHB A;  3ZQL A;  2DA6 A;  2DJN A;  3JRA A;  5EG0 A;  3O8G A;  3ZQI A;  3S1N J;  3OSF A;  2E2J J;  5K7H A;  2Y2Z A;  2R5Y B;  4XRS G;  5M5W J;  2KT0 A;  2WAQ N;  3WHC A;  4AC0 A;  1JTY A;  1B72 B;  2QCO A;  1IDZ A;  2R7Z J;  1VFC A;  3GTQ J;  1TWG J;  2W48 A;  2LFB A;  2QF7 A;  1JTX A;  1JGG A;  1ZQ3 P;  3HGY A;  2HYJ A;  2FQ4 A;  2DA2 A;  2X9D A;  2JWT A;  2N8G A;  2FX0 A;  1TWC J;  2NVX J;  3B6A A;  3DEW A;  3RQI A;  4S0H B;  2L0K A;  3UKG A;  2L7Z A;  2E2H J;  4XRS A;  3ZQG A;  1HOM A;  2XGD A;  5F0H A;  1IUF A;  2EZK A;  1ZR4 A;  4UUS A;  5EDN A;  5E3L A;  3LSJ A;  2VPR A;  3JRH A;  3FIS A;  1UMQ A;  3IH3 A;  1HDD C;  5IYD J;  4M3D A;  2M2E A;  4C3H J;  3S15 J;  4ABZ A;  1HDP A;  4MO7 A;  1P7I A;  1MSE C;  1OCP A;  5C44 J;  2X6O A;  4DYQ A;  1RKW A;  2LVS A;  1ZK8 A;  2LKX A;  3TW6 A;  2VI6 A;  2R5Z B;  1IC8 A;  3CQZ J;  1W0U A;  2O7O A;  2O9L A;  4V2F A;  3BQY A;  5E3O A;  1VF9 A;  1ZTR A;  4M3F A;  5C4J J;  3B6C A;  2XPW A;  3CCY A;  2DMQ A;  3Q3S A;  1BW5 A;  2ME6 A;  1NTC A;  3LSG A;  3K2A A;  3HKZ N;  4W97 A;  2JA5 J;  1PUF A;  1ETK A;  2DA1 A;  2E2I J;  1EF4 A;  1MBG A;  1XC5 A;  4M3G A;  3G1O A;  1H8A C;  3OOU A;  5EZG A;  2R93 J;  3QPS A;  3A01 B;  1F43 A;  2Y9Y A;  3S16 J;  1G2H A;  5EGO B;  2M9H A;  3JRI A;  2GBY A;  3SJM A;  5EG0 B;  5FLM J;  5FKL A;  2XPU A;  3LNQ A;  2EH3 A;  2WB1 N;  1XG1 A;  4FCY A;  2M34 A;  1HLV A;  1ZR2 A;  1QPI A;  3MVP A;  1FTT A;  1CQT A;  2EQR A;  3GBG A;  5E3N A;  2DTZ A;  4J19 A;  3GTL J;  1IG7 A;  4RBO A;  4AUX A;  3H3V K;  1AU7 A;  1APL C;  5M3M J;  3JRD A;  2OPT A;  4I6Z A;  5C3E J;  1ENH A;  1QVT A;  1I50 J;  2HQ5 A;  4Y52 J;  2DMP A;  1JKO C;  1ETQ A;  3QPL A;  1GV2 A;  1ETW A;  1GT0 C;  4I76 A;  1RKT A;  2CUF A;  1MH3 A;  2AHQ A;  1MSF C;  1FTZ A;  5FLV A;  2MG4 A;  2DA3 A;  3BT9 A;  3HOX J;  3BG9 A;  2RAE A;  4MIM A;  3S2D J;  5EGO A;  2FD5 A;  4UUS B;  5FKM A;  4B3A A;  3JRC A;  1WI3 A;  4IHX A;  1VND A;  2Y31 A;  1ZKG A;  3GTM J;  1X2M A;  4CYC A;  5F27 A;  4JX6 A;  3BR0 A;  3S1M J;  2XPV A;  2VUM J;  1JUM A;  2VKV A;  2JA6 J;  3HB9 A;  4A3E J;  1TC3 C;  5J1U A;  2LR8 A;  2M0C A;  2JMW A;  5J1R A;  1RPW A;  2K40 A;  4BY7 J;  3H0G J;  5IP6 A;  3LSP A;  3ZQC A;  2K9Q A;  4G12 A;  4C3J J;  3HBL A;  4C3I J;  5GP9 A;  4MFE A;  3S1Q J;  2TCT A;  4BBR J;  2X48 A;  3FIW A;  5E3M A;  2WV1 A;  2H1K A;  2NVY J;  2LD5 A;  4RDU A;  2JA8 J;  5IPA A;  1F36 A;  2MSY A;  5EZH A;  3IV5 A;  1PUF B;  2DA7 A;  3S2H J;  3RKQ A;  5JLW A;  3VPR A;  2JK3 A;  2O8K A;  3ZOB A;  1NK3 P;  1FEX A;  4D5C A;  1GUU A;  1IJW C;  3GTG J;  1K83 J;  2HOA A;  3GTO J;  1AKH A;  1U9N A;  1U8B A;  3GTP J;  1VI0 A;  5F0F A;  1OJL A;  3HGG A;  2DMU A;  4FTH A;  5K7Z A;  2DA4 A;  5BNG A;  1LE8 A;  2MW8 A;  2LK2 A;  3BG5 A;  3I4N J;  2E19 A;  3FK6 A;  1MBF A;  4IHY A;  1SAN A;  3MN2 A;  1WCM J;  2CUE A;  5FKK A;  4A3I J;  2FJ1 A;  4D7M A;  2YU9 J;  4XIC A;  2Y9Z A;  3A02 A;  4FIS A;  4DYC A;  2JA7 J;  5J3L A;  2K9N A;  1JKP C;  2HI3 A;  2DA5 A;  3Q0V A;  1OFC X;  1JKQ C;  4GFB A;  3OSG A;  3TED A;  3HDD A;  3W6V A;  3RZO J;  4IHV A;  1YRN B;  1JT0 A;  1U78 A;  2H8R A;  5GPC A;  1DU6 A;  3M3Y J;  2DMT A;  1WGX A;  4D7N A;  1RET A;  1JJ6 C;  1U9O A;  4XK4 A;  2NVQ J;  4M3E A;  1DU0 A;  2R0Q C;  4AYB N;  1K61 A;  2HOT A;  2XSD C;  1WH7 A;  1MH4 A;  2ZB9 A;  1X2N A;  1A6I A;  1P7J A;  2P81 A;  5IOZ A;  3HOW J;  1JJ8 C;  3ZQF A;  4CYC B; 
#chains in the Genus database with same CATH topology
 1K6O A;  4L9T A;  4IO9 F;  2L7K A;  5BMZ A;  4NNJ A;  1N75 A;  3ASO H;  3F72 A;  4GCV A;  3SXY A;  4L5E A;  4EEF G;  5DDG A;  2UV1 A;  3ECH A;  3AL0 B;  1XN7 A;  4QSH A;  1TQP A;  1FNN A;  5TIS C;  3HPH A;  2CV2 A;  3MWM A;  3QP5 A;  1IGN A;  4N0B A;  5FLX Z;  3F23 A;  5HLH A;  1EKE A;  3CP2 A;  4HX4 A;  3VOE A;  4NQW B;  3KEY A;  1KYZ A;  1JKR C;  5D6E A;  4I7H A;  3BDD A;  1ULY A;  4YRV A;  1T38 A;  1BL0 A;  4BBS J;  1QRY A;  1HC8 A;  2VAS A;  4QPO A;  1TT5 B;  5IP9 J;  1V5G A;  1D0X A;  2E5Z A;  3TW7 A;  4A69 C;  4EMS A;  3F6O A;  1UG0 A;  2LBF B;  2ZKZ A;  3VYR B;  3ASN H;  3M8F A;  2X0L A;  4KMU X;  3HSE A;  5IT9 K;  3AG1 H;  4Y13 A;  4XKB A;  2F4O B;  4XSZ F;  3K1M A;  2KIU A;  1LE8 B;  4ZYD A;  4XL9 A;  3NAU A;  3SFZ A;  4CIC A;  2L7M P;  4A6E A;  2EB7 A;  2DTR A;  1HW2 A;  1MBK A;  2JN6 A;  1HW5 A;  2KDZ A;  1S7A A;  1HQC A;  4PGG A;  5GPA A;  4KT6 A;  2NAZ A;  5HLI A;  2F5E A;  2K9L A;  4NQW A;  1B1B A;  1ZH5 A;  4FE4 A;  2DK5 A;  2X6W A;  4QTR A;  1STZ A;  2A6T A;  2IGK A;  2MFZ A;  1S9H A;  1USS A;  1XSV A;  3F6V A;  1I1S A;  1PVE A;  2W24 A;  1BJZ A;  1POG A;  4QWQ A;  3HSF A;  2DT5 A;  2LY9 A;  3BRO A;  2ECB A;  4ESB A;  1ORK A;  4K2E A;  9ANT A;  2PJR A;  2GWR A;  2ECC A;  2RNJ A;  3BR5 A;  2L9R A;  3FBI B;  5D5V B;  1MBJ A;  3MKL A;  3W2V A;  1O7F A;  1IV6 A;  2KFD A;  3F8M A;  4XSX F;  3M9A A;  1WJB A;  3WTS C;  4E7K A;  1Z21 A;  4OMZ A;  3DLA A;  2I10 A;  4AD9 A;  2NS0 A;  5B5E C;  3D5L A;  1J75 A;  2CFO A;  2WTE A;  2TDX A;  4FE7 A;  2QSH X;  4XID A;  1YQA A;  2MA3 A;  4X1E A;  3ZRG A;  3BY6 A;  1ON1 A;  4IKF A;  3TDU C;  1XDU A;  5E1Z B;  4U0V A;  1QO0 D;  1Z6R A;  2M0M A;  2OTJ I;  4U7D A;  1MMS A;  1WRJ A;  3A03 A;  2LKS A;  1IW7 F;  3FXL A;  2X6Y A;  1S72 I;  4Q48 A;  1OCC H;  4E7I A;  3PSI A;  3EPZ A;  1LFU P;  4XMY A;  3SHF A;  3IH2 A;  4MLO A;  5D5X B;  4XN0 A;  4ETS A;  5HDN A;  2HS5 A;  4JP0 A;  1FC3 A;  2M4K A;  4ITV A;  1Y1W J;  1L3L A;  2QEN A;  4Y33 A;  4U87 A;  2Z99 A;  2QZ8 A;  4P55 A;  5B1B H;  4MHG A;  4ZTJ A;  3CUQ A;  1AOY A;  1IV8 A;  1KQ8 A;  1WH5 A;  2DXI A;  2V4J C;  2JRT A;  2K9S A;  4EQQ A;  5ILV A;  2YS9 A;  1IXC A;  2PN6 A;  1G3W A;  1DGR M;  1W5S A;  2ID3 A;  3MQ0 A;  3LQQ A;  1XMA A;  2DK8 A;  1NH3 A;  2FA5 A;  2FXA A;  2EA2 A;  2IAI A;  1FIP A;  4LIT A;  5H6R A;  3WGI A;  2ZXH A;  2FU4 A;  4OU0 A;  3FKJ A;  2DO7 A;  4UB8 C;  2B63 J;  3OYA A;  3O8H A;  2K7L A;  3AG4 H;  3JRF A;  5EEH A;  1YS7 A;  1FLI A;  2XF6 A;  2JTV A;  3CLO A;  3OIP A;  3DFG A;  2BY0 A;  3VWB A;  2IS6 A;  1FMW A;  1OYY A;  3I54 A;  4YEJ A;  2CW0 F;  1KQ9 A;  1ETO A;  2MLK A;  3BG3 A;  5LHI A;  2L9S A;  2IBD A;  4KIF A;  4BUP A;  3PO3 J;  2PG4 A;  1A36 A;  4OWR B;  3T1B A;  2E7W A;  2KJC A;  5CVV A;  1QZE A;  3QU6 A;  3LQR A;  3CJN A;  2E1N A;  5DD8 A;  3RTR A;  1BI3 A;  2ELJ A;  3OYD A;  2NVU B;  2IT0 A;  2MYS A;  5F6F A;  4A3K J;  2L2O A;  4GGG A;  1SD7 A;  3A01 A;  2WWY A;  4G7O F;  3GEZ A;  3GTK J;  4PCQ A;  4HPQ A;  1GDT A;  1WJF A;  4XLE A;  4AU7 A;  3KP2 A;  3TL4 X;  3EUH A;  1Z6T A;  4ZDP A;  2PLY A;  1E3O C;  2KHM A;  2L02 A;  3E6D A;  2DJN A;  3JSP A;  1ZRC A;  5EG0 A;  1MMD A;  2RGV A;  3A2K A;  4XOR A;  2R7U A;  2K3F A;  4RB1 A;  3LA3 A;  3S93 A;  1S7O A;  2V79 A;  1UEL B;  5J8C A;  3CCJ I;  2OA4 A;  1OYW A;  1GHC A;  1B72 B;  2VOO A;  1TQM A;  2Y0S A;  3ELK A;  1RI7 A;  1VFC A;  5ICC A;  5IY5 H;  1U5T A;  3GTQ J;  1TWG J;  1F9N A;  4WK8 F;  3MCZ A;  4HA8 A;  2LFB A;  4NC8 A;  2HYG D;  5ICE A;  3OIQ A;  3F3X A;  3HGY A;  3HXL A;  2ZFU A;  5CKT A;  2HVR A;  2Y48 A;  1D3Y A;  2N8G A;  3OY9 A;  1X1D A;  1TWC J;  3WG9 A;  3OYC A;  1BR2 A;  2VOP A;  2HQR A;  1NHA A;  3RQI A;  4S0H B;  2HU9 A;  2OQR A;  4XRS A;  1HOM A;  3H92 A;  2W25 A;  2VJJ A;  5F0H A;  1WHU A;  5L3G A;  1R5H A;  2EZK A;  3QPH A;  4S04 A;  4CXF A;  5E8I A;  1ZG3 A;  1UJ8 A;  3LSJ A;  4GYI A;  2KIS A;  1TP4 A;  3JRH A;  4HDV A;  1SEU A;  1FMV A;  1WJA A;  4XLF A;  4CZC A;  2DQL A;  4KJZ A;  3GFI A;  2F2E A;  3F8C A;  3FXO A;  2VOD A;  1XX5 A;  2IGO A;  4IZZ A;  1P7I A;  3P5J A;  4NC7 A;  2XF7 A;  1MSE C;  2EFO A;  2VE8 A;  3MFK A;  1IRG A;  3K0L A;  4MTE A;  3TW6 A;  1QNT A;  4BQN A;  3WU2 C;  2XAJ A;  3FF5 A;  1NG6 A;  3OL4 A;  2QQ8 A;  1VF9 A;  2F5V A;  2M3A A;  3G6E I;  1KU7 A;  1ODD A;  2GA1 A;  4HW0 A;  3GX4 X;  1QA6 A;  2VBY A;  4L18 B;  3HOS A;  5HVQ C;  1K79 A;  3W2W A;  1VQN I;  3N05 A;  1PUF A;  3QYB A;  3PIO F;  3T0Y A;  2UUZ A;  3R4K A;  1H8A C;  4UNO A;  3R0J A;  2R93 J;  1BM9 A;  2DAO A;  4HOB A;  1JGS A;  3JCU C;  4KIS A;  2KZV A;  3VYT B;  1G8X A;  4G9Y A;  3NQO A;  4BEH B;  2F5F A;  2XAF A;  3JTH A;  2OZ6 A;  4I98 B;  5EGO B;  2FNA A;  2A5W A;  1BC7 C;  4UV9 A;  1QBJ A;  5FLM J;  1RUO A;  4G6T B;  3LNQ A;  3O2P E;  2WB1 N;  3FXR A;  5E79 C;  2WAD A;  1HLV A;  2D2W A;  2RRE A;  3WTW C;  4FQG A;  2K85 A;  3I56 I;  3AL0 C;  2EQR A;  2DYR H;  4J19 A;  3GTL J;  1IG7 A;  1F1Z A;  1Z3X A;  4AUX A;  3OYH A;  3H3V K;  3V7S A;  2OV7 A;  3EDP A;  3OS1 A;  3WE3 A;  3JRD A;  2W85 A;  3T8T A;  4ESJ A;  1ZLJ A;  4A0X A;  2IGM A;  5C3E J;  1ZN2 A;  1XCB A;  5TGT A;  3HOT A;  4H4K C;  5AIQ A;  2P8T A;  1PDN C;  3LAP A;  2CO5 A;  4PDK A;  2DMP A;  2VPL A;  4RAZ A;  2P6S A;  2DJI A;  1HSJ A;  1FBU A;  3LSI A;  1XGO A;  4I76 A;  2VT2 A;  2CUF A;  2F5C A;  5FRN A;  4EAT A;  3HOX J;  1MJB A;  4KIC A;  3S2D J;  2M7B A;  5EGO A;  2FD5 A;  3IL2 A;  2PI0 A;  1DPU A;  4IHX A;  1VND A;  4LIV A;  4M73 A;  2VJ5 A;  1QQI A;  3GTM J;  2V1U A;  3OYM A;  4YII A;  5F27 A;  4YG2 F;  3ERM A;  5FB2 A;  2A05 A;  2VUM J;  1JUM A;  2PJP A;  2JA6 J;  1OR7 A;  4A3E J;  2W4S A;  1IN5 A;  2X1E A;  4DQ2 A;  1PP7 U;  2M0C A;  4CHU A;  5A2Q K;  3DEE A;  2ZNZ A;  2CG4 A;  3KZZ A;  2DFI A;  5IP6 A;  2O8X A;  3LMM A;  4Z2Y A;  1LUJ B;  1JI8 A;  4G12 A;  1MKM A;  2STW A;  3HBL A;  3QP6 A;  5GP9 A;  4I09 A;  2E60 A;  3A4C A;  3L9F A;  5JVG F;  5BPD A;  4I2O A;  4BAY A;  3E5Q A;  2QWW A;  4XKC A;  2RKH A;  5CJ9 A;  1BR1 A;  2Z5U A;  3IV5 A;  1BIA A;  3FXM A;  3TDZ C;  3OYJ A;  3S2H J;  5JLW A;  4RM2 A;  4LG3 A;  2J5P A;  4BHP A;  4NC6 A;  1P6R A;  1WJE A;  2DDB A;  1JE8 A;  1NK3 P;  2OUM A;  1WJC A;  4HDU A;  1IUY A;  4CCN A;  4KUM A;  4I99 C;  3E3V A;  3LAJ A;  1DGW Y;  1U9N A;  1EH7 A;  3V8L A;  3GTP J;  4E7L A;  1D8J A;  2EIM H;  2A3S A;  3H5N A;  2W7N A;  2M4G A;  4FTH A;  2DA4 A;  3CCS I;  1XGS A;  4EM0 B;  1WJD A;  3DLL F;  2I8D A;  3WU0 A;  2KDO A;  4ZDO A;  1V4R A;  1HKS A;  4XLA A;  4IHY A;  1WCM J;  4ZH4 F;  4BL0 B;  2O3F A;  3P7N A;  2MD0 A;  3W2A A;  1J7K A;  1W5C C;  4P1W A;  3TQN A;  3CD6 I;  2Y9Z A;  5JHF A;  2NNY A;  1R71 A;  3K4K A;  4DYC A;  1FSH A;  4R8H A;  2DOE A;  3HJE A;  4U88 A;  2EIJ H;  3CJQ B;  3IKV A;  1JKQ C;  3OSG A;  1NG7 A;  3KFW X;  3HDD A;  3RKX A;  4IHS A;  1IF1 A;  1YRN B;  3H9G A;  5K5R A;  2KP6 A;  3CC7 I;  2ZME B;  3OYB A;  2HR3 A;  3HHG A;  4D7N A;  1RET A;  3FHN A;  2FOK A;  2NVQ J;  1DU0 A;  3AG2 H;  3DBL B;  1K61 A;  3FXJ A;  4E4H A;  2XSD C;  1UAA A;  1MJA A;  4B8X A;  1P7J A;  4UY8 I;  4IRG A;  1R7J A;  1FP1 D;  2LYC A;  3DTK A;  3CCL I;  5D4S A;  1T6S A;  3ZPL A;  4LB6 B;  2FRH A;  3KEO A;  2LSO A;  1CF7 A;  1SVO A;  1LDK B;  2FF4 A;  1B8I A;  4BKX A;  1FX7 A;  1VQ6 I;  1U2W A;  4KIB A;  4PSW A;  1A5J A;  2NRA C;  1BW6 A;  5E8G A;  4PUS A;  3VB2 A;  3ML6 A;  1T2K A;  3FK7 A;  4MGR A;  2I5U A;  4KN4 X;  2XRL A;  3BG7 A;  2QQB A;  1SAU A;  3CF5 F;  1YRN A;  1Y0U A;  5DM6 F;  1TBX A;  3I3L A;  1KGS A;  4Y3O A;  3NRV A;  2G7H A;  1XPX A;  3CCE I;  1A35 A;  2EFN A;  1I6H J;  4BJ6 C;  5FKO A;  3SYT A;  1YW7 A;  1W7P D;  3HYI A;  1S3J A;  3X2Q H;  2R7O A;  2CWE A;  2BY1 A;  3J81 K;  2GLO A;  3WU1 B;  1OQY A;  5C4X J;  4F55 A;  3HRS A;  4BXF A;  5EYR A;  1DPR A;  1WKM A;  1UHM A;  2VQC A;  4BYY A;  1DDN A;  2D45 A;  1K78 A;  4BGD A;  3DTI A;  5CVJ A;  2HXO A;  1X4O A;  2KIQ A;  2M5W A;  2GZW A;  3DXJ F;  4DGW B;  2X51 A;  5HLT A;  1MMN A;  1TWH J;  4AID A;  4KDP A;  3GZ5 A;  4FX4 A;  4HZF A;  2A69 F;  3PNY A;  1A6Q A;  3R61 A;  1LEB A;  4BXX J;  2MC3 A;  4CYD A;  4E7S A;  1R9T J;  3ABT A;  4B4C A;  3GO5 A;  4ASN A;  1R4M B;  2K5C A;  2D5V A;  1J09 A;  1VQP I;  4MEX F;  2DMN A;  2KRF A;  2H6B A;  2LRD A;  2O0Y A;  3MD2 A;  1LB2 A;  4OAZ A;  5D6F A;  1XB4 A;  5EEA A;  5JFR A;  2XKP A;  5IT9 Z;  5CVI A;  2EV0 A;  4L9V A;  2XVC A;  3C2B A;  5LRS A;  4BE2 A;  3BTI A;  4PJN A;  5H6Q A;  2EBI A;  2A6H F;  3K4M A;  3KLN A;  4GYG A;  3BTL A;  5FJ8 J;  4RGX A;  2M87 A;  1RR7 A;  3H3U A;  5J4V A;  3OYK A;  4A3G J;  2CH0 A;  3BR2 A;  4C30 A;  3ESW B;  1RES A;  3I59 A;  5H20 A;  3K7A J;  4PJL A;  5GAG J;  3DEU A;  3L1P A;  1K4S A;  1MNM C;  5JVT A;  5L3D A;  3ZMT A;  5HDG A;  2HQN A;  5LGU A;  3EUK L;  2Y0M A;  3N97 A;  2QQ9 A;  2VT3 A;  5LLQ A;  1SAX A;  4LMY A;  1HF0 A;  4XLC A;  2K3P A;  2WAQ A;  1H88 C;  3GCM A;  1T08 B;  1JT6 A;  3V7R A;  3HOV J;  2P5K A;  1VQL I;  4I0A A;  4HX8 A;  4JX4 A;  3MZ8 A;  2XGE A;  2V1X A;  4DIQ A;  4BXU A;  1LKX A;  3BTC A;  2RNG A;  1GV5 A;  4G94 A;  3KP7 A;  4AVZ A;  3G1M A;  2JUG A;  1GXQ A;  1S7E A;  1BA5 A;  4AIJ A;  4JYK A;  4NDL A;  5DYM A;  3C3W A;  4OIR F;  1GVD A;  3M8J A;  2FMY A;  1YO5 C;  4XR6 A;  3MEX A;  3I64 A;  2FE3 A;  1XTA A;  3BJ6 A;  3Q0W A;  4L5J A;  5D5U B;  3DV8 A;  4MFD A;  3HOZ J;  1REP C;  4HLY A;  4KYW A;  4B48 A;  3HOY J;  3DCF A;  4EGY A;  3WTZ A;  1LQ1 A;  1O57 A;  3S17 J;  1XGN A;  5F64 A;  2V6C A;  1LFB A;  2JQ7 A;  2LLK A;  5KNL A;  1DP3 A;  1GVJ A;  2VJ4 A;  1E17 A;  2KQR A;  1YW8 A;  1E2X A;  3KP3 A;  4AVP A;  2V9V A;  4II3 A;  2CU7 A;  5F04 A;  3QRF F;  3RYR A;  5DUI A;  3K69 A;  2G0E A;  4GRI A;  2BY2 A;  4X0G A;  1FYL A;  3CES A;  2XC7 A;  3VSL A;  3I71 A;  1O4X A;  1UFM A;  4UUT A;  2R5Z A;  5CVU A;  2HXI A;  1HKT A;  1U6G A;  3IAM 2;  4KT5 C;  3RKW A;  5HOD A;  4LLN A;  2R7X A;  5J1Y A;  1JUS A;  2EJR A;  2PX9 A;  2BXZ A;  3IH4 A;  2CQX A;  2ICW G;  3HKZ A;  5ED4 A;  3G73 A;  1Z77 A;  3BR6 A;  4A12 A;  2IA1 A;  2CYY A;  4KNY A;  3BTJ A;  2M8G X;  3G4S I;  2PJR B;  3BG6 A;  3L2R A;  2R92 J;  2NOJ B;  4N9I A;  4J00 A;  1A31 A;  2BW3 A;  4RB0 A;  4DBQ A;  2AXT C;  1M1E B;  1PUE E;  2Y30 A;  5GAH J;  2HDW A;  2JSP A;  1VQK I;  2Q1Z B;  2XGX A;  5LHH A;  4DYR A;  3RPU D;  3CP8 A;  1T0F A;  4HF1 A;  1UB9 A;  3QU3 A;  4L0Y B;  4LJZ F;  4ZYG A;  2JJ7 A;  2FUG 2;  2UXX A;  3LFU A;  4UHT A;  2R7S A;  3OL3 A;  3I0T A;  3ZQI A;  2D1V A;  2EK5 A;  3MKY B;  1DP7 P;  2VQL A;  4UVC A;  3OSF A;  2E2J J;  5K7H A;  1X1B A;  2JVH A;  1VZ0 A;  5LEJ A;  2WBM A;  4IF4 A;  4AC0 A;  3WHC A;  2HDC A;  2O61 A;  4ZTF A;  2QBY A;  5LHG A;  4PGH A;  1Y8R B;  1OIS A;  4Q4Z F;  4OIO F;  4RGR A;  2R7Z J;  3BPV A;  4CGZ A;  3IRR A;  3V8K A;  3KCC A;  3VFZ A;  1OCZ H;  4HNT A;  2VKD A;  4Q5S F;  1O3R A;  3KIO A;  3CUQ B;  3NWT A;  5L3E A;  4IHT A;  2V1D A;  4LIU A;  3FM5 A;  4F93 B;  2CMP A;  4RGU A;  2FX0 A;  4XNF A;  3DEW A;  2L0K A;  3ABU A;  3UKG A;  2HKX A;  3V42 A;  3ZQG A;  4IL6 C;  1IZ1 A;  2FSW A;  3K1N A;  1YIO A;  3QYE A;  3G3Z A;  3GFM A;  3ERE D;  2F6C A;  4OIQ F;  4S05 A;  5IYD J;  3BP8 A;  4M9S A;  2HTS A;  4ABZ A;  4MO7 A;  5GAD J;  4HX7 A;  1MMG A;  1OCP A;  2K86 A;  2X6O A;  2LVS A;  4FET A;  4NUB A;  4DYQ A;  4NBQ A;  2VI6 A;  1IC8 A;  3CQZ J;  2HNH A;  4QLC U;  4CZZ A;  1TT0 A;  4RGS A;  1EA3 A;  4LD5 A;  2O9L A;  1MD0 A;  3S3N A;  1ZTR A;  4M3F A;  5C4J J;  3B6C A;  3DKW A;  4WF2 A;  1Y39 A;  2XPW A;  3A0H C;  3Q3S A;  1BW5 A;  3G71 I;  1X1A A;  2ME6 A;  2F48 A;  1WJ5 A;  3LSG A;  1X1P A;  3TKY A;  2ZME C;  2JA5 J;  2QSG X;  3J7A Y;  2DA1 A;  2E2I J;  2EFW A;  3L2V A;  2JSC A;  2HEO A;  5EZG A;  3OYN A;  2OZU A;  3KET A;  2DFH A;  2WAE A;  1H9G A;  2DFE A;  3A01 B;  2A07 F;  4PSX A;  3I9V 2;  3K4C A;  2CGP A;  3S16 J;  3SZT A;  2LG4 A;  3SQN A;  2BVL A;  1KON A;  3JRI A;  2VXD A;  3SJM A;  3GW2 A;  5EG0 B;  2PBI A;  2XPU A;  1JHH A;  3ZN0 A;  3U2R A;  1LDJ A;  2ZXJ A;  3RIR A;  1MDM A;  2CQ7 A;  3GLX A;  2HVQ A;  4A5N A;  1QPI A;  2E36 A;  2L5Q A;  1LPQ A;  3SEQ A;  4BE0 A;  2AXL A;  1CQT A;  3GBG A;  4L9J A;  2DTZ A;  4XON A;  5E3N A;  4G7Z F;  4HQE A;  1AU7 A;  3PQJ A;  1G4D A;  5H2F C;  1U5T B;  2E1M B;  4I6Z A;  2ETH A;  4YFK F;  5J47 A;  2XSJ C;  1ENH A;  3FDY A;  4HG2 A;  4EJO A;  1QVT A;  2L4M A;  4UV8 A;  1SVL A;  1W1W E;  4YIR X;  1ZRE A;  2P5V A;  3CUO A;  3ECO A;  5DCF A;  1JXS A;  2GOM A;  4AYB A;  2HWV A;  2DI3 A;  1RKT A;  1I5Z A;  1MH3 A;  2QKM B;  1FTZ A;  4B47 A;  1QPM A;  3CTA A;  1G59 A;  1P2F A;  3BT9 A;  2B0L A;  2K4B A;  3RDI A;  3BG9 A;  2KRH A;  4MIM A;  4BQQ A;  2EIK H;  4F52 A;  1KYW A;  2YPR A;  1WI3 A;  1OLT A;  3WTT C;  4RAY A;  1D0Y A;  3WTY C;  1X2M A;  3KZY A;  1WWX A;  4CYC A;  3T5X A;  3K2Z A;  3SZG A;  3O3K A;  2NNN A;  3BR0 A;  2XPV A;  2ZXI A;  4XLN F;  2PMZ A;  4WWC A;  5TJJ A;  1ONV A;  3DBH B;  3H36 A;  3JSO A;  1TC3 C;  5J1U A;  2JMW A;  3KYL A;  4BY7 J;  2DU9 A;  2DT6 A;  3M07 A;  5D8K B;  3ZQC A;  3EET A;  3LFK A;  3S2W A;  3DKY A;  4DJA A;  2JZY A;  4IQ4 A;  3ZGK A;  4MFE A;  2DPD A;  3OS2 A;  3QOD A;  4BBR J;  2X48 A;  1SMT A;  3FIW A;  1P4X A;  3IC7 A;  3KE2 A;  2NVY J;  2JA8 J;  2G7U A;  5IPA A;  1F36 A;  2MSY A;  5B3S H;  3R60 A;  2Y69 H;  5D5W B;  1PUF B;  3PJR A;  2DQR A;  1IXR C;  2X4H A;  2XHK A;  1Y6I A;  1C0W A;  1S8N A;  4PJJ A;  1ZRF A;  3BZC A;  4D5C A;  1GUU A;  4ENJ A;  3GZ6 A;  5JHU A;  2DBB A;  1Z05 A;  1RRJ A;  3GTO J;  1AKH A;  2W84 A;  4MQV A;  1YS6 A;  4UVB A;  1VI0 A;  5A2Q Z;  3AAF A;  1OJL A;  3VYU B;  1FP2 A;  3OYG A;  1IRX A;  2DMU A;  3FXQ A;  4E70 A;  5K7Z A;  3VSK A;  2Q8K A;  5BNG A;  3ZN1 A;  1LNW A;  1EH6 A;  4A0Z A;  1BJA A;  3PUB A;  1YJ9 I;  2H27 A;  3MN2 A;  4XRF A;  2R3S A;  2LNB A;  2R7Q A;  1QU3 A;  3P9C A;  2FJ1 A;  2VC1 A;  1D1C A;  1D0Z A;  3DP7 A;  3A02 A;  1X3U A;  1J9I A;  2EIL H;  2JA7 J;  1BBY A;  4YEL A;  2HI3 A;  1O3S A;  2DA5 A;  1FYK A;  4JBA A;  2FQ3 A;  1T98 A;  2XUB A;  3Q9S A;  3K4L A;  2BGC A;  4FT8 A;  4CUG A;  4HNU A;  1U78 A;  1DU6 A;  5LEK A;  5FRO A;  2QKL B;  1BC8 C;  1ON2 A;  4KFC A;  1U9O A;  2E71 A;  1H0M A;  3E6C C;  3RJP A;  2FBH A;  1XMX A;  2HOT A;  1RR8 C;  2BXY A;  5HS8 A;  1WH7 A;  2ZB9 A;  3BZK A;  1X2N A;  1A6I A;  1BN5 A;  2BYV E;  2M1B A;  4UXN A;  2EPF A;  3PNV A;  1JJ8 C;  1IAW A;  2KRC A;  3M7G A;  5F0C A;  1SFE A;  3OYE A;  2VQH A;  1KU9 A;  5K1Y A;  3HTU A;  2XGC A;  4E7Z A;  3JAM K;  1T0F C;  3U1K A;  5TRD A;  4C2U A;  1IO2 A;  1WPK A;  4FAS D;  2YUS A;  1UCR A;  2AQF A;  3LSH A;  4ZC3 A;  4LG0 A;  3REO A;  1SFU A;  1FJL A;  5F1J A;  3PFI A;  1T33 A;  3JRB A;  2XB0 X;  3BZ6 A;  3L2Q A;  4B43 A;  1P9Q C;  3CC4 I;  1OCT C;  5J8F A;  1Z9C A;  5LBQ A;  4IVN A;  4BHC A;  4E7H A;  3DF8 A;  2CW8 A;  4XM3 A;  2XF5 A;  1RNL A;  4V2G A;  3K4B A;  2WY8 Q;  5HLG A;  4JOM A;  1T8I A;  3KYD B;  4I0B A;  3K70 C;  4HBL A;  2LTP A;  3Q5F A;  3FM3 A;  3HL2 A;  5ILS A;  3LSM A;  4QIW N;  1IN4 A;  1YFH A;  2V1N A;  2ZC2 A;  4BE1 A;  5AON A;  3H35 A;  1ETV A;  1QHH D;  3DU5 A;  3E7L A;  4HNV A;  1VQ8 I;  3S8P A;  4IEJ A;  3IP4 B;  4G7H F;  4HST A;  2ZBK A;  2QGU A;  3GLL A;  3VYS B;  4DBR A;  3D5S C;  4GXO A;  3RQ4 A;  2HPI A;  1ITY A;  3OV8 A;  2LF7 A;  4E6K G;  4O6J A;  1MBE A;  4CDG A;  1YX5 A;  3CCR I;  3CDH A;  1W0T A;  4PJM A;  1I3Q J;  3TP3 A;  1BI2 A;  1P4A A;  4Y17 A;  5DTD A;  1UG2 A;  3F8F A;  1FOK A;  4OIP F;  5JR3 A;  1NK2 P;  2MH9 A;  3I4M J;  2L7F P;  1P4W A;  2OC6 A;  4BAC A;  2PEX A;  2Q2E A;  1EH8 A;  4LLG F;  1VQO I;  5KAI C;  2HKO A;  1DQU A;  1W7P A;  1ETX A;  4ENM A;  5KK1 A;  3J81 Z;  2ZJ2 A;  3AFH A;  2EWN A;  3P9I A;  1CGP A;  4QPQ A;  3C18 A;  1UZC A;  3JRE A;  2ESH A;  1MW7 A;  2QA4 I;  1VQM I;  2NS7 A;  1B6A A;  3CUQ C;  3GVA A;  1FBQ A;  1SFX A;  4M6V A;  2A68 F;  3HRT A;  5GAE J;  2YU3 A;  3WTU C;  2ISZ A;  4Y7N J;  1IDY A;  4PFP A;  3FX3 A;  1HCR A;  3W6K B;  2ID6 A;  3CDI A;  1FWZ A;  3TOA A;  1T95 A;  5CPR B;  2BVM A;  2HVS A;  1ZG1 A;  2LOO A;  3Q0U A;  1Z0X A;  1FSE A;  2CQN A;  3C7J A;  3QQA A;  3KP5 A;  2QEX I;  3L09 A;  2COB A;  4ESF A;  3E97 A;  3CCQ I;  3OIO A;  3R6S A;  2JPC A;  1CF7 B;  1Z91 A;  1X3Z B;  2H1L A;  1B8I B;  2AS5 F;  2QUF A;  3HM5 A;  5LGN A;  1WFX A;  2VN2 A;  1I3A A;  2K27 A;  2KJB A;  5B1A H;  2XAU A;  3I53 A;  4AM3 A;  5HS9 A;  1Y1V J;  1D1A A;  3A0B C;  2R5Y A;  1JUP A;  1MIJ A;  2DPU A;  1OCR H;  4IOC F;  3CLQ A;  5ILU A;  4WX9 A;  4ZZL A;  1D8K A;  3PM1 A;  1SFK A;  2QQA A;  3KPH A;  1YHQ I;  2NVT J;  4WXH A;  3E6B A;  3AKZ A;  3CMY A;  4A93 J;  3IWF A;  1LVA A;  2FNP A;  2L9N A;  3IRQ A;  3QAH A;  3IWZ A;  4OMY A;  4HRI A;  5LD2 C;  1S6L A;  2MGQ A;  1ETY A;  2IS1 A;  3HEF A;  4F7Z A;  4YFX F;  1OPC A;  3KLO A;  1R58 A;  1KU3 A;  2K9M A;  1K78 B;  4LK1 F;  3TMO A;  3EUH C;  2EFP A;  3EYI A;  2MC4 A;  1H89 C;  2CRG A;  5IP7 J;  5IYC J;  2IGN A;  4A3L J;  3HRM A;  4J01 A;  3SDG A;  1O3Q A;  2GM4 A;  2QSF X;  4ENK A;  4A3B J;  4A3M J;  1YW9 A;  3E6M A;  4BNC A;  5LGT A;  2WY7 Q;  3VDX A;  2VKE A;  4DW6 A;  3OYF A;  1MNE A;  1OMI A;  3C1D A;  4G8X A;  2IP2 A;  4XKV A;  5FKN A;  2ZCW A;  2WC2 A;  3PUF A;  4MQ9 F;  5FD6 A;  3K4N A;  4BY1 J;  1R4N B;  3M4O J;  1U0J A;  3V4G A;  3J7Y J;  4KIG A;  6PAX A;  4XQF A;  1U5T C;  1Z67 A;  2E1M C;  1Z1D A;  3ZQQ A;  1X4P A;  3FZV A;  2LP0 A;  5M3F J;  1XSD A;  1VQ9 I;  2XKO A;  4IHW A;  1TWA J;  1ZGW A;  3F8N A;  3FXU A;  3LOC A;  5D4R A;  3CCU I;  5EF6 A;  4U0W A;  3L00 A;  3ZMS A;  3LA2 A;  2E7X A;  3I5U A;  2JVG A;  4ENN A;  3E5U A;  3R0A A;  2FML A;  4A3D J;  1OCO H;  5CYV A;  3W3C A;  3I59 B;  3OWT A;  4XBF A;  2EZH A;  2Y75 A;  3WGG A;  2OF7 A;  2EZL A;  3EYY A;  3WHB A;  3ZQL A;  2VE9 A;  1K4T A;  3O8G A;  2LF8 A;  2DDA A;  3S1N J;  1BOA A;  5DUK A;  5CVR A;  1YTY A;  3UR3 C;  4A6D A;  2UZK A;  2OBP A;  3QOE A;  1JHF A;  2CV1 A;  2WAQ N;  1V5F A;  2IW5 A;  1ZEL A;  4P9U A;  1W36 C;  4CH7 A;  3CJR B;  1ZAR A;  2W48 A;  2GXA A;  2XV4 S;  5BQT A;  4IJA A;  2ADU A;  2V9K A;  3JTG A;  1MND A;  2FQ4 A;  2JWT A;  3RPU A;  4B09 A;  2VJI A;  3B6A A;  4ZZD A;  1HW1 A;  5DV5 A;  1I39 A;  2B9S A;  3CZ6 A;  3MKZ A;  2O6G E;  2L7Z A;  3GFL A;  1UHW A;  2OD5 A;  2XGD A;  1IUF A;  1SC7 A;  1ZR4 A;  2MH2 A;  3BJO A;  4UUS A;  2VIX A;  2E1C A;  2V26 A;  5E3L A;  4HQM A;  4RLF A;  1GXP A;  2VPR A;  1R23 A;  2VL8 A;  4M3D A;  5HDK A;  1RC9 A;  2ZJQ F;  4C3H J;  3S15 J;  3KP4 A;  3ZMV A;  1HDP A;  3TGN A;  3H1C A;  3PL8 A;  1G3S A;  2OQG A;  1ZK8 A;  1B9M A;  1PJR A;  2R5Z B;  4G6D A;  3DBR B;  1K7A A;  3BQY A;  1YYV A;  3HC7 A;  1YIJ I;  4P5O A;  4D0P A;  1S5L C;  3ROU A;  1Z3Y A;  3IAS 2;  3CCY A;  2DMQ A;  2PMH A;  2KMU A;  3BJA A;  1EV7 A;  1NTC A;  3OS0 A;  3K2A A;  3H9Q A;  3HKZ N;  4LGW A;  4BJT A;  2L01 A;  2Z16 A;  5DCM B;  2BW3 B;  1MBG A;  1ZYR F;  3FMS A;  5DM7 F;  2HPM A;  1XC5 A;  3UNG C;  1N25 A;  3QPS A;  1K6Y A;  4RMN A;  4R79 A;  1F43 A;  1MMA A;  2HZD A;  2L54 A;  2ESN A;  4RAG A;  2M9H A;  3DKX A;  2BV6 A;  4NB5 A;  4M9Z A;  2FBK A;  5FRM A;  1OR7 C;  2EH3 A;  4D1Q A;  2M34 A;  4PZJ A;  4HYE A;  3BPX A;  5FGM A;  1G3T A;  3MVP A;  2R7R A;  2MAB A;  3F9K A;  3HZJ A;  1V3F A;  4RBO A;  2QBY B;  3BLY A;  3MZH A;  5M3M J;  1APL C;  2VBW A;  1TNT A;  1BOB A;  4O5V A;  5DCM A;  1ETQ A;  3QPL A;  5HS7 A;  1SVM A;  3AG3 H;  2IJL A;  4N9H A;  1ETW A;  4G6Q A;  1KU2 A;  1QGP A;  2ELH A;  2H8W A;  2AHQ A;  3EQL F;  3GYH X;  5FLV A;  2ZXW H;  2DA3 A;  5HNF A;  3RCO A;  2RAE A;  1YLF A;  3PFY A;  4II2 A;  4B3A A;  2CSO A;  2O03 A;  2Y31 A;  1ZKG A;  1B9N A;  3LST A;  4A2U A;  1XMK A;  1S29 A;  2XRN A;  4JX6 A;  2XIG A;  2BZT A;  2YR2 A;  3S1M J;  2W57 A;  1UST A;  1ZAO A;  2VKV A;  5KHD A;  1WQ2 A;  5J40 A;  1ZLK A;  3J80 K;  4MTD A;  4IX7 A;  2Z2S B;  5J1R A;  1RPW A;  2K40 A;  3RSN A;  3E5X A;  1XDS A;  4ZYA A;  3GZN B;  4ZYH A;  5AIP A;  1Y8Q B;  2JRM A;  2K9Q A;  3BOQ A;  4C3J J;  3DPL C;  2HGC A;  4C3I J;  2W00 A;  1YX3 A;  3WGH A;  3I55 I;  2TCT A;  2H1K A;  2GXB A;  2LD5 A;  3V8J A;  1A04 A;  3VEP A;  4PFO A;  4KIT B;  2DA7 A;  4M71 A;  3SEZ A;  3VPR A;  2GIZ A;  4LLL A;  2LKP A;  5KCM A;  1SD4 A;  3ZOB A;  1LJ9 A;  3NWS A;  3EUA A;  3BWG A;  1FEX A;  3GTG J;  2XAS A;  3OR2 C;  2HFH A;  1K83 J;  2LBF A;  4JQF A;  1U8B A;  2HTJ A;  1FY7 A;  5F0F A;  1KZH A;  3GXO A;  1TTY A;  3I4P A;  2KLO A;  2O5R A;  1XGM A;  2OJE D;  2E5N A;  2WA0 A;  3S3O A;  3S32 A;  1R49 A;  4EJV A;  3ULQ B;  1LE8 A;  4RA2 A;  1MDM B;  1R00 A;  2LK2 A;  3BG5 A;  3I4N J;  2DLL A;  2BHZ A;  3ZMD A;  1J2X A;  3FK6 A;  1MBF A;  4CCJ A;  1SAN A;  3RYP A;  2GXG A;  3BCB A;  3FBN B;  3G2B A;  4JK1 X;  5FKK A;  4A3I J;  4LFU A;  2KIF A;  4D7M A;  1WVR A;  3MZY A;  3QYF A;  2ZFW A;  4XIC A;  1ZRD A;  5LFA A;  5FFX A;  3H9J A;  3L2U A;  3U9G A;  1JKP C;  4IRI A;  3Q0V A;  3J7Z I;  1OFC X;  1FOW A;  4Q47 A;  1I6X A;  2QVO A;  4GFB A;  3TED A;  2R7W A;  3W6V A;  3RZO J;  4IHV A;  3ZCO A;  2QLZ A;  2FBI A;  1JT0 A;  2H8R A;  5FLX K;  4OOI A;  3I58 A;  1I1G A;  1LFP A;  2E34 A;  4BU2 A;  1JJ6 C;  1IXS B;  4M3E A;  2R0Q C;  5CQE A;  4AYB N;  3CJT B;  2IPQ X;  1LVK A;  1MH4 A;  1O7L A;  2RDP A;  2Q0O A;  5IOZ A;  2ZSH B;  3HOW J;  1QZY A;  3C2H A;  3DQV C;  4BJ5 C;  5E1X A;  3ZQF A;  4XLH A;  4AIH A;  4CYC B;  3S1R J;  1J59 A;  3SZP A;  1EJ9 A;  1AHD P;  2P0W A;  4Z6Y A;  3TO6 A;  5L3C A;  2FOW A;  3CF2 A;  1TLH B;  1V54 H;  3M1C A;  2CQQ A;  3IUO A;  1UHS A;  1KA8 A;  4A5M A;  1PP8 F;  1W4M A;  3GWZ A;  5BS6 A;  3F0C A;  1FOY A;  3D0S A;  4I01 A;  2PMZ N;  5M5Y J;  3FHZ A;  4XOP A;  3PO2 J;  1ZHF A;  3H5A A;  3ZMU A;  1G3Y A;  3S14 J;  2VQG A;  2NYX A;  2Y0S N;  1IRF A;  2HOS A;  4C9Y A;  2Z9O A;  4XRM A;  4TV7 A;  3O6B B;  3L2W A;  3HSR A;  2JT1 A;  3PQK A;  4V19 K;  4DZP A;  2VXZ A;  3H3Z A;  1IN7 A;  3CDL A;  2EZI A;  2F4I A;  1SFO J;  5KAF C;  4JX5 A;  3T8R A;  4A3F J;  3W6J B;  1E0E A;  1Z7U A;  4RM3 A;  2DCE A;  1G6N A;  4UUV A;  3BQZ A;  4DZJ A;  3JAM Z;  4U0Y A;  3L7W A;  1AKH B;  2HYF A;  4ZDL A;  3K1P A;  3D1N I;  4HLX A;  2D1H A;  5CQG A;  1FOX A;  1PYV A;  4HV5 A;  3WTV C;  3K70 D;  4X6A J;  2RN7 A;  4A0Y A;  1J0R A;  3ZQH A;  4L0Z B;  5DS9 A;  5KVR A;  2RV8 A;  2CQK A;  3M1E A;  4BHB A;  4M6Y A;  2VON A;  5M5X J;  1L0O C;  1LDD A;  2HDD A;  1GLN A;  3DU6 A;  4B1R A;  5ERI A;  5K5O A;  4UVA A;  2OAZ A;  3TOB A;  2XAH A;  1MBH A;  5DEQ A;  3E1S A;  2R4G A;  1TQI A;  2F4M B;  3RKY A;  4BS9 A;  1D1B A;  2ACJ A;  2IRF G;  1XSX A;  3HTS B;  4ANJ A;  2TRT A;  3KX2 A;  3TBI A;  3OOP A;  1R22 A;  1T39 A;  3HHH A;  2QM3 A;  2KKO A;  3N4M A;  3J7A O;  2PMU A;  1ACI A;  2KPM A;  4IQJ A;  2BHY A;  4A3C J;  4M9X A;  5CLS A;  1D5Y A;  2VBZ A;  3OR1 C;  2G9W A;  4KN7 X;  2EA4 A;  2J5O A;  2RQQ A;  2NOG A;  4FHT A;  3HOU J;  1BIB A;  3B73 A;  2M45 A;  5E18 F;  5IYB J;  3OYI A;  1TL8 A;  2P7C B;  5JI6 A;  1X3W B;  4LK0 F;  3ZP5 A;  3RI4 A;  3FMQ A;  5F08 A;  2UWM A;  2P7V B;  2VC0 A;  4BDZ A;  1VQ5 I;  1RUN A;  1E3H A;  4BH9 A;  4IRH A;  2OCE A;  5E17 F;  1SMY F;  2NS8 A;  4LG0 B;  3A1Y A;  2Z33 A;  3JW4 A;  4EGZ A;  1IRZ A;  4ZYE A;  3F21 A;  4WXC A;  5E1W A;  1AA7 A;  3Q9V A;  3GUD A;  2QYO A;  5L3B A;  3CMA I;  2GA2 A;  5BPI A;  2IEK A;  1FIA A;  2ZJR F;  2ELK A;  3SFI A;  1B72 A;  3RZD J;  4HEA 2;  3GTJ J;  4P96 A;  4RB2 C;  4IPA A;  1WI9 A;  2DN0 A;  2P6T A;  2RVC A;  4FX0 A;  4CCM A;  3TP0 A;  2LMD A;  1IN8 A;  5EEG A;  1QVU A;  2W1O A;  5ICG A;  4XKW A;  1N78 A;  4IOA F;  1R5I D;  2X6X A;  4M3B A;  1T56 A;  2CV0 A;  2AQE A;  4D5F A;  5HNH A;  2ME0 A;  4XN3 A;  3KZI C;  4W1U A;  5D8L B;  4CA0 A;  1V55 H;  4DNC A;  1VTN C;  1TZL A;  2OTL I;  1MZB A;  3TO7 A;  2DT7 B;  5FD5 A;  3ZQ7 A;  3LSK A;  2L9V A;  3JRG A;  1XS9 A;  3JR9 A;  1Q1V A;  2RQP A;  1Z7L A;  3D5R C;  3CC2 I;  4YFN F;  3FKI J;  5LRR A;  1U8R A;  1FBS A;  1SD5 A;  2JUC A;  3S3M A;  1VQ7 I;  2OU2 A;  2XB5 A;  3G1L A;  4CCL A;  1FPQ A;  1D5V A;  3U21 A;  4U7B A;  2A61 A;  3BR3 A;  1F5T A;  4L9N A;  4KMF A;  1J5Y A;  2Q2E B;  3QOP A;  2HQA A;  1WSU A;  5IOY A;  1O3T A;  1N77 A;  2L4A A;  1YIT I;  1XCV A;  1ERD A;  1W7P B;  2GOX B;  3DWL E;  2CJJ A;  4LOC A;  4M72 A;  2K4J A;  4C2M J;  2AO9 A;  5K7F A;  1X58 A;  3LSR A;  4BQO A;  3L2C A;  2R7V A;  1W5T A;  3KEQ A;  4A3J J;  4M74 A;  2E35 A;  3KYC B;  1Q1H A;  2PFB A;  2NXN B;  2DOD A;  4P9F A;  4BDY A;  5F1R A;  5IT3 A;  2E1O A;  1YJW I;  3BR1 A;  4OIN F;  3MAJ A;  4Y4R A;  1R5G A;  3NAR A;  2LRE A;  3K4J A;  2IS4 A;  2LY1 A;  2GAU A;  4MNU A;  5JLX A;  3PSF A;  4BEH A;  4O3M A;  2WB1 A;  4CO8 A;  2M8E A;  1TWF J;  4OAY A;  1U3E M;  1H9T A;  2CUJ A;  2L3D A;  2LH9 A;  1BR4 A;  2DA6 A;  3JRA A;  4PK4 A;  2V9P A;  2P4W A;  2EV6 A;  3K10 A;  3GME A;  4XOT A;  2XAG A;  2Y2Z A;  2H6C A;  2BE5 F;  2R5Y B;  4XRS G;  4M6X A;  4D9J A;  3M8E A;  4RB3 C;  5M5W J;  2KT0 A;  4EJU A;  1JTY A;  2GIV A;  2QCO A;  5J4Y A;  2YSR A;  1IDZ A;  5FO5 A;  2DYS H;  3CCM I;  2BY3 A;  1TW3 A;  3DPU A;  3COA C;  4LB5 A;  2P5L C;  2QF7 A;  1YE9 A;  3U1D A;  2W82 A;  1JTX A;  3PIP F;  1JGG A;  1R1U A;  1ZQ3 P;  2HYJ A;  2DA2 A;  2X9D A;  1FT9 A;  3B02 A;  1W36 D;  2NVX J;  2ZO4 A;  2E2H J;  1V5E A;  5E20 A;  1F4K A;  2UXN A;  1MGT A;  3ZMZ A;  2ZSI B;  4CSW A;  2WV0 A;  5EDN A;  2DW4 A;  1HST A;  3GF2 A;  3LA7 A;  1KQ0 A;  3FIS A;  1UMQ A;  3IH3 A;  1HDD C;  2FEZ A;  1QHG A;  3K9T A;  5DD4 A;  2X85 A;  2LDU A;  3LWF A;  2M2E A;  2B7E A;  3OYL A;  2VB6 A;  2IA2 A;  4EJW A;  5C44 J;  3P9K A;  2LKX A;  1RKW A;  3WG7 H;  5GTI C;  3BCA A;  1W0U A;  5K5Q A;  3ZR8 X;  5B66 C;  1OKR A;  2O7O A;  3KP6 A;  3MMY B;  2BBY A;  4V2F A;  2DFF A;  5E3O A;  1BI0 A;  3CO6 C;  2BOL A;  3CO7 C;  3WE2 A;  1BI1 A;  3DTE A;  3H5R A;  1IN6 A;  2V7F A;  4W97 A;  3HG9 A;  2R7D A;  4DOZ A;  4HF2 A;  1ETK A;  2HOE A;  4IXA A;  1OYI A;  3LL7 A;  4HAM A;  2R7F A;  1EF4 A;  3PNT A;  1WZ2 A;  4M3G A;  3G1O A;  2EIN H;  3OOU A;  2RC4 A;  1XD7 A;  2Y9Y A;  2MD5 A;  3DPT A;  4KA4 A;  3F8B A;  1HKQ A;  3IHU A;  1FZP B;  1G2H A;  3TO9 A;  1RZ4 A;  2HZT A;  2GBY A;  4F3Q A;  3FWE A;  4E7J A;  3VOD A;  3ABM H;  5FKL A;  1AWC A;  3CMM A;  1XG1 A;  4FCY A;  1LEA A;  1ZR2 A;  2JPB A;  3FXK A;  1SD6 A;  1FTT A;  2XDV A;  4MEY F;  3OMY A;  3QWL A;  2XRO A;  1DUX C;  4UB6 C;  2OPT A;  4L5I A;  4B3X A;  4B44 A;  1B59 A;  4H0E A;  1HA8 A;  2Z3Y A;  3ONQ A;  4I02 A;  1I50 J;  3HRU A;  2HQ5 A;  2PQ8 A;  4N4N B;  4Y52 J;  2LY2 A;  4R1H A;  5EJC A;  4EM2 A;  2GQQ A;  1JKO C;  1GV2 A;  1HXD A;  1Y56 A;  4HSR A;  2ZME A;  4CCK A;  5BOX A;  1GT0 C;  3ABL H;  1X1C A;  1MSF C;  2MG4 A;  2A6E F;  4XLP F;  3MKW B;  1FYM A;  1R1V A;  4UUS B;  5FKM A;  1TNS A;  4EV0 A;  3JRC A;  4C2T A;  4HF0 A;  1YI2 I;  4ZJZ A;  4Y15 A;  3CCV I;  2DOA A;  4WXD A;  2M30 A;  2IA0 A;  4EVI A;  2ZNY A;  5GTH C;  4CCO A;  2STT A;  3HB9 A;  2CFX A;  4F91 B;  2LR8 A;  2Z1D A;  2EV5 A;  1I27 A;  2KZG A;  2ZJP F;  2X1C A;  3H0G J;  3LSP A;  1VQ4 I;  4NHJ A;  1MJ9 A;  3WOD F;  5ICF A;  2DOF A;  2KIM A;  2KL4 A;  4WCG A;  3S1Q J;  1B4A A;  1R6R A;  2LC2 A;  1ZG5 A;  4F92 B;  2BEO A;  2WV1 A;  5E3M A;  4RDU A;  1YJN I;  2A5Y B;  1TW2 A;  1YG2 A;  5EZH A;  3RKQ A;  1ZGA A;  4EM1 A;  3NEU A;  2JK3 A;  3K6G A;  2O8K A;  3WTX C;  1E3P A;  4EJT A;  5FFZ A;  2H09 A;  1IJW C;  1QZZ A;  4RAF A;  3V7C A;  2YX7 A;  2ISY A;  1ZGJ A;  2HOA A;  2M7A A;  5L3F A;  2MLG A;  3GFJ A;  3J80 Z;  4RLQ A;  1X19 A;  2YX4 A;  3HGG A;  3HUG B;  2R7T A;  2V6E A;  2C6Y A;  2CUZ A;  4GO1 A;  2MW8 A;  1YOV B;  2E19 A;  2VBX A;  1P92 A;  3RPQ A;  2CUE A;  3ZXS A;  2WAF A;  3ABK H;  2VLA A;  2OCC H;  2EFQ A;  2YU9 J;  4BQA A;  1R1T A;  4FIS A;  3HPG A;  1Y0N A;  5J6X A;  2IXS A;  3E0J B;  4YIF A;  5J3L A;  2K9N A;  3SDB A;  5HOO A;  2VKH A;  4GDF A;  1R36 A;  1HBX G;  2IVM A;  3HIF A;  3H0D A;  3IKT A;  2XAQ A;  2CW7 A;  2CS3 A;  2K02 A;  5GPC A;  2MBF A;  3M3Y J;  2DMT A;  2JA2 A;  1WGX A;  2X1D A;  4HV6 A;  3QPT A;  4PJ0 C;  4XK4 A;  3C2G A;  4AWX B;  3ISP A;  4AIK A;  3F22 A;  2IS2 A;  2COM A;  2F5D A;  4RS8 A;  3FMR A;  2H94 A;  1RIO H;  3CME I;  4ON0 A;  2P81 A;  3HUG A;  4N4O B;  3BC8 A; 
#chains in the Genus database with same CATH homology
 5F0C A;  3S1R J;  1AHD P;  2XGC A;  2CQQ A;  4L5E A;  1WPK A;  1UHS A;  1B8I A;  4EEF G;  2YUS A;  4BKX A;  3F0C A;  1A5J A;  1FJL A;  5F1J A;  4QSH A;  2PMZ N;  1BW6 A;  5M5Y J;  3PO2 J;  1T33 A;  3JRB A;  1IGN A;  2XB0 X;  3FK7 A;  3S14 J;  2Y0S N;  2XRL A;  2HOS A;  1OCT C;  1YRN A;  4XRM A;  1JKR C;  4V2G A;  1BL0 A;  4BBS J;  4DZP A;  1QRY A;  1I6H J;  3CDL A;  2EZI A;  5FKO A;  1SFO J;  5IP9 J;  2LTP A;  4JX5 A;  3TW7 A;  4QIW N;  4A3F J;  4A69 C;  2GLO A;  5C4X J;  3BQZ A;  4DZJ A;  5EYR A;  1AKH B;  1ETV A;  3E7L A;  3D1N I;  4HNV A;  4IEJ A;  4X6A J;  3ZQH A;  1LE8 B;  5DS9 A;  2HXO A;  1ITY A;  3NAU A;  1MBE A;  2L7M P;  5M5X J;  1W0T A;  2HDD A;  1I3Q J;  3TP3 A;  4B1R A;  1MBK A;  2JN6 A;  1TWH J;  5DTD A;  2KDZ A;  1UG2 A;  1MBH A;  1NK2 P;  5GPA A;  3I4M J;  2L7F P;  4BXX J;  2TRT A;  4FE4 A;  1R9T J;  4B4C A;  4QTR A;  1ETX A;  2D5V A;  2DMN A;  1BJZ A;  1POG A;  3JRE A;  4A3C J;  5EEA A;  1D5Y A;  2LY9 A;  2ECB A;  1ORK A;  2NS7 A;  9ANT A;  3C2B A;  2ECC A;  3BR5 A;  2L9R A;  4M6V A;  3BTI A;  2NOG A;  2EBI A;  1MBJ A;  4Y7N J;  1IDY A;  3HOU J;  1HCR A;  2ID6 A;  3BTL A;  3MKL A;  5FJ8 J;  1IV6 A;  5IYB J;  1RR7 A;  4A3G J;  3Q0U A;  1Z0X A;  3BR2 A;  3QQA A;  5F08 A;  1RES A;  2COB A;  2I10 A;  3K7A J;  3OIO A;  1MNM C;  3L1P A;  4FE7 A;  1B8I B;  4XID A;  4X1E A;  3HM5 A;  2NS8 A;  1HF0 A;  1IRZ A;  1H88 C;  1JT6 A;  3A03 A;  3HOV J;  1Y1V J;  4JX4 A;  2R5Y A;  2IEK A;  1JUP A;  1FIA A;  2XGE A;  2ELK A;  3SFI A;  1LFU P;  1B72 A;  3RZD J;  3BTC A;  1GV5 A;  3GTJ J;  3IH2 A;  4MLO A;  3PM1 A;  3G1M A;  2DN0 A;  1S7E A;  1BA5 A;  2NVT J;  4JP0 A;  4JYK A;  4NDL A;  4A93 J;  3CMY A;  3TP0 A;  1GVD A;  1Y1W J;  3Q0W A;  1QVU A;  4MFD A;  3HOZ J;  2MGQ A;  1ETY A;  3HOY J;  1WH5 A;  3DCF A;  4M3B A;  2K9S A;  1T56 A;  2YS9 A;  4D5F A;  3HEF A;  2ME0 A;  3S17 J;  2ID3 A;  4W1U A;  1LFB A;  2LLK A;  1H89 C;  3JRG A;  2CRG A;  3JR9 A;  2IAI A;  1FIP A;  1Q1V A;  5IP7 J;  5IYC J;  1XS9 A;  4A3L J;  3SDG A;  2GM4 A;  3FKI J;  4A3B J;  4A3M J;  2XB5 A;  2CU7 A;  5F04 A;  3G1L A;  2VKE A;  2G0E A;  4DW6 A;  2B63 J;  3BR3 A;  3O8H A;  3JRF A;  5FKN A;  1O4X A;  4UUT A;  2R5Z A;  5IOY A;  2HXI A;  4BY1 J;  3M4O J;  5HOD A;  5J1Y A;  1JUS A;  2CJJ A;  4LOC A;  4C2M J;  1ETO A;  2AO9 A;  5K7F A;  3IH4 A;  2CQX A;  3BG3 A;  1X58 A;  2IBD A;  1Z77 A;  3LSR A;  3PO3 J;  2LP0 A;  3BR6 A;  5M3F J;  4A3J J;  4IHW A;  1TWA J;  1ZGW A;  3BTJ A;  2M8G X;  3LOC A;  5EF6 A;  2R92 J;  2E1O A;  3BR1 A;  3NAR A;  4A3K J;  4A3D J;  2Y30 A;  3A01 A;  3GTK J;  4DYR A;  5JLX A;  1GDT A;  2EZH A;  2OF7 A;  1TWF J;  2EZL A;  1E3O C;  2JJ7 A;  3WHB A;  3ZQL A;  2DA6 A;  2DJN A;  3JRA A;  5EG0 A;  3O8G A;  3ZQI A;  3S1N J;  3OSF A;  2E2J J;  5K7H A;  2Y2Z A;  2R5Y B;  4XRS G;  5M5W J;  2KT0 A;  2WAQ N;  3WHC A;  4AC0 A;  1JTY A;  1B72 B;  2QCO A;  1IDZ A;  2R7Z J;  1VFC A;  3GTQ J;  1TWG J;  2W48 A;  2LFB A;  2QF7 A;  1JTX A;  1JGG A;  1ZQ3 P;  3HGY A;  2HYJ A;  2FQ4 A;  2DA2 A;  2X9D A;  2JWT A;  2N8G A;  2FX0 A;  1TWC J;  2NVX J;  3B6A A;  3DEW A;  3RQI A;  4S0H B;  2L0K A;  3UKG A;  2L7Z A;  2E2H J;  4XRS A;  3ZQG A;  1HOM A;  2XGD A;  5F0H A;  1IUF A;  2EZK A;  1ZR4 A;  4UUS A;  5EDN A;  5E3L A;  3LSJ A;  2VPR A;  3JRH A;  3FIS A;  1UMQ A;  3IH3 A;  1HDD C;  5IYD J;  4M3D A;  2M2E A;  4C3H J;  3S15 J;  4ABZ A;  1HDP A;  4MO7 A;  1P7I A;  1MSE C;  1OCP A;  5C44 J;  2X6O A;  4DYQ A;  1RKW A;  2LVS A;  1ZK8 A;  2LKX A;  3TW6 A;  2VI6 A;  2R5Z B;  1IC8 A;  3CQZ J;  1W0U A;  2O7O A;  2O9L A;  4V2F A;  3BQY A;  5E3O A;  1VF9 A;  1ZTR A;  4M3F A;  5C4J J;  3B6C A;  2XPW A;  3CCY A;  2DMQ A;  3Q3S A;  1BW5 A;  2ME6 A;  1NTC A;  3LSG A;  3K2A A;  3HKZ N;  4W97 A;  2JA5 J;  1PUF A;  1ETK A;  2DA1 A;  2E2I J;  1EF4 A;  1MBG A;  1XC5 A;  4M3G A;  3G1O A;  1H8A C;  3OOU A;  5EZG A;  2R93 J;  3QPS A;  3A01 B;  1F43 A;  2Y9Y A;  3S16 J;  1G2H A;  5EGO B;  2M9H A;  3JRI A;  2GBY A;  3SJM A;  5EG0 B;  5FLM J;  5FKL A;  2XPU A;  3LNQ A;  2EH3 A;  2WB1 N;  1XG1 A;  4FCY A;  2M34 A;  1HLV A;  1ZR2 A;  1QPI A;  3MVP A;  1FTT A;  1CQT A;  2EQR A;  3GBG A;  5E3N A;  2DTZ A;  4J19 A;  3GTL J;  1IG7 A;  4RBO A;  4AUX A;  3H3V K;  1AU7 A;  1APL C;  5M3M J;  3JRD A;  2OPT A;  4I6Z A;  5C3E J;  1ENH A;  1QVT A;  1I50 J;  2HQ5 A;  4Y52 J;  2DMP A;  1JKO C;  1ETQ A;  3QPL A;  1GV2 A;  1ETW A;  1GT0 C;  4I76 A;  1RKT A;  2CUF A;  1MH3 A;  2AHQ A;  1MSF C;  1FTZ A;  5FLV A;  2MG4 A;  2DA3 A;  3BT9 A;  3HOX J;  3BG9 A;  2RAE A;  4MIM A;  3S2D J;  5EGO A;  2FD5 A;  4UUS B;  5FKM A;  4B3A A;  3JRC A;  1WI3 A;  4IHX A;  1VND A;  2Y31 A;  1ZKG A;  3GTM J;  1X2M A;  4CYC A;  5F27 A;  4JX6 A;  3BR0 A;  3S1M J;  2XPV A;  2VUM J;  1JUM A;  2VKV A;  2JA6 J;  3HB9 A;  4A3E J;  1TC3 C;  5J1U A;  2LR8 A;  2M0C A;  2JMW A;  5J1R A;  1RPW A;  2K40 A;  4BY7 J;  3H0G J;  5IP6 A;  3LSP A;  3ZQC A;  2K9Q A;  4G12 A;  4C3J J;  3HBL A;  4C3I J;  5GP9 A;  4MFE A;  3S1Q J;  2TCT A;  4BBR J;  2X48 A;  3FIW A;  5E3M A;  2WV1 A;  2H1K A;  2NVY J;  2LD5 A;  4RDU A;  2JA8 J;  5IPA A;  1F36 A;  2MSY A;  5EZH A;  3IV5 A;  1PUF B;  2DA7 A;  3S2H J;  3RKQ A;  5JLW A;  3VPR A;  2JK3 A;  2O8K A;  3ZOB A;  1NK3 P;  1FEX A;  4D5C A;  1GUU A;  1IJW C;  3GTG J;  1K83 J;  2HOA A;  3GTO J;  1AKH A;  1U9N A;  1U8B A;  3GTP J;  1VI0 A;  5F0F A;  1OJL A;  3HGG A;  2DMU A;  4FTH A;  5K7Z A;  2DA4 A;  5BNG A;  1LE8 A;  2MW8 A;  2LK2 A;  3BG5 A;  3I4N J;  2E19 A;  3FK6 A;  1MBF A;  4IHY A;  1SAN A;  3MN2 A;  1WCM J;  2CUE A;  5FKK A;  4A3I J;  2FJ1 A;  4D7M A;  2YU9 J;  4XIC A;  2Y9Z A;  3A02 A;  4FIS A;  4DYC A;  2JA7 J;  5J3L A;  2K9N A;  1JKP C;  2HI3 A;  2DA5 A;  3Q0V A;  1OFC X;  1JKQ C;  4GFB A;  3OSG A;  3TED A;  3HDD A;  3W6V A;  3RZO J;  4IHV A;  1YRN B;  1JT0 A;  1U78 A;  2H8R A;  5GPC A;  1DU6 A;  3M3Y J;  2DMT A;  1WGX A;  4D7N A;  1RET A;  1JJ6 C;  1U9O A;  4XK4 A;  2NVQ J;  4M3E A;  1DU0 A;  2R0Q C;  4AYB N;  1K61 A;  2HOT A;  2XSD C;  1WH7 A;  1MH4 A;  2ZB9 A;  1X2N A;  1A6I A;  1P7J A;  2P81 A;  5IOZ A;  3HOW J;  1JJ8 C;  3ZQF A;  4CYC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...