2L7MP

Solution structure of the pitx2 homeodomain r24h mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNHYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pituitary homeobox 2
publication title Solution Structure of the Pitx2 Homeodomain R24H mutant
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 25
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l7mP00
4BY7J 1B8IA 1ZR2A 2LP0A 3B6AA 1VF9A 4A93J 1BA5A 4C3IJ 3HOVJ 1MBKA 3G1MA 5M5XJ 2QCOA 2DA3A 1X2NA 2CJJA 3BT9A 1AU7A 4BKXA 2I10A 2CUFA 1ZR4A 2R93J 3GTOJ 5DS9A 2LD5A 3CDLA 1NK2P 1HDDC 1XS9A 1QPIA 5HODA 3HDDA 4M3DA 4A3IJ 4FE4A 3OIOA 1F36A 3LNQA 4AUXA 2R7ZJ 3BG3A 3VPRA 4MLOA 3S15J 3OOUA 3Q3SA 4QTRA 1A6IA 3S17J 4JYKA 1ETYA 2LK2A 3C2BA 3TW6A 5F08A 1OFCX 1U9OA 3BTCA 3LOCA 3IH2A 2L7FP 4GFBA 2WV1A 2KT0A 4JP0A 4JX4A 4QSHA 2DMTA 5J1UA 5E3NA 1W0UA 1APLC 1IG7A 4DZJA 4C3HJ 3SFIA 4UUTA 2L0KA 3H3VK 1GDTA 3JRIA 2NS7A 3JRCA 3A02A 3H0GJ 4I6ZA 3MKLA 1GV2A 2XRLA 2R5ZA 3SDGA 1DU6A 1U9NA 4BBRJ 1JJ8C 3S1MJ 2WAQN 3FISA 4A3GJ 4A3CJ 2L7MP 2ZB9A 4JX5A 2RAEA 3CMYA 5FKNA 1ZGWA 3GTPJ 3NAUA 3JRGA 4X6AJ 3RKQA 2IBDA 4B4CA 5EEAA 3S16J 5FLMJ 2K40A 5K7ZA 3S1RJ 2WB1N 1VNDA 5J3LA 1UHSA 2K9SA 3ZQIA 5E3LA 1IGNA 3CCYA 2OPTA 4A3MJ 1DU0A 3LSJA 2IAIA 4DW6A 2LTPA 2Y30A 3BG5A 1PUFA 1FEXA 4FISA 1G2HA 2X9DA 5F1JA 2CU7A 1CQTA 2VI6A 4RBOA 3S2HJ 1WI3A 1Y1VJ 2FQ4A 1LFUP 2X6OA 2M2EA 3IH4A 3PO3J 5F27A 2MW8A 3GTJJ 5DTDA 2ID3A 3HOXJ 1H89C 2R5YB 2OF7A 3CQZJ 3FK7A 3E7LA 1RETA 1I6HJ 4D5CA 1X58A 2EH3A 5FKMA 1XC5A 2DA6A 2YS9A 2ME6A 2M34A 2O9LA 3BR1A 4IHXA 1U78A 1LE8A 1VFCA 2R92J 4MO7A 5C4XJ 2YUSA 1LFBA 1JT0A 2XGEA 4A69C 1SFOJ 5M3MJ 3ZQLA 2M0CA 2O7OA 2O8KA 2DA7A 5K7FA 4Y7NJ 4XRMA 2PMZN 4A3EJ 5JLWA 2L9RA 1FJLA 4A3BJ 4A3JJ 2E2HJ 3D1NI 1QRYA 1MH4A 4XK4A 5GP9A 2LKXA 3JREA 1AKHA 1RR7A 1JT6A 3BTLA 1JKOC 3A01A 3NARA 1A5JA 2XGDA 2H8RA 5GPAA 1JJ6C 2FD5A 2LVSA 2EZKA 4ABZA 2Y2ZA 4IHYA 2P81A 2IEKA 4JX6A 2NS8A 4W1UA 1Y1WJ 4D7NA 2LY9A 3JRHA 2LR8A 3JRDA 1WH5A 4A3LJ 4AYBN 2H1KA 4XICA 3DCFA 2CUEA 2HI3A 5M5YJ 3M4OJ 3HKZN 1ETVA 1EF4A 2Y0SN 1ETOA 5IOYA 4UUSB 3ZQCA 1POGA 1YRNA 1UG2A 1HOMA 1W0TA 1IDZA 9ANTA 4MIMA 1ITYA 2JJ7A 3BTIA 1D5YA 1ETKA 2K9QA 1JKRC 4IHVA 2N8GA 4A3KJ 4IHWA 1MNMC 2TRTA 1JUPA 2DJNA 3IV5A 2M9HA 1TWHJ 4X1EA 3O8GA 3S1NJ 5FKLA 3S14J 2COBA 1B72A 3UKGA 1MSFC 3TEDA 1MBFA 2DMUA 2XB0X 2DA4A 1WH7A 4MFEA 3GTMJ 3HGGA 5IP6A 2HXOA 1MSEC 2GBYA 1S7EA 1NTCA 1ZQ3P 2HYJA 4NDLA 2XGCA 2Y31A 5BNGA 3K7AJ 2MSYA 2DN0A 1T56A 1RPWA 2QF7A 4W97A 5F0FA 4EEFG 2HDDA 2NVQJ 1O4XA 2K9NA 2EZHA 1GT0C 1WGXA 3K2AA 3LSPA 2FJ1A 2JN6A 1FTZA 1FIAA 4A3DJ 4M3GA 5K7HA 1B8IB 3LSGA 3FKIJ 2HOAA 4RDUA 1RKWA 1FIPA 5IYDJ 2VKEA 2CQXA 3OSGA 3JRFA 2B63J 5J1YA 3SJMA 2KDZA 3W6VA 5E3MA 3I4NJ 2FX0A 4FTHA 1ETXA 2ID6A 4AC0A 3GTGJ 1IDYA 1FTTA 1GUUA 5M3FJ 2E2JJ 5C4JJ 1RKTA 5M5WJ 1P7JA 1OJLA 3B6CA 3BQYA 3ZOBA 2E1OA 1IUFA 4M3BA 4D5FA 2JA6J 4D7MA 2D5VA 5E3OA 5EF6A 3Q0VA 3HOWJ 1IRZA 1BW5A 3HEFA 1HDPA 2ECCA 2L7ZA 3FIWA 3Q0WA 5JLXA 5EDNA 2G0EA 3HBLA 1NK3P 1P7IA 1Z77A 2VPRA 2EBIA 3HB9A 1UMQA 3MN2A 2AO9A 3PM1A 1T33A 3HGYA 1HF0A 2DA2A 5IYBJ 4M3FA 1WPKA 4V2FA 1X2MA 5EZGA 1HLVA 5GPCA 2AHQA 1K61A 2R5ZB 3GTLJ 2YU9J 3BR0A 1F43A 1GV5A 1TC3C 2W48A 3FK6A 3JRBA 3BR3A 2Y9YA 3QPSA 3DEWA 1JKPC 4BBSJ 1H8AC 5EG0A 4DYCA 2GM4A 2JMWA 3BR2A 2DMPA 5C3EJ 2DMQA 3RZDJ 1MBGA 1JKQC 4A3FJ 2HXIA 5C44J 2MGQA 2ME0A 4FCYA 1ENHA 5IP9J 5F0CA 3L1PA 2ECBA 1ZK8A 5EGOA 4QIWN 3F0CA 2DMNA 5FKKA 2XPUA 1RESA 2TCTA 5EYRA 3QPLA 5J1RA 1PUFB 3HOUJ 2EQRA 4CYCA 1OCPA 2E2IJ 4IEJA 4J19A 2JA7J 3HOZJ 3ZQHA 3BTJA 4XIDA 2EZIA 1IJWC 5EZHA 2VUMJ 1JUMA 4M3EA 1I3QJ 2NOGA 2ELKA 4L5EA 3A03A 4HNVA 1JTXA 4XRSG 2R0QC 2R5YA 1JGGA 3RQIA 1BJZA 1MBHA 1WCMJ 3MVPA 2HOSA 5F0HA 1LE8B 4M6VA 1SANA 5FLVA 4BXXJ 3G1OA 3BR5A 3TP0A 1GVDA 1ETQA 3GTQJ 5FJ8J 2CRGA 1ZTRA 1TWAJ 2EZLA 2XSDC 3JRAA 4BY1J 4MFDA 1XG1A 4I76A 2NVTJ 2XPVA 1H88C 2XB5A 3WHBA 3JR9A 4S0HB 1AKHB 4LOCA 3BG9A 3IH3A 2LLKA 2JK3A 4XRSA 3A01B 3I4MJ 2MG4A 5EG0B 3TW7A 2DA1A 2HOTA 3PO2J 3S1QJ 1BL0A 4DYQA 3GTKJ 2HQ5A 1U8BA 3HM5A 4DZPA 2JWTA 3WHCA 1QVUA 3ZQFA 3Q0UA 1TWCJ 5EGOB 1MBJA 1VI0A 1R9TJ 4FE7A 2M8GX 2X48A 1JUSA 3HOYJ 1QVTA 3BR6A 4CYCB 5FKOA 2Y9ZA 1MH3A 1TWGJ 3OSFA 4V2GA 4Y52J 3TP3A 1YRNB 2E19A 3GBGA 4UUSA 1IV6A 1Q1VA 3M3YJ 4C2MJ 2JA8J 1BW6A 3QQAA 2JA5J 1TWFJ 4C3JJ 1MBEA 2GLOA 4G12A 5F04A 2NVYJ 2DTZA 1B72B 1K83J 3BQZA 1AHDP 1JTYA 1ZKGA 5IYCJ 3O8HA 5IPAA 2XPWA 5IOZA 4DYRA 2DA5A 3ZQGA 1HCRA 3S2DJ 2CQQA 1Z0XA 2LFBA 4B1RA 1ORKA 1E3OC 1OCTC 3LSRA 1IC8A 2NVXJ 1ETWA 4B3AA 3RZOJ 1I50J 5IP7J 3G1LA 2VKVA
chains in the Genus database with same CATH superfamily
4G7ZF 3L2UA 1B8IA 1SVOA 1G3SA 3CDHA 5CVJA 2A07F 1E0EA 1PUEE 2FE3A 5DYMA 5M5XJ 1I1GA 1YIJI 1N78A 4E7HA 2DA3A 4C30A 2EPFA 2CJJA 2YR2A 3BT9A 3IL2A 2I10A 4LLLA 2QA4I 1RIOH 4EMSA 1IN5A 2R93J 4ENNA 2ZJQF 3Q9VA 1BOBA 3UNGC 3HDDA 2V9VA 2DYSH 4AUXA 4ZZLA 3DBRB 3VPRA 3WTYC 1T39A 4EGZA 3SEZA 5ICFA 1WJEA 2JRMA 3CMEI 3CLQA 3IKVA 4BL0B 2KJBA 2NAZA 3HSEA 3S17J 4KT5C 1K4TA 2CO5A 4AYBA 3C2BA 3TW6A 1QZYA 3L9FA 2K4BA 2X6XA 3K4LA 3BJ6A 3MKZA 1WZ2A 4QSHA 1W0UA 4AWXB 5AIPA 1IG7A 1V5GA 2L0KA 2XAHA 4ON0A 2E1MB 4MNUA 3JRCA 4I6ZA 1GV2A 2R5ZA 5D6EA 1U9NA 2EB7A 2RKHA 2WAQN 3FISA 3CD6I 1X1CA 4A3GJ 1OCOH 2VIXA 2VQCA 4PCQA 3R4KA 1GXPA 2RAEA 2ZSHB 5IT9K 1K4SA 4FQGA 1FBSA 4E7SA 5FLMJ 2V1XA 3S1RJ 1KYZA 5K7ZA 4EATA 3OR1C 1B59A 3LSHA 2IJLA 3RKXA 2VOPA 2QQ8A 3ZQIA 3JSPA 4U0VA 1IGNA 1UFMA 1OMIA 2AXTC 4ASNA 5BS6A 2DDAA 2IAIA 3ZMDA 5D4SA 4U0WA 4BHBA 3V4GA 2Y30A 4DW6A 2IW5A 4O5VA 1DUXC 3BG5A 1PUFA 2K02A 2QM3A 3D5SC 2ZMEC 1PDNC 1OPCA 3X2QH 3J7ZI 5F1JA 4EJVA 5J8FA 3P9KA 2KKOA 4RLFA 2MYSA 2W84A 3RQ4A 4RBOA 4EVIA 3BP8A 3FXRA 1Y1VJ 2FQ4A 2M7AA 2DFHA 3DQVC 2LG4A 5H6RA 2MW8A 4A5NA 3GTJJ 1H89C 1KONA 2R5YB 2PN6A 3CQZJ 2W4SA 3FK7A 4FX4A 4OMZA 2EFOA 1GVJA 3WU0A 1IXRC 5L3FA 3DKXA 4PGHA 4XN0A 3FXKA 3DBLB 3L2VA 2E5NA 1J59A 2JA2A 3WG7H 1QNTA 1IAWA 1CGPA 3ML6A 4B47A 1LFBA 1YI2I 5M3MJ 3ZQLA 5F64A 3M9AA 3PUFA 3ZP5A 1BR1A 4HF1A 3S3MA 4XRMA 3FKJA 5JLWA 4A3BJ 5KHDA 3MZYA 4A3JJ 1A04A 3OYIA 1MH4A 1LEBA 3P5JA 2RC4A 3MD2A 4A6EA 3BPVA 1RR7A 1XD7A 1ZN2A 3F8BA 4MTDA 1JKOC 3FXQA 2RREA 1R6RA 2QUFA 3HHGA 3GFJA 4BHPA 4KISA 2ISYA 5CYVA 3JTGA 4KN4X 1JE8A 2X1CA 2Y2ZA 4IHYA 2L4AA 2IEKA 3P9IA 4D7NA 2W57A 5JR3A 5KCMA 4XKCA 4E70A 3JRDA 2HOEA 3KYCB 4A3LJ 2H1KA 2K9LA 1ZREA 2RQPA 2HI3A 2HKOA 2ZXHA 3J80Z 1BI2A 3KE2A 3ZMZA 2IA1A 2LREA 3ABLH 1HKTA 4RS8A 1UG2A 5BOXA 1MDMB 2E1CA 2L9SA 4MIMA 4NC7A 4XLAA 2W85A 1WJBA 3OYNA 1ACIA 1D1BA 2FOWA 5LGUA 2QKLB 1JHFA 2VE8A 3K4NA 2KIMA 4HLXA 4IHVA 2N8GA 3JW4A 1MNMC 2DJNA 2M9HA 1TWHJ 4B43A 3OIPA 3CCMI 4HPQA 2VKDA 1DP7P 3EUAA 3UKGA 1R1UA 2K5CA 5IP6A 1TLHB 1YITI 1MSEC 2ZJRF 1ON1A 1NTCA 2JT1A 2FMYA 3RI4A 2HYJA 4NDLA 2DI3A 1GLNA 3E0JB 2JTVA 3ABUA 2HEOA 1IF1A 2A61A 1T56A 1IN4A 1QU3A 1RUOA 5F0FA 1D0YA 2EFNA 1O4XA 2EZHA 1GT0C 3K2AA 3BLYA 2FJ1A 2OUMA 1Y39A 1F4KA 3GCMA 4A3DJ 4M3GA 3LSGA 2HOAA 3IUOA 1FIPA 2UV1A 3MFKA 3OSGA 2X85A 4R1HA 5J1YA 2LF7A 4ETSA 1FZPB 2HYGD 2IGKA 3I0TA 1KU7A 3KZYA 3COAC 2XASA 4CCLA 2FX0A 1ETXA 1OR7A 3K70C 5HNFA 3RYRA 3GTGJ 1LDDA 3CJTB 3TKYA 2KL4A 2CV2A 4ZTFA 5LEKA 5C4JJ 2VC1A 2ZSIB 1OJLA 2RV8A 1ZHFA 4Y3OA 4M3BA 3EYIA 3QAHA 4WCGA 3HPGA 4D7MA 5E3OA 3E5XA 3FXJA 3K69A 3AKZA 4L9JA 2ELHA 3O6BB 1JXSA 2L7ZA 1MMNA 3FIWA 1EH7A 1OYYA 4PUSA 1YX5A 4ZH4F 5BPDA 2HDWA 3HBLA 2JUGA 1NK3P 2OQGA 2H8WA 3W2VA 1DQUA 2D1HA 5DM7F 2IGMA 3MN2A 2E34A 4G6QA 2JPBA 2YX4A 4KIGA 3PM1A 2JRTA 1WJFA 5DCMA 4N9HA 2EFWA 3C1DA 1O3SA 1S7OA 2QGUA 4V2FA 5EZGA 2FF4A 1F43A 5FRNA 1HW1A 3IRRA 1TC3C 1J9IA 4X0GA 2RVCA 1BOAA 5FB2A 4U7BA 1YFHA 3DEWA 4CH7A 2F5DA 3C2HA 3OYMA 3J7YJ 1H8AC 4OAYA 5AIQA 2GM4A 5LHGA 1W4MA 1S6LA 2QSFX 3RZDJ 1OR7C 1BIBA 1Z3YA 2CW8A 5ERIA 1R4NB 4BS9A 5E1WA 3L1PA 2ETHA 5EGOA 2QQ9A 4QIWN 1FYLA 2PJRA 2XPUA 1RESA 5FROA 2RNJA 3H5NA 4P5OA 4XLNF 4EJWA 5J1RA 3HOUJ 2EQRA 4LLNA 4F93B 1OCPA 1W1WE 4I09A 4IEJA 3CMMA 4OIOF 3HOZJ 5HOOA 3OYDA 4IOCF 4CHUA 3BJOA 1MMAA 4HEA2 3G6EI 3DLLF 1YQAA 2VBYA 3SFZA 5ICEA 1O3TA 5EZHA 3SZPA 1KGSA 5KK1A 1TNTA 1FYMA 4ZTJA 1IZ1A 1K6YA 2ELKA 3A03A 4L5EA 3VYSB 3MEXA 1JTXA 2R5YA 2E1MC 3RKWA 3J81Z 3RSNA 1BJZA 2EIMH 3ZN1A 3O2PE 3MVPA 2F4OB 4HDVA 2STWA 2LNBA 5F0HA 1LE8B 4PJLA 1Z9CA 1SAUA 2EFPA 5FLVA 4PZJA 1CF7A 1Z91A 5D5VB 1HKQA 3BROA 4IZZA 1XCVA 1KQ8A 2F2EA 5HLTA 3K0LA 2XSDC 3JRAA 1LDKB 2XAFA 1MIJA 4YELA 4MTEA 4KICA 2E71A 2XPVA 5DUKA 3OYFA 1QGPA 1Z1DA 2XB5A 1IRXA 2O3FA 3WHBA 4BJTA 1TNSA 2IA0A 4LOCA 1SD7A 1K78B 4XRSA 2F5CA 4B44A 3A01B 4ZZDA 4A6DA 4EJUA 1BM9A 2K3FA 4NB5A 3PFYA 1VZ0A 3GTKJ 3BPXA 2HQ5A 3GZ5A 3KP5A 3HM5A 3R6SA 4RB2C 4BJ5C 2R7UA 2H1LA 2B0LA 4XKVA 2DFIA 5CLSA 2Z99A 3C2GA 1FBQA 1V3FA 3EPZA 1A35A 3AFHA 4II2A 1ZG5A 5A2QK 3SHFA 3CCQI 1FOWA 1LPQA 1QVTA 3H9JA 4CYCB 1BN5A 1MH3A 3LA7A 2X6YA 2QEXI 5CJ9A 3G71I 5ILVA 5TJJA 1IV6A 1Z7LA 1Q1VA 2NS0A 2CQNA 2XIGA 2JA8J 4OIQF 1R5ID 1MDMA 3H5RA 2VT3A 5LRSA 3OL4A 6PAXA 2JA5J 4HNUA 4GXOA 4ZYEA 1LVKA 3OV8A 2R7WA 2DK8A 4F52A 5D6FA 3K6GA 1JI8A 5F04A 2XAGA 1U8RA 1K6OA 2NRAC 2NVYJ 3E5QA 4OOIA 2VODA 5CVRA 5FLXZ 4D1QA 1MMDA 1FC3A 4Q48A 1VQNI 5L3CA 2HYFA 1K83J 3BQZA 1TW3A 3LFUA 1RR8C 1JTYA 1ZKGA 3CP8A 2K7LA 4CSWA 3O8HA 5IYCJ 4E7KA 1DP3A 2XPWA 4N0BA 3ASNH 4XBFA 4AVPA 5IOZA 3R0AA 4ANJA 4DYRA 4CDGA 4F92B 4BE0A 4B1RA 4P55A 4HNTA 1TZLA 2OZ6A 1B6AA 1R58A 3JCUC 1XMAA 2M4GA 2VKVA 1ZRDA 2EIKH 1ZR2A 2HPMA 2BXZA 1VF9A 4A93J 2BBYA 2BEOA 1YE9A 2PEXA 4QPQA 3TGNA 4IQ4A 2OQRA 2MFZA 2QYOA 2CUFA 3QOPA 1ZR4A 5DS9A 2WTEA 1HDDC 2KQRA 2WV0A 1XS9A 1QPIA 3A2KA 4M3DA 1TW2A 1F36A 3F6OA 3NRVA 2DFEA 1VQ5I 3MKWB 1U5TB 4L9TA 1OKRA 3TDUC 3DKYA 4JYKA 1ODDA 1ETYA 2Y48A 1MW7A 3ECOA 4QPOA 5CVVA 4E7LA 2WV1A 4GFBA 2KT0A 2L2OA 3EUHA 3LA2A 5E3NA 2DMTA 1APLC 2Z5UA 1LKXA 4C3HJ 4DZJA 3SFIA 4XKWA 1STZA 4BEHB 3LAJA 3CCRI 1GDTA 1X1BA 4M6YA 2BW3B 3MKLA 4CICA 1A6QA 1BR4A 2XRLA 5IY5H 3UR3C 3RTRA 4BE1A 2V4JC 4EJTA 1MMGA 1FMVA 4XORA 2DO7A 3RDIA 3IWFA 4E4HA 3GTPJ 4X6AJ 2VBXA 3REOA 1N77A 3RKQA 3QWLA 2DU9A 3S16J 1OISA 2VJ5A 2KIQA 2V9KA 5J3LA 1UHSA 3I56I 4A3MJ 5LD2C 1DU0A 3LSJA 2KMUA 3U1KA 4E7ZA 1WSUA 3BJAA 4F3QA 1E3HA 2O5RA 2HVQA 2A3SA 3IAM2 3VB2A 1VQ8I 1G2HA 2X9DA 2L7KA 2FBHA 2OZUA 2A6EF 2JVHA 3HTSB 1YW9A 1CQTA 1TQMA 2VXDA 2VI6A 1FOYA 5FGMA 3ZMUA 3S3OA 4HG2A 4QWQA 4CA0A 3EUHC 3CF2A 1WJAA 3TMOA 2RN7A 2VASA 3ISPA 3PO3J 3SYTA 5DTDA 1SC7A 4H4KC 5E1XA 1RETA 1I6HJ 4CCMA 2EH3A 2QSGX 5FKMA 2DA6A 2YS9A 2M34A 1Z7UA 2O9LA 4IHXA 1LE8A 2LY1A 3CC4I 3B02A 1MJBA 1WJCA 4MGRA 2YUSA 4MO7A 4P96A 1HSJA 5LRRA 2D45A 3H92A 1SFOJ 4UB8C 4PFOA 3IKTA 2R7SA 2M0CA 5BMZA 2QKMB 5L3BA 3VWBA 2DA7A 2CQKA 3ABKH 3OY9A 2H27A 3H3UA 2PI0A 1HXDA 4Y7NJ 2FUG2 3H9GA 4IVNA 4A3EJ 2W82A 2L9RA 3CJQB 1LFPA 2B7EA 4G7HF 2LKXA 3JREA 3NQOA 2FNPA 3BTLA 1JT6A 2CFOA 2ZO4A 2MD0A 3O3KA 4FX0A 4L9NA 3A01A 2H8RA 2M8EA 5GPAA 4ENKA 5CVIA 5D8LB 1YYVA 1VQ7I 4PDKA 3S3NA 2EIJH 1OCCH 2WAEA 2P81A 4W1UA 4JX6A 4B8XA 1Y1WJ 3OYGA 3D5LA 5H20A 2Q0OA 3KX2A 4OINF 2LR8A 1WH5A 4CXFA 2HS5A 1R5HA 2K85A 4XICA 3LQQA 3DCFA 3TL4X 4LFUA 2CUEA 2CUJA 4L9VA 3W3CA 5M5YJ 4Q5SF 4LITA 3V8JA 1EF4A 2Y0SN 1ETOA 3GZNB 4UUSB 3H1CA 2KIUA 5JI6A 1POGA 1AWCA 1RC9A 1X1AA 3ASOH 4A5MA 3BZCA 2CV1A 2EV5A 2OAZA 3CCEI 1O7FA 4HBLA 1FY7A 5GTHC 1D5YA 2WC2A 4RB0A 3K70D 2K9QA 5J4VA 4A3KJ 5E17F 3MQ0A 3IV5A 1S72I 4BGDA 3E3VA 4Y17A 4RAGA 3S1NJ 1I6XA 2RDPA 5FKLA 2DOAA 2HTJA 2LYCA 3FBNB 1MSFC 3A0HC 2DMUA 1Z21A 3DPTA 3MCZA 1WH7A 2KJCA 3KP2A 2QBYB 4KUMA 3OR2C 1S7EA 2EA2A 2ELJA 1O3QA 2Y31A 4IHSA 3K7AJ 3KEQA 4E6KG 2DN0A 1IRFA 1X3UA 1RPWA 4ZDPA 1QHHD 3VEPA 4J01A 2HDDA 2NVQJ 3ZMSA 4CCOA 3U1DA 2AS5F 2O6GE 1YHQI 1LVAA 1FTZA 4BH9A 1FIAA 2FA5A 1I39A 2K27A 2R3SA 5K7HA 1L3LA 2IT0A 2HTSA 4BHCA 5IYDJ 3OIQA 3ZXSA 4N4NB 3OYCA 2VKEA 3J80K 4V19K 3JAMZ 3KLOA 2CG4A 2B63J 4GCVA 2HNHA 3U21A 5CVUA 1P4AA 3W6VA 5E3MA 4DBQA 1EH6A 3WE2A 2VLAA 5H2FC 3GZ6A 4HZFA 2P4WA 4FTHA 2WADA 2IRFG 2ID6A 2R7FA 3H3ZA 1FTTA 3PQJA 5D5WB 4A0ZA 5M3FJ 4I99C 1RKTA 5IT3A 3BQYA 3B6CA 5D8KB 2L4MA 3OS2A 3ZOBA 4YIFA 4ENMA 1YJNI 1IUFA 4UHTA 2FBKA 1Y56A 3IP4B 3TQNA 3CCSI 2FMLA 1T0FA 2ZJ2A 2L02A 3Q0VA 1E2XA 3VSKA 3GLLA 1IRZA 1HDPA 2ECCA 5JLXA 3L2WA 1J7KA 3DEEA 3D5RC 1WFXA 1R00A 3RPQA 2KRFA 1P7IA 3PQKA 5HDKA 3HB9A 4BQAA 2EJRA 2UUZA 1T33A 3HGYA 3TBIA 1ZGJA 2HZTA 5GAHJ 3TOAA 1ZRCA 2MA3A 1WPKA 3HUGB 5JHUA 2DT7B 1K61A 1P6RA 4U88A 4IRGA 3BR0A 2BW3A 2YU9J 4FT8A 4DOZA 3L09A 4PSXA 4CUGA 2STTA 4JOMA 1P4XA 5J4YA 3BZKA 3PSFA 3AAFA 1WVRA 2IA2A 3RJPA 2HQAA 5GADJ 4D9JA 4DYCA 4UVBA 1DPRA 4XQFA 3ZR8X 2EWNA 3BG7A 2P5VA 1LEAA 2H6CA 2DMQA 3GVAA 4Z6YA 1ULYA 3KP6A 1JKQC 4A3FJ 4J00A 2HXIA 4KITB 5HS8A 5KVRA 1QPMA 2ZXWH 4G8XA 5E79C 4I01A 2HVSA 1J5YA 1GHCA 2ECBA 4MQ9F 3F0CA 4LMYA 4Y13A 2H94A 3FHNA 3MZ8A 3K2ZA 3NEUA 3P9CA 4HQMA 3CP2A 5EYRA 3QPLA 3DPUA 1T0FC 4HX7A 4LD5A 3DXJF 1A31A 1IN7A 1LUJB 2VBWA 4J19A 2JA7J 3R60A 1V5EA 2CFXA 2GAUA 2VJJA 2PX9A 4H0EA 1HSTA 3QP5A 5KNLA 2EFQA 4WXHA 2EZIA 1U0JA 2BV6A 1OLTA 4A0YA 4IPAA 1JUMA 4M3EA 1XSDA 4YRVA 5HDGA 3WTWC 1BR2A 3A0BC 3PSIA 3PJRA 3E6CC 3CCUI 3WTVC 3RQIA 1WWXA 1HA8A 1WCMJ 4G94A 1I5ZA 4M6VA 3L2CA 4BXXJ 2JSCA 5LLQA 2ZXIA 3T8TA 1X4OA 2RGVA 1OQYA 3E1SA 4XNFA 3GTQJ 2X6WA 5FJ8J 3AG2H 4UVCA 2VQLA 4HW0A 3HJEA 2ZFWA 3HYIA 3L2QA 2QENA 4I76A 2R7XA 3BDDA 4XKBA 1HKSA 5L3GA 1X3ZB 1YX3A 2XSJC 1IXSB 3JR9A 1WJ5A 1UHWA 2F4IA 4S0HB 1AKHB 4IRIA 4UNOA 3BG9A 3IH3A 4U87A 2O8XA 3BWGA 4HSTA 3I4MJ 2KP6A 3TO7A 5EG0B 5HS7A 3SXYA 3DEUA 3HHHA 2DA1A 4F55A 2FRHA 3K1PA 1WJDA 2E60A 3KYDB 5HNHA 4I2OA 5EJCA 1R23A 1U8BA 2WAFA 2VL8A 1D1CA 3NWTA 2OCCH 4DJAA 4S05A 3WGIA 3WGGA 3HOSA 3CUQB 5LHIA 3GW2A 3Q0UA 4HX8A 1MBJA 4PJ0C 1REPC 2V1DA 4M9ZA 4WXCA 3BCAA 1IN8A 3WU1B 3EYYA 1JUSA 3H5AA 4GRIA 3S93A 1VQ9I 2VQHA 4GGGA 5FO5A 1S3JA 3J81K 3HRTA 4KIBA 4EV0A 4Y52J 3TP3A 3DU5A 3GBGA 1YRNB 4UUSA 4TV7A 1XGMA 4NC6A 3M3YJ 4Q47A 4U0YA 1VTNC 2KZGA 4BQQA 3WTXC 4OIRF 3IWZA 3U2RA 5DM6F 4FASD 5HS9A 3IHUA 3V7RA 2GLOA 2VXZA 2NXNB 1JHHA 2GOXB 1BI3A 3K9TA 4L5JA 3FDYA 4XSZF 2GXGA 2LMDA 1O3RA 2GOMA 4G7OF 2JUCA 3QRFF 3A1YA 2CSOA 2GZWA 5LFAA 2DPDA 3GMEA 2KLOA 3F8FA 3MWMA 1FOKA 1FPQA 3OOPA 2Z2SB 3ZCOA 4HF0A 1X3WB 1AHDP 1WI9A 2ADUA 3PL8A 2QBYA 1UZCA 2BY1A 1Y8RB 1V4RA 1HCRA 2CQQA 1Z0XA 4JQFA 2X51A 2LSOA 1E3OC 2V9PA 5B3SH 2CV0A 3HC7A 2LDUA 4PFPA 4YIRX 1XMXA 1IC8A 2NVXJ 2GIZA 3RZOJ 1I50J 4HF2A 4UV8A 3ECHA 4B09A 3ZMTA 4BY7J 4BXUA 3HL2A 3B6AA 4DIQA 1IXCA 2DBBA 1BA5A 4C3IJ 1P9QC 3G1MA 2IS2A 2EA4A 2QCOA 2A5YB 2KIFA 1Z6TA 2CS3A 1X2NA 3BG6A 1XN7A 4LLGF 1AU7A 2VONA 3PNVA 2DLLA 1HQCA 1UJ8A 4NUBA 2P7CB 2E7WA 2P5LC 2C6YA 1KU2A 3CDLA 1NK2P 5HODA 4FE4A 2BVMA 2ZBKA 3TDZC 2DODA 2R7ZJ 4BDZA 3BG3A 2YPRA 4MLOA 2XAQA 5D5XB 4HYEA 3E6MA 3SZTA 1EV7A 4IO9F 1YG2A 5FLXK 3Q3SA 2W25A 4QTRA 2ZJPF 1MJAA 1X1PA 3FXMA 1A6IA 2ZKZA 2DFFA 1TP4A 2W00A 3B73A 4M72A 1OFCX 1U9OA 3BTCA 3T8RA 4WK8F 1IUYA 2L7FP 5DV5A 4MHGA 3FX3A 3Q5FA 5J1UA 5H6QA 1P4WA 1I3AA 1EJ9A 2Y0SA 4UXNA 3DF8A 1E3PA 3G4SI 1FYKA 3HTUA 1E17A 2Q1ZB 2DK5A 2NS7A 3A02A 1YJWI 1G6NA 2M5WA 1OCZH 3SDGA 2K3PA 1DU6A 3S1MJ 1JJ8C 1J09A 1RUNA 3ONQA 3AL0B 1D3YA 3C18A 1ON2A 1NG7A 3FMQA 5HVQC 3CDIA 1UCRA 1S9HA 4ZDLA 2HGCA 3I58A 3NAUA 3GEZA 4NHJA 4B4CA 1TL8A 1ERDA 5EEAA 2L9VA 2K40A 1XB4A 2WB1N 2PFBA 2IS1A 5J6XA 1QZZA 2WAQA 2LBFB 3RKYA 3DTEA 5E3LA 3CCYA 2OPTA 3QPTA 2ESNA 3F23A 2K9MA 1EH8A 4I0AA 4HOBA 3ZQ7A 4GDFA 3QODA 4Y15A 5ILUA 2G9WA 4FISA 1H0MA 3JSOA 2OTLI 5FD6A 2M30A 4L18B 3L2RA 4L0YB 4P9FA 5L3EA 2CU7A 4WF2A 4IOAF 2R7DA 3S2HJ 1LFUP 1SVMA 4M6XA 2ZC2A 1XSXA 1XDSA 1KQ0A 2MD5A 1VQ4I 3HOXJ 2ID3A 3KPHA 3I64A 3G3ZA 2VQGA 3GFMA 2DXIA 2LY2A 1UELB 3DTKA 5DCFA 3I4PA 4D5CA 1SEUA 1ZYRF 2ZNYA 1TTYA 2ZMEB 1HW2A 3ABTA 1B9NA 2O0YA 3BR1A 1U78A 4R8HA 4YFXF 4EM1A 2Z16A 2P7VB 1W5SA 2D2WA 1JT0A 2NNNA 2F6CA 4C9YA 3F21A 4HA8A 3P7NA 4RGRA 4AIJA 3S2WA 2M0MA 2HWVA 1FP1D 2M7BA 2O7OA 2PQ8A 1VQKI 2R7VA 1UB9A 5K7FA 4A12A 3BZ6A 1ZG1A 1XCBA 2PMZN 2F5EA 1TT5B 1QZEA 1ZAOA 3TOBA 2HFHA 2HR3A 2YU3A 3H35A 1XDUA 2E2HJ 3M8EA 1QRYA 2W1OA 4OAZA 5GP9A 4RB1A 1AKHA 3DFGA 2COMA 2M87A 3NARA 2GXBA 2XGDA 5F6FA 1JJ6C 2VE9A 1PYVA 2I5UA 3KCCA 4ABZA 1X1DA 3SZGA 5ED4A 5K5OA 4YIIA 2B9SA 3OYBA 2NS8A 2ZFUA 2LY9A 3ULQB 2XGXA 3CUQA 4XN3A 3N97A 1P92A 4XLHA 3F8CA 5LHHA 2IVMA 1R22A 1B1BA 4IQJA 1M1EB 2UXXA 2DDBA 2XHKA 3HKZN 2Y0MA 3RYPA 2AXLA 2JVGA 5IOYA 1KU3A 3ERMA 3ZQCA 2QSHX 3QYBA 2QZ8A 1YRNA 3F8MA 1SFUA 3OYKA 1X4PA 1HOMA 5EEGA 1W0TA 1ZLJA 9ANTA 4N9IA 2JJ7A 3AG4H 1ITYA 1D0ZA 4ESBA 2VC0A 2L9NA 1S8NA 5TGTA 3CJRB 3GLXA 1JKRC 1IRGA 3NWSA 3R61A 4ZYDA 3AG3H 1JUPA 2OC6A 1R71A 3T5XA 5GAGJ 4X1EA 3O8GA 1UAAA 5LGNA 1Y8QB 3PIPF 3TO6A 2ACJA 2COBA 2BY2A 3Q9SA 1J2XA 4ZYGA 3TEDA 4CYDA 2VJIA 3SDBA 4ESFA 1YLFA 3OYJA 4MFEA 3CTAA 3M8FA 3GTMJ 1W7PB 4NC8A 3H9QA 1O57A 3KIOA 2GBYA 3DBHB 3KP4A 3D0SA 1ZQ3P 5ICGA 1MNEA 2QF7A 4W97A 3CUQC 2JPCA 1O7LA 4HLYA 3EETA 5TRDA 5DD8A 2K9NA 2FBIA 1WGXA 2CH0A 2KHMA 3LSPA 1R4MB 2XAUA 2JN6A 1GXQA 2KFDA 3FKIJ 3HZJA 5HDNA 1RKWA 2IGOA 4G6DA 1SMYF 4RDUA 2MBFA 2OA4A 2OCEA 4XRFA 2CQXA 2E1NA 1YTYA 3JRFA 2NYXA 2CYYA 3SJMA 4LG0B 1DGRM 2KDZA 2OTJI 4DQ2A 5GTIC 3PNYA 1IV8A 3WODF 2VBZA 4CO8A 4DBRA 1YOVB 5K5QA 1T2KA 2RQQA 1ZGAA 3OYHA 3KP7A 1B9MA 1GUUA 1TQIA 4UY8I 1ZH5A 5JHFA 2E2JJ 2BY3A 3VODA 3ERED 5M5WJ 1P7JA 1SVLA 5CPRB 4D5FA 1ZRFA 2JA6J 5E18F 4PJJA 2D5VA 2UZKA 5EF6A 1B4AA 2R7OA 4OMYA 2L3DA 4I02A 3CC7I 2PMHA 4RLQA 5EDNA 3ROUA 2WA0A 1Q1HA 2VPRA 1TBXA 1YS7A 4A2UA 2KPMA 2BHYA 3OYEA 3S32A 2VOOA 3BY6A 1OYWA 1BI1A 2DA2A 4O3MA 5IYBJ 3EDPA 2AHQA 2V6EA 2AQEA 2VT2A 4RGXA 5LBQA 3QPSA 2CW7A 2EINH 2WY7Q 2R7RA 1K78A 1S7AA 2NOJB 3ZQQA 3OYAA 1JKPC 4BBSJ 4XLFA 3WTSC 2JMWA 2Z33A 2NVUB 3JAMK 2KRHA 3BR2A 2QVOA 3I3LA 1SD4A 5C3EJ 2G7HA 1G59A 5C44J 2MGQA 3M7GA 4M9SA 1LJ9A 2ME0A 4FCYA 2YX7A 5IP9J 3KZZA 2CUZA 4GYGA 2LBFA 1BI0A 3WGHA 1ZK8A 1QHGA 2MABA 5TISC 1YIOA 1I27A 3AG1H 2MH9A 4XR6A 4CYCA 3E6DA 1VQPI 1NH3A 1XGSA 3FM5A 1HBXG 4HAMA 2Z3YA 1KA8A 4RGUA 1FOXA 2KISA 3ZQHA 2XC7A 5FD5A 4XIDA 1IJWC 4LJZF 2PMUA 2GWRA 1MZBA 1YO5C 1L0OC 1PVEA 2EK5A 3DKWA 3HOTA 1G8XA 2BHZA 5LGTA 4HNVA 4RM2A 4XRSG 2R0QC 4HSRA 3H0DA 4LB5A 1T8IA 3L00A 1MBHA 4IHTA 4KA4A 3AL0C 1F5TA 2HOSA 2ZMEA 3E6BA 1SANA 3G1OA 4RB3C 2DPUA 5EEHA 4FETA 3TP0A 4QLCU 1GVDA 1ETQA 5HLGA 3GWZA 4I7HA 2Q2EB 5J8CA 3FBIB 4HX4A 3CJNA 2PBIA 3OS1A 1ZTRA 1TWAJ 3V42A 5DCMB 4HDUA 5FRMA 5DDGA 4BY1J 4F91B 2NVTJ 1SFEA 2O03A 2OD5A 3QU3A 4IF4A 2VB6A 5FFZA 3KP3A 1W5CC 2MLGA 2DYRH 1V54H 1IW7F 2M4KA 3CF5F 1SAXA 1YJ9I 3ZMVA 3TW7A 1VQLI 2V1NA 3PO2J 1S29A 1XMKA 2A6TA 4AIDA 1BL0A 2DW4A 3E5UA 4XOPA 3WU2C 2W24A 2R7TA 4LGWA 4HV6A 4AIKA 2OJED 3DTIA 1QVUA 2JQ7A 3ZQFA 3OYLA 5EGOB 1TWCJ 1R7JA 1ONVA 2DJIA 5JFRA 2PJRB 2Y69H 1VI0A 3KZIC 3RIRA 2X48A 5E1ZB 3WTTC 3HOYJ 5FFXA 2F4MB 2DOFA 2XF7A 2Y9ZA 1FWZA 4Y4RA 5LEJA 1W36C 1TWGJ 4LB6B 2LKPA 2WB1A 4XSXF 2E19A 4LIUA 5DD4A 4AM3A 1FSEA 3KYLA 1U5TA 4CCNA 4C2MJ 2IS6A 2A5WA 4KMUX 1F9NA 3RPUD 4C3JJ 1R1VA 4HV5A 3VSLA 2XAJA 1MMSA 3I5UA 2E5ZA 4UB6C 3GUDA 1AA7A 3IC7A 3K4MA 1DPUA 2DTZA 1T08B 4BEHA 1B72B 4GYIA 4EM2A 4EQQA 3HSFA 4ENJA 2BY0A 3ZN0A 1CF7B 3CC2I 1YW8A 2MH2A 4KDPA 2K86A 1W7PA 4CZZA 3FM3A 5IPAA 3QYFA 4E7IA 3G73A 2M45A 2PLYA 5GAEJ 2DA5A 3ZQGA 2XROA 1V5FA 3S2DJ 5KAIC 2DQLA 2LFBA 4O6JA 4E7JA 1OCTC 3MMYB 2GA2A 3GF2A 1DDNA 4LIVA 2X0LA 2FU4A 2M1BA 2A05A 1R5GA 2L54A 1G3YA 2ZNZA 3G2BA 2LP0A 5K1YA 3KETA 3ESWB 4UV9A 5IT9Z 3HOVJ 1MBKA 5F1RA 1U5TC 3F3XA 2DCEA 2PMZA 3KFWX 4LG0A 3U9GA 2XVCA 1FBUA 1SD5A 3K4JA 3MAJA 4BKXA 3N05A 2HDCA 4BU2A 3F9KA 4M74A 2E7XA 3GTOJ 2LD5A 2F5VA 2A69F 4XLEA 4A3IJ 3I71A 3LNQA 3OIOA 4XMYA 3V8KA 2P5KA 3QYEA 1OCRH 3S15J 4UUVA 3OOUA 2UWMA 4I0BA 3E97A 4NQWB 4ZC3A 2TDXA 3M1CA 3I59B 5AONA 2QQBA 2F5FA 1WHUA 2BXYA 3HRSA 4RM3A 4BXFA 1I1SA 2LK2A 5F08A 5B66C 1K79A 4P9UA 3LOCA 3IH2A 3S8PA 4BJ6C 3DU6A 3EUKL 3CUOA 4JP0A 4JX4A 3KLNA 4LG3A 1LNWA 3HKZA 4WXDA 2ZXJA 2CMPA 4GO1A 3BC8A 4UUTA 1FMWA 1V55H 1BBYA 1FX7A 3H3VK 4KT6A 3JRIA 4XLPF 1MD0A 3H0GJ 3KEYA 4HQEA 3ZRGA 4BBRJ 1SFKA 1JGSA 3V8LA 2IPQX 3C7JA 4BUPA 4A3CJ 3LSMA 2L7MP 3LL7A 2X4HA 3LSTA 1Y0NA 2ZB9A 4JX5A 4CGZA 3CMYA 1ZGWA 5FKNA 2V79A 2LC2A 4YG2F 1XSVA 3CLOA 3JRGA 2PJPA 2IBDA 4RGSA 4ESJA 2GIVA 1VNDA 4MQVA 2K9SA 4KIFA 4YFNF 4YFKF 4I98B 3PIOF 2XDVA 2FSWA 4IJAA 2LF8A 2LTPA 5HLHA 2BOLA 1FEXA 2G7UA 4BQOA 2HVRA 3VOEA 2GA1A 2UXNA 2FNAA 1SFXA 3MKYB 2CWEA 1QA6A 1WI3A 4LK0F 4OIPF 3SEQA 1NG6A 3RPUA 2X6OA 2WBMA 2YSRA 2OU2A 2M2EA 2P6TA 4P1WA 3IH4A 3OS0A 3CMAI 2ICWG 2AQFA 5F27A 1EKEA 1LDJA 3ZGKA 2HQNA 3OMYA 5ICCA 1J0RA 2OF7A 1XGOA 3V7SA 3FZVA 3N4MA 1RI7A 2GQQA 2XV4S 3E7LA 4A0XA 1TT0A 3I9V2 3OL3A 1X58A 2ME6A 1XC5A 3PFIA 3VYRB 3VYUB 2LOOA 1QBJA 5E20A 1D8KA 2KRCA 3QPHA 2JSPA 1A36A 1VFCA 2R92J 5C4XJ 1U6GA 4XOTA 2XGEA 4A69C 3BOQA 2HU9A 2W7NA 3DWLE 1FNNA 2I8DA 2Q2EA 3T1BA 2VJ4A 1N75A 3J7AO 2O8KA 3CCJI 3WTUC 4KMFA 5CQGA 3F8NA 5E8GA 1ZG3A 2IGNA 3TO9A 1FJLA 2ESHA 1RZ4A 3LAPA 4HRIA 3D1NI 4XK4A 5DUIA 3ELKA 3V7CA 3K4CA 1H9GA 4EM0B 1MJ9A 4BYYA 1A5JA 2BE5F 2PG4A 4KNYA 2FD5A 2LVSA 2EZKA 3LSKA 2LKSA 4ZJZA 2OBPA 1PP8F 3LSIA 3WG9A 3HSRA 2JZYA 4EGYA 2VPLA 1IN6A 3GXOA 1ZELA 3JRHA 1SMTA 4JK1X 3F6VA 1XPXA 4AYBN 1QQIA 5KAFC 5E8IA 1WRJA 1AOYA 4K2EA 1FT9A 2Z1DA 3HPHA 3K10A 3LQRA 3M4OJ 2HKXA 1R36A 1HW5A 4N4OB 1ETVA 3W2AA 4CZCA 1H9TA 1YW7A 1D5VA 4IXAA 1BC8C 4XLCA 1VQMI 4AVZA 3K4BA 1IDZA 3DP7A 4UVAA 3BTIA 1Z3XA 1ETKA 2M3AA 4Q4ZF 4U7DA 4IHWA 2TRTA 2LH9A 2R4GA 3FXUA 1QO0D 3MZHA 3HUGA 3FHZA 1Y6IA 3W6JB 3HG9A 3S14J 2DOEA 3LA3A 5B1AH 1LQ1A 1B72A 1FLIA 3GFLA 2D1VA 3J7AY 1MBFA 4DNCA 5BQTA 2XB0X 4PSWA 2DA4A 3HGGA 5D4RA 4AIHA 4KFCA 2HXOA 3IRQA 3FXLA 4S04A 2IP2A 1KQ9A 2VKHA 1USTA 3QP6A 4II3A 1MKMA 2XGCA 3HRMA 5BNGA 2MSYA 2R7QA 4BAYA 1G3TA 4CCJA 4MEXF 1Y0UA 5L3DA 4EEFG 3I54A 3RCOA 3KEOA 2V26A 4Z2YA 3IAS2 3F72A 4IRHA 1FSHA 1B8IB 2QWWA 2K4JA 1T98A 3WE3A 2BGCA 2J5OA 2FXAA 3FF5A 3K1MA 1EA3A 2HPIA 2X1EA 3H36A 3I4NJ 2FEZA 4XL9A 1T6SA 1MNDA 3HXLA 1RNLA 2KDOA 4AC0A 1IDYA 2MLKA 3R0JA 2RNGA 4RA2A 3BCBA 4M9XA 2IS4A 4WX9A 4RMNA 2E1OA 2OV7A 4OWRB 4XM3A 2O61A 5CQEA 3HOWJ 4NQWA 1BW5A 3HEFA 3Q0WA 2EV0A 3I59A 1USSA 2G0EA 3T0YA 1J75A 1Z77A 3HIFA 2EBIA 1UMQA 4XONA 2AO9A 2Q8KA 2WY8Q 1NHAA 2XRNA 3JTHA 4ZYAA 4KJZA 1W5TA 1MGTA 4L5IA 1HF0A 4M3FA 3ZPLA 5HLIA 2FOKA 1X2MA 1F1ZA 2KZVA 5D5UB 5GPCA 1HLVA 4ZYHA 2EILH 2R5ZB 3GTLJ 3W6KB 4AU7A 1GV5A 2W48A 2H6BA 2QLZA 3DV8A 3FK6A 3JRBA 3BR3A 2Z9OA 2Y9YA 2DT6A 3LFKA 3FMRA 5CKTA 1T95A 2MC4A 3FMSA 3M07A 3PUBA 1UHMA 4M71A 1KU9A 5EG0A 2P0WA 2ZCWA 4NNJA 4BQNA 1UG0A 2DMPA 1MBGA 2V7FA 4F7ZA 2MC3A 2P8TA 1XGNA 1ENHA 5F0CA 4CCKA 1R49A 4C2TA 4OU0A 4PGGA 2DMNA 5FKKA 2IXSA 2DAOA 2TCTA 1BIAA 4PK4A 1BC7C 1PUFB 3L7WA 1Z67A 2A6HF 3WTZA 1HC8A 2E2IJ 2XF6A 5B5EC 3I53A 4DGWB 2NNYA 4L0ZB 4IX7A 1PJRA 1BJAA 1T38A 3QU6A 1C0WA 3BTJA 5BPIA 2DTRA 4NBQA 4RAZA 5J40A 1G3WA 2VUMJ 3M8JA 3CO6C 5A2QZ 4G9YA 2BYVE 1I3QJ 2NOGA 3A4CA 1JGGA 5B1BH 1SD6A 2FQ3A 4Y33A 2BZTA 4R79A 3GYHX 1LB2A 1PP7U 1W36D 3CZ6A 5DEQA 4KYWA 1VQOI 1FP2A 4BACA 4ITVA 2CQ7A 3PNTA 4BE2A 3BR5A 2HQRA 4WWCA 4C2UA 1VQ6I 3CESA 2E35A 2DQRA 4BDYA 2CRGA 2EZLA 3C3WA 3GFIA 5K5RA 4MFDA 1XG1A 3W2WA 5J47A 4EJOA 1H88C 1WQ2A 3F22A 1G4DA 1Z05A 2LLKA 2JK3A 1IO2A 2H09A 2MG4A 2EV6A 3M1EA 2XKOA 2VN2A 3CCLI 1ZARA 2HOTA 1RRJA 3S1QJ 3LWFA 2P6SA 1S5LC 2HZDA 4FHTA 2J5PA 4DYQA 1XTAA 2XKPA 3K1NA 4DZPA 2X1DA 2JWTA 2V1UA 3ABMH 4PJMA 4AD9A 2A68F 1KZHA 3WHCA 2L01A 4KN7X 4LK1F 2ISZA 2DT5A 1R9TJ 4FE7A 2M8GX 1KYWA 2F48A 1TQPA 1D0XA 3BR6A 1P2FA 5FKOA 3FWEA 1OYIA 2GXAA 3HRUA 3OSFA 4V2GA 4B3XA 4D0PA 1U3EM 3FXOA 5JVGF 1D1AA 1D8JA 4G6TB 1BW6A 3SQNA 3QQAA 3OWTA 3I55I 3VFZA 1TWFJ 3QOEA 1DGWY 1YS6A 4M73A 1MBEA 4G12A 2XUBA 2CW0F 1WKMA 2L5QA 4BNCA 2WWYA 3VDXA 1X19A 3K4KA 3VYTB 1R1TA 2XF5A 4IKFA 2E36A 1N25A 2V6CA 1ZLKA 2CGPA 4JBAA 4PJNA 2LRDA 1XX5A 4RAYA 1Z6RA 1W7PD 4YEJA 3DLAA 2BVLA 2QQAA 3CO7C 3GO5A 4RAFA 4ZDOA 4MEYF 3LMMA 4B48A 3EQLF 5ILSA 1ORKA 1U2WA 3CCVI 2Y75A 3LSRA 4IL6C 1ETWA 4B3AA 5JVTA 3GX4X 5IP7J 1K7AA 3G1LA 3DPLC
chains in the Genus database with same CATH topology
4BY7J 1B8IA 1ZR2A 2LP0A 3B6AA 1VF9A 4A93J 1BA5A 4C3IJ 3HOVJ 1MBKA 3G1MA 5M5XJ 2QCOA 2DA3A 1X2NA 2CJJA 3BT9A 1AU7A 4BKXA 2I10A 2CUFA 1ZR4A 2R93J 3GTOJ 5DS9A 2LD5A 3CDLA 1NK2P 1HDDC 1XS9A 1QPIA 5HODA 3HDDA 4M3DA 4A3IJ 4FE4A 3OIOA 1F36A 3LNQA 4AUXA 2R7ZJ 3BG3A 3VPRA 4MLOA 3S15J 3OOUA 3Q3SA 4QTRA 1A6IA 3S17J 4JYKA 1ETYA 2LK2A 3C2BA 3TW6A 5F08A 1OFCX 1U9OA 3BTCA 3LOCA 3IH2A 2L7FP 4GFBA 2WV1A 2KT0A 4JP0A 4JX4A 4QSHA 2DMTA 5J1UA 5E3NA 1W0UA 1APLC 1IG7A 4DZJA 4C3HJ 3SFIA 4UUTA 2L0KA 3H3VK 1GDTA 3JRIA 2NS7A 3JRCA 3A02A 3H0GJ 4I6ZA 3MKLA 1GV2A 2XRLA 2R5ZA 3SDGA 1DU6A 1U9NA 4BBRJ 1JJ8C 3S1MJ 2WAQN 3FISA 4A3GJ 4A3CJ 2L7MP 2ZB9A 4JX5A 2RAEA 3CMYA 5FKNA 1ZGWA 3GTPJ 3NAUA 3JRGA 4X6AJ 3RKQA 2IBDA 4B4CA 5EEAA 3S16J 5FLMJ 2K40A 5K7ZA 3S1RJ 2WB1N 1VNDA 5J3LA 1UHSA 2K9SA 3ZQIA 5E3LA 1IGNA 3CCYA 2OPTA 4A3MJ 1DU0A 3LSJA 2IAIA 4DW6A 2LTPA 2Y30A 3BG5A 1PUFA 1FEXA 4FISA 1G2HA 2X9DA 5F1JA 2CU7A 1CQTA 2VI6A 4RBOA 3S2HJ 1WI3A 1Y1VJ 2FQ4A 1LFUP 2X6OA 2M2EA 3IH4A 3PO3J 5F27A 2MW8A 3GTJJ 5DTDA 2ID3A 3HOXJ 1H89C 2R5YB 2OF7A 3CQZJ 3FK7A 3E7LA 1RETA 1I6HJ 4D5CA 1X58A 2EH3A 5FKMA 1XC5A 2DA6A 2YS9A 2ME6A 2M34A 2O9LA 3BR1A 4IHXA 1U78A 1LE8A 1VFCA 2R92J 4MO7A 5C4XJ 2YUSA 1LFBA 1JT0A 2XGEA 4A69C 1SFOJ 5M3MJ 3ZQLA 2M0CA 2O7OA 2O8KA 2DA7A 5K7FA 4Y7NJ 4XRMA 2PMZN 4A3EJ 5JLWA 2L9RA 1FJLA 4A3BJ 4A3JJ 2E2HJ 3D1NI 1QRYA 1MH4A 4XK4A 5GP9A 2LKXA 3JREA 1AKHA 1RR7A 1JT6A 3BTLA 1JKOC 3A01A 3NARA 1A5JA 2XGDA 2H8RA 5GPAA 1JJ6C 2FD5A 2LVSA 2EZKA 4ABZA 2Y2ZA 4IHYA 2P81A 2IEKA 4JX6A 2NS8A 4W1UA 1Y1WJ 4D7NA 2LY9A 3JRHA 2LR8A 3JRDA 1WH5A 4A3LJ 4AYBN 2H1KA 4XICA 3DCFA 2CUEA 2HI3A 5M5YJ 3M4OJ 3HKZN 1ETVA 1EF4A 2Y0SN 1ETOA 5IOYA 4UUSB 3ZQCA 1POGA 1YRNA 1UG2A 1HOMA 1W0TA 1IDZA 9ANTA 4MIMA 1ITYA 2JJ7A 3BTIA 1D5YA 1ETKA 2K9QA 1JKRC 4IHVA 2N8GA 4A3KJ 4IHWA 1MNMC 2TRTA 1JUPA 2DJNA 3IV5A 2M9HA 1TWHJ 4X1EA 3O8GA 3S1NJ 5FKLA 3S14J 2COBA 1B72A 3UKGA 1MSFC 3TEDA 1MBFA 2DMUA 2XB0X 2DA4A 1WH7A 4MFEA 3GTMJ 3HGGA 5IP6A 2HXOA 1MSEC 2GBYA 1S7EA 1NTCA 1ZQ3P 2HYJA 4NDLA 2XGCA 2Y31A 5BNGA 3K7AJ 2MSYA 2DN0A 1T56A 1RPWA 2QF7A 4W97A 5F0FA 4EEFG 2HDDA 2NVQJ 1O4XA 2K9NA 2EZHA 1GT0C 1WGXA 3K2AA 3LSPA 2FJ1A 2JN6A 1FTZA 1FIAA 4A3DJ 4M3GA 5K7HA 1B8IB 3LSGA 3FKIJ 2HOAA 4RDUA 1RKWA 1FIPA 5IYDJ 2VKEA 2CQXA 3OSGA 3JRFA 2B63J 5J1YA 3SJMA 2KDZA 3W6VA 5E3MA 3I4NJ 2FX0A 4FTHA 1ETXA 2ID6A 4AC0A 3GTGJ 1IDYA 1FTTA 1GUUA 5M3FJ 2E2JJ 5C4JJ 1RKTA 5M5WJ 1P7JA 1OJLA 3B6CA 3BQYA 3ZOBA 2E1OA 1IUFA 4M3BA 4D5FA 2JA6J 4D7MA 2D5VA 5E3OA 5EF6A 3Q0VA 3HOWJ 1IRZA 1BW5A 3HEFA 1HDPA 2ECCA 2L7ZA 3FIWA 3Q0WA 5JLXA 5EDNA 2G0EA 3HBLA 1NK3P 1P7IA 1Z77A 2VPRA 2EBIA 3HB9A 1UMQA 3MN2A 2AO9A 3PM1A 1T33A 3HGYA 1HF0A 2DA2A 5IYBJ 4M3FA 1WPKA 4V2FA 1X2MA 5EZGA 1HLVA 5GPCA 2AHQA 1K61A 2R5ZB 3GTLJ 2YU9J 3BR0A 1F43A 1GV5A 1TC3C 2W48A 3FK6A 3JRBA 3BR3A 2Y9YA 3QPSA 3DEWA 1JKPC 4BBSJ 1H8AC 5EG0A 4DYCA 2GM4A 2JMWA 3BR2A 2DMPA 5C3EJ 2DMQA 3RZDJ 1MBGA 1JKQC 4A3FJ 2HXIA 5C44J 2MGQA 2ME0A 4FCYA 1ENHA 5IP9J 5F0CA 3L1PA 2ECBA 1ZK8A 5EGOA 4QIWN 3F0CA 2DMNA 5FKKA 2XPUA 1RESA 2TCTA 5EYRA 3QPLA 5J1RA 1PUFB 3HOUJ 2EQRA 4CYCA 1OCPA 2E2IJ 4IEJA 4J19A 2JA7J 3HOZJ 3ZQHA 3BTJA 4XIDA 2EZIA 1IJWC 5EZHA 2VUMJ 1JUMA 4M3EA 1I3QJ 2NOGA 2ELKA 4L5EA 3A03A 4HNVA 1JTXA 4XRSG 2R0QC 2R5YA 1JGGA 3RQIA 1BJZA 1MBHA 1WCMJ 3MVPA 2HOSA 5F0HA 1LE8B 4M6VA 1SANA 5FLVA 4BXXJ 3G1OA 3BR5A 3TP0A 1GVDA 1ETQA 3GTQJ 5FJ8J 2CRGA 1ZTRA 1TWAJ 2EZLA 2XSDC 3JRAA 4BY1J 4MFDA 1XG1A 4I76A 2NVTJ 2XPVA 1H88C 2XB5A 3WHBA 3JR9A 4S0HB 1AKHB 4LOCA 3BG9A 3IH3A 2LLKA 2JK3A 4XRSA 3A01B 3I4MJ 2MG4A 5EG0B 3TW7A 2DA1A 2HOTA 3PO2J 3S1QJ 1BL0A 4DYQA 3GTKJ 2HQ5A 1U8BA 3HM5A 4DZPA 2JWTA 3WHCA 1QVUA 3ZQFA 3Q0UA 1TWCJ 5EGOB 1MBJA 1VI0A 1R9TJ 4FE7A 2M8GX 2X48A 1JUSA 3HOYJ 1QVTA 3BR6A 4CYCB 5FKOA 2Y9ZA 1MH3A 1TWGJ 3OSFA 4V2GA 4Y52J 3TP3A 1YRNB 2E19A 3GBGA 4UUSA 1IV6A 1Q1VA 3M3YJ 4C2MJ 2JA8J 1BW6A 3QQAA 2JA5J 1TWFJ 4C3JJ 1MBEA 2GLOA 4G12A 5F04A 2NVYJ 2DTZA 1B72B 1K83J 3BQZA 1AHDP 1JTYA 1ZKGA 5IYCJ 3O8HA 5IPAA 2XPWA 5IOZA 4DYRA 2DA5A 3ZQGA 1HCRA 3S2DJ 2CQQA 1Z0XA 2LFBA 4B1RA 1ORKA 1E3OC 1OCTC 3LSRA 1IC8A 2NVXJ 1ETWA 4B3AA 3RZOJ 1I50J 5IP7J 3G1LA 2VKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 J;  1B8I A;  1ZR2 A;  2LP0 A;  3B6A A;  1VF9 A;  4A93 J;  1BA5 A;  4C3I J;  3HOV J;  1MBK A;  3G1M A;  5M5X J;  2QCO A;  2DA3 A;  1X2N A;  2CJJ A;  3BT9 A;  1AU7 A;  4BKX A;  2I10 A;  2CUF A;  1ZR4 A;  2R93 J;  3GTO J;  5DS9 A;  2LD5 A;  3CDL A;  1NK2 P;  1HDD C;  1XS9 A;  1QPI A;  5HOD A;  3HDD A;  4M3D A;  4A3I J;  4FE4 A;  3OIO A;  1F36 A;  3LNQ A;  4AUX A;  2R7Z J;  3BG3 A;  3VPR A;  4MLO A;  3S15 J;  3OOU A;  3Q3S A;  4QTR A;  1A6I A;  3S17 J;  4JYK A;  1ETY A;  2LK2 A;  3C2B A;  3TW6 A;  5F08 A;  1OFC X;  1U9O A;  3BTC A;  3LOC A;  3IH2 A;  2L7F P;  4GFB A;  2WV1 A;  2KT0 A;  4JP0 A;  4JX4 A;  4QSH A;  2DMT A;  5J1U A;  5E3N A;  1W0U A;  1APL C;  1IG7 A;  4DZJ A;  4C3H J;  3SFI A;  4UUT A;  2L0K A;  3H3V K;  1GDT A;  3JRI A;  2NS7 A;  3JRC A;  3A02 A;  3H0G J;  4I6Z A;  3MKL A;  1GV2 A;  2XRL A;  2R5Z A;  3SDG A;  1DU6 A;  1U9N A;  4BBR J;  1JJ8 C;  3S1M J;  2WAQ N;  3FIS A;  4A3G J;  4A3C J;  2L7M P;  2ZB9 A;  4JX5 A;  2RAE A;  3CMY A;  5FKN A;  1ZGW A;  3GTP J;  3NAU A;  3JRG A;  4X6A J;  3RKQ A;  2IBD A;  4B4C A;  5EEA A;  3S16 J;  5FLM J;  2K40 A;  5K7Z A;  3S1R J;  2WB1 N;  1VND A;  5J3L A;  1UHS A;  2K9S A;  3ZQI A;  5E3L A;  1IGN A;  3CCY A;  2OPT A;  4A3M J;  1DU0 A;  3LSJ A;  2IAI A;  4DW6 A;  2LTP A;  2Y30 A;  3BG5 A;  1PUF A;  1FEX A;  4FIS A;  1G2H A;  2X9D A;  5F1J A;  2CU7 A;  1CQT A;  2VI6 A;  4RBO A;  3S2H J;  1WI3 A;  1Y1V J;  2FQ4 A;  1LFU P;  2X6O A;  2M2E A;  3IH4 A;  3PO3 J;  5F27 A;  2MW8 A;  3GTJ J;  5DTD A;  2ID3 A;  3HOX J;  1H89 C;  2R5Y B;  2OF7 A;  3CQZ J;  3FK7 A;  3E7L A;  1RET A;  1I6H J;  4D5C A;  1X58 A;  2EH3 A;  5FKM A;  1XC5 A;  2DA6 A;  2YS9 A;  2ME6 A;  2M34 A;  2O9L A;  3BR1 A;  4IHX A;  1U78 A;  1LE8 A;  1VFC A;  2R92 J;  4MO7 A;  5C4X J;  2YUS A;  1LFB A;  1JT0 A;  2XGE A;  4A69 C;  1SFO J;  5M3M J;  3ZQL A;  2M0C A;  2O7O A;  2O8K A;  2DA7 A;  5K7F A;  4Y7N J;  4XRM A;  2PMZ N;  4A3E J;  5JLW A;  2L9R A;  1FJL A;  4A3B J;  4A3J J;  2E2H J;  3D1N I;  1QRY A;  1MH4 A;  4XK4 A;  5GP9 A;  2LKX A;  3JRE A;  1AKH A;  1RR7 A;  1JT6 A;  3BTL A;  1JKO C;  3A01 A;  3NAR A;  1A5J A;  2XGD A;  2H8R A;  5GPA A;  1JJ6 C;  2FD5 A;  2LVS A;  2EZK A;  4ABZ A;  2Y2Z A;  4IHY A;  2P81 A;  2IEK A;  4JX6 A;  2NS8 A;  4W1U A;  1Y1W J;  4D7N A;  2LY9 A;  3JRH A;  2LR8 A;  3JRD A;  1WH5 A;  4A3L J;  4AYB N;  2H1K A;  4XIC A;  3DCF A;  2CUE A;  2HI3 A;  5M5Y J;  3M4O J;  3HKZ N;  1ETV A;  1EF4 A;  2Y0S N;  1ETO A;  5IOY A;  4UUS B;  3ZQC A;  1POG A;  1YRN A;  1UG2 A;  1HOM A;  1W0T A;  1IDZ A;  9ANT A;  4MIM A;  1ITY A;  2JJ7 A;  3BTI A;  1D5Y A;  1ETK A;  2K9Q A;  1JKR C;  4IHV A;  2N8G A;  4A3K J;  4IHW A;  1MNM C;  2TRT A;  1JUP A;  2DJN A;  3IV5 A;  2M9H A;  1TWH J;  4X1E A;  3O8G A;  3S1N J;  5FKL A;  3S14 J;  2COB A;  1B72 A;  3UKG A;  1MSF C;  3TED A;  1MBF A;  2DMU A;  2XB0 X;  2DA4 A;  1WH7 A;  4MFE A;  3GTM J;  3HGG A;  5IP6 A;  2HXO A;  1MSE C;  2GBY A;  1S7E A;  1NTC A;  1ZQ3 P;  2HYJ A;  4NDL A;  2XGC A;  2Y31 A;  5BNG A;  3K7A J;  2MSY A;  2DN0 A;  1T56 A;  1RPW A;  2QF7 A;  4W97 A;  5F0F A;  4EEF G;  2HDD A;  2NVQ J;  1O4X A;  2K9N A;  2EZH A;  1GT0 C;  1WGX A;  3K2A A;  3LSP A;  2FJ1 A;  2JN6 A;  1FTZ A;  1FIA A;  4A3D J;  4M3G A;  5K7H A;  1B8I B;  3LSG A;  3FKI J;  2HOA A;  4RDU A;  1RKW A;  1FIP A;  5IYD J;  2VKE A;  2CQX A;  3OSG A;  3JRF A;  2B63 J;  5J1Y A;  3SJM A;  2KDZ A;  3W6V A;  5E3M A;  3I4N J;  2FX0 A;  4FTH A;  1ETX A;  2ID6 A;  4AC0 A;  3GTG J;  1IDY A;  1FTT A;  1GUU A;  5M3F J;  2E2J J;  5C4J J;  1RKT A;  5M5W J;  1P7J A;  1OJL A;  3B6C A;  3BQY A;  3ZOB A;  2E1O A;  1IUF A;  4M3B A;  4D5F A;  2JA6 J;  4D7M A;  2D5V A;  5E3O A;  5EF6 A;  3Q0V A;  3HOW J;  1IRZ A;  1BW5 A;  3HEF A;  1HDP A;  2ECC A;  2L7Z A;  3FIW A;  3Q0W A;  5JLX A;  5EDN A;  2G0E A;  3HBL A;  1NK3 P;  1P7I A;  1Z77 A;  2VPR A;  2EBI A;  3HB9 A;  1UMQ A;  3MN2 A;  2AO9 A;  3PM1 A;  1T33 A;  3HGY A;  1HF0 A;  2DA2 A;  5IYB J;  4M3F A;  1WPK A;  4V2F A;  1X2M A;  5EZG A;  1HLV A;  5GPC A;  2AHQ A;  1K61 A;  2R5Z B;  3GTL J;  2YU9 J;  3BR0 A;  1F43 A;  1GV5 A;  1TC3 C;  2W48 A;  3FK6 A;  3JRB A;  3BR3 A;  2Y9Y A;  3QPS A;  3DEW A;  1JKP C;  4BBS J;  1H8A C;  5EG0 A;  4DYC A;  2GM4 A;  2JMW A;  3BR2 A;  2DMP A;  5C3E J;  2DMQ A;  3RZD J;  1MBG A;  1JKQ C;  4A3F J;  2HXI A;  5C44 J;  2MGQ A;  2ME0 A;  4FCY A;  1ENH A;  5IP9 J;  5F0C A;  3L1P A;  2ECB A;  1ZK8 A;  5EGO A;  4QIW N;  3F0C A;  2DMN A;  5FKK A;  2XPU A;  1RES A;  2TCT A;  5EYR A;  3QPL A;  5J1R A;  1PUF B;  3HOU J;  2EQR A;  4CYC A;  1OCP A;  2E2I J;  4IEJ A;  4J19 A;  2JA7 J;  3HOZ J;  3ZQH A;  3BTJ A;  4XID A;  2EZI A;  1IJW C;  5EZH A;  2VUM J;  1JUM A;  4M3E A;  1I3Q J;  2NOG A;  2ELK A;  4L5E A;  3A03 A;  4HNV A;  1JTX A;  4XRS G;  2R0Q C;  2R5Y A;  1JGG A;  3RQI A;  1BJZ A;  1MBH A;  1WCM J;  3MVP A;  2HOS A;  5F0H A;  1LE8 B;  4M6V A;  1SAN A;  5FLV A;  4BXX J;  3G1O A;  3BR5 A;  3TP0 A;  1GVD A;  1ETQ A;  3GTQ J;  5FJ8 J;  2CRG A;  1ZTR A;  1TWA J;  2EZL A;  2XSD C;  3JRA A;  4BY1 J;  4MFD A;  1XG1 A;  4I76 A;  2NVT J;  2XPV A;  1H88 C;  2XB5 A;  3WHB A;  3JR9 A;  4S0H B;  1AKH B;  4LOC A;  3BG9 A;  3IH3 A;  2LLK A;  2JK3 A;  4XRS A;  3A01 B;  3I4M J;  2MG4 A;  5EG0 B;  3TW7 A;  2DA1 A;  2HOT A;  3PO2 J;  3S1Q J;  1BL0 A;  4DYQ A;  3GTK J;  2HQ5 A;  1U8B A;  3HM5 A;  4DZP A;  2JWT A;  3WHC A;  1QVU A;  3ZQF A;  3Q0U A;  1TWC J;  5EGO B;  1MBJ A;  1VI0 A;  1R9T J;  4FE7 A;  2M8G X;  2X48 A;  1JUS A;  3HOY J;  1QVT A;  3BR6 A;  4CYC B;  5FKO A;  2Y9Z A;  1MH3 A;  1TWG J;  3OSF A;  4V2G A;  4Y52 J;  3TP3 A;  1YRN B;  2E19 A;  3GBG A;  4UUS A;  1IV6 A;  1Q1V A;  3M3Y J;  4C2M J;  2JA8 J;  1BW6 A;  3QQA A;  2JA5 J;  1TWF J;  4C3J J;  1MBE A;  2GLO A;  4G12 A;  5F04 A;  2NVY J;  2DTZ A;  1B72 B;  1K83 J;  3BQZ A;  1AHD P;  1JTY A;  1ZKG A;  5IYC J;  3O8H A;  5IPA A;  2XPW A;  5IOZ A;  4DYR A;  2DA5 A;  3ZQG A;  1HCR A;  3S2D J;  2CQQ A;  1Z0X A;  2LFB A;  4B1R A;  1ORK A;  1E3O C;  1OCT C;  3LSR A;  1IC8 A;  2NVX J;  1ETW A;  4B3A A;  3RZO J;  1I50 J;  5IP7 J;  3G1L A;  2VKV A; 
#chains in the Genus database with same CATH topology
 4G7Z F;  3L2U A;  1B8I A;  1SVO A;  1G3S A;  3CDH A;  5CVJ A;  2A07 F;  1E0E A;  1PUE E;  2FE3 A;  5DYM A;  5M5X J;  1I1G A;  1YIJ I;  1N78 A;  4E7H A;  2DA3 A;  4C30 A;  2EPF A;  2CJJ A;  2YR2 A;  3BT9 A;  3IL2 A;  2I10 A;  4LLL A;  2QA4 I;  1RIO H;  4EMS A;  1IN5 A;  2R93 J;  4ENN A;  2ZJQ F;  3Q9V A;  1BOB A;  3UNG C;  3HDD A;  2V9V A;  2DYS H;  4AUX A;  4ZZL A;  3DBR B;  3VPR A;  3WTY C;  1T39 A;  4EGZ A;  3SEZ A;  5ICF A;  1WJE A;  2JRM A;  3CME I;  3CLQ A;  3IKV A;  4BL0 B;  2KJB A;  2NAZ A;  3HSE A;  3S17 J;  4KT5 C;  1K4T A;  2CO5 A;  4AYB A;  3C2B A;  3TW6 A;  1QZY A;  3L9F A;  2K4B A;  2X6X A;  3K4L A;  3BJ6 A;  3MKZ A;  1WZ2 A;  4QSH A;  1W0U A;  4AWX B;  5AIP A;  1IG7 A;  1V5G A;  2L0K A;  2XAH A;  4ON0 A;  2E1M B;  4MNU A;  3JRC A;  4I6Z A;  1GV2 A;  2R5Z A;  5D6E A;  1U9N A;  2EB7 A;  2RKH A;  2WAQ N;  3FIS A;  3CD6 I;  1X1C A;  4A3G J;  1OCO H;  2VIX A;  2VQC A;  4PCQ A;  3R4K A;  1GXP A;  2RAE A;  2ZSH B;  5IT9 K;  1K4S A;  4FQG A;  1FBS A;  4E7S A;  5FLM J;  2V1X A;  3S1R J;  1KYZ A;  5K7Z A;  4EAT A;  3OR1 C;  1B59 A;  3LSH A;  2IJL A;  3RKX A;  2VOP A;  2QQ8 A;  3ZQI A;  3JSP A;  4U0V A;  1IGN A;  1UFM A;  1OMI A;  2AXT C;  4ASN A;  5BS6 A;  2DDA A;  2IAI A;  3ZMD A;  5D4S A;  4U0W A;  4BHB A;  3V4G A;  2Y30 A;  4DW6 A;  2IW5 A;  4O5V A;  1DUX C;  3BG5 A;  1PUF A;  2K02 A;  2QM3 A;  3D5S C;  2ZME C;  1PDN C;  1OPC A;  3X2Q H;  3J7Z I;  5F1J A;  4EJV A;  5J8F A;  3P9K A;  2KKO A;  4RLF A;  2MYS A;  2W84 A;  3RQ4 A;  4RBO A;  4EVI A;  3BP8 A;  3FXR A;  1Y1V J;  2FQ4 A;  2M7A A;  2DFH A;  3DQV C;  2LG4 A;  5H6R A;  2MW8 A;  4A5N A;  3GTJ J;  1H89 C;  1KON A;  2R5Y B;  2PN6 A;  3CQZ J;  2W4S A;  3FK7 A;  4FX4 A;  4OMZ A;  2EFO A;  1GVJ A;  3WU0 A;  1IXR C;  5L3F A;  3DKX A;  4PGH A;  4XN0 A;  3FXK A;  3DBL B;  3L2V A;  2E5N A;  1J59 A;  2JA2 A;  3WG7 H;  1QNT A;  1IAW A;  1CGP A;  3ML6 A;  4B47 A;  1LFB A;  1YI2 I;  5M3M J;  3ZQL A;  5F64 A;  3M9A A;  3PUF A;  3ZP5 A;  1BR1 A;  4HF1 A;  3S3M A;  4XRM A;  3FKJ A;  5JLW A;  4A3B J;  5KHD A;  3MZY A;  4A3J J;  1A04 A;  3OYI A;  1MH4 A;  1LEB A;  3P5J A;  2RC4 A;  3MD2 A;  4A6E A;  3BPV A;  1RR7 A;  1XD7 A;  1ZN2 A;  3F8B A;  4MTD A;  1JKO C;  3FXQ A;  2RRE A;  1R6R A;  2QUF A;  3HHG A;  3GFJ A;  4BHP A;  4KIS A;  2ISY A;  5CYV A;  3JTG A;  4KN4 X;  1JE8 A;  2X1C A;  2Y2Z A;  4IHY A;  2L4A A;  2IEK A;  3P9I A;  4D7N A;  2W57 A;  5JR3 A;  5KCM A;  4XKC A;  4E70 A;  3JRD A;  2HOE A;  3KYC B;  4A3L J;  2H1K A;  2K9L A;  1ZRE A;  2RQP A;  2HI3 A;  2HKO A;  2ZXH A;  3J80 Z;  1BI2 A;  3KE2 A;  3ZMZ A;  2IA1 A;  2LRE A;  3ABL H;  1HKT A;  4RS8 A;  1UG2 A;  5BOX A;  1MDM B;  2E1C A;  2L9S A;  4MIM A;  4NC7 A;  4XLA A;  2W85 A;  1WJB A;  3OYN A;  1ACI A;  1D1B A;  2FOW A;  5LGU A;  2QKL B;  1JHF A;  2VE8 A;  3K4N A;  2KIM A;  4HLX A;  4IHV A;  2N8G A;  3JW4 A;  1MNM C;  2DJN A;  2M9H A;  1TWH J;  4B43 A;  3OIP A;  3CCM I;  4HPQ A;  2VKD A;  1DP7 P;  3EUA A;  3UKG A;  1R1U A;  2K5C A;  5IP6 A;  1TLH B;  1YIT I;  1MSE C;  2ZJR F;  1ON1 A;  1NTC A;  2JT1 A;  2FMY A;  3RI4 A;  2HYJ A;  4NDL A;  2DI3 A;  1GLN A;  3E0J B;  2JTV A;  3ABU A;  2HEO A;  1IF1 A;  2A61 A;  1T56 A;  1IN4 A;  1QU3 A;  1RUO A;  5F0F A;  1D0Y A;  2EFN A;  1O4X A;  2EZH A;  1GT0 C;  3K2A A;  3BLY A;  2FJ1 A;  2OUM A;  1Y39 A;  1F4K A;  3GCM A;  4A3D J;  4M3G A;  3LSG A;  2HOA A;  3IUO A;  1FIP A;  2UV1 A;  3MFK A;  3OSG A;  2X85 A;  4R1H A;  5J1Y A;  2LF7 A;  4ETS A;  1FZP B;  2HYG D;  2IGK A;  3I0T A;  1KU7 A;  3KZY A;  3COA C;  2XAS A;  4CCL A;  2FX0 A;  1ETX A;  1OR7 A;  3K70 C;  5HNF A;  3RYR A;  3GTG J;  1LDD A;  3CJT B;  3TKY A;  2KL4 A;  2CV2 A;  4ZTF A;  5LEK A;  5C4J J;  2VC1 A;  2ZSI B;  1OJL A;  2RV8 A;  1ZHF A;  4Y3O A;  4M3B A;  3EYI A;  3QAH A;  4WCG A;  3HPG A;  4D7M A;  5E3O A;  3E5X A;  3FXJ A;  3K69 A;  3AKZ A;  4L9J A;  2ELH A;  3O6B B;  1JXS A;  2L7Z A;  1MMN A;  3FIW A;  1EH7 A;  1OYY A;  4PUS A;  1YX5 A;  4ZH4 F;  5BPD A;  2HDW A;  3HBL A;  2JUG A;  1NK3 P;  2OQG A;  2H8W A;  3W2V A;  1DQU A;  2D1H A;  5DM7 F;  2IGM A;  3MN2 A;  2E34 A;  4G6Q A;  2JPB A;  2YX4 A;  4KIG A;  3PM1 A;  2JRT A;  1WJF A;  5DCM A;  4N9H A;  2EFW A;  3C1D A;  1O3S A;  1S7O A;  2QGU A;  4V2F A;  5EZG A;  2FF4 A;  1F43 A;  5FRN A;  1HW1 A;  3IRR A;  1TC3 C;  1J9I A;  4X0G A;  2RVC A;  1BOA A;  5FB2 A;  4U7B A;  1YFH A;  3DEW A;  4CH7 A;  2F5D A;  3C2H A;  3OYM A;  3J7Y J;  1H8A C;  4OAY A;  5AIQ A;  2GM4 A;  5LHG A;  1W4M A;  1S6L A;  2QSF X;  3RZD J;  1OR7 C;  1BIB A;  1Z3Y A;  2CW8 A;  5ERI A;  1R4N B;  4BS9 A;  5E1W A;  3L1P A;  2ETH A;  5EGO A;  2QQ9 A;  4QIW N;  1FYL A;  2PJR A;  2XPU A;  1RES A;  5FRO A;  2RNJ A;  3H5N A;  4P5O A;  4XLN F;  4EJW A;  5J1R A;  3HOU J;  2EQR A;  4LLN A;  4F93 B;  1OCP A;  1W1W E;  4I09 A;  4IEJ A;  3CMM A;  4OIO F;  3HOZ J;  5HOO A;  3OYD A;  4IOC F;  4CHU A;  3BJO A;  1MMA A;  4HEA 2;  3G6E I;  3DLL F;  1YQA A;  2VBY A;  3SFZ A;  5ICE A;  1O3T A;  5EZH A;  3SZP A;  1KGS A;  5KK1 A;  1TNT A;  1FYM A;  4ZTJ A;  1IZ1 A;  1K6Y A;  2ELK A;  3A03 A;  4L5E A;  3VYS B;  3MEX A;  1JTX A;  2R5Y A;  2E1M C;  3RKW A;  3J81 Z;  3RSN A;  1BJZ A;  2EIM H;  3ZN1 A;  3O2P E;  3MVP A;  2F4O B;  4HDV A;  2STW A;  2LNB A;  5F0H A;  1LE8 B;  4PJL A;  1Z9C A;  1SAU A;  2EFP A;  5FLV A;  4PZJ A;  1CF7 A;  1Z91 A;  5D5V B;  1HKQ A;  3BRO A;  4IZZ A;  1XCV A;  1KQ8 A;  2F2E A;  5HLT A;  3K0L A;  2XSD C;  3JRA A;  1LDK B;  2XAF A;  1MIJ A;  4YEL A;  4MTE A;  4KIC A;  2E71 A;  2XPV A;  5DUK A;  3OYF A;  1QGP A;  1Z1D A;  2XB5 A;  1IRX A;  2O3F A;  3WHB A;  4BJT A;  1TNS A;  2IA0 A;  4LOC A;  1SD7 A;  1K78 B;  4XRS A;  2F5C A;  4B44 A;  3A01 B;  4ZZD A;  4A6D A;  4EJU A;  1BM9 A;  2K3F A;  4NB5 A;  3PFY A;  1VZ0 A;  3GTK J;  3BPX A;  2HQ5 A;  3GZ5 A;  3KP5 A;  3HM5 A;  3R6S A;  4RB2 C;  4BJ5 C;  2R7U A;  2H1L A;  2B0L A;  4XKV A;  2DFI A;  5CLS A;  2Z99 A;  3C2G A;  1FBQ A;  1V3F A;  3EPZ A;  1A35 A;  3AFH A;  4II2 A;  1ZG5 A;  5A2Q K;  3SHF A;  3CCQ I;  1FOW A;  1LPQ A;  1QVT A;  3H9J A;  4CYC B;  1BN5 A;  1MH3 A;  3LA7 A;  2X6Y A;  2QEX I;  5CJ9 A;  3G71 I;  5ILV A;  5TJJ A;  1IV6 A;  1Z7L A;  1Q1V A;  2NS0 A;  2CQN A;  2XIG A;  2JA8 J;  4OIQ F;  1R5I D;  1MDM A;  3H5R A;  2VT3 A;  5LRS A;  3OL4 A;  6PAX A;  2JA5 J;  4HNU A;  4GXO A;  4ZYE A;  1LVK A;  3OV8 A;  2R7W A;  2DK8 A;  4F52 A;  5D6F A;  3K6G A;  1JI8 A;  5F04 A;  2XAG A;  1U8R A;  1K6O A;  2NRA C;  2NVY J;  3E5Q A;  4OOI A;  2VOD A;  5CVR A;  5FLX Z;  4D1Q A;  1MMD A;  1FC3 A;  4Q48 A;  1VQN I;  5L3C A;  2HYF A;  1K83 J;  3BQZ A;  1TW3 A;  3LFU A;  1RR8 C;  1JTY A;  1ZKG A;  3CP8 A;  2K7L A;  4CSW A;  3O8H A;  5IYC J;  4E7K A;  1DP3 A;  2XPW A;  4N0B A;  3ASN H;  4XBF A;  4AVP A;  5IOZ A;  3R0A A;  4ANJ A;  4DYR A;  4CDG A;  4F92 B;  4BE0 A;  4B1R A;  4P55 A;  4HNT A;  1TZL A;  2OZ6 A;  1B6A A;  1R58 A;  3JCU C;  1XMA A;  2M4G A;  2VKV A;  1ZRD A;  2EIK H;  1ZR2 A;  2HPM A;  2BXZ A;  1VF9 A;  4A93 J;  2BBY A;  2BEO A;  1YE9 A;  2PEX A;  4QPQ A;  3TGN A;  4IQ4 A;  2OQR A;  2MFZ A;  2QYO A;  2CUF A;  3QOP A;  1ZR4 A;  5DS9 A;  2WTE A;  1HDD C;  2KQR A;  2WV0 A;  1XS9 A;  1QPI A;  3A2K A;  4M3D A;  1TW2 A;  1F36 A;  3F6O A;  3NRV A;  2DFE A;  1VQ5 I;  3MKW B;  1U5T B;  4L9T A;  1OKR A;  3TDU C;  3DKY A;  4JYK A;  1ODD A;  1ETY A;  2Y48 A;  1MW7 A;  3ECO A;  4QPO A;  5CVV A;  4E7L A;  2WV1 A;  4GFB A;  2KT0 A;  2L2O A;  3EUH A;  3LA2 A;  5E3N A;  2DMT A;  1APL C;  2Z5U A;  1LKX A;  4C3H J;  4DZJ A;  3SFI A;  4XKW A;  1STZ A;  4BEH B;  3LAJ A;  3CCR I;  1GDT A;  1X1B A;  4M6Y A;  2BW3 B;  3MKL A;  4CIC A;  1A6Q A;  1BR4 A;  2XRL A;  5IY5 H;  3UR3 C;  3RTR A;  4BE1 A;  2V4J C;  4EJT A;  1MMG A;  1FMV A;  4XOR A;  2DO7 A;  3RDI A;  3IWF A;  4E4H A;  3GTP J;  4X6A J;  2VBX A;  3REO A;  1N77 A;  3RKQ A;  3QWL A;  2DU9 A;  3S16 J;  1OIS A;  2VJ5 A;  2KIQ A;  2V9K A;  5J3L A;  1UHS A;  3I56 I;  4A3M J;  5LD2 C;  1DU0 A;  3LSJ A;  2KMU A;  3U1K A;  4E7Z A;  1WSU A;  3BJA A;  4F3Q A;  1E3H A;  2O5R A;  2HVQ A;  2A3S A;  3IAM 2;  3VB2 A;  1VQ8 I;  1G2H A;  2X9D A;  2L7K A;  2FBH A;  2OZU A;  2A6E F;  2JVH A;  3HTS B;  1YW9 A;  1CQT A;  1TQM A;  2VXD A;  2VI6 A;  1FOY A;  5FGM A;  3ZMU A;  3S3O A;  4HG2 A;  4QWQ A;  4CA0 A;  3EUH C;  3CF2 A;  1WJA A;  3TMO A;  2RN7 A;  2VAS A;  3ISP A;  3PO3 J;  3SYT A;  5DTD A;  1SC7 A;  4H4K C;  5E1X A;  1RET A;  1I6H J;  4CCM A;  2EH3 A;  2QSG X;  5FKM A;  2DA6 A;  2YS9 A;  2M34 A;  1Z7U A;  2O9L A;  4IHX A;  1LE8 A;  2LY1 A;  3CC4 I;  3B02 A;  1MJB A;  1WJC A;  4MGR A;  2YUS A;  4MO7 A;  4P96 A;  1HSJ A;  5LRR A;  2D45 A;  3H92 A;  1SFO J;  4UB8 C;  4PFO A;  3IKT A;  2R7S A;  2M0C A;  5BMZ A;  2QKM B;  5L3B A;  3VWB A;  2DA7 A;  2CQK A;  3ABK H;  3OY9 A;  2H27 A;  3H3U A;  2PI0 A;  1HXD A;  4Y7N J;  2FUG 2;  3H9G A;  4IVN A;  4A3E J;  2W82 A;  2L9R A;  3CJQ B;  1LFP A;  2B7E A;  4G7H F;  2LKX A;  3JRE A;  3NQO A;  2FNP A;  3BTL A;  1JT6 A;  2CFO A;  2ZO4 A;  2MD0 A;  3O3K A;  4FX0 A;  4L9N A;  3A01 A;  2H8R A;  2M8E A;  5GPA A;  4ENK A;  5CVI A;  5D8L B;  1YYV A;  1VQ7 I;  4PDK A;  3S3N A;  2EIJ H;  1OCC H;  2WAE A;  2P81 A;  4W1U A;  4JX6 A;  4B8X A;  1Y1W J;  3OYG A;  3D5L A;  5H20 A;  2Q0O A;  3KX2 A;  4OIN F;  2LR8 A;  1WH5 A;  4CXF A;  2HS5 A;  1R5H A;  2K85 A;  4XIC A;  3LQQ A;  3DCF A;  3TL4 X;  4LFU A;  2CUE A;  2CUJ A;  4L9V A;  3W3C A;  5M5Y J;  4Q5S F;  4LIT A;  3V8J A;  1EF4 A;  2Y0S N;  1ETO A;  3GZN B;  4UUS B;  3H1C A;  2KIU A;  5JI6 A;  1POG A;  1AWC A;  1RC9 A;  1X1A A;  3ASO H;  4A5M A;  3BZC A;  2CV1 A;  2EV5 A;  2OAZ A;  3CCE I;  1O7F A;  4HBL A;  1FY7 A;  5GTH C;  1D5Y A;  2WC2 A;  4RB0 A;  3K70 D;  2K9Q A;  5J4V A;  4A3K J;  5E17 F;  3MQ0 A;  3IV5 A;  1S72 I;  4BGD A;  3E3V A;  4Y17 A;  4RAG A;  3S1N J;  1I6X A;  2RDP A;  5FKL A;  2DOA A;  2HTJ A;  2LYC A;  3FBN B;  1MSF C;  3A0H C;  2DMU A;  1Z21 A;  3DPT A;  3MCZ A;  1WH7 A;  2KJC A;  3KP2 A;  2QBY B;  4KUM A;  3OR2 C;  1S7E A;  2EA2 A;  2ELJ A;  1O3Q A;  2Y31 A;  4IHS A;  3K7A J;  3KEQ A;  4E6K G;  2DN0 A;  1IRF A;  1X3U A;  1RPW A;  4ZDP A;  1QHH D;  3VEP A;  4J01 A;  2HDD A;  2NVQ J;  3ZMS A;  4CCO A;  3U1D A;  2AS5 F;  2O6G E;  1YHQ I;  1LVA A;  1FTZ A;  4BH9 A;  1FIA A;  2FA5 A;  1I39 A;  2K27 A;  2R3S A;  5K7H A;  1L3L A;  2IT0 A;  2HTS A;  4BHC A;  5IYD J;  3OIQ A;  3ZXS A;  4N4N B;  3OYC A;  2VKE A;  3J80 K;  4V19 K;  3JAM Z;  3KLO A;  2CG4 A;  2B63 J;  4GCV A;  2HNH A;  3U21 A;  5CVU A;  1P4A A;  3W6V A;  5E3M A;  4DBQ A;  1EH6 A;  3WE2 A;  2VLA A;  5H2F C;  3GZ6 A;  4HZF A;  2P4W A;  4FTH A;  2WAD A;  2IRF G;  2ID6 A;  2R7F A;  3H3Z A;  1FTT A;  3PQJ A;  5D5W B;  4A0Z A;  5M3F J;  4I99 C;  1RKT A;  5IT3 A;  3BQY A;  3B6C A;  5D8K B;  2L4M A;  3OS2 A;  3ZOB A;  4YIF A;  4ENM A;  1YJN I;  1IUF A;  4UHT A;  2FBK A;  1Y56 A;  3IP4 B;  3TQN A;  3CCS I;  2FML A;  1T0F A;  2ZJ2 A;  2L02 A;  3Q0V A;  1E2X A;  3VSK A;  3GLL A;  1IRZ A;  1HDP A;  2ECC A;  5JLX A;  3L2W A;  1J7K A;  3DEE A;  3D5R C;  1WFX A;  1R00 A;  3RPQ A;  2KRF A;  1P7I A;  3PQK A;  5HDK A;  3HB9 A;  4BQA A;  2EJR A;  2UUZ A;  1T33 A;  3HGY A;  3TBI A;  1ZGJ A;  2HZT A;  5GAH J;  3TOA A;  1ZRC A;  2MA3 A;  1WPK A;  3HUG B;  5JHU A;  2DT7 B;  1K61 A;  1P6R A;  4U88 A;  4IRG A;  3BR0 A;  2BW3 A;  2YU9 J;  4FT8 A;  4DOZ A;  3L09 A;  4PSX A;  4CUG A;  2STT A;  4JOM A;  1P4X A;  5J4Y A;  3BZK A;  3PSF A;  3AAF A;  1WVR A;  2IA2 A;  3RJP A;  2HQA A;  5GAD J;  4D9J A;  4DYC A;  4UVB A;  1DPR A;  4XQF A;  3ZR8 X;  2EWN A;  3BG7 A;  2P5V A;  1LEA A;  2H6C A;  2DMQ A;  3GVA A;  4Z6Y A;  1ULY A;  3KP6 A;  1JKQ C;  4A3F J;  4J00 A;  2HXI A;  4KIT B;  5HS8 A;  5KVR A;  1QPM A;  2ZXW H;  4G8X A;  5E79 C;  4I01 A;  2HVS A;  1J5Y A;  1GHC A;  2ECB A;  4MQ9 F;  3F0C A;  4LMY A;  4Y13 A;  2H94 A;  3FHN A;  3MZ8 A;  3K2Z A;  3NEU A;  3P9C A;  4HQM A;  3CP2 A;  5EYR A;  3QPL A;  3DPU A;  1T0F C;  4HX7 A;  4LD5 A;  3DXJ F;  1A31 A;  1IN7 A;  1LUJ B;  2VBW A;  4J19 A;  2JA7 J;  3R60 A;  1V5E A;  2CFX A;  2GAU A;  2VJJ A;  2PX9 A;  4H0E A;  1HST A;  3QP5 A;  5KNL A;  2EFQ A;  4WXH A;  2EZI A;  1U0J A;  2BV6 A;  1OLT A;  4A0Y A;  4IPA A;  1JUM A;  4M3E A;  1XSD A;  4YRV A;  5HDG A;  3WTW C;  1BR2 A;  3A0B C;  3PSI A;  3PJR A;  3E6C C;  3CCU I;  3WTV C;  3RQI A;  1WWX A;  1HA8 A;  1WCM J;  4G94 A;  1I5Z A;  4M6V A;  3L2C A;  4BXX J;  2JSC A;  5LLQ A;  2ZXI A;  3T8T A;  1X4O A;  2RGV A;  1OQY A;  3E1S A;  4XNF A;  3GTQ J;  2X6W A;  5FJ8 J;  3AG2 H;  4UVC A;  2VQL A;  4HW0 A;  3HJE A;  2ZFW A;  3HYI A;  3L2Q A;  2QEN A;  4I76 A;  2R7X A;  3BDD A;  4XKB A;  1HKS A;  5L3G A;  1X3Z B;  1YX3 A;  2XSJ C;  1IXS B;  3JR9 A;  1WJ5 A;  1UHW A;  2F4I A;  4S0H B;  1AKH B;  4IRI A;  4UNO A;  3BG9 A;  3IH3 A;  4U87 A;  2O8X A;  3BWG A;  4HST A;  3I4M J;  2KP6 A;  3TO7 A;  5EG0 B;  5HS7 A;  3SXY A;  3DEU A;  3HHH A;  2DA1 A;  4F55 A;  2FRH A;  3K1P A;  1WJD A;  2E60 A;  3KYD B;  5HNH A;  4I2O A;  5EJC A;  1R23 A;  1U8B A;  2WAF A;  2VL8 A;  1D1C A;  3NWT A;  2OCC H;  4DJA A;  4S05 A;  3WGI A;  3WGG A;  3HOS A;  3CUQ B;  5LHI A;  3GW2 A;  3Q0U A;  4HX8 A;  1MBJ A;  4PJ0 C;  1REP C;  2V1D A;  4M9Z A;  4WXC A;  3BCA A;  1IN8 A;  3WU1 B;  3EYY A;  1JUS A;  3H5A A;  4GRI A;  3S93 A;  1VQ9 I;  2VQH A;  4GGG A;  5FO5 A;  1S3J A;  3J81 K;  3HRT A;  4KIB A;  4EV0 A;  4Y52 J;  3TP3 A;  3DU5 A;  3GBG A;  1YRN B;  4UUS A;  4TV7 A;  1XGM A;  4NC6 A;  3M3Y J;  4Q47 A;  4U0Y A;  1VTN C;  2KZG A;  4BQQ A;  3WTX C;  4OIR F;  3IWZ A;  3U2R A;  5DM6 F;  4FAS D;  5HS9 A;  3IHU A;  3V7R A;  2GLO A;  2VXZ A;  2NXN B;  1JHH A;  2GOX B;  1BI3 A;  3K9T A;  4L5J A;  3FDY A;  4XSZ F;  2GXG A;  2LMD A;  1O3R A;  2GOM A;  4G7O F;  2JUC A;  3QRF F;  3A1Y A;  2CSO A;  2GZW A;  5LFA A;  2DPD A;  3GME A;  2KLO A;  3F8F A;  3MWM A;  1FOK A;  1FPQ A;  3OOP A;  2Z2S B;  3ZCO A;  4HF0 A;  1X3W B;  1AHD P;  1WI9 A;  2ADU A;  3PL8 A;  2QBY A;  1UZC A;  2BY1 A;  1Y8R B;  1V4R A;  1HCR A;  2CQQ A;  1Z0X A;  4JQF A;  2X51 A;  2LSO A;  1E3O C;  2V9P A;  5B3S H;  2CV0 A;  3HC7 A;  2LDU A;  4PFP A;  4YIR X;  1XMX A;  1IC8 A;  2NVX J;  2GIZ A;  3RZO J;  1I50 J;  4HF2 A;  4UV8 A;  3ECH A;  4B09 A;  3ZMT A;  4BY7 J;  4BXU A;  3HL2 A;  3B6A A;  4DIQ A;  1IXC A;  2DBB A;  1BA5 A;  4C3I J;  1P9Q C;  3G1M A;  2IS2 A;  2EA4 A;  2QCO A;  2A5Y B;  2KIF A;  1Z6T A;  2CS3 A;  1X2N A;  3BG6 A;  1XN7 A;  4LLG F;  1AU7 A;  2VON A;  3PNV A;  2DLL A;  1HQC A;  1UJ8 A;  4NUB A;  2P7C B;  2E7W A;  2P5L C;  2C6Y A;  1KU2 A;  3CDL A;  1NK2 P;  5HOD A;  4FE4 A;  2BVM A;  2ZBK A;  3TDZ C;  2DOD A;  2R7Z J;  4BDZ A;  3BG3 A;  2YPR A;  4MLO A;  2XAQ A;  5D5X B;  4HYE A;  3E6M A;  3SZT A;  1EV7 A;  4IO9 F;  1YG2 A;  5FLX K;  3Q3S A;  2W25 A;  4QTR A;  2ZJP F;  1MJA A;  1X1P A;  3FXM A;  1A6I A;  2ZKZ A;  2DFF A;  1TP4 A;  2W00 A;  3B73 A;  4M72 A;  1OFC X;  1U9O A;  3BTC A;  3T8R A;  4WK8 F;  1IUY A;  2L7F P;  5DV5 A;  4MHG A;  3FX3 A;  3Q5F A;  5J1U A;  5H6Q A;  1P4W A;  1I3A A;  1EJ9 A;  2Y0S A;  4UXN A;  3DF8 A;  1E3P A;  3G4S I;  1FYK A;  3HTU A;  1E17 A;  2Q1Z B;  2DK5 A;  2NS7 A;  3A02 A;  1YJW I;  1G6N A;  2M5W A;  1OCZ H;  3SDG A;  2K3P A;  1DU6 A;  3S1M J;  1JJ8 C;  1J09 A;  1RUN A;  3ONQ A;  3AL0 B;  1D3Y A;  3C18 A;  1ON2 A;  1NG7 A;  3FMQ A;  5HVQ C;  3CDI A;  1UCR A;  1S9H A;  4ZDL A;  2HGC A;  3I58 A;  3NAU A;  3GEZ A;  4NHJ A;  4B4C A;  1TL8 A;  1ERD A;  5EEA A;  2L9V A;  2K40 A;  1XB4 A;  2WB1 N;  2PFB A;  2IS1 A;  5J6X A;  1QZZ A;  2WAQ A;  2LBF B;  3RKY A;  3DTE A;  5E3L A;  3CCY A;  2OPT A;  3QPT A;  2ESN A;  3F23 A;  2K9M A;  1EH8 A;  4I0A A;  4HOB A;  3ZQ7 A;  4GDF A;  3QOD A;  4Y15 A;  5ILU A;  2G9W A;  4FIS A;  1H0M A;  3JSO A;  2OTL I;  5FD6 A;  2M30 A;  4L18 B;  3L2R A;  4L0Y B;  4P9F A;  5L3E A;  2CU7 A;  4WF2 A;  4IOA F;  2R7D A;  3S2H J;  1LFU P;  1SVM A;  4M6X A;  2ZC2 A;  1XSX A;  1XDS A;  1KQ0 A;  2MD5 A;  1VQ4 I;  3HOX J;  2ID3 A;  3KPH A;  3I64 A;  3G3Z A;  2VQG A;  3GFM A;  2DXI A;  2LY2 A;  1UEL B;  3DTK A;  5DCF A;  3I4P A;  4D5C A;  1SEU A;  1ZYR F;  2ZNY A;  1TTY A;  2ZME B;  1HW2 A;  3ABT A;  1B9N A;  2O0Y A;  3BR1 A;  1U78 A;  4R8H A;  4YFX F;  4EM1 A;  2Z16 A;  2P7V B;  1W5S A;  2D2W A;  1JT0 A;  2NNN A;  2F6C A;  4C9Y A;  3F21 A;  4HA8 A;  3P7N A;  4RGR A;  4AIJ A;  3S2W A;  2M0M A;  2HWV A;  1FP1 D;  2M7B A;  2O7O A;  2PQ8 A;  1VQK I;  2R7V A;  1UB9 A;  5K7F A;  4A12 A;  3BZ6 A;  1ZG1 A;  1XCB A;  2PMZ N;  2F5E A;  1TT5 B;  1QZE A;  1ZAO A;  3TOB A;  2HFH A;  2HR3 A;  2YU3 A;  3H35 A;  1XDU A;  2E2H J;  3M8E A;  1QRY A;  2W1O A;  4OAZ A;  5GP9 A;  4RB1 A;  1AKH A;  3DFG A;  2COM A;  2M87 A;  3NAR A;  2GXB A;  2XGD A;  5F6F A;  1JJ6 C;  2VE9 A;  1PYV A;  2I5U A;  3KCC A;  4ABZ A;  1X1D A;  3SZG A;  5ED4 A;  5K5O A;  4YII A;  2B9S A;  3OYB A;  2NS8 A;  2ZFU A;  2LY9 A;  3ULQ B;  2XGX A;  3CUQ A;  4XN3 A;  3N97 A;  1P92 A;  4XLH A;  3F8C A;  5LHH A;  2IVM A;  1R22 A;  1B1B A;  4IQJ A;  1M1E B;  2UXX A;  2DDB A;  2XHK A;  3HKZ N;  2Y0M A;  3RYP A;  2AXL A;  2JVG A;  5IOY A;  1KU3 A;  3ERM A;  3ZQC A;  2QSH X;  3QYB A;  2QZ8 A;  1YRN A;  3F8M A;  1SFU A;  3OYK A;  1X4P A;  1HOM A;  5EEG A;  1W0T A;  1ZLJ A;  9ANT A;  4N9I A;  2JJ7 A;  3AG4 H;  1ITY A;  1D0Z A;  4ESB A;  2VC0 A;  2L9N A;  1S8N A;  5TGT A;  3CJR B;  3GLX A;  1JKR C;  1IRG A;  3NWS A;  3R61 A;  4ZYD A;  3AG3 H;  1JUP A;  2OC6 A;  1R71 A;  3T5X A;  5GAG J;  4X1E A;  3O8G A;  1UAA A;  5LGN A;  1Y8Q B;  3PIP F;  3TO6 A;  2ACJ A;  2COB A;  2BY2 A;  3Q9S A;  1J2X A;  4ZYG A;  3TED A;  4CYD A;  2VJI A;  3SDB A;  4ESF A;  1YLF A;  3OYJ A;  4MFE A;  3CTA A;  3M8F A;  3GTM J;  1W7P B;  4NC8 A;  3H9Q A;  1O57 A;  3KIO A;  2GBY A;  3DBH B;  3KP4 A;  3D0S A;  1ZQ3 P;  5ICG A;  1MNE A;  2QF7 A;  4W97 A;  3CUQ C;  2JPC A;  1O7L A;  4HLY A;  3EET A;  5TRD A;  5DD8 A;  2K9N A;  2FBI A;  1WGX A;  2CH0 A;  2KHM A;  3LSP A;  1R4M B;  2XAU A;  2JN6 A;  1GXQ A;  2KFD A;  3FKI J;  3HZJ A;  5HDN A;  1RKW A;  2IGO A;  4G6D A;  1SMY F;  4RDU A;  2MBF A;  2OA4 A;  2OCE A;  4XRF A;  2CQX A;  2E1N A;  1YTY A;  3JRF A;  2NYX A;  2CYY A;  3SJM A;  4LG0 B;  1DGR M;  2KDZ A;  2OTJ I;  4DQ2 A;  5GTI C;  3PNY A;  1IV8 A;  3WOD F;  2VBZ A;  4CO8 A;  4DBR A;  1YOV B;  5K5Q A;  1T2K A;  2RQQ A;  1ZGA A;  3OYH A;  3KP7 A;  1B9M A;  1GUU A;  1TQI A;  4UY8 I;  1ZH5 A;  5JHF A;  2E2J J;  2BY3 A;  3VOD A;  3ERE D;  5M5W J;  1P7J A;  1SVL A;  5CPR B;  4D5F A;  1ZRF A;  2JA6 J;  5E18 F;  4PJJ A;  2D5V A;  2UZK A;  5EF6 A;  1B4A A;  2R7O A;  4OMY A;  2L3D A;  4I02 A;  3CC7 I;  2PMH A;  4RLQ A;  5EDN A;  3ROU A;  2WA0 A;  1Q1H A;  2VPR A;  1TBX A;  1YS7 A;  4A2U A;  2KPM A;  2BHY A;  3OYE A;  3S32 A;  2VOO A;  3BY6 A;  1OYW A;  1BI1 A;  2DA2 A;  4O3M A;  5IYB J;  3EDP A;  2AHQ A;  2V6E A;  2AQE A;  2VT2 A;  4RGX A;  5LBQ A;  3QPS A;  2CW7 A;  2EIN H;  2WY7 Q;  2R7R A;  1K78 A;  1S7A A;  2NOJ B;  3ZQQ A;  3OYA A;  1JKP C;  4BBS J;  4XLF A;  3WTS C;  2JMW A;  2Z33 A;  2NVU B;  3JAM K;  2KRH A;  3BR2 A;  2QVO A;  3I3L A;  1SD4 A;  5C3E J;  2G7H A;  1G59 A;  5C44 J;  2MGQ A;  3M7G A;  4M9S A;  1LJ9 A;  2ME0 A;  4FCY A;  2YX7 A;  5IP9 J;  3KZZ A;  2CUZ A;  4GYG A;  2LBF A;  1BI0 A;  3WGH A;  1ZK8 A;  1QHG A;  2MAB A;  5TIS C;  1YIO A;  1I27 A;  3AG1 H;  2MH9 A;  4XR6 A;  4CYC A;  3E6D A;  1VQP I;  1NH3 A;  1XGS A;  3FM5 A;  1HBX G;  4HAM A;  2Z3Y A;  1KA8 A;  4RGU A;  1FOX A;  2KIS A;  3ZQH A;  2XC7 A;  5FD5 A;  4XID A;  1IJW C;  4LJZ F;  2PMU A;  2GWR A;  1MZB A;  1YO5 C;  1L0O C;  1PVE A;  2EK5 A;  3DKW A;  3HOT A;  1G8X A;  2BHZ A;  5LGT A;  4HNV A;  4RM2 A;  4XRS G;  2R0Q C;  4HSR A;  3H0D A;  4LB5 A;  1T8I A;  3L00 A;  1MBH A;  4IHT A;  4KA4 A;  3AL0 C;  1F5T A;  2HOS A;  2ZME A;  3E6B A;  1SAN A;  3G1O A;  4RB3 C;  2DPU A;  5EEH A;  4FET A;  3TP0 A;  4QLC U;  1GVD A;  1ETQ A;  5HLG A;  3GWZ A;  4I7H A;  2Q2E B;  5J8C A;  3FBI B;  4HX4 A;  3CJN A;  2PBI A;  3OS1 A;  1ZTR A;  1TWA J;  3V42 A;  5DCM B;  4HDU A;  5FRM A;  5DDG A;  4BY1 J;  4F91 B;  2NVT J;  1SFE A;  2O03 A;  2OD5 A;  3QU3 A;  4IF4 A;  2VB6 A;  5FFZ A;  3KP3 A;  1W5C C;  2MLG A;  2DYR H;  1V54 H;  1IW7 F;  2M4K A;  3CF5 F;  1SAX A;  1YJ9 I;  3ZMV A;  3TW7 A;  1VQL I;  2V1N A;  3PO2 J;  1S29 A;  1XMK A;  2A6T A;  4AID A;  1BL0 A;  2DW4 A;  3E5U A;  4XOP A;  3WU2 C;  2W24 A;  2R7T A;  4LGW A;  4HV6 A;  4AIK A;  2OJE D;  3DTI A;  1QVU A;  2JQ7 A;  3ZQF A;  3OYL A;  5EGO B;  1TWC J;  1R7J A;  1ONV A;  2DJI A;  5JFR A;  2PJR B;  2Y69 H;  1VI0 A;  3KZI C;  3RIR A;  2X48 A;  5E1Z B;  3WTT C;  3HOY J;  5FFX A;  2F4M B;  2DOF A;  2XF7 A;  2Y9Z A;  1FWZ A;  4Y4R A;  5LEJ A;  1W36 C;  1TWG J;  4LB6 B;  2LKP A;  2WB1 A;  4XSX F;  2E19 A;  4LIU A;  5DD4 A;  4AM3 A;  1FSE A;  3KYL A;  1U5T A;  4CCN A;  4C2M J;  2IS6 A;  2A5W A;  4KMU X;  1F9N A;  3RPU D;  4C3J J;  1R1V A;  4HV5 A;  3VSL A;  2XAJ A;  1MMS A;  3I5U A;  2E5Z A;  4UB6 C;  3GUD A;  1AA7 A;  3IC7 A;  3K4M A;  1DPU A;  2DTZ A;  1T08 B;  4BEH A;  1B72 B;  4GYI A;  4EM2 A;  4EQQ A;  3HSF A;  4ENJ A;  2BY0 A;  3ZN0 A;  1CF7 B;  3CC2 I;  1YW8 A;  2MH2 A;  4KDP A;  2K86 A;  1W7P A;  4CZZ A;  3FM3 A;  5IPA A;  3QYF A;  4E7I A;  3G73 A;  2M45 A;  2PLY A;  5GAE J;  2DA5 A;  3ZQG A;  2XRO A;  1V5F A;  3S2D J;  5KAI C;  2DQL A;  2LFB A;  4O6J A;  4E7J A;  1OCT C;  3MMY B;  2GA2 A;  3GF2 A;  1DDN A;  4LIV A;  2X0L A;  2FU4 A;  2M1B A;  2A05 A;  1R5G A;  2L54 A;  1G3Y A;  2ZNZ A;  3G2B A;  2LP0 A;  5K1Y A;  3KET A;  3ESW B;  4UV9 A;  5IT9 Z;  3HOV J;  1MBK A;  5F1R A;  1U5T C;  3F3X A;  2DCE A;  2PMZ A;  3KFW X;  4LG0 A;  3U9G A;  2XVC A;  1FBU A;  1SD5 A;  3K4J A;  3MAJ A;  4BKX A;  3N05 A;  2HDC A;  4BU2 A;  3F9K A;  4M74 A;  2E7X A;  3GTO J;  2LD5 A;  2F5V A;  2A69 F;  4XLE A;  4A3I J;  3I71 A;  3LNQ A;  3OIO A;  4XMY A;  3V8K A;  2P5K A;  3QYE A;  1OCR H;  3S15 J;  4UUV A;  3OOU A;  2UWM A;  4I0B A;  3E97 A;  4NQW B;  4ZC3 A;  2TDX A;  3M1C A;  3I59 B;  5AON A;  2QQB A;  2F5F A;  1WHU A;  2BXY A;  3HRS A;  4RM3 A;  4BXF A;  1I1S A;  2LK2 A;  5F08 A;  5B66 C;  1K79 A;  4P9U A;  3LOC A;  3IH2 A;  3S8P A;  4BJ6 C;  3DU6 A;  3EUK L;  3CUO A;  4JP0 A;  4JX4 A;  3KLN A;  4LG3 A;  1LNW A;  3HKZ A;  4WXD A;  2ZXJ A;  2CMP A;  4GO1 A;  3BC8 A;  4UUT A;  1FMW A;  1V55 H;  1BBY A;  1FX7 A;  3H3V K;  4KT6 A;  3JRI A;  4XLP F;  1MD0 A;  3H0G J;  3KEY A;  4HQE A;  3ZRG A;  4BBR J;  1SFK A;  1JGS A;  3V8L A;  2IPQ X;  3C7J A;  4BUP A;  4A3C J;  3LSM A;  2L7M P;  3LL7 A;  2X4H A;  3LST A;  1Y0N A;  2ZB9 A;  4JX5 A;  4CGZ A;  3CMY A;  1ZGW A;  5FKN A;  2V79 A;  2LC2 A;  4YG2 F;  1XSV A;  3CLO A;  3JRG A;  2PJP A;  2IBD A;  4RGS A;  4ESJ A;  2GIV A;  1VND A;  4MQV A;  2K9S A;  4KIF A;  4YFN F;  4YFK F;  4I98 B;  3PIO F;  2XDV A;  2FSW A;  4IJA A;  2LF8 A;  2LTP A;  5HLH A;  2BOL A;  1FEX A;  2G7U A;  4BQO A;  2HVR A;  3VOE A;  2GA1 A;  2UXN A;  2FNA A;  1SFX A;  3MKY B;  2CWE A;  1QA6 A;  1WI3 A;  4LK0 F;  4OIP F;  3SEQ A;  1NG6 A;  3RPU A;  2X6O A;  2WBM A;  2YSR A;  2OU2 A;  2M2E A;  2P6T A;  4P1W A;  3IH4 A;  3OS0 A;  3CMA I;  2ICW G;  2AQF A;  5F27 A;  1EKE A;  1LDJ A;  3ZGK A;  2HQN A;  3OMY A;  5ICC A;  1J0R A;  2OF7 A;  1XGO A;  3V7S A;  3FZV A;  3N4M A;  1RI7 A;  2GQQ A;  2XV4 S;  3E7L A;  4A0X A;  1TT0 A;  3I9V 2;  3OL3 A;  1X58 A;  2ME6 A;  1XC5 A;  3PFI A;  3VYR B;  3VYU B;  2LOO A;  1QBJ A;  5E20 A;  1D8K A;  2KRC A;  3QPH A;  2JSP A;  1A36 A;  1VFC A;  2R92 J;  5C4X J;  1U6G A;  4XOT A;  2XGE A;  4A69 C;  3BOQ A;  2HU9 A;  2W7N A;  3DWL E;  1FNN A;  2I8D A;  2Q2E A;  3T1B A;  2VJ4 A;  1N75 A;  3J7A O;  2O8K A;  3CCJ I;  3WTU C;  4KMF A;  5CQG A;  3F8N A;  5E8G A;  1ZG3 A;  2IGN A;  3TO9 A;  1FJL A;  2ESH A;  1RZ4 A;  3LAP A;  4HRI A;  3D1N I;  4XK4 A;  5DUI A;  3ELK A;  3V7C A;  3K4C A;  1H9G A;  4EM0 B;  1MJ9 A;  4BYY A;  1A5J A;  2BE5 F;  2PG4 A;  4KNY A;  2FD5 A;  2LVS A;  2EZK A;  3LSK A;  2LKS A;  4ZJZ A;  2OBP A;  1PP8 F;  3LSI A;  3WG9 A;  3HSR A;  2JZY A;  4EGY A;  2VPL A;  1IN6 A;  3GXO A;  1ZEL A;  3JRH A;  1SMT A;  4JK1 X;  3F6V A;  1XPX A;  4AYB N;  1QQI A;  5KAF C;  5E8I A;  1WRJ A;  1AOY A;  4K2E A;  1FT9 A;  2Z1D A;  3HPH A;  3K10 A;  3LQR A;  3M4O J;  2HKX A;  1R36 A;  1HW5 A;  4N4O B;  1ETV A;  3W2A A;  4CZC A;  1H9T A;  1YW7 A;  1D5V A;  4IXA A;  1BC8 C;  4XLC A;  1VQM I;  4AVZ A;  3K4B A;  1IDZ A;  3DP7 A;  4UVA A;  3BTI A;  1Z3X A;  1ETK A;  2M3A A;  4Q4Z F;  4U7D A;  4IHW A;  2TRT A;  2LH9 A;  2R4G A;  3FXU A;  1QO0 D;  3MZH A;  3HUG A;  3FHZ A;  1Y6I A;  3W6J B;  3HG9 A;  3S14 J;  2DOE A;  3LA3 A;  5B1A H;  1LQ1 A;  1B72 A;  1FLI A;  3GFL A;  2D1V A;  3J7A Y;  1MBF A;  4DNC A;  5BQT A;  2XB0 X;  4PSW A;  2DA4 A;  3HGG A;  5D4R A;  4AIH A;  4KFC A;  2HXO A;  3IRQ A;  3FXL A;  4S04 A;  2IP2 A;  1KQ9 A;  2VKH A;  1UST A;  3QP6 A;  4II3 A;  1MKM A;  2XGC A;  3HRM A;  5BNG A;  2MSY A;  2R7Q A;  4BAY A;  1G3T A;  4CCJ A;  4MEX F;  1Y0U A;  5L3D A;  4EEF G;  3I54 A;  3RCO A;  3KEO A;  2V26 A;  4Z2Y A;  3IAS 2;  3F72 A;  4IRH A;  1FSH A;  1B8I B;  2QWW A;  2K4J A;  1T98 A;  3WE3 A;  2BGC A;  2J5O A;  2FXA A;  3FF5 A;  3K1M A;  1EA3 A;  2HPI A;  2X1E A;  3H36 A;  3I4N J;  2FEZ A;  4XL9 A;  1T6S A;  1MND A;  3HXL A;  1RNL A;  2KDO A;  4AC0 A;  1IDY A;  2MLK A;  3R0J A;  2RNG A;  4RA2 A;  3BCB A;  4M9X A;  2IS4 A;  4WX9 A;  4RMN A;  2E1O A;  2OV7 A;  4OWR B;  4XM3 A;  2O61 A;  5CQE A;  3HOW J;  4NQW A;  1BW5 A;  3HEF A;  3Q0W A;  2EV0 A;  3I59 A;  1USS A;  2G0E A;  3T0Y A;  1J75 A;  1Z77 A;  3HIF A;  2EBI A;  1UMQ A;  4XON A;  2AO9 A;  2Q8K A;  2WY8 Q;  1NHA A;  2XRN A;  3JTH A;  4ZYA A;  4KJZ A;  1W5T A;  1MGT A;  4L5I A;  1HF0 A;  4M3F A;  3ZPL A;  5HLI A;  2FOK A;  1X2M A;  1F1Z A;  2KZV A;  5D5U B;  5GPC A;  1HLV A;  4ZYH A;  2EIL H;  2R5Z B;  3GTL J;  3W6K B;  4AU7 A;  1GV5 A;  2W48 A;  2H6B A;  2QLZ A;  3DV8 A;  3FK6 A;  3JRB A;  3BR3 A;  2Z9O A;  2Y9Y A;  2DT6 A;  3LFK A;  3FMR A;  5CKT A;  1T95 A;  2MC4 A;  3FMS A;  3M07 A;  3PUB A;  1UHM A;  4M71 A;  1KU9 A;  5EG0 A;  2P0W A;  2ZCW A;  4NNJ A;  4BQN A;  1UG0 A;  2DMP A;  1MBG A;  2V7F A;  4F7Z A;  2MC3 A;  2P8T A;  1XGN A;  1ENH A;  5F0C A;  4CCK A;  1R49 A;  4C2T A;  4OU0 A;  4PGG A;  2DMN A;  5FKK A;  2IXS A;  2DAO A;  2TCT A;  1BIA A;  4PK4 A;  1BC7 C;  1PUF B;  3L7W A;  1Z67 A;  2A6H F;  3WTZ A;  1HC8 A;  2E2I J;  2XF6 A;  5B5E C;  3I53 A;  4DGW B;  2NNY A;  4L0Z B;  4IX7 A;  1PJR A;  1BJA A;  1T38 A;  3QU6 A;  1C0W A;  3BTJ A;  5BPI A;  2DTR A;  4NBQ A;  4RAZ A;  5J40 A;  1G3W A;  2VUM J;  3M8J A;  3CO6 C;  5A2Q Z;  4G9Y A;  2BYV E;  1I3Q J;  2NOG A;  3A4C A;  1JGG A;  5B1B H;  1SD6 A;  2FQ3 A;  4Y33 A;  2BZT A;  4R79 A;  3GYH X;  1LB2 A;  1PP7 U;  1W36 D;  3CZ6 A;  5DEQ A;  4KYW A;  1VQO I;  1FP2 A;  4BAC A;  4ITV A;  2CQ7 A;  3PNT A;  4BE2 A;  3BR5 A;  2HQR A;  4WWC A;  4C2U A;  1VQ6 I;  3CES A;  2E35 A;  2DQR A;  4BDY A;  2CRG A;  2EZL A;  3C3W A;  3GFI A;  5K5R A;  4MFD A;  1XG1 A;  3W2W A;  5J47 A;  4EJO A;  1H88 C;  1WQ2 A;  3F22 A;  1G4D A;  1Z05 A;  2LLK A;  2JK3 A;  1IO2 A;  2H09 A;  2MG4 A;  2EV6 A;  3M1E A;  2XKO A;  2VN2 A;  3CCL I;  1ZAR A;  2HOT A;  1RRJ A;  3S1Q J;  3LWF A;  2P6S A;  1S5L C;  2HZD A;  4FHT A;  2J5P A;  4DYQ A;  1XTA A;  2XKP A;  3K1N A;  4DZP A;  2X1D A;  2JWT A;  2V1U A;  3ABM H;  4PJM A;  4AD9 A;  2A68 F;  1KZH A;  3WHC A;  2L01 A;  4KN7 X;  4LK1 F;  2ISZ A;  2DT5 A;  1R9T J;  4FE7 A;  2M8G X;  1KYW A;  2F48 A;  1TQP A;  1D0X A;  3BR6 A;  1P2F A;  5FKO A;  3FWE A;  1OYI A;  2GXA A;  3HRU A;  3OSF A;  4V2G A;  4B3X A;  4D0P A;  1U3E M;  3FXO A;  5JVG F;  1D1A A;  1D8J A;  4G6T B;  1BW6 A;  3SQN A;  3QQA A;  3OWT A;  3I55 I;  3VFZ A;  1TWF J;  3QOE A;  1DGW Y;  1YS6 A;  4M73 A;  1MBE A;  4G12 A;  2XUB A;  2CW0 F;  1WKM A;  2L5Q A;  4BNC A;  2WWY A;  3VDX A;  1X19 A;  3K4K A;  3VYT B;  1R1T A;  2XF5 A;  4IKF A;  2E36 A;  1N25 A;  2V6C A;  1ZLK A;  2CGP A;  4JBA A;  4PJN A;  2LRD A;  1XX5 A;  4RAY A;  1Z6R A;  1W7P D;  4YEJ A;  3DLA A;  2BVL A;  2QQA A;  3CO7 C;  3GO5 A;  4RAF A;  4ZDO A;  4MEY F;  3LMM A;  4B48 A;  3EQL F;  5ILS A;  1ORK A;  1U2W A;  3CCV I;  2Y75 A;  3LSR A;  4IL6 C;  1ETW A;  4B3A A;  5JVT A;  3GX4 X;  5IP7 J;  1K7A A;  3G1L A;  3DPL C; 
#chains in the Genus database with same CATH homology
 4BY7 J;  1B8I A;  1ZR2 A;  2LP0 A;  3B6A A;  1VF9 A;  4A93 J;  1BA5 A;  4C3I J;  3HOV J;  1MBK A;  3G1M A;  5M5X J;  2QCO A;  2DA3 A;  1X2N A;  2CJJ A;  3BT9 A;  1AU7 A;  4BKX A;  2I10 A;  2CUF A;  1ZR4 A;  2R93 J;  3GTO J;  5DS9 A;  2LD5 A;  3CDL A;  1NK2 P;  1HDD C;  1XS9 A;  1QPI A;  5HOD A;  3HDD A;  4M3D A;  4A3I J;  4FE4 A;  3OIO A;  1F36 A;  3LNQ A;  4AUX A;  2R7Z J;  3BG3 A;  3VPR A;  4MLO A;  3S15 J;  3OOU A;  3Q3S A;  4QTR A;  1A6I A;  3S17 J;  4JYK A;  1ETY A;  2LK2 A;  3C2B A;  3TW6 A;  5F08 A;  1OFC X;  1U9O A;  3BTC A;  3LOC A;  3IH2 A;  2L7F P;  4GFB A;  2WV1 A;  2KT0 A;  4JP0 A;  4JX4 A;  4QSH A;  2DMT A;  5J1U A;  5E3N A;  1W0U A;  1APL C;  1IG7 A;  4DZJ A;  4C3H J;  3SFI A;  4UUT A;  2L0K A;  3H3V K;  1GDT A;  3JRI A;  2NS7 A;  3JRC A;  3A02 A;  3H0G J;  4I6Z A;  3MKL A;  1GV2 A;  2XRL A;  2R5Z A;  3SDG A;  1DU6 A;  1U9N A;  4BBR J;  1JJ8 C;  3S1M J;  2WAQ N;  3FIS A;  4A3G J;  4A3C J;  2L7M P;  2ZB9 A;  4JX5 A;  2RAE A;  3CMY A;  5FKN A;  1ZGW A;  3GTP J;  3NAU A;  3JRG A;  4X6A J;  3RKQ A;  2IBD A;  4B4C A;  5EEA A;  3S16 J;  5FLM J;  2K40 A;  5K7Z A;  3S1R J;  2WB1 N;  1VND A;  5J3L A;  1UHS A;  2K9S A;  3ZQI A;  5E3L A;  1IGN A;  3CCY A;  2OPT A;  4A3M J;  1DU0 A;  3LSJ A;  2IAI A;  4DW6 A;  2LTP A;  2Y30 A;  3BG5 A;  1PUF A;  1FEX A;  4FIS A;  1G2H A;  2X9D A;  5F1J A;  2CU7 A;  1CQT A;  2VI6 A;  4RBO A;  3S2H J;  1WI3 A;  1Y1V J;  2FQ4 A;  1LFU P;  2X6O A;  2M2E A;  3IH4 A;  3PO3 J;  5F27 A;  2MW8 A;  3GTJ J;  5DTD A;  2ID3 A;  3HOX J;  1H89 C;  2R5Y B;  2OF7 A;  3CQZ J;  3FK7 A;  3E7L A;  1RET A;  1I6H J;  4D5C A;  1X58 A;  2EH3 A;  5FKM A;  1XC5 A;  2DA6 A;  2YS9 A;  2ME6 A;  2M34 A;  2O9L A;  3BR1 A;  4IHX A;  1U78 A;  1LE8 A;  1VFC A;  2R92 J;  4MO7 A;  5C4X J;  2YUS A;  1LFB A;  1JT0 A;  2XGE A;  4A69 C;  1SFO J;  5M3M J;  3ZQL A;  2M0C A;  2O7O A;  2O8K A;  2DA7 A;  5K7F A;  4Y7N J;  4XRM A;  2PMZ N;  4A3E J;  5JLW A;  2L9R A;  1FJL A;  4A3B J;  4A3J J;  2E2H J;  3D1N I;  1QRY A;  1MH4 A;  4XK4 A;  5GP9 A;  2LKX A;  3JRE A;  1AKH A;  1RR7 A;  1JT6 A;  3BTL A;  1JKO C;  3A01 A;  3NAR A;  1A5J A;  2XGD A;  2H8R A;  5GPA A;  1JJ6 C;  2FD5 A;  2LVS A;  2EZK A;  4ABZ A;  2Y2Z A;  4IHY A;  2P81 A;  2IEK A;  4JX6 A;  2NS8 A;  4W1U A;  1Y1W J;  4D7N A;  2LY9 A;  3JRH A;  2LR8 A;  3JRD A;  1WH5 A;  4A3L J;  4AYB N;  2H1K A;  4XIC A;  3DCF A;  2CUE A;  2HI3 A;  5M5Y J;  3M4O J;  3HKZ N;  1ETV A;  1EF4 A;  2Y0S N;  1ETO A;  5IOY A;  4UUS B;  3ZQC A;  1POG A;  1YRN A;  1UG2 A;  1HOM A;  1W0T A;  1IDZ A;  9ANT A;  4MIM A;  1ITY A;  2JJ7 A;  3BTI A;  1D5Y A;  1ETK A;  2K9Q A;  1JKR C;  4IHV A;  2N8G A;  4A3K J;  4IHW A;  1MNM C;  2TRT A;  1JUP A;  2DJN A;  3IV5 A;  2M9H A;  1TWH J;  4X1E A;  3O8G A;  3S1N J;  5FKL A;  3S14 J;  2COB A;  1B72 A;  3UKG A;  1MSF C;  3TED A;  1MBF A;  2DMU A;  2XB0 X;  2DA4 A;  1WH7 A;  4MFE A;  3GTM J;  3HGG A;  5IP6 A;  2HXO A;  1MSE C;  2GBY A;  1S7E A;  1NTC A;  1ZQ3 P;  2HYJ A;  4NDL A;  2XGC A;  2Y31 A;  5BNG A;  3K7A J;  2MSY A;  2DN0 A;  1T56 A;  1RPW A;  2QF7 A;  4W97 A;  5F0F A;  4EEF G;  2HDD A;  2NVQ J;  1O4X A;  2K9N A;  2EZH A;  1GT0 C;  1WGX A;  3K2A A;  3LSP A;  2FJ1 A;  2JN6 A;  1FTZ A;  1FIA A;  4A3D J;  4M3G A;  5K7H A;  1B8I B;  3LSG A;  3FKI J;  2HOA A;  4RDU A;  1RKW A;  1FIP A;  5IYD J;  2VKE A;  2CQX A;  3OSG A;  3JRF A;  2B63 J;  5J1Y A;  3SJM A;  2KDZ A;  3W6V A;  5E3M A;  3I4N J;  2FX0 A;  4FTH A;  1ETX A;  2ID6 A;  4AC0 A;  3GTG J;  1IDY A;  1FTT A;  1GUU A;  5M3F J;  2E2J J;  5C4J J;  1RKT A;  5M5W J;  1P7J A;  1OJL A;  3B6C A;  3BQY A;  3ZOB A;  2E1O A;  1IUF A;  4M3B A;  4D5F A;  2JA6 J;  4D7M A;  2D5V A;  5E3O A;  5EF6 A;  3Q0V A;  3HOW J;  1IRZ A;  1BW5 A;  3HEF A;  1HDP A;  2ECC A;  2L7Z A;  3FIW A;  3Q0W A;  5JLX A;  5EDN A;  2G0E A;  3HBL A;  1NK3 P;  1P7I A;  1Z77 A;  2VPR A;  2EBI A;  3HB9 A;  1UMQ A;  3MN2 A;  2AO9 A;  3PM1 A;  1T33 A;  3HGY A;  1HF0 A;  2DA2 A;  5IYB J;  4M3F A;  1WPK A;  4V2F A;  1X2M A;  5EZG A;  1HLV A;  5GPC A;  2AHQ A;  1K61 A;  2R5Z B;  3GTL J;  2YU9 J;  3BR0 A;  1F43 A;  1GV5 A;  1TC3 C;  2W48 A;  3FK6 A;  3JRB A;  3BR3 A;  2Y9Y A;  3QPS A;  3DEW A;  1JKP C;  4BBS J;  1H8A C;  5EG0 A;  4DYC A;  2GM4 A;  2JMW A;  3BR2 A;  2DMP A;  5C3E J;  2DMQ A;  3RZD J;  1MBG A;  1JKQ C;  4A3F J;  2HXI A;  5C44 J;  2MGQ A;  2ME0 A;  4FCY A;  1ENH A;  5IP9 J;  5F0C A;  3L1P A;  2ECB A;  1ZK8 A;  5EGO A;  4QIW N;  3F0C A;  2DMN A;  5FKK A;  2XPU A;  1RES A;  2TCT A;  5EYR A;  3QPL A;  5J1R A;  1PUF B;  3HOU J;  2EQR A;  4CYC A;  1OCP A;  2E2I J;  4IEJ A;  4J19 A;  2JA7 J;  3HOZ J;  3ZQH A;  3BTJ A;  4XID A;  2EZI A;  1IJW C;  5EZH A;  2VUM J;  1JUM A;  4M3E A;  1I3Q J;  2NOG A;  2ELK A;  4L5E A;  3A03 A;  4HNV A;  1JTX A;  4XRS G;  2R0Q C;  2R5Y A;  1JGG A;  3RQI A;  1BJZ A;  1MBH A;  1WCM J;  3MVP A;  2HOS A;  5F0H A;  1LE8 B;  4M6V A;  1SAN A;  5FLV A;  4BXX J;  3G1O A;  3BR5 A;  3TP0 A;  1GVD A;  1ETQ A;  3GTQ J;  5FJ8 J;  2CRG A;  1ZTR A;  1TWA J;  2EZL A;  2XSD C;  3JRA A;  4BY1 J;  4MFD A;  1XG1 A;  4I76 A;  2NVT J;  2XPV A;  1H88 C;  2XB5 A;  3WHB A;  3JR9 A;  4S0H B;  1AKH B;  4LOC A;  3BG9 A;  3IH3 A;  2LLK A;  2JK3 A;  4XRS A;  3A01 B;  3I4M J;  2MG4 A;  5EG0 B;  3TW7 A;  2DA1 A;  2HOT A;  3PO2 J;  3S1Q J;  1BL0 A;  4DYQ A;  3GTK J;  2HQ5 A;  1U8B A;  3HM5 A;  4DZP A;  2JWT A;  3WHC A;  1QVU A;  3ZQF A;  3Q0U A;  1TWC J;  5EGO B;  1MBJ A;  1VI0 A;  1R9T J;  4FE7 A;  2M8G X;  2X48 A;  1JUS A;  3HOY J;  1QVT A;  3BR6 A;  4CYC B;  5FKO A;  2Y9Z A;  1MH3 A;  1TWG J;  3OSF A;  4V2G A;  4Y52 J;  3TP3 A;  1YRN B;  2E19 A;  3GBG A;  4UUS A;  1IV6 A;  1Q1V A;  3M3Y J;  4C2M J;  2JA8 J;  1BW6 A;  3QQA A;  2JA5 J;  1TWF J;  4C3J J;  1MBE A;  2GLO A;  4G12 A;  5F04 A;  2NVY J;  2DTZ A;  1B72 B;  1K83 J;  3BQZ A;  1AHD P;  1JTY A;  1ZKG A;  5IYC J;  3O8H A;  5IPA A;  2XPW A;  5IOZ A;  4DYR A;  2DA5 A;  3ZQG A;  1HCR A;  3S2D J;  2CQQ A;  1Z0X A;  2LFB A;  4B1R A;  1ORK A;  1E3O C;  1OCT C;  3LSR A;  1IC8 A;  2NVX J;  1ETW A;  4B3A A;  3RZO J;  1I50 J;  5IP7 J;  3G1L A;  2VKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...