2L7MP

Solution structure of the pitx2 homeodomain r24h mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
68
structure length
68
Chain Sequence
b'GSQRRQRTHFTSQQLQELEATFQRNHYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pituitary homeobox 2
publication title Solution Structure of the Pitx2 Homeodomain R24H mutant
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 25
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l7mP00
3ZQIA 2R93J 1ENHA 3GTJJ 4AYBN 2XRLA 3FKIJ 3SJMA 4DYQA 1FIAA 2AO9A 1G2HA 5C44J 2XGEA 2IBDA 3PO3J 1LE8A 2O9LA 3CCYA 3RZOJ 1JUMA 1YRNB 4DZPA 4A93J 1AU7A 2YS9A 2Y31A 2VKEA 2JMWA 2QF7A 1VF9A 1H89C 1D5YA 3BG3A 4M3FA 3HBLA 2R0QC 4L5EA 4A3CJ 2LK2A 1DU0A 2LLKA 3BR5A 4W1UA 1MBEA 5M3MJ 1NK3P 2EBIA 3E7LA 2CQQA 4JYKA 1XS9A 3BTCA 5IYDJ 3ZQFA 2LD5A 2NS8A 4X1EA 3SDGA 1EF4A 2DA6A 3L1PA 3FK7A 3O8HA 1T33A 1ORKA 2G0EA 5EG0A 4G12A 3TP0A 1U78A 2DA5A 3FIWA 3MKLA 4RBOA 1U9OA 1RKWA 2DA2A 2HXOA 2FJ1A 3TP3A 2ME6A 3D1NI 3TEDA 3PO2J 3JRHA 1FEXA 1HF0A 3BR3A 3TW7A 4GFBA 1QVUA 3IH4A 4QIWN 2I10A 1ITYA 1MBJA 3BQZA 3BR0A 3OSGA 1WPKA 2JWTA 1RPWA 2Y9ZA 1MBFA 5EG0B 4Y52J 2IAIA 2O8KA 1Y1WJ 1T56A 1I6HJ 4C3IJ 1MSFC 2M9HA 3IH3A 5FLMJ 1W0TA 4BKXA 3QPLA 5DS9A 2ECCA 3ZQLA 3BT9A 2DJNA 2HOSA 1QVTA 1ETOA 1APLC 4HNVA 1VFCA 2EQRA 4JX6A 5IP9J 1GDTA 2KT0A 3I4NJ 1ZK8A 5GP9A 3HB9A 2EZHA 4BBSJ 1RR7A 4FE4A 1W0UA 1OJLA 3QPSA 2FQ4A 1TWFJ 1TWHJ 2TRTA 2E2IJ 4A3BJ 5JLWA 3GTQJ 1K83J 5HODA 9ANTA 3CQZJ 1NK2P 5BNGA 2N8GA 4IEJA 4V2GA 3JREA 3PM1A 2CJJA 1FJLA 2DA7A 3WHBA 3HDDA 3Q0UA 2COBA 3JR9A 3BQYA 1LFUP 3HOVJ 2ME0A 2WB1N 1UMQA 5EZGA 3JRFA 3NAUA 1BJZA 2LY9A 3BG9A 2AHQA 3LOCA 1IJWC 4JX4A 3WHCA 2JK3A 1I3QJ 4A3MJ 4JP0A 3HOYJ 4B3AA 4EEFG 1PUFA 5M3FJ 3G1OA 2NVQJ 5IOZA 2CUFA 1POGA 2DN0A 4AC0A 2X6OA 1P7JA 2JN6A 2JA5J 2JA6J 1JGGA 2R5YA 2ID6A 2JJ7A 1WH5A 3VPRA 1VNDA 2LTPA 2M8GX 4XRMA 4D7NA 2WV1A 1OCPA 3O8GA 1XC5A 1GVDA 1JT0A 3QQAA 3SFIA 1HCRA 2L7ZA 5J1YA 2NVYJ 1PUFB 3H0GJ 2MSYA 1ZTRA 5IP7J 2P81A 1RETA 1JKQC 5EEAA 1IG7A 5IYBJ 1JUSA 4M3DA 2DMUA 2NVTJ 4D5FA 2R5YB 3S16J 3MVPA 4JX5A 1GT0C 1HOMA 1MBGA 4C3HJ 4XIDA 5J1RA 1B72B 3S17J 1DU6A 2EZLA 1MBHA 2YUSA 4A3FJ 2K40A 3CDLA 3FK6A 4CYCA 3S1QJ 3NARA 2XSDC 1BW6A 4M6VA 2TCTA 2Y2ZA 3RQIA 4V2FA 1I50J 4C2MJ 4A3KJ 1MBKA 2MW8A 2HI3A 3DCFA 5EF6A 2O7OA 2XPVA 2LVSA 4D5CA 3GTMJ 4A69C 2GLOA 2CRGA 3G1MA 2VI6A 3GTKJ 1SFOJ 2E2JJ 3A03A 1MH3A 4CYCB 1TC3C 1JTYA 4NDLA 2K9QA 2L7MP 3BR6A 2ECBA 1P7IA 5FKLA 3LSGA 2B63J 1JT6A 4XRSA 3BR2A 2KDZA 1GUUA 5GPAA 3MN2A 5IPAA 2M0CA 1A5JA 3JRBA 3I4MJ 2L9RA 5EYRA 3TW6A 1X2NA 2GM4A 4BXXJ 3JRGA 4A3IJ 2E19A 5J1UA 1F43A 1JKRC 1WI3A 3Q0VA 3B6AA 4IHXA 1JUPA 4DZJA 4IHWA 3H3VK 1ETQA 2DA1A 1H8AC 5F0FA 3W6VA 1WGXA 2MG4A 3Q3SA 3LSPA 4FCYA 2JA7J 5C3EJ 3ZQGA 1IUFA 5K7ZA 2HDDA 2WAQN 5E3LA 3S1MJ 1OCTC 5E3OA 5FKMA 5F1JA 3F0CA 3DEWA 2ELKA 1IC8A 3HEFA 2D5VA 3HOXJ 2M2EA 5DTDA 5M5YJ 1BW5A 3G1LA 2L7FP 2DMTA 5M5WJ 4I76A 4DYRA 2DMNA 2LFBA 5FLVA 1SANA 2PMZN 1FIPA 5C4JJ 4X6AJ 3A01A 1X2MA 4DYCA 3S14J 3JRIA 3RZDJ 3HKZN 1Z0XA 3GBGA 4MO7A 5F0CA 3LNQA 3S1NJ 3JRDA 2R92J 2CUEA 3HOUJ 4MIMA 3M4OJ 2LKXA 3LSJA 1S7EA 2EZIA 1JJ6C 3ZQHA 1Z77A 3GTGJ 1VI0A 2NS7A 2CQXA 4I6ZA 1H88C 1ETWA 3Q0WA 4LOCA 3B6CA 1R9TJ 3A01B 1B72A 1JKOC 2E1OA 3BG5A 3FISA 5JLXA 1AKHA 3S1RJ 1IGNA 3GTOJ 1AHDP 3IV5A 3BTLA 2OPTA 4B4CA 2EH3A 2XGDA 3JRAA 2FD5A 1BA5A 1XG1A 2VPRA 2ZB9A 3A02A 4ABZA 5F27A 2DMPA 2LR8A 2K9NA 1ETVA 5FKKA 5FJ8J 1FTZA 4M3GA 2HXIA 2QCOA 2R5ZA 3OOUA 3BTJA 1ZGWA 5EGOA 1ZR2A 4J19A 3HM5A 4QTRA 2M34A 3JRCA 1AKHB 4UUSA 5GPCA 2K9SA 2X9DA 1IDYA 2W48A 4XRSG 1WH7A 4A3DJ 1LE8B 3HGYA 2NOGA 1MSEC 3C2BA 1Y1VJ 1QPIA 2CU7A 1UHSA 3GTLJ 2R5ZB 2XGCA 1U9NA 5EGOB 1B8IA 2HQ5A 4S0HB 5IYCJ 1JJ8C 2DMQA 4IHYA 4UUSB 1Q1VA 2Y0SN 5K7FA 1MNMC 3BTIA 3HGGA 4AUXA 5E3NA 1O4XA 3LSRA 5EDNA 2H8RA 2DA4A 1MH4A 2RAEA 4D7MA 1IRZA 3IH2A 4IHVA 2E2HJ 5F04A 3M3YJ 3HOZJ 4FTHA 5FKNA 4DW6A 5F0HA 5IOYA 4MFDA 1HDDC 3K7AJ 5IP6A 1B8IB 1TWGJ 2OF7A 3S15J 3OSFA 2EZKA 1QRYA 5C4XJ 5F08A 1IV6A 4RDUA 1E3OC 1TWCJ 2MGQA 1FTTA 2JA8J 2HOTA 4BY1J 1ETYA 2NVXJ 3RKQA 4Y7NJ 4FISA 3ZQCA 2XPWA 1ZR4A 1JKPC 4A3EJ 3HOWJ 1UG2A 1GV2A 2GBYA 2L0KA 1K61A 3BR1A 1GV5A 5M5XJ 2HYJA 4MLOA 3CMYA 1JTXA 2VKVA 4A3JJ 3S2DJ 4UUTA 2X48A 3OIOA 2FX0A 3S2HJ 5FKOA 5K7HA 2Y30A 4XK4A 2DTZA 1RKTA 4W97A 5J3LA 2XB5A 2ID3A 2VUMJ 1ETKA 4M3BA 4XICA 1F36A 3UKGA 2HOAA 2XPUA 2IEKA 2H1KA 4FE7A 3K2AA 1NTCA 1IDZA 1X58A 5E3MA 1LFBA 3GTPJ 4BY7J 5EZHA 1ZKGA 4B1RA 1HLVA 1CQTA 2XB0X 1BL0A 2R7ZJ 4C3JJ 1U8BA 1A6IA 1OFCX 4MFEA 2Y9YA 4M3EA 2DA3A 1ZQ3P 3ZOBA 4A3LJ 1YRNA 1TWAJ 4BBRJ 1RESA 2LP0A 1HDPA 4QSHA 4A3GJ 2YU9J 1ETXA 1WCMJ
chains in the Genus database with same CATH superfamily
3IWFA 2CW0F 3ISPA 3IKTA 4A5MA 3H3ZA 4PJMA 1VQ9I 4NHJA 3ULQB 2O03A 2F6CA 1FC3A 3DWLE 2E60A 5C44J 1B4AA 4R8HA 2X6YA 2MFZA 4DQ2A 5DYMA 3C2GA 3BOQA 3LFUA 1LEAA 4RGXA 4LFUA 2FQ3A 1YRNB 4DZPA 2ZC2A 5B66C 3CMEI 2A07F 4KNYA 2VBYA 2JUGA 4I0BA 3CDIA 3G3ZA 2E7XA 2QF7A 1VF9A 1H89C 4L5IA 4BHCA 5E79C 5HNFA 4CXFA 4CICA 2HVSA 2A5WA 3BG3A 3H5NA 2MLKA 3U2RA 4L5EA 4N9IA 4CCLA 1J09A 2Z9OA 3BR5A 2FRHA 1NK3P 2KQRA 5DD4A 3E7LA 2CQQA 1FZPB 2NS8A 4BGDA 2EILH 1FP2A 2EFQA 2FU4A 3L1PA 2OAZA 2ESHA 2DW4A 4NQWA 4JK1X 2CMPA 2GIVA 5EG0A 3TP0A 2L3DA 1TL8A 1G3YA 3FIWA 2E34A 3KPHA 5D6EA 4IZZA 1T6SA 2DK5A 1KU7A 1R7JA 1AWCA 3K6GA 4XKBA 2DA2A 2FJ1A 2MBFA 3TP3A 3PO2J 1WVRA 2EWNA 3QAHA 1HF0A 4GFBA 1QVUA 3IH4A 2HU9A 3ZXSA 2F5FA 3BQZA 1JHFA 1RPWA 2ESNA 3BJAA 1MBFA 1S5LC 4PZJA 5EG0B 2OD5A 2IAIA 2O8KA 3C1DA 1Y1WJ 2VB6A 2XF6A 1I6HJ 1XD7A 2NNNA 2UV1A 1W0TA 3X2QH 4U0WA 4ZDLA 1SAUA 3BT9A 3LSHA 1QVTA 2DK8A 4HRIA 2KT0A 3H3UA 1ZK8A 3HB9A 3W2VA 4FE4A 3K4MA 1GHCA 2PBIA 3LSKA 2FQ4A 2A61A 4J00A 2LOOA 2TRTA 2VKHA 3MMYB 2E2IJ 1K83J 5HODA 3GTQJ 9ANTA 1RIOH 1TQMA 2Q1ZB 2ZXIA 2FA5A 4Q4ZF 4L5JA 4CCJA 4CSWA 1GXQA 1D1BA 2R7QA 3RIRA 1BOBA 4KT6A 5CVIA 4XLPF 1F1ZA 4WX9A 1NK2P 1TT0A 4G7HF 1WZ2A 3J81K 3HYIA 4V2GA 5FLXZ 2K7LA 4M6YA 2HS5A 3WHBA 3HDDA 3DKYA 4ZYDA 2AS5F 1B6AA 1RI7A 5HDNA 3D5RC 3BQYA 1E2XA 1FOYA 3GLLA 1P4AA 3HOVJ 4KIFA 4XOTA 5EZGA 4C2UA 2HKXA 3NAUA 1RUOA 4P5OA 3TMOA 2LY9A 4EM2A 3HOSA 2DT5A 3I54A 1IJWC 4JX4A 1I3QJ 3ZQ7A 4A3MJ 3F8MA 1PUFA 2RKHA 2JSCA 3L2VA 3H1CA 2ZNZA 3FXUA 3QYBA 5FO5A 3SEQA 2O8XA 1QZZA 2JA5J 3I58A 4BXFA 1V5GA 4HBLA 3VSLA 1FLIA 2K86A 3H36A 3N97A 5FRNA 1OR7A 1PUEE 3PNTA 5ICGA 2ID6A 2JJ7A 1WH5A 2LTPA 4XRMA 3Q9VA 1OCPA 3E6BA 1LDKB 2RGVA 2VJ5A 3CJRB 2HDWA 4Q47A 4UB6C 1PUFB 3CUQB 2EK5A 5LHGA 3FBNB 2MSYA 1T8IA 1R5ID 2OJED 1RETA 2WY8Q 3MWMA 2K4BA 5J4VA 2Z16A 4M3DA 2W00A 2NXNB 2BY3A 3S16J 2BHZA 5HLGA 1WKMA 2VONA 1QA6A 1Y39A 1MBGA 2RN7A 3J81Z 5ICEA 2FSWA 1K78A 1B72B 1C0WA 3K70D 1R5GA 2EZLA 2IVMA 2YUSA 3I5UA 4A3FJ 3CDLA 3S1QJ 2H1LA 3RKXA 3RJPA 4ZYAA 2AXLA 4M6VA 5E20A 1EKEA 3ZP5A 1W5SA 2Y2ZA 3W6KB 3ECOA 4LD5A 4WXHA 1NH3A 3GFJA 3ZCOA 2I8DA 1YS6A 1I1SA 1Y6IA 3DCFA 2EFOA 2O7OA 5EF6A 2EV6A 5TGTA 4H0EA 4D5CA 1X19A 1ZREA 1SFOJ 2XUBA 2W1OA 5CQGA 3QP6A 3QRFF 2L7MP 2EIJH 1BBYA 1DUXC 2KDZA 4KFCA 5ILSA 2LREA 1REPC 2M0CA 2EPFA 3VB2A 4L18B 5DV5A 3H5AA 1GVJA 5EYRA 1FYKA 3DBLB 3HIFA 1J7KA 3OIQA 4DNCA 3GLXA 4RAYA 3F22A 1LUJB 2DFEA 2XSJC 1JUPA 4DZJA 2RV8A 3H3VK 3KEOA 3RPQA 4WWCA 4KN4X 1SFEA 2E7WA 3FXMA 5F0FA 1H8AC 3GFLA 1WGXA 3WODF 4XKWA 3OYMA 1HBXG 5D8KB 2HEOA 4GO1A 4LLLA 5K7ZA 1F4KA 4E7HA 5HOOA 2GAUA 3BZKA 4MTEA 3UR3C 5E3OA 4CZCA 1Z91A 2L4AA 2X6XA 3IC7A 1PP8F 1B9MA 4LITA 2M4KA 4HG2A 3V7CA 3S3OA 2Q0OA 1FWZA 4FX4A 1Y8QB 1A36A 1IN6A 3I0TA 4A6DA 2LFBA 2PMZN 1FIPA 3WGHA 5C4JJ 4X6AJ 4I99C 3MZHA 3BZ6A 3I56I 1IRFA 4CZZA 2BZTA 2E5NA 3FXOA 3OYAA 4PSWA 4HX4A 2JPCA 3DBRB 5D6FA 1TP4A 2EA4A 2HVRA 4MO7A 5F0CA 4IHTA 1R6RA 2QBYA 2GA2A 4KICA 1R00A 3A2KA 4P55A 1VI0A 2VQCA 4LB6B 2NS7A 2CQXA 1M1EB 1ETWA 4HA8A 1IUYA 4ZZDA 2VBZA 1JKOC 2WA0A 1V54H 1AKHA 2DXIA 1FBQA 1ZGAA 1XGSA 1AHDP 1KONA 2DPDA 2LY1A 1QZYA 2FD5A 5KAIC 3CJTB 4C30A 2QBYB 2ACJA 4N9HA 1XG1A 3A02A 3L2WA 4ABZA 2D1VA 5F27A 3DXJF 3E1SA 3FM3A 2DMPA 1YHQI 4BEHB 4HEA2 4E7JA 4E7KA 1FTZA 2STTA 2K3FA 4NC6A 4CA0A 1XMAA 2HGCA 3PQJA 4QPOA 4XKCA 5H6RA 4KIBA 4ZZLA 4L9JA 4HLXA 1OCZH 2A69F 1ACIA 1P4XA 5H2FC 2M34A 3JRCA 1AKHB 4G6DA 2DFIA 3RYPA 4BDYA 5LFAA 4CCNA 1WRJA 2LRDA 1TW2A 3A4CA 3TO7A 1WH7A 1YW7A 2CW8A 3JAMZ 1K4TA 1EV7A 3C2BA 1MSEC 1USTA 2CUJA 2V26A 1WSUA 3K1MA 5KVRA 3E5XA 4CH7A 4OIOF 1WJFA 1U9NA 2D45A 2DODA 3PIPF 4B43A 3GZNB 2PMZA 1JJ8C 1DPUA 3CP2A 2V6EA 4BHBA 3SZTA 3M8FA 3CF5F 2RNGA 4B44A 1T95A 4KIGA 1VZ0A 3AG1H 3BTIA 2PEXA 5E3NA 3LSRA 5EDNA 2DA4A 1U5TC 2FOWA 1ZYRF 4BYYA 2JT1A 2VE8A 1ON2A 1HDDC 3SEZA 2EZKA 1QRYA 4I98B 3OWTA 3V8JA 2B0LA 1EH7A 2PMUA 2VJ4A 4IRIA 4QWQA 1YIOA 4BY1J 3MZ8A 2FXAA 3RKQA 2P8TA 1ZR4A 4G6QA 5ILVA 3O2PE 2DFFA 3HOWJ 3LQRA 1ZARA 2QUFA 3NWSA 3CZ6A 3P7NA 4UUVA 4B09A 4N4OB 1EH8A 1Z3XA 1SVMA 2VKVA 2ZMEA 2MH9A 1YS7A 2KDOA 2OBPA 4BUPA 2CO5A 3EYYA 2CS3A 1XSVA 3CLOA 3FXRA 4PGHA 3AL0B 3U21A 2RVCA 1F9NA 1MKMA 5AIQA 2HWVA 5EJCA 5B3SH 2Y30A 1XB4A 2V79A 1RKTA 1P6RA 5CPRB 3WGIA 4A2UA 5JI6A 5E1WA 2JRMA 4OOIA 1R22A 2VUMJ 1FOXA 4M3BA 3UKGA 1F36A 2BBYA 1D0YA 3MZYA 1L3LA 4XLEA 3R0AA 3G73A 3RSNA 2ZMEB 1K4SA 4OIPF 3VYRB 3TOBA 4BY7J 3LSMA 1HW1A 5BS6A 1OYYA 1BR1A 1ZKGA 2OU2A 3RDIA 1U8BA 1OFCX 1IN7A 3IRQA 4IRHA 4BS9A 4Y4RA 3J7ZI 2WAEA 2Y9YA 3S8PA 1W36D 1XDSA 4R79A 3ZMVA 4QSHA 2R7XA 4CO8A 2HYFA 3DEUA 1ETXA 3TDUC 4F91B 3PQKA 4HYEA 3ZQIA 3R4KA 5L3FA 3IKVA 1UCRA 1ENHA 4U87A 3OMYA 4AYBN 3GTJJ 1SVOA 1BIBA 2P6TA 3C3WA 3R60A 3FKIJ 4XLAA 3QPHA 3L7WA 3F21A 2XGEA 1VQKI 3OR2C 4IHSA 2ADUA 3HSFA 3HJEA 2KKOA 3SXYA 4BDZA 2VC1A 1R23A 2O3FA 2VKEA 2JMWA 1T39A 1T2KA 2MC4A 1FBSA 1SFKA 4M3FA 4UHTA 2DPUA 2V9KA 1Z9CA 2R0QC 3J7AO 1JI8A 3CO7C 2LK2A 4BHPA 1VQLI 1MBEA 2EBIA 4BACA 4EJOA 1I5ZA 4G6TB 1XS9A 1I3AA 3DPLC 3RPUD 3HZJA 2K02A 1VQ4I 3ZQFA 2KLOA 4X1EA 1UB9A 5A2QZ 2P5LC 3BG6A 3KIOA 1FYMA 2G7HA 3MKWB 4BQAA 2V9VA 2G0EA 3BJOA 3CTAA 5J8CA 2BOLA 2DA5A 4ZDPA 1HA8A 2X51A 2QVOA 2VN2A 2DFHA 2VC0A 2R4GA 3HXLA 4HNUA 3IHUA 3HHGA 5LGNA 1VQPI 1XTAA 3AG3H 2L9SA 4FT8A 3CMMA 2R7WA 3TW7A 1S3JA 1VTNC 1V4RA 4AM3A 1ITYA 3K4BA 2L9VA 4BU2A 1DQUA 2A3SA 2WB1A 3BR0A 4XN3A 2JWTA 2J5OA 2H09A 2V6CA 1VQNI 2LF8A 2IS2A 3VYUB 1K7AA 1W7PA 3RCOA 4F55A 4F93B 5DM7F 3ERED 3K1NA 1T56A 4C3IJ 2IA0A 1S7OA 3DU6A 2PMHA 4BKXA 5F1RA 5DS9A 2ECCA 4AYBA 2LY2A 2O61A 3E5UA 3BLYA 1PJRA 3SFZA 1APLC 3RTRA 2KZVA 2PLYA 2HZDA 3E6DA 1MJBA 2ZKZA 4NB5A 4RB2C 2K9MA 3I4NJ 3D0SA 5GP9A 2EFPA 1XGMA 1P4WA 1W7PB 1TWHJ 2KHMA 5LRRA 3CLQA 2DT6A 3T8TA 4P9FA 2XKPA 4QPQA 4G8XA 2EIMH 2DI3A 5L3CA 2KIUA 4MEYF 1TQIA 1ERDA 3IAS2 3J7YJ 1O7FA 3HSRA 1BI3A 3JREA 3PM1A 1FJLA 1R58A 3DLLF 2DA7A 4GYIA 2KRHA 3Q0UA 4YIFA 1ZG3A 2KFDA 4PSXA 4P9UA 1LFUP 3OYEA 2ME0A 5IT9Z 1J75A 4FASD 1W36C 5IT3A 1OCCH 4WXDA 1BJZA 3LOCA 3BG9A 1RZ4A 3P5JA 1ONVA 3NWTA 4LB5A 3GFIA 1TT5B 2JK3A 1WHUA 2C6YA 4JP0A 2RQQA 4BJTA 4B3AA 1BC7C 4EEFG 1MMDA 4EGYA 4A5NA 3F6OA 1FOKA 1TQPA 4YELA 3GX4X 1POGA 2DN0A 2XVCA 2X6OA 4AC0A 2JN6A 2JA6J 4JOMA 2DBBA 4BXUA 1OR7C 1R49A 2P7VB 3ABUA 3BY6A 3OV8A 1FX7A 3L9FA 3R61A 2E1MC 1OYWA 2F4IA 2M8GX 4IRGA 1K79A 2L4MA 3LA2A 5L3DA 1YE9A 2PI0A 3BCAA 3QQAA 3JW4A 3CC2I 1FMVA 5J1YA 2QENA 2NVYJ 1BR2A 3H0GJ 1Z05A 1D8KA 2F2EA 2KPMA 3ELKA 2HFHA 1ZTRA 4LG3A 3KYLA 4ESBA 1JKQC 2RNJA 4B8XA 4WXCA 3M8JA 3KLNA 3EPZA 5IYBJ 1IG7A 2NVTJ 3P9CA 1ZG1A 1X3ZB 1Y0NA 4Y15A 3AG2H 4JX5A 5E1ZB 1HOMA 2VJIA 1IXCA 2VLAA 4XIDA 4GGGA 1W5CC 2WY7Q 5DCFA 3T1BA 2IGMA 4EM0B 5J1RA 1DU6A 1UFMA 3IWZA 3OYHA 3TBIA 2G9WA 2HOEA 3SHFA 2BW3B 2GA1A 4CYCA 3H5RA 2WTEA 4CCKA 2LC2A 4KITB 2R7RA 3NARA 1SC7A 3VYSB 3JSPA 5DCMA 3QU6A 4BE1A 1WFXA 1NHAA 5H20A 3I9V2 3RQIA 2FNPA 4L9TA 4V2FA 5HS9A 4A3KJ 2QQAA 4OAYA 1I27A 2MW8A 3WTZA 3FHNA 2HI3A 3O3KA 4IOAF 1OLTA 2EA2A 4QLCU 2LVSA 5TJJA 4G7ZF 5E8GA 4XBFA 3A1YA 1S7AA 1IW7F 5HLHA 2GLOA 2CRGA 2DYRH 2KIMA 2ZJRF 4IX7A 4PJJA 3GTKJ 1MNDA 3K9TA 1TW3A 3BZCA 3A03A 4OIRF 4CYCB 2Q2EA 1K6OA 4NDLA 5DCMB 2ECBA 2FUG2 3HTUA 2B63J 4LG0A 3HHHA 3DBHB 3MN2A 2XAQA 2W57A 1LKXA 3M1EA 2HKOA 3OS2A 2BV6A 2WV0A 3I4MJ 3TW6A 4UV8A 2AQEA 1F5TA 3JRGA 4BXXJ 4A3IJ 2E19A 5J1UA 3K2ZA 3VEPA 2LNBA 1G6NA 5D4RA 2Q2EB 4RAFA 1X1CA 2W25A 3W2WA 3M1CA 4HV6A 1UHMA 4LG0B 2LG4A 2V1NA 3GF2A 3W6VA 4XSZF 1AOYA 2V1XA 3LSPA 5KNLA 4GDFA 2E36A 1HSTA 3ZQGA 1IUFA 2MD0A 2GOXB 3GCMA 2KP6A 2Z3YA 3PFIA 3V7SA 5J4YA 1YX3A 1ZLJA 1OQYA 2XAGA 1D5VA 1QPMA 2D5VA 3HOXJ 1H0MA 1HQCA 1N25A 1ZRDA 4EV0A 3CESA 2L7FP 4LIVA 3T5XA 4LLNA 3ZQQA 1SANA 1VQ6I 4BH9A 1UHWA 1UJ8A 3VSKA 1A6QA 1EJ9A 1B9NA 2CSOA 4DYCA 3JRIA 3CUQA 3CCEI 3GBGA 3FBIB 3QYFA 4EJUA 3JRDA 4DBQA 4DOZA 3PFYA 5AONA 1SD6A 2PX9A 2OZUA 2FBKA 2QLZA 3LSJA 1XCBA 3R0JA 3S2WA 2Y0SA 3ABLH 4B3XA 1FSEA 1MW7A 1JJ6C 1Y8RB 3KYCB 4A6EA 1H88C 5CVJA 3MFKA 3Q0WA 2L5QA 1R9TJ 1QZEA 1B72A 2E1NA 2E1OA 3BG5A 3K69A 4NC7A 2M0MA 3G2BA 3S1RJ 3GTOJ 3BG7A 2BVLA 3DKWA 4E7SA 2OPTA 2DYSH 3IV5A 1VQ5I 2HPMA 2VOPA 2BXYA 2E71A 2HQAA 2EV0A 2OA4A 1SD7A 1MMNA 2VPRA 1IXSB 1BOAA 3V42A 2LR8A 2K9NA 1ETVA 5FKKA 1R1TA 4BAYA 2G7UA 4M3GA 4U0YA 1DPRA 1HSJA 3T0YA 5BMZA 5J40A 4OIQF 4L9NA 3I55I 3BTJA 4Q48A 2R5ZA 4DGWB 1YOVB 5K5QA 2CQKA 1BI0A 5EGOA 3HM5A 3EETA 4RGSA 1LB2A 2Z1DA 4BJ5C 4YFXF 1O3TA 5DUIA 4A0YA 1IDYA 4A3DJ 1LE8B 4U7DA 2NOGA 4B48A 5JHFA 1A04A 3DPTA 4ANJA 1XMXA 3VYTB 3EUHA 4RGUA 1G8XA 2R5ZB 3K4NA 5D5XB 2DO7A 5EGOB 2HQ5A 1E3HA 1G59A 1WWXA 3KE2A 4IHYA 3MAJA 4Z6YA 1FPQA 2LDUA 4PFPA 3ZMZA 1P9QC 2F5EA 3HGGA 3MQ0A 1KU9A 3WG7H 4AUXA 1IN4A 1OMIA 1YW9A 2JVGA 2H8RA 3OYLA 1YJNI 1A35A 1IRZA 2IPQX 3IH2A 3E0JB 2Q8KA 2EFWA 1WJCA 5F04A 2ZXWH 3M3YJ 3HOZJ 5IY5H 1UELB 5F0HA 2IP2A 1ZELA 3K7AJ 2JA2A 5K5OA 4XONA 1ZH5A 1TTYA 4ESFA 1XCVA 3ABKH 4FETA 3ZMTA 2HPIA 1TWCJ 3ASNH 3AL0C 1E17A 2NNYA 6PAXA 4FX0A 4OAZA 2JA8J 1FTTA 1ETYA 2KMUA 4FISA 4HSRA 2QYOA 1LJ9A 3ONQA 1W5TA 3NQOA 1TNSA 2V9PA 5JHUA 1D1AA 1UG2A 1GV2A 2GBYA 2L0KA 1BN5A 1SFUA 3CMAI 2ZFUA 2M4GA 3WU1B 4ETSA 2W82A 3B02A 4MLOA 2KIQA 3DU5A 1CF7B 2CW7A 2ZMEC 4NUBA 1WJBA 2GOMA 4UXNA 3CCLI 1VQ7I 2EV5A 3L00A 4UUTA 2VOOA 3E5QA 2X48A 1SMYF 1DGRM 2F5DA 3S2HJ 1XX5A 5D5WB 2DTZA 1UG0A 3TDZC 2OCCH 4PCQA 2QQ8A 4G94A 3K1PA 4W97A 2H8WA 4II3A 5FROA 1D3YA 2ID3A 2ZO4A 5LD2C 2HOAA 2DJIA 2Y0MA 2IGNA 3C7JA 2H1KA 3KLOA 5HNHA 5LBQA 1NTCA 1E3PA 1FSHA 1WQ2A 3WE2A 5EZHA 4F7ZA 4B1RA 2R7SA 4M9ZA 1QO0D 4XQFA 1CQTA 2XB0X 3EUKL 4RAZA 2O6GE 3TQNA 1YO5C 1FMWA 4L0ZB 2A68F 4BEHA 4M3EA 4U0VA 4XOPA 1TWAJ 2LP0A 1D0XA 4G9YA 2D1HA 3KYDB 4XLNF 2CG4A 2IA1A 4PFOA 1RUNA 2YU9J 4CHUA 4LJZF 2R93J 1LEBA 2GWRA 3G71I 5HDKA 3LMMA 2DQRA 2XRLA 2WWYA 1U6GA 3RYRA 2DTRA 1QHGA 4FQGA 3I59B 3M7GA 3PO3J 3VWBA 2NYXA 1JXSA 2YX4A 2DT7B 3HOTA 2IT0A 2O9LA 2F4OB 3CCYA 5K1YA 2ZCWA 1JUMA 4YIRX 2XC7A 5FD6A 4A93J 4YEJA 3J80K 3QPTA 2E1CA 1MIJA 1MNEA 2VODA 3KZZA 5B1BH 1FBUA 5HDGA 2QKLB 2ZJPF 2Y75A 2DOEA 2XAUA 4Y33A 3TKYA 1YW8A 1KZHA 1Z21A 2JQ7A 3L2CA 4A3CJ 4M73A 4OMYA 1DU0A 5BPIA 5FD5A 5M3MJ 4P96A 3SYTA 3BTCA 4HF2A 5IYDJ 2L7KA 2EINH 2VT3A 4UV9A 4IJAA 3HL2A 1IRXA 4EJVA 3L2QA 2DA6A 3O8HA 3L2UA 3COAC 4BE2A 1T33A 3E6MA 2MD5A 3GFMA 2VE9A 2VQLA 1XN7A 1U78A 1XDUA 2KIFA 2JVHA 4TV7A 2OZ6A 3MKLA 1OCOH 4RBOA 3W2AA 2W7NA 4AIKA 3F23A 3CCSI 2HXOA 4RM2A 1Z67A 3D1NI 2VT2A 3TEDA 2HNHA 3JRHA 5B1AH 4D0PA 3WTUC 2OC6A 3F8CA 4HQMA 1TZLA 4QIWN 5LEJA 2MC3A 4LGWA 1MBJA 3OSGA 1WPKA 4CUGA 3DLAA 2Y9ZA 4LK1F 3N05A 1DP3A 4Y52J 1BM9A 1YG2A 3CO6C 1LQ1A 2J5PA 5GTHC 2FBIA 2OTJI 4DBRA 1MSFC 2M9HA 3IH3A 3NRVA 5FLMJ 5HVQC 4UB8C 3E97A 2DJNA 2HOSA 3MKYB 3PL8A 1VQOI 4ESJA 2IA2A 1ETOA 2K5CA 4HNVA 1VFCA 3C18A 1FY7A 5IP9J 4NBQA 3J80Z 3QOEA 3K4LA 1RR7A 2M45A 2BYVE 1TWFJ 1MZBA 1R4NB 1OISA 4MQ9F 3BROA 4GCVA 5CYVA 1RRJA 2Z5UA 3CJNA 4NC8A 5BNGA 1D0ZA 3ABTA 3DFGA 3BCBA 3OYDA 5JVTA 3KP7A 3GO5A 3F72A 4X0GA 5JR3A 3SDBA 3OYNA 2XDVA 1D8JA 2OQRA 1W1WE 4UVCA 3W6JB 4ITVA 2AXTC 1S8NA 4RB0A 2COBA 2AQFA 3WTTC 5DEQA 3K4KA 3IP4B 4AVPA 1X1PA 3V8KA 2WB1N 1J2XA 2HQNA 3DF8A 4RAGA 3V4GA 4C9YA 4F3QA 5CVVA 3OYBA 1YJWI 1RR8C 3JTGA 2STWA 2KJCA 2RDPA 5E1XA 1N78A 4XKVA 2IXSA 2CV2A 3FF5A 4I7HA 3RQ4A 2VIXA 3LA7A 2FNAA 4PJNA 5DD8A 1EH6A 3K0LA 4YFNF 3G1OA 5BPDA 5J47A 5IOZA 2CUFA 3I53A 3CP8A 1P7JA 3JTHA 4AD9A 4EMSA 2UWMA 1X1AA 4MQVA 2X1CA 3WTWC 1JGGA 4YIIA 2CH0A 2R5YA 3RKYA 1YI2I 1X3UA 2XF7A 3JSOA 1VNDA 4D7NA 2WV1A 2VL8A 5FGMA 2Z33A 4EGZA 1BC8C 1J0RA 3BP8A 1ULYA 1Z7UA 3U1KA 3SFIA 2HR3A 2L7ZA 3EUAA 3LL7A 4I0AA 2KZGA 5L3EA 4OINF 4EJTA 2ETHA 2HVQA 4HNTA 3R6SA 3SZGA 2A6TA 4KMUX 2P81A 3A0BC 4HW0A 3HSEA 3LAJA 5BOXA 2FMYA 3FKJA 3I3LA 3D5LA 4D5FA 2R5YB 4DJAA 2VKDA 2EJRA 2K9LA 5CLSA 3EQLF 1U0JA 1OKRA 4ZC3A 1HKQA 4IPAA 4II2A 5CVRA 4CGZA 2K40A 1MJAA 4U88A 3HPGA 2WAQA 1E0EA 1D1CA 1BW6A 4XN0A 2IGOA 4HQEA 2LMDA 2QSHX 2I5UA 4C2MJ 1I50J 3Q9SA 2E5ZA 4M9XA 3PUFA 3KEQA 1BIAA 3VDXA 3L09A 2XPVA 4BQQA 2HDCA 1A31A 2DU9A 1N75A 3CUOA 2BEOA 2QSFX 2XRNA 4XLHA 1KQ0A 4A69C 3F8NA 3PUBA 2R3SA 1YX5A 1X4OA 2EB7A 2YX7A 1U8RA 2E2JJ 3WTVC 1MH3A 1TC3C 4IQJA 4XLCA 1JTYA 3HRTA 1QU3A 4AWXB 5FKLA 2LSOA 1PP7U 2XAHA 1JT6A 4KISA 5GPAA 2ELJA 5IPAA 2HTSA 1VQMI 1A5JA 4E7IA 2VJJA 1WJ5A 1Y0UA 2L9RA 2PN6A 2V7FA 3OYCA 2XAJA 5GAEJ 4ENMA 4K2EA 5CKTA 4S05A 4MEXF 5LHIA 1JKRC 1WI3A 2CUZA 3Q0VA 2MH2A 4IHXA 4LLGF 5DUKA 3G6EI 3WU2C 2UZKA 4IHWA 2A5YB 2DA1A 3KP5A 2A6EF 3ESWB 2B9SA 1KYZA 4BNCA 3O6BB 2P5VA 1ZRCA 1L0OC 3Q3SA 4JBAA 4S04A 2OV7A 4FCYA 3FM5A 1ZLKA 2JA7J 2K85A 1R4MB 3S3NA 1YITI 4RS8A 2X6WA 1QBJA 5E3LA 4BQNA 1OCTC 3EDPA 2UXNA 3ZMDA 5F1JA 3HEFA 2M2EA 5DTDA 5M5YJ 1BW5A 1O3QA 2XV4S 3IUOA 2DMTA 3BC8A 1Z6RA 1K6YA 2LKPA 2KISA 5FLVA 2PFBA 3F3XA 2IS1A 1MGTA 5HLTA 3RKWA 3OYKA 3E6CC 2QSGX 2XF5A 3A01A 1V55H 1X2MA 3CUQC 4WCGA 3GWZA 3S14J 3RZDJ 4ZTJA 3HKZN 1YFHA 1Z0XA 1WJAA 2QGUA 2R7TA 1MMGA 3S1NJ 2ZJ2A 3DTKA 5LHHA 2R92J 2CUEA 3HRMA 3U1DA 1QGPA 1FOWA 1O3SA 3B73A 1IF1A 3HOUJ 3S32A 3M4OJ 1V3FA 1J5YA 1Z77A 2XASA 1ZRFA 4D1QA 4HF0A 1MJ9A 4I6ZA 3DP7A 5FRMA 2JTVA 3A01B 2BE5F 2A6HF 3ABMH 3KP2A 2BHYA 4PDKA 4HOBA 4PUSA 1DDNA 2FBHA 2BW3A 4O3MA 3BTLA 4B4CA 5DM6F 2EH3A 1SAXA 3WE3A 1PYVA 2D2WA 2ZB9A 3U9GA 5LGUA 1STZA 5FJ8J 4YG2F 3MKZA 2HTJA 4ZYGA 4V19K 2QCOA 4AVZA 2W4SA 3BDDA 2VQHA 1ZGWA 1X1DA 3H0DA 2V1UA 5LGTA 1FYLA 4QTRA 2O0YA 2H27A 4UUSA 2CV0A 5GPCA 3KP3A 3P9IA 5D5VB 1Z1DA 4XLFA 2XAFA 3DV8A 2X9DA 4E7ZA 4PJLA 1WJEA 3F9KA 4HF1A 4BE0A 3EUHC 3WG9A 2R7FA 1QPIA 1H9GA 2CU7A 4O5VA 1UHSA 3GTLJ 1GXPA 4HX8A 1B8IA 4S0HB 5FLXK 4HDVA 5IYCJ 3LFKA 4Y3OA 3E3VA 3TO6A 2DMQA 4N4NB 4A12A 2ZXJA 1I6XA 4UUSB 2Y0SN 2MA3A 1AA7A 2M1BA 1J9IA 2O5RA 3BPVA 4D9JA 5E8IA 3HKZA 2RAEA 4D7MA 2ZSHB 4EATA 3LA3A 2YU3A 2QZ8A 5FKNA 2ZBKA 3FMRA 5IOYA 2P7CB 4MFDA 3KZIC 2KRFA 1FP1D 3ML6A 2X85A 4GXOA 3TO9A 1B8IB 4CCOA 4NQWB 4OWRB 3L2RA 5E17F 3OSFA 3OYFA 2K27A 4AIHA 3HG9A 2DLLA 1P2FA 4KT5C 1HW2A 3GXOA 3H92A 2H6CA 2IGKA 3K10A 4Y7NJ 2DOFA 3ZQCA 2XPWA 4XL9A 3DTIA 1WCMJ 1JKPC 4A3EJ 2GIZA 4A0ZA 1SMTA 1ZG5A 1GV5A 5M5XJ 2UUZA 1YTYA 1LDJA 3AFHA 3CMYA 1SVLA 3GMEA 1JTXA 4A3JJ 4IQ4A 3S2DJ 2P4WA 1R1UA 5JFRA 4IOCF 1RC9A 2DDAA 3TGNA 2FX0A 2F5VA 1IN8A 2Y48A 3CJQB 5D5UB 3BWGA 5K7HA 4XSXF 3TL4X 2CQNA 3ERMA 2Z99A 3CCRI 5J3LA 2XB5A 3ECHA 4NNJA 3OYIA 3GEZA 2XPUA 2IEKA 2DQLA 4M9SA 1X4PA 2BY0A 3ZMUA 4FE7A 3CF2A 1OPCA 3K2AA 5FFXA 1X58A 5E3MA 3GTPJ 3C2HA 1HW5A 3CCJI 3OY9A 4ENJA 4HSTA 3GYHX 2R7ZJ 2V1DA 4C3JJ 1A6IA 4R1HA 4MFEA 2DCEA 5CVUA 2DA3A 1ZQ3P 4YRVA 1TNTA 3OS0A 4HZFA 3FX3A 1HDPA 4A3GJ 4MNUA 3WTYC 2COMA 2V4JC 2WBMA 1ON1A 2NVQJ 4IKFA 1NG6A 1S6LA 1T0FA 4DIQA 3K4JA 3SJMA 2CYYA 4DYQA 5F6FA 1FIAA 4MTDA 2AO9A 2JZYA 2UXXA 1G2HA 1YYVA 2IBDA 1MMAA 2YSRA 1LE8A 2F4MB 2DOAA 5GADJ 4ZYHA 3RZOJ 1QNTA 3OOPA 4LMYA 1AU7A 2YS9A 3QODA 5D8LB 5ICFA 2M8EA 2Y31A 3ROUA 4J01A 1O3RA 1D5YA 4RMNA 1H9TA 3HBLA 3DPUA 2YPRA 2LLKA 4WK8F 3OL4A 1JHHA 2QWWA 4W1UA 4ZJZA 1S29A 5TISC 2LBFA 4JYKA 3RPUA 5LLQA 3JCUC 4AIJA 1XGNA 1PVEA 5KHDA 2LD5A 2MLGA 1S9HA 3SDGA 1Z6TA 2HYGD 5GTIC 2QA4I 1EF4A 2E1MB 3FK7A 4FHTA 1ORKA 2DDBA 4L9VA 3KP6A 4G12A 4XMYA 2LF7A 4B47A 4BQOA 3H9QA 4M72A 1BI2A 1ZHFA 4RA2A 1U9OA 4GYGA 3QP5A 1O57A 1RKWA 4M6XA 1U2WA 2K4JA 2L02A 2RC4A 4RLFA 2ME6A 2L9NA 3NEUA 2LBFB 1FEXA 3BR3A 3FMSA 1IO2A 3ASOH 4Z2YA 5EEHA 2HZTA 2I10A 4EQQA 1K78B 2CV1A 2B7EA 1HKTA 3BJ6A 2OCEA 2BXZA 1CF7A 4MHGA 4UY8I 2OUMA 4EJWA 3KFWX 1W7PD 1KA8A 4UNOA 1Q1HA 3G4SI 4LIUA 3QPLA 4XORA 5AIPA 3ZQLA 4RB1A 4CCMA 3GW2A 2OTLI 2EQRA 3ZGKA 3KCCA 3PSIA 4JX6A 3AAFA 1GDTA 1X1BA 3V8LA 2EZHA 4BBSJ 1W0UA 1OJLA 3QPSA 4A3BJ 2ICWG 5J8FA 5JLWA 2P6SA 3J7AY 2JSPA 4KDPA 3CQZJ 1Y56A 4JQFA 2FE3A 5CJ9A 2FF4A 2N8GA 1R71A 3F6VA 1LPQA 1IXRC 3LSIA 4IEJA 3LAPA 3H9JA 1IAWA 2M5WA 1TBXA 2CJJA 4XR6A 4KUMA 1JE8A 2ZJQF 2M87A 3KEYA 1CGPA 1XSDA 3JR9A 3M8EA 3I59A 3IL2A 3GZ5A 3UNGC 3JAMK 2HQRA 2VBXA 2TDXA 1UMQA 3GZ6A 3JRFA 3RI4A 4RM3A 3N4MA 1BR4A 4GRIA 2AHQA 2XROA 3K4CA 4I2OA 3WHCA 4OU0A 1JGSA 4PJ0C 3ZPLA 3FXQA 3HOYJ 5M3FJ 3VODA 4IVNA 5L3GA 1EA3A 3PJRA 1HXDA 4I02A 1USSA 1J59A 1I1GA 1UZCA 2IRFG 3F8BA 1YJ9I 3FWEA 3A0HC 3VPRA 3OL3A 1MD0A 3D5SC 2P5KA 2KRCA 3O8GA 1XC5A 2RREA 1GVDA 3H9GA 1JT0A 1HCRA 2IJLA 4IO9F 5IP7J 2GXBA 2ZXHA 3DKXA 5EEAA 3QYEA 2MABA 4G7OF 3PNYA 4ZH4F 3PIOF 1R36A 1JUSA 2DMUA 3OS1A 2ELHA 1KU2A 1FNNA 3MVPA 1GT0C 2PJRA 1MMSA 4C3HJ 3K70C 2VXZA 1Z7LA 1G3TA 2RQPA 3S17J 1ZN2A 1MBHA 1IV8A 1UAAA 5BQTA 2XKOA 4HDUA 2M7BA 3FK6A 3CDHA 4I09A 1HKSA 2XSDC 3WTSC 2WAFA 1LVAA 2TCTA 1SFXA 4IXAA 2LYCA 5ICCA 5HS7A 4P1WA 4CYDA 1MBKA 5KK1A 2ZSIB 1WJDA 1B1BA 3CC7I 3IAM2 2PJRB 1BJAA 3WTXC 1QHHD 3GTMJ 1V5EA 3G1MA 2VI6A 2A05A 2M30A 2R7UA 3M07A 2VQGA 2QKMB 5GAHJ 5D4SA 4F92B 2K9QA 3BR6A 1P7IA 3P9KA 3LSGA 5FFZA 4MGRA 4XRSA 3BR2A 4HAMA 3I4PA 1GUUA 1DGWY 1XMKA 3GUDA 3HPHA 1WI9A 3JRBA 4RGRA 1OYIA 5H6QA 3ZR8X 3AKZA 1X2NA 1BI1A 3HC7A 4I01A 2GM4A 3MCZA 2BY2A 1KGSA 2M7AA 5EEGA 2GZWA 5LEKA 1F43A 3CCUI 1X3WB 3B6AA 3W3CA 1IRGA 1LFPA 1O7LA 1KYWA 3ZN0A 4ENNA 3DQVC 1TLHB 1ETQA 2W85A 2JPBA 1OCRH 3FZVA 4EVIA 1P92A 1T98A 2MG4A 3PSFA 4ENKA 2EIKH 2FMLA 5B5EC 5C3EJ 2HDDA 2CFXA 3ZRGA 2WAQN 4EM1A 4Y17A 3S1MJ 5HLIA 3T8RA 4UVAA 1SEUA 2NS0A 2ISYA 3HRUA 5FKMA 3CCVI 2LKSA 3MEXA 1IC8A 3F0CA 1LNWA 2ELKA 3DEWA 4XRFA 4ASNA 3M9AA 3G1LA 3KX2A 4Y13A 1LVKA 3BPXA 5M5WJ 4I76A 4DYRA 2DMNA 5A2QK 1GLNA 1KQ9A 3FXJA 2WC2A 3S3MA 4E70A 4ZTFA 3LSTA 4N0BA 4XM3A 2PJPA 1B59A 2X1DA 5FB2A 1N77A 3QU3A 2WADA 5GAGJ 2F5CA 2DAOA 3KZYA 3LNQA 2X1EA 2XIGA 3FMQA 1NG7A 2MYSA 2QM3A 3SZPA 4A0XA 4MIMA 2LKXA 1S7EA 2EZIA 4LK0F 1XGOA 1YQAA 2LH9A 3ZQHA 3GTGJ 3Q5FA 3FDYA 2XHKA 3ZMSA 3QOPA 2ISZA 2BVMA 1HC8A 2R7VA 4C2TA 4PK4A 4LOCA 4HLYA 3B6CA 5E18F 2BY1A 3DTEA 3FXKA 4F52A 2VXDA 2VBWA 3FISA 5JLXA 3H35A 1IGNA 1YIJI 1LDDA 2XGDA 1BA5A 1SD5A 3JRAA 3SQNA 3FXLA 2KJBA 5TRDA 2ZNYA 5J6XA 2F48A 1T38A 2X0LA 4XNFA 2HXIA 1SD4A 3OOUA 1IN5A 2H94A 3AG4H 3F8FA 1ZR2A 4HV5A 2OQGA 2QQBA 4J19A 3VFZA 4U7BA 2NRAC 2JRTA 3OIPA 5ERIA 4ZDOA 1KU3A 4KN7X 1ZGJA 2CGPA 2K9SA 4L0YB 4BL0B 4AIDA 2W48A 2P0WA 4XRSG 2GXAA 3HGYA 4M71A 4WF2A 3WGGA 1DP7P 2W84A 1Y1VJ 2L2OA 1YLFA 2XGCA 5KAFC 2NOJB 4KMFA 3LWFA 3DEEA 1G4DA 3LQQA 5F64A 5ED4A 2CQ7A 3V7RA 2R7OA 1FT9A 1Q1VA 1MDMA 5K7FA 1MNMC 2PQ8A 2R7DA 1O4XA 2PG4A 1V5FA 2QEXI 1Z3YA 2Z2SB 4AU7A 1MH4A 2FOKA 5JVGF 4KJZA 5IT9K 1U5TA 4IHVA 2E2HJ 3KETA 3CD6I 3IRRA 4FTHA 1G3SA 4DW6A 5KCMA 5IP6A 1PDNC 3HTSB 1TWGJ 2OF7A 5DDGA 4RB3C 3S15J 4IL6C 3CCMI 5F08A 4E7LA 2IS6A 1IV6A 4Q5SF 5C4XJ 2QQ9A 4RDUA 1E3OC 3TOAA 2GXGA 4ZYEA 1MDMB 2VPLA 3REOA 2MGQA 3QWLA 3HRSA 2IS4A 2HOTA 4HX7A 2NVUB 2NVXJ 3HUGA 2JUCA 4KA4A 1U5TB 3EYIA 5LRSA 5ILUA 3CC4I 4OMZA 1QQIA 4PGGA 1ODDA 1W4MA 1K61A 3BR1A 2W24A 3ZN1A 1R1VA 2HYJA 1U3EM 3S93A 1XSXA 2FEZA 4M74A 2L54A 5K5RA 3OIOA 3OYGA 2Y69H 4UVBA 2ZFWA 3HUGB 5FKOA 3GVAA 3KP4A 4IF4A 2XGXA 4XK4A 3MD2A 4BJ6C 4KYWA 3FHZA 4H4KC 2KL4A 1R5HA 2EFNA 1ETKA 4XICA 3CCQI 5HS8A 3I64A 2GQQA 1XPXA 1ZAOA 3PNVA 1KQ8A 2BGCA 1I39A 1IDZA 4RLQA 1LFBA 2L01A 2K3PA 2YR2A 1IZ1A 5L3BA 1HLVA 2VASA 1RNLA 1BL0A 5CQEA 1G3WA 2CWEA 3OR1C 2M3AA 2H6BA 4O6JA 3OYJA 3VOEA 1S72I 2NAZA 2X4HA 3ZOBA 3WU0A 4A3LJ 4HPQA 1YRNA 1T08B 4BBRJ 1RESA 4CDGA 1VQ8I 4YFKF 2IW5A 4E6KG 4E4HA 2E35A 3I71A 1T0FC 2CFOA 4ON0A
chains in the Genus database with same CATH topology
3ZQIA 2R93J 1ENHA 3GTJJ 4AYBN 2XRLA 3FKIJ 3SJMA 4DYQA 1FIAA 2AO9A 1G2HA 5C44J 2XGEA 2IBDA 3PO3J 1LE8A 2O9LA 3CCYA 3RZOJ 1JUMA 1YRNB 4DZPA 4A93J 1AU7A 2YS9A 2Y31A 2VKEA 2JMWA 2QF7A 1VF9A 1H89C 1D5YA 3BG3A 4M3FA 3HBLA 2R0QC 4L5EA 4A3CJ 2LK2A 1DU0A 2LLKA 3BR5A 4W1UA 1MBEA 5M3MJ 1NK3P 2EBIA 3E7LA 2CQQA 4JYKA 1XS9A 3BTCA 5IYDJ 3ZQFA 2LD5A 2NS8A 4X1EA 3SDGA 1EF4A 2DA6A 3L1PA 3FK7A 3O8HA 1T33A 1ORKA 2G0EA 5EG0A 4G12A 3TP0A 1U78A 2DA5A 3FIWA 3MKLA 4RBOA 1U9OA 1RKWA 2DA2A 2HXOA 2FJ1A 3TP3A 2ME6A 3D1NI 3TEDA 3PO2J 3JRHA 1FEXA 1HF0A 3BR3A 3TW7A 4GFBA 1QVUA 3IH4A 4QIWN 2I10A 1ITYA 1MBJA 3BQZA 3BR0A 3OSGA 1WPKA 2JWTA 1RPWA 2Y9ZA 1MBFA 5EG0B 4Y52J 2IAIA 2O8KA 1Y1WJ 1T56A 1I6HJ 4C3IJ 1MSFC 2M9HA 3IH3A 5FLMJ 1W0TA 4BKXA 3QPLA 5DS9A 2ECCA 3ZQLA 3BT9A 2DJNA 2HOSA 1QVTA 1ETOA 1APLC 4HNVA 1VFCA 2EQRA 4JX6A 5IP9J 1GDTA 2KT0A 3I4NJ 1ZK8A 5GP9A 3HB9A 2EZHA 4BBSJ 1RR7A 4FE4A 1W0UA 1OJLA 3QPSA 2FQ4A 1TWFJ 1TWHJ 2TRTA 2E2IJ 4A3BJ 5JLWA 3GTQJ 1K83J 5HODA 9ANTA 3CQZJ 1NK2P 5BNGA 2N8GA 4IEJA 4V2GA 3JREA 3PM1A 2CJJA 1FJLA 2DA7A 3WHBA 3HDDA 3Q0UA 2COBA 3JR9A 3BQYA 1LFUP 3HOVJ 2ME0A 2WB1N 1UMQA 5EZGA 3JRFA 3NAUA 1BJZA 2LY9A 3BG9A 2AHQA 3LOCA 1IJWC 4JX4A 3WHCA 2JK3A 1I3QJ 4A3MJ 4JP0A 3HOYJ 4B3AA 4EEFG 1PUFA 5M3FJ 3G1OA 2NVQJ 5IOZA 2CUFA 1POGA 2DN0A 4AC0A 2X6OA 1P7JA 2JN6A 2JA5J 2JA6J 1JGGA 2R5YA 2ID6A 2JJ7A 1WH5A 3VPRA 1VNDA 2LTPA 2M8GX 4XRMA 4D7NA 2WV1A 1OCPA 3O8GA 1XC5A 1GVDA 1JT0A 3QQAA 3SFIA 1HCRA 2L7ZA 5J1YA 2NVYJ 1PUFB 3H0GJ 2MSYA 1ZTRA 5IP7J 2P81A 1RETA 1JKQC 5EEAA 1IG7A 5IYBJ 1JUSA 4M3DA 2DMUA 2NVTJ 4D5FA 2R5YB 3S16J 3MVPA 4JX5A 1GT0C 1HOMA 1MBGA 4C3HJ 4XIDA 5J1RA 1B72B 3S17J 1DU6A 2EZLA 1MBHA 2YUSA 4A3FJ 2K40A 3CDLA 3FK6A 4CYCA 3S1QJ 3NARA 2XSDC 1BW6A 4M6VA 2TCTA 2Y2ZA 3RQIA 4V2FA 1I50J 4C2MJ 4A3KJ 1MBKA 2MW8A 2HI3A 3DCFA 5EF6A 2O7OA 2XPVA 2LVSA 4D5CA 3GTMJ 4A69C 2GLOA 2CRGA 3G1MA 2VI6A 3GTKJ 1SFOJ 2E2JJ 3A03A 1MH3A 4CYCB 1TC3C 1JTYA 4NDLA 2K9QA 2L7MP 3BR6A 2ECBA 1P7IA 5FKLA 3LSGA 2B63J 1JT6A 4XRSA 3BR2A 2KDZA 1GUUA 5GPAA 3MN2A 5IPAA 2M0CA 1A5JA 3JRBA 3I4MJ 2L9RA 5EYRA 3TW6A 1X2NA 2GM4A 4BXXJ 3JRGA 4A3IJ 2E19A 5J1UA 1F43A 1JKRC 1WI3A 3Q0VA 3B6AA 4IHXA 1JUPA 4DZJA 4IHWA 3H3VK 1ETQA 2DA1A 1H8AC 5F0FA 3W6VA 1WGXA 2MG4A 3Q3SA 3LSPA 4FCYA 2JA7J 5C3EJ 3ZQGA 1IUFA 5K7ZA 2HDDA 2WAQN 5E3LA 3S1MJ 1OCTC 5E3OA 5FKMA 5F1JA 3F0CA 3DEWA 2ELKA 1IC8A 3HEFA 2D5VA 3HOXJ 2M2EA 5DTDA 5M5YJ 1BW5A 3G1LA 2L7FP 2DMTA 5M5WJ 4I76A 4DYRA 2DMNA 2LFBA 5FLVA 1SANA 2PMZN 1FIPA 5C4JJ 4X6AJ 3A01A 1X2MA 4DYCA 3S14J 3JRIA 3RZDJ 3HKZN 1Z0XA 3GBGA 4MO7A 5F0CA 3LNQA 3S1NJ 3JRDA 2R92J 2CUEA 3HOUJ 4MIMA 3M4OJ 2LKXA 3LSJA 1S7EA 2EZIA 1JJ6C 3ZQHA 1Z77A 3GTGJ 1VI0A 2NS7A 2CQXA 4I6ZA 1H88C 1ETWA 3Q0WA 4LOCA 3B6CA 1R9TJ 3A01B 1B72A 1JKOC 2E1OA 3BG5A 3FISA 5JLXA 1AKHA 3S1RJ 1IGNA 3GTOJ 1AHDP 3IV5A 3BTLA 2OPTA 4B4CA 2EH3A 2XGDA 3JRAA 2FD5A 1BA5A 1XG1A 2VPRA 2ZB9A 3A02A 4ABZA 5F27A 2DMPA 2LR8A 2K9NA 1ETVA 5FKKA 5FJ8J 1FTZA 4M3GA 2HXIA 2QCOA 2R5ZA 3OOUA 3BTJA 1ZGWA 5EGOA 1ZR2A 4J19A 3HM5A 4QTRA 2M34A 3JRCA 1AKHB 4UUSA 5GPCA 2K9SA 2X9DA 1IDYA 2W48A 4XRSG 1WH7A 4A3DJ 1LE8B 3HGYA 2NOGA 1MSEC 3C2BA 1Y1VJ 1QPIA 2CU7A 1UHSA 3GTLJ 2R5ZB 2XGCA 1U9NA 5EGOB 1B8IA 2HQ5A 4S0HB 5IYCJ 1JJ8C 2DMQA 4IHYA 4UUSB 1Q1VA 2Y0SN 5K7FA 1MNMC 3BTIA 3HGGA 4AUXA 5E3NA 1O4XA 3LSRA 5EDNA 2H8RA 2DA4A 1MH4A 2RAEA 4D7MA 1IRZA 3IH2A 4IHVA 2E2HJ 5F04A 3M3YJ 3HOZJ 4FTHA 5FKNA 4DW6A 5F0HA 5IOYA 4MFDA 1HDDC 3K7AJ 5IP6A 1B8IB 1TWGJ 2OF7A 3S15J 3OSFA 2EZKA 1QRYA 5C4XJ 5F08A 1IV6A 4RDUA 1E3OC 1TWCJ 2MGQA 1FTTA 2JA8J 2HOTA 4BY1J 1ETYA 2NVXJ 3RKQA 4Y7NJ 4FISA 3ZQCA 2XPWA 1ZR4A 1JKPC 4A3EJ 3HOWJ 1UG2A 1GV2A 2GBYA 2L0KA 1K61A 3BR1A 1GV5A 5M5XJ 2HYJA 4MLOA 3CMYA 1JTXA 2VKVA 4A3JJ 3S2DJ 4UUTA 2X48A 3OIOA 2FX0A 3S2HJ 5FKOA 5K7HA 2Y30A 4XK4A 2DTZA 1RKTA 4W97A 5J3LA 2XB5A 2ID3A 2VUMJ 1ETKA 4M3BA 4XICA 1F36A 3UKGA 2HOAA 2XPUA 2IEKA 2H1KA 4FE7A 3K2AA 1NTCA 1IDZA 1X58A 5E3MA 1LFBA 3GTPJ 4BY7J 5EZHA 1ZKGA 4B1RA 1HLVA 1CQTA 2XB0X 1BL0A 2R7ZJ 4C3JJ 1U8BA 1A6IA 1OFCX 4MFEA 2Y9YA 4M3EA 2DA3A 1ZQ3P 3ZOBA 4A3LJ 1YRNA 1TWAJ 4BBRJ 1RESA 2LP0A 1HDPA 4QSHA 4A3GJ 2YU9J 1ETXA 1WCMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQI A;  2R93 J;  1ENH A;  3GTJ J;  4AYB N;  2XRL A;  3FKI J;  3SJM A;  4DYQ A;  1FIA A;  2AO9 A;  1G2H A;  5C44 J;  2XGE A;  2IBD A;  3PO3 J;  1LE8 A;  2O9L A;  3CCY A;  3RZO J;  1JUM A;  1YRN B;  4DZP A;  4A93 J;  1AU7 A;  2YS9 A;  2Y31 A;  2VKE A;  2JMW A;  2QF7 A;  1VF9 A;  1H89 C;  1D5Y A;  3BG3 A;  4M3F A;  3HBL A;  2R0Q C;  4L5E A;  4A3C J;  2LK2 A;  1DU0 A;  2LLK A;  3BR5 A;  4W1U A;  1MBE A;  5M3M J;  1NK3 P;  2EBI A;  3E7L A;  2CQQ A;  4JYK A;  1XS9 A;  3BTC A;  5IYD J;  3ZQF A;  2LD5 A;  2NS8 A;  4X1E A;  3SDG A;  1EF4 A;  2DA6 A;  3L1P A;  3FK7 A;  3O8H A;  1T33 A;  1ORK A;  2G0E A;  5EG0 A;  4G12 A;  3TP0 A;  1U78 A;  2DA5 A;  3FIW A;  3MKL A;  4RBO A;  1U9O A;  1RKW A;  2DA2 A;  2HXO A;  2FJ1 A;  3TP3 A;  2ME6 A;  3D1N I;  3TED A;  3PO2 J;  3JRH A;  1FEX A;  1HF0 A;  3BR3 A;  3TW7 A;  4GFB A;  1QVU A;  3IH4 A;  4QIW N;  2I10 A;  1ITY A;  1MBJ A;  3BQZ A;  3BR0 A;  3OSG A;  1WPK A;  2JWT A;  1RPW A;  2Y9Z A;  1MBF A;  5EG0 B;  4Y52 J;  2IAI A;  2O8K A;  1Y1W J;  1T56 A;  1I6H J;  4C3I J;  1MSF C;  2M9H A;  3IH3 A;  5FLM J;  1W0T A;  4BKX A;  3QPL A;  5DS9 A;  2ECC A;  3ZQL A;  3BT9 A;  2DJN A;  2HOS A;  1QVT A;  1ETO A;  1APL C;  4HNV A;  1VFC A;  2EQR A;  4JX6 A;  5IP9 J;  1GDT A;  2KT0 A;  3I4N J;  1ZK8 A;  5GP9 A;  3HB9 A;  2EZH A;  4BBS J;  1RR7 A;  4FE4 A;  1W0U A;  1OJL A;  3QPS A;  2FQ4 A;  1TWF J;  1TWH J;  2TRT A;  2E2I J;  4A3B J;  5JLW A;  3GTQ J;  1K83 J;  5HOD A;  9ANT A;  3CQZ J;  1NK2 P;  5BNG A;  2N8G A;  4IEJ A;  4V2G A;  3JRE A;  3PM1 A;  2CJJ A;  1FJL A;  2DA7 A;  3WHB A;  3HDD A;  3Q0U A;  2COB A;  3JR9 A;  3BQY A;  1LFU P;  3HOV J;  2ME0 A;  2WB1 N;  1UMQ A;  5EZG A;  3JRF A;  3NAU A;  1BJZ A;  2LY9 A;  3BG9 A;  2AHQ A;  3LOC A;  1IJW C;  4JX4 A;  3WHC A;  2JK3 A;  1I3Q J;  4A3M J;  4JP0 A;  3HOY J;  4B3A A;  4EEF G;  1PUF A;  5M3F J;  3G1O A;  2NVQ J;  5IOZ A;  2CUF A;  1POG A;  2DN0 A;  4AC0 A;  2X6O A;  1P7J A;  2JN6 A;  2JA5 J;  2JA6 J;  1JGG A;  2R5Y A;  2ID6 A;  2JJ7 A;  1WH5 A;  3VPR A;  1VND A;  2LTP A;  2M8G X;  4XRM A;  4D7N A;  2WV1 A;  1OCP A;  3O8G A;  1XC5 A;  1GVD A;  1JT0 A;  3QQA A;  3SFI A;  1HCR A;  2L7Z A;  5J1Y A;  2NVY J;  1PUF B;  3H0G J;  2MSY A;  1ZTR A;  5IP7 J;  2P81 A;  1RET A;  1JKQ C;  5EEA A;  1IG7 A;  5IYB J;  1JUS A;  4M3D A;  2DMU A;  2NVT J;  4D5F A;  2R5Y B;  3S16 J;  3MVP A;  4JX5 A;  1GT0 C;  1HOM A;  1MBG A;  4C3H J;  4XID A;  5J1R A;  1B72 B;  3S17 J;  1DU6 A;  2EZL A;  1MBH A;  2YUS A;  4A3F J;  2K40 A;  3CDL A;  3FK6 A;  4CYC A;  3S1Q J;  3NAR A;  2XSD C;  1BW6 A;  4M6V A;  2TCT A;  2Y2Z A;  3RQI A;  4V2F A;  1I50 J;  4C2M J;  4A3K J;  1MBK A;  2MW8 A;  2HI3 A;  3DCF A;  5EF6 A;  2O7O A;  2XPV A;  2LVS A;  4D5C A;  3GTM J;  4A69 C;  2GLO A;  2CRG A;  3G1M A;  2VI6 A;  3GTK J;  1SFO J;  2E2J J;  3A03 A;  1MH3 A;  4CYC B;  1TC3 C;  1JTY A;  4NDL A;  2K9Q A;  2L7M P;  3BR6 A;  2ECB A;  1P7I A;  5FKL A;  3LSG A;  2B63 J;  1JT6 A;  4XRS A;  3BR2 A;  2KDZ A;  1GUU A;  5GPA A;  3MN2 A;  5IPA A;  2M0C A;  1A5J A;  3JRB A;  3I4M J;  2L9R A;  5EYR A;  3TW6 A;  1X2N A;  2GM4 A;  4BXX J;  3JRG A;  4A3I J;  2E19 A;  5J1U A;  1F43 A;  1JKR C;  1WI3 A;  3Q0V A;  3B6A A;  4IHX A;  1JUP A;  4DZJ A;  4IHW A;  3H3V K;  1ETQ A;  2DA1 A;  1H8A C;  5F0F A;  3W6V A;  1WGX A;  2MG4 A;  3Q3S A;  3LSP A;  4FCY A;  2JA7 J;  5C3E J;  3ZQG A;  1IUF A;  5K7Z A;  2HDD A;  2WAQ N;  5E3L A;  3S1M J;  1OCT C;  5E3O A;  5FKM A;  5F1J A;  3F0C A;  3DEW A;  2ELK A;  1IC8 A;  3HEF A;  2D5V A;  3HOX J;  2M2E A;  5DTD A;  5M5Y J;  1BW5 A;  3G1L A;  2L7F P;  2DMT A;  5M5W J;  4I76 A;  4DYR A;  2DMN A;  2LFB A;  5FLV A;  1SAN A;  2PMZ N;  1FIP A;  5C4J J;  4X6A J;  3A01 A;  1X2M A;  4DYC A;  3S14 J;  3JRI A;  3RZD J;  3HKZ N;  1Z0X A;  3GBG A;  4MO7 A;  5F0C A;  3LNQ A;  3S1N J;  3JRD A;  2R92 J;  2CUE A;  3HOU J;  4MIM A;  3M4O J;  2LKX A;  3LSJ A;  1S7E A;  2EZI A;  1JJ6 C;  3ZQH A;  1Z77 A;  3GTG J;  1VI0 A;  2NS7 A;  2CQX A;  4I6Z A;  1H88 C;  1ETW A;  3Q0W A;  4LOC A;  3B6C A;  1R9T J;  3A01 B;  1B72 A;  1JKO C;  2E1O A;  3BG5 A;  3FIS A;  5JLX A;  1AKH A;  3S1R J;  1IGN A;  3GTO J;  1AHD P;  3IV5 A;  3BTL A;  2OPT A;  4B4C A;  2EH3 A;  2XGD A;  3JRA A;  2FD5 A;  1BA5 A;  1XG1 A;  2VPR A;  2ZB9 A;  3A02 A;  4ABZ A;  5F27 A;  2DMP A;  2LR8 A;  2K9N A;  1ETV A;  5FKK A;  5FJ8 J;  1FTZ A;  4M3G A;  2HXI A;  2QCO A;  2R5Z A;  3OOU A;  3BTJ A;  1ZGW A;  5EGO A;  1ZR2 A;  4J19 A;  3HM5 A;  4QTR A;  2M34 A;  3JRC A;  1AKH B;  4UUS A;  5GPC A;  2K9S A;  2X9D A;  1IDY A;  2W48 A;  4XRS G;  1WH7 A;  4A3D J;  1LE8 B;  3HGY A;  2NOG A;  1MSE C;  3C2B A;  1Y1V J;  1QPI A;  2CU7 A;  1UHS A;  3GTL J;  2R5Z B;  2XGC A;  1U9N A;  5EGO B;  1B8I A;  2HQ5 A;  4S0H B;  5IYC J;  1JJ8 C;  2DMQ A;  4IHY A;  4UUS B;  1Q1V A;  2Y0S N;  5K7F A;  1MNM C;  3BTI A;  3HGG A;  4AUX A;  5E3N A;  1O4X A;  3LSR A;  5EDN A;  2H8R A;  2DA4 A;  1MH4 A;  2RAE A;  4D7M A;  1IRZ A;  3IH2 A;  4IHV A;  2E2H J;  5F04 A;  3M3Y J;  3HOZ J;  4FTH A;  5FKN A;  4DW6 A;  5F0H A;  5IOY A;  4MFD A;  1HDD C;  3K7A J;  5IP6 A;  1B8I B;  1TWG J;  2OF7 A;  3S15 J;  3OSF A;  2EZK A;  1QRY A;  5C4X J;  5F08 A;  1IV6 A;  4RDU A;  1E3O C;  1TWC J;  2MGQ A;  1FTT A;  2JA8 J;  2HOT A;  4BY1 J;  1ETY A;  2NVX J;  3RKQ A;  4Y7N J;  4FIS A;  3ZQC A;  2XPW A;  1ZR4 A;  1JKP C;  4A3E J;  3HOW J;  1UG2 A;  1GV2 A;  2GBY A;  2L0K A;  1K61 A;  3BR1 A;  1GV5 A;  5M5X J;  2HYJ A;  4MLO A;  3CMY A;  1JTX A;  2VKV A;  4A3J J;  3S2D J;  4UUT A;  2X48 A;  3OIO A;  2FX0 A;  3S2H J;  5FKO A;  5K7H A;  2Y30 A;  4XK4 A;  2DTZ A;  1RKT A;  4W97 A;  5J3L A;  2XB5 A;  2ID3 A;  2VUM J;  1ETK A;  4M3B A;  4XIC A;  1F36 A;  3UKG A;  2HOA A;  2XPU A;  2IEK A;  2H1K A;  4FE7 A;  3K2A A;  1NTC A;  1IDZ A;  1X58 A;  5E3M A;  1LFB A;  3GTP J;  4BY7 J;  5EZH A;  1ZKG A;  4B1R A;  1HLV A;  1CQT A;  2XB0 X;  1BL0 A;  2R7Z J;  4C3J J;  1U8B A;  1A6I A;  1OFC X;  4MFE A;  2Y9Y A;  4M3E A;  2DA3 A;  1ZQ3 P;  3ZOB A;  4A3L J;  1YRN A;  1TWA J;  4BBR J;  1RES A;  2LP0 A;  1HDP A;  4QSH A;  4A3G J;  2YU9 J;  1ETX A;  1WCM J; 
#chains in the Genus database with same CATH topology
 3IWF A;  2CW0 F;  3ISP A;  3IKT A;  4A5M A;  3H3Z A;  4PJM A;  1VQ9 I;  4NHJ A;  3ULQ B;  2O03 A;  2F6C A;  1FC3 A;  3DWL E;  2E60 A;  5C44 J;  1B4A A;  4R8H A;  2X6Y A;  2MFZ A;  4DQ2 A;  5DYM A;  3C2G A;  3BOQ A;  3LFU A;  1LEA A;  4RGX A;  4LFU A;  2FQ3 A;  1YRN B;  4DZP A;  2ZC2 A;  5B66 C;  3CME I;  2A07 F;  4KNY A;  2VBY A;  2JUG A;  4I0B A;  3CDI A;  3G3Z A;  2E7X A;  2QF7 A;  1VF9 A;  1H89 C;  4L5I A;  4BHC A;  5E79 C;  5HNF A;  4CXF A;  4CIC A;  2HVS A;  2A5W A;  3BG3 A;  3H5N A;  2MLK A;  3U2R A;  4L5E A;  4N9I A;  4CCL A;  1J09 A;  2Z9O A;  3BR5 A;  2FRH A;  1NK3 P;  2KQR A;  5DD4 A;  3E7L A;  2CQQ A;  1FZP B;  2NS8 A;  4BGD A;  2EIL H;  1FP2 A;  2EFQ A;  2FU4 A;  3L1P A;  2OAZ A;  2ESH A;  2DW4 A;  4NQW A;  4JK1 X;  2CMP A;  2GIV A;  5EG0 A;  3TP0 A;  2L3D A;  1TL8 A;  1G3Y A;  3FIW A;  2E34 A;  3KPH A;  5D6E A;  4IZZ A;  1T6S A;  2DK5 A;  1KU7 A;  1R7J A;  1AWC A;  3K6G A;  4XKB A;  2DA2 A;  2FJ1 A;  2MBF A;  3TP3 A;  3PO2 J;  1WVR A;  2EWN A;  3QAH A;  1HF0 A;  4GFB A;  1QVU A;  3IH4 A;  2HU9 A;  3ZXS A;  2F5F A;  3BQZ A;  1JHF A;  1RPW A;  2ESN A;  3BJA A;  1MBF A;  1S5L C;  4PZJ A;  5EG0 B;  2OD5 A;  2IAI A;  2O8K A;  3C1D A;  1Y1W J;  2VB6 A;  2XF6 A;  1I6H J;  1XD7 A;  2NNN A;  2UV1 A;  1W0T A;  3X2Q H;  4U0W A;  4ZDL A;  1SAU A;  3BT9 A;  3LSH A;  1QVT A;  2DK8 A;  4HRI A;  2KT0 A;  3H3U A;  1ZK8 A;  3HB9 A;  3W2V A;  4FE4 A;  3K4M A;  1GHC A;  2PBI A;  3LSK A;  2FQ4 A;  2A61 A;  4J00 A;  2LOO A;  2TRT A;  2VKH A;  3MMY B;  2E2I J;  1K83 J;  5HOD A;  3GTQ J;  9ANT A;  1RIO H;  1TQM A;  2Q1Z B;  2ZXI A;  2FA5 A;  4Q4Z F;  4L5J A;  4CCJ A;  4CSW A;  1GXQ A;  1D1B A;  2R7Q A;  3RIR A;  1BOB A;  4KT6 A;  5CVI A;  4XLP F;  1F1Z A;  4WX9 A;  1NK2 P;  1TT0 A;  4G7H F;  1WZ2 A;  3J81 K;  3HYI A;  4V2G A;  5FLX Z;  2K7L A;  4M6Y A;  2HS5 A;  3WHB A;  3HDD A;  3DKY A;  4ZYD A;  2AS5 F;  1B6A A;  1RI7 A;  5HDN A;  3D5R C;  3BQY A;  1E2X A;  1FOY A;  3GLL A;  1P4A A;  3HOV J;  4KIF A;  4XOT A;  5EZG A;  4C2U A;  2HKX A;  3NAU A;  1RUO A;  4P5O A;  3TMO A;  2LY9 A;  4EM2 A;  3HOS A;  2DT5 A;  3I54 A;  1IJW C;  4JX4 A;  1I3Q J;  3ZQ7 A;  4A3M J;  3F8M A;  1PUF A;  2RKH A;  2JSC A;  3L2V A;  3H1C A;  2ZNZ A;  3FXU A;  3QYB A;  5FO5 A;  3SEQ A;  2O8X A;  1QZZ A;  2JA5 J;  3I58 A;  4BXF A;  1V5G A;  4HBL A;  3VSL A;  1FLI A;  2K86 A;  3H36 A;  3N97 A;  5FRN A;  1OR7 A;  1PUE E;  3PNT A;  5ICG A;  2ID6 A;  2JJ7 A;  1WH5 A;  2LTP A;  4XRM A;  3Q9V A;  1OCP A;  3E6B A;  1LDK B;  2RGV A;  2VJ5 A;  3CJR B;  2HDW A;  4Q47 A;  4UB6 C;  1PUF B;  3CUQ B;  2EK5 A;  5LHG A;  3FBN B;  2MSY A;  1T8I A;  1R5I D;  2OJE D;  1RET A;  2WY8 Q;  3MWM A;  2K4B A;  5J4V A;  2Z16 A;  4M3D A;  2W00 A;  2NXN B;  2BY3 A;  3S16 J;  2BHZ A;  5HLG A;  1WKM A;  2VON A;  1QA6 A;  1Y39 A;  1MBG A;  2RN7 A;  3J81 Z;  5ICE A;  2FSW A;  1K78 A;  1B72 B;  1C0W A;  3K70 D;  1R5G A;  2EZL A;  2IVM A;  2YUS A;  3I5U A;  4A3F J;  3CDL A;  3S1Q J;  2H1L A;  3RKX A;  3RJP A;  4ZYA A;  2AXL A;  4M6V A;  5E20 A;  1EKE A;  3ZP5 A;  1W5S A;  2Y2Z A;  3W6K B;  3ECO A;  4LD5 A;  4WXH A;  1NH3 A;  3GFJ A;  3ZCO A;  2I8D A;  1YS6 A;  1I1S A;  1Y6I A;  3DCF A;  2EFO A;  2O7O A;  5EF6 A;  2EV6 A;  5TGT A;  4H0E A;  4D5C A;  1X19 A;  1ZRE A;  1SFO J;  2XUB A;  2W1O A;  5CQG A;  3QP6 A;  3QRF F;  2L7M P;  2EIJ H;  1BBY A;  1DUX C;  2KDZ A;  4KFC A;  5ILS A;  2LRE A;  1REP C;  2M0C A;  2EPF A;  3VB2 A;  4L18 B;  5DV5 A;  3H5A A;  1GVJ A;  5EYR A;  1FYK A;  3DBL B;  3HIF A;  1J7K A;  3OIQ A;  4DNC A;  3GLX A;  4RAY A;  3F22 A;  1LUJ B;  2DFE A;  2XSJ C;  1JUP A;  4DZJ A;  2RV8 A;  3H3V K;  3KEO A;  3RPQ A;  4WWC A;  4KN4 X;  1SFE A;  2E7W A;  3FXM A;  5F0F A;  1H8A C;  3GFL A;  1WGX A;  3WOD F;  4XKW A;  3OYM A;  1HBX G;  5D8K B;  2HEO A;  4GO1 A;  4LLL A;  5K7Z A;  1F4K A;  4E7H A;  5HOO A;  2GAU A;  3BZK A;  4MTE A;  3UR3 C;  5E3O A;  4CZC A;  1Z91 A;  2L4A A;  2X6X A;  3IC7 A;  1PP8 F;  1B9M A;  4LIT A;  2M4K A;  4HG2 A;  3V7C A;  3S3O A;  2Q0O A;  1FWZ A;  4FX4 A;  1Y8Q B;  1A36 A;  1IN6 A;  3I0T A;  4A6D A;  2LFB A;  2PMZ N;  1FIP A;  3WGH A;  5C4J J;  4X6A J;  4I99 C;  3MZH A;  3BZ6 A;  3I56 I;  1IRF A;  4CZZ A;  2BZT A;  2E5N A;  3FXO A;  3OYA A;  4PSW A;  4HX4 A;  2JPC A;  3DBR B;  5D6F A;  1TP4 A;  2EA4 A;  2HVR A;  4MO7 A;  5F0C A;  4IHT A;  1R6R A;  2QBY A;  2GA2 A;  4KIC A;  1R00 A;  3A2K A;  4P55 A;  1VI0 A;  2VQC A;  4LB6 B;  2NS7 A;  2CQX A;  1M1E B;  1ETW A;  4HA8 A;  1IUY A;  4ZZD A;  2VBZ A;  1JKO C;  2WA0 A;  1V54 H;  1AKH A;  2DXI A;  1FBQ A;  1ZGA A;  1XGS A;  1AHD P;  1KON A;  2DPD A;  2LY1 A;  1QZY A;  2FD5 A;  5KAI C;  3CJT B;  4C30 A;  2QBY B;  2ACJ A;  4N9H A;  1XG1 A;  3A02 A;  3L2W A;  4ABZ A;  2D1V A;  5F27 A;  3DXJ F;  3E1S A;  3FM3 A;  2DMP A;  1YHQ I;  4BEH B;  4HEA 2;  4E7J A;  4E7K A;  1FTZ A;  2STT A;  2K3F A;  4NC6 A;  4CA0 A;  1XMA A;  2HGC A;  3PQJ A;  4QPO A;  4XKC A;  5H6R A;  4KIB A;  4ZZL A;  4L9J A;  4HLX A;  1OCZ H;  2A69 F;  1ACI A;  1P4X A;  5H2F C;  2M34 A;  3JRC A;  1AKH B;  4G6D A;  2DFI A;  3RYP A;  4BDY A;  5LFA A;  4CCN A;  1WRJ A;  2LRD A;  1TW2 A;  3A4C A;  3TO7 A;  1WH7 A;  1YW7 A;  2CW8 A;  3JAM Z;  1K4T A;  1EV7 A;  3C2B A;  1MSE C;  1UST A;  2CUJ A;  2V26 A;  1WSU A;  3K1M A;  5KVR A;  3E5X A;  4CH7 A;  4OIO F;  1WJF A;  1U9N A;  2D45 A;  2DOD A;  3PIP F;  4B43 A;  3GZN B;  2PMZ A;  1JJ8 C;  1DPU A;  3CP2 A;  2V6E A;  4BHB A;  3SZT A;  3M8F A;  3CF5 F;  2RNG A;  4B44 A;  1T95 A;  4KIG A;  1VZ0 A;  3AG1 H;  3BTI A;  2PEX A;  5E3N A;  3LSR A;  5EDN A;  2DA4 A;  1U5T C;  2FOW A;  1ZYR F;  4BYY A;  2JT1 A;  2VE8 A;  1ON2 A;  1HDD C;  3SEZ A;  2EZK A;  1QRY A;  4I98 B;  3OWT A;  3V8J A;  2B0L A;  1EH7 A;  2PMU A;  2VJ4 A;  4IRI A;  4QWQ A;  1YIO A;  4BY1 J;  3MZ8 A;  2FXA A;  3RKQ A;  2P8T A;  1ZR4 A;  4G6Q A;  5ILV A;  3O2P E;  2DFF A;  3HOW J;  3LQR A;  1ZAR A;  2QUF A;  3NWS A;  3CZ6 A;  3P7N A;  4UUV A;  4B09 A;  4N4O B;  1EH8 A;  1Z3X A;  1SVM A;  2VKV A;  2ZME A;  2MH9 A;  1YS7 A;  2KDO A;  2OBP A;  4BUP A;  2CO5 A;  3EYY A;  2CS3 A;  1XSV A;  3CLO A;  3FXR A;  4PGH A;  3AL0 B;  3U21 A;  2RVC A;  1F9N A;  1MKM A;  5AIQ A;  2HWV A;  5EJC A;  5B3S H;  2Y30 A;  1XB4 A;  2V79 A;  1RKT A;  1P6R A;  5CPR B;  3WGI A;  4A2U A;  5JI6 A;  5E1W A;  2JRM A;  4OOI A;  1R22 A;  2VUM J;  1FOX A;  4M3B A;  3UKG A;  1F36 A;  2BBY A;  1D0Y A;  3MZY A;  1L3L A;  4XLE A;  3R0A A;  3G73 A;  3RSN A;  2ZME B;  1K4S A;  4OIP F;  3VYR B;  3TOB A;  4BY7 J;  3LSM A;  1HW1 A;  5BS6 A;  1OYY A;  1BR1 A;  1ZKG A;  2OU2 A;  3RDI A;  1U8B A;  1OFC X;  1IN7 A;  3IRQ A;  4IRH A;  4BS9 A;  4Y4R A;  3J7Z I;  2WAE A;  2Y9Y A;  3S8P A;  1W36 D;  1XDS A;  4R79 A;  3ZMV A;  4QSH A;  2R7X A;  4CO8 A;  2HYF A;  3DEU A;  1ETX A;  3TDU C;  4F91 B;  3PQK A;  4HYE A;  3ZQI A;  3R4K A;  5L3F A;  3IKV A;  1UCR A;  1ENH A;  4U87 A;  3OMY A;  4AYB N;  3GTJ J;  1SVO A;  1BIB A;  2P6T A;  3C3W A;  3R60 A;  3FKI J;  4XLA A;  3QPH A;  3L7W A;  3F21 A;  2XGE A;  1VQK I;  3OR2 C;  4IHS A;  2ADU A;  3HSF A;  3HJE A;  2KKO A;  3SXY A;  4BDZ A;  2VC1 A;  1R23 A;  2O3F A;  2VKE A;  2JMW A;  1T39 A;  1T2K A;  2MC4 A;  1FBS A;  1SFK A;  4M3F A;  4UHT A;  2DPU A;  2V9K A;  1Z9C A;  2R0Q C;  3J7A O;  1JI8 A;  3CO7 C;  2LK2 A;  4BHP A;  1VQL I;  1MBE A;  2EBI A;  4BAC A;  4EJO A;  1I5Z A;  4G6T B;  1XS9 A;  1I3A A;  3DPL C;  3RPU D;  3HZJ A;  2K02 A;  1VQ4 I;  3ZQF A;  2KLO A;  4X1E A;  1UB9 A;  5A2Q Z;  2P5L C;  3BG6 A;  3KIO A;  1FYM A;  2G7H A;  3MKW B;  4BQA A;  2V9V A;  2G0E A;  3BJO A;  3CTA A;  5J8C A;  2BOL A;  2DA5 A;  4ZDP A;  1HA8 A;  2X51 A;  2QVO A;  2VN2 A;  2DFH A;  2VC0 A;  2R4G A;  3HXL A;  4HNU A;  3IHU A;  3HHG A;  5LGN A;  1VQP I;  1XTA A;  3AG3 H;  2L9S A;  4FT8 A;  3CMM A;  2R7W A;  3TW7 A;  1S3J A;  1VTN C;  1V4R A;  4AM3 A;  1ITY A;  3K4B A;  2L9V A;  4BU2 A;  1DQU A;  2A3S A;  2WB1 A;  3BR0 A;  4XN3 A;  2JWT A;  2J5O A;  2H09 A;  2V6C A;  1VQN I;  2LF8 A;  2IS2 A;  3VYU B;  1K7A A;  1W7P A;  3RCO A;  4F55 A;  4F93 B;  5DM7 F;  3ERE D;  3K1N A;  1T56 A;  4C3I J;  2IA0 A;  1S7O A;  3DU6 A;  2PMH A;  4BKX A;  5F1R A;  5DS9 A;  2ECC A;  4AYB A;  2LY2 A;  2O61 A;  3E5U A;  3BLY A;  1PJR A;  3SFZ A;  1APL C;  3RTR A;  2KZV A;  2PLY A;  2HZD A;  3E6D A;  1MJB A;  2ZKZ A;  4NB5 A;  4RB2 C;  2K9M A;  3I4N J;  3D0S A;  5GP9 A;  2EFP A;  1XGM A;  1P4W A;  1W7P B;  1TWH J;  2KHM A;  5LRR A;  3CLQ A;  2DT6 A;  3T8T A;  4P9F A;  2XKP A;  4QPQ A;  4G8X A;  2EIM H;  2DI3 A;  5L3C A;  2KIU A;  4MEY F;  1TQI A;  1ERD A;  3IAS 2;  3J7Y J;  1O7F A;  3HSR A;  1BI3 A;  3JRE A;  3PM1 A;  1FJL A;  1R58 A;  3DLL F;  2DA7 A;  4GYI A;  2KRH A;  3Q0U A;  4YIF A;  1ZG3 A;  2KFD A;  4PSX A;  4P9U A;  1LFU P;  3OYE A;  2ME0 A;  5IT9 Z;  1J75 A;  4FAS D;  1W36 C;  5IT3 A;  1OCC H;  4WXD A;  1BJZ A;  3LOC A;  3BG9 A;  1RZ4 A;  3P5J A;  1ONV A;  3NWT A;  4LB5 A;  3GFI A;  1TT5 B;  2JK3 A;  1WHU A;  2C6Y A;  4JP0 A;  2RQQ A;  4BJT A;  4B3A A;  1BC7 C;  4EEF G;  1MMD A;  4EGY A;  4A5N A;  3F6O A;  1FOK A;  1TQP A;  4YEL A;  3GX4 X;  1POG A;  2DN0 A;  2XVC A;  2X6O A;  4AC0 A;  2JN6 A;  2JA6 J;  4JOM A;  2DBB A;  4BXU A;  1OR7 C;  1R49 A;  2P7V B;  3ABU A;  3BY6 A;  3OV8 A;  1FX7 A;  3L9F A;  3R61 A;  2E1M C;  1OYW A;  2F4I A;  2M8G X;  4IRG A;  1K79 A;  2L4M A;  3LA2 A;  5L3D A;  1YE9 A;  2PI0 A;  3BCA A;  3QQA A;  3JW4 A;  3CC2 I;  1FMV A;  5J1Y A;  2QEN A;  2NVY J;  1BR2 A;  3H0G J;  1Z05 A;  1D8K A;  2F2E A;  2KPM A;  3ELK A;  2HFH A;  1ZTR A;  4LG3 A;  3KYL A;  4ESB A;  1JKQ C;  2RNJ A;  4B8X A;  4WXC A;  3M8J A;  3KLN A;  3EPZ A;  5IYB J;  1IG7 A;  2NVT J;  3P9C A;  1ZG1 A;  1X3Z B;  1Y0N A;  4Y15 A;  3AG2 H;  4JX5 A;  5E1Z B;  1HOM A;  2VJI A;  1IXC A;  2VLA A;  4XID A;  4GGG A;  1W5C C;  2WY7 Q;  5DCF A;  3T1B A;  2IGM A;  4EM0 B;  5J1R A;  1DU6 A;  1UFM A;  3IWZ A;  3OYH A;  3TBI A;  2G9W A;  2HOE A;  3SHF A;  2BW3 B;  2GA1 A;  4CYC A;  3H5R A;  2WTE A;  4CCK A;  2LC2 A;  4KIT B;  2R7R A;  3NAR A;  1SC7 A;  3VYS B;  3JSP A;  5DCM A;  3QU6 A;  4BE1 A;  1WFX A;  1NHA A;  5H20 A;  3I9V 2;  3RQI A;  2FNP A;  4L9T A;  4V2F A;  5HS9 A;  4A3K J;  2QQA A;  4OAY A;  1I27 A;  2MW8 A;  3WTZ A;  3FHN A;  2HI3 A;  3O3K A;  4IOA F;  1OLT A;  2EA2 A;  4QLC U;  2LVS A;  5TJJ A;  4G7Z F;  5E8G A;  4XBF A;  3A1Y A;  1S7A A;  1IW7 F;  5HLH A;  2GLO A;  2CRG A;  2DYR H;  2KIM A;  2ZJR F;  4IX7 A;  4PJJ A;  3GTK J;  1MND A;  3K9T A;  1TW3 A;  3BZC A;  3A03 A;  4OIR F;  4CYC B;  2Q2E A;  1K6O A;  4NDL A;  5DCM B;  2ECB A;  2FUG 2;  3HTU A;  2B63 J;  4LG0 A;  3HHH A;  3DBH B;  3MN2 A;  2XAQ A;  2W57 A;  1LKX A;  3M1E A;  2HKO A;  3OS2 A;  2BV6 A;  2WV0 A;  3I4M J;  3TW6 A;  4UV8 A;  2AQE A;  1F5T A;  3JRG A;  4BXX J;  4A3I J;  2E19 A;  5J1U A;  3K2Z A;  3VEP A;  2LNB A;  1G6N A;  5D4R A;  2Q2E B;  4RAF A;  1X1C A;  2W25 A;  3W2W A;  3M1C A;  4HV6 A;  1UHM A;  4LG0 B;  2LG4 A;  2V1N A;  3GF2 A;  3W6V A;  4XSZ F;  1AOY A;  2V1X A;  3LSP A;  5KNL A;  4GDF A;  2E36 A;  1HST A;  3ZQG A;  1IUF A;  2MD0 A;  2GOX B;  3GCM A;  2KP6 A;  2Z3Y A;  3PFI A;  3V7S A;  5J4Y A;  1YX3 A;  1ZLJ A;  1OQY A;  2XAG A;  1D5V A;  1QPM A;  2D5V A;  3HOX J;  1H0M A;  1HQC A;  1N25 A;  1ZRD A;  4EV0 A;  3CES A;  2L7F P;  4LIV A;  3T5X A;  4LLN A;  3ZQQ A;  1SAN A;  1VQ6 I;  4BH9 A;  1UHW A;  1UJ8 A;  3VSK A;  1A6Q A;  1EJ9 A;  1B9N A;  2CSO A;  4DYC A;  3JRI A;  3CUQ A;  3CCE I;  3GBG A;  3FBI B;  3QYF A;  4EJU A;  3JRD A;  4DBQ A;  4DOZ A;  3PFY A;  5AON A;  1SD6 A;  2PX9 A;  2OZU A;  2FBK A;  2QLZ A;  3LSJ A;  1XCB A;  3R0J A;  3S2W A;  2Y0S A;  3ABL H;  4B3X A;  1FSE A;  1MW7 A;  1JJ6 C;  1Y8R B;  3KYC B;  4A6E A;  1H88 C;  5CVJ A;  3MFK A;  3Q0W A;  2L5Q A;  1R9T J;  1QZE A;  1B72 A;  2E1N A;  2E1O A;  3BG5 A;  3K69 A;  4NC7 A;  2M0M A;  3G2B A;  3S1R J;  3GTO J;  3BG7 A;  2BVL A;  3DKW A;  4E7S A;  2OPT A;  2DYS H;  3IV5 A;  1VQ5 I;  2HPM A;  2VOP A;  2BXY A;  2E71 A;  2HQA A;  2EV0 A;  2OA4 A;  1SD7 A;  1MMN A;  2VPR A;  1IXS B;  1BOA A;  3V42 A;  2LR8 A;  2K9N A;  1ETV A;  5FKK A;  1R1T A;  4BAY A;  2G7U A;  4M3G A;  4U0Y A;  1DPR A;  1HSJ A;  3T0Y A;  5BMZ A;  5J40 A;  4OIQ F;  4L9N A;  3I55 I;  3BTJ A;  4Q48 A;  2R5Z A;  4DGW B;  1YOV B;  5K5Q A;  2CQK A;  1BI0 A;  5EGO A;  3HM5 A;  3EET A;  4RGS A;  1LB2 A;  2Z1D A;  4BJ5 C;  4YFX F;  1O3T A;  5DUI A;  4A0Y A;  1IDY A;  4A3D J;  1LE8 B;  4U7D A;  2NOG A;  4B48 A;  5JHF A;  1A04 A;  3DPT A;  4ANJ A;  1XMX A;  3VYT B;  3EUH A;  4RGU A;  1G8X A;  2R5Z B;  3K4N A;  5D5X B;  2DO7 A;  5EGO B;  2HQ5 A;  1E3H A;  1G59 A;  1WWX A;  3KE2 A;  4IHY A;  3MAJ A;  4Z6Y A;  1FPQ A;  2LDU A;  4PFP A;  3ZMZ A;  1P9Q C;  2F5E A;  3HGG A;  3MQ0 A;  1KU9 A;  3WG7 H;  4AUX A;  1IN4 A;  1OMI A;  1YW9 A;  2JVG A;  2H8R A;  3OYL A;  1YJN I;  1A35 A;  1IRZ A;  2IPQ X;  3IH2 A;  3E0J B;  2Q8K A;  2EFW A;  1WJC A;  5F04 A;  2ZXW H;  3M3Y J;  3HOZ J;  5IY5 H;  1UEL B;  5F0H A;  2IP2 A;  1ZEL A;  3K7A J;  2JA2 A;  5K5O A;  4XON A;  1ZH5 A;  1TTY A;  4ESF A;  1XCV A;  3ABK H;  4FET A;  3ZMT A;  2HPI A;  1TWC J;  3ASN H;  3AL0 C;  1E17 A;  2NNY A;  6PAX A;  4FX0 A;  4OAZ A;  2JA8 J;  1FTT A;  1ETY A;  2KMU A;  4FIS A;  4HSR A;  2QYO A;  1LJ9 A;  3ONQ A;  1W5T A;  3NQO A;  1TNS A;  2V9P A;  5JHU A;  1D1A A;  1UG2 A;  1GV2 A;  2GBY A;  2L0K A;  1BN5 A;  1SFU A;  3CMA I;  2ZFU A;  2M4G A;  3WU1 B;  4ETS A;  2W82 A;  3B02 A;  4MLO A;  2KIQ A;  3DU5 A;  1CF7 B;  2CW7 A;  2ZME C;  4NUB A;  1WJB A;  2GOM A;  4UXN A;  3CCL I;  1VQ7 I;  2EV5 A;  3L00 A;  4UUT A;  2VOO A;  3E5Q A;  2X48 A;  1SMY F;  1DGR M;  2F5D A;  3S2H J;  1XX5 A;  5D5W B;  2DTZ A;  1UG0 A;  3TDZ C;  2OCC H;  4PCQ A;  2QQ8 A;  4G94 A;  3K1P A;  4W97 A;  2H8W A;  4II3 A;  5FRO A;  1D3Y A;  2ID3 A;  2ZO4 A;  5LD2 C;  2HOA A;  2DJI A;  2Y0M A;  2IGN A;  3C7J A;  2H1K A;  3KLO A;  5HNH A;  5LBQ A;  1NTC A;  1E3P A;  1FSH A;  1WQ2 A;  3WE2 A;  5EZH A;  4F7Z A;  4B1R A;  2R7S A;  4M9Z A;  1QO0 D;  4XQF A;  1CQT A;  2XB0 X;  3EUK L;  4RAZ A;  2O6G E;  3TQN A;  1YO5 C;  1FMW A;  4L0Z B;  2A68 F;  4BEH A;  4M3E A;  4U0V A;  4XOP A;  1TWA J;  2LP0 A;  1D0X A;  4G9Y A;  2D1H A;  3KYD B;  4XLN F;  2CG4 A;  2IA1 A;  4PFO A;  1RUN A;  2YU9 J;  4CHU A;  4LJZ F;  2R93 J;  1LEB A;  2GWR A;  3G71 I;  5HDK A;  3LMM A;  2DQR A;  2XRL A;  2WWY A;  1U6G A;  3RYR A;  2DTR A;  1QHG A;  4FQG A;  3I59 B;  3M7G A;  3PO3 J;  3VWB A;  2NYX A;  1JXS A;  2YX4 A;  2DT7 B;  3HOT A;  2IT0 A;  2O9L A;  2F4O B;  3CCY A;  5K1Y A;  2ZCW A;  1JUM A;  4YIR X;  2XC7 A;  5FD6 A;  4A93 J;  4YEJ A;  3J80 K;  3QPT A;  2E1C A;  1MIJ A;  1MNE A;  2VOD A;  3KZZ A;  5B1B H;  1FBU A;  5HDG A;  2QKL B;  2ZJP F;  2Y75 A;  2DOE A;  2XAU A;  4Y33 A;  3TKY A;  1YW8 A;  1KZH A;  1Z21 A;  2JQ7 A;  3L2C A;  4A3C J;  4M73 A;  4OMY A;  1DU0 A;  5BPI A;  5FD5 A;  5M3M J;  4P96 A;  3SYT A;  3BTC A;  4HF2 A;  5IYD J;  2L7K A;  2EIN H;  2VT3 A;  4UV9 A;  4IJA A;  3HL2 A;  1IRX A;  4EJV A;  3L2Q A;  2DA6 A;  3O8H A;  3L2U A;  3COA C;  4BE2 A;  1T33 A;  3E6M A;  2MD5 A;  3GFM A;  2VE9 A;  2VQL A;  1XN7 A;  1U78 A;  1XDU A;  2KIF A;  2JVH A;  4TV7 A;  2OZ6 A;  3MKL A;  1OCO H;  4RBO A;  3W2A A;  2W7N A;  4AIK A;  3F23 A;  3CCS I;  2HXO A;  4RM2 A;  1Z67 A;  3D1N I;  2VT2 A;  3TED A;  2HNH A;  3JRH A;  5B1A H;  4D0P A;  3WTU C;  2OC6 A;  3F8C A;  4HQM A;  1TZL A;  4QIW N;  5LEJ A;  2MC3 A;  4LGW A;  1MBJ A;  3OSG A;  1WPK A;  4CUG A;  3DLA A;  2Y9Z A;  4LK1 F;  3N05 A;  1DP3 A;  4Y52 J;  1BM9 A;  1YG2 A;  3CO6 C;  1LQ1 A;  2J5P A;  5GTH C;  2FBI A;  2OTJ I;  4DBR A;  1MSF C;  2M9H A;  3IH3 A;  3NRV A;  5FLM J;  5HVQ C;  4UB8 C;  3E97 A;  2DJN A;  2HOS A;  3MKY B;  3PL8 A;  1VQO I;  4ESJ A;  2IA2 A;  1ETO A;  2K5C A;  4HNV A;  1VFC A;  3C18 A;  1FY7 A;  5IP9 J;  4NBQ A;  3J80 Z;  3QOE A;  3K4L A;  1RR7 A;  2M45 A;  2BYV E;  1TWF J;  1MZB A;  1R4N B;  1OIS A;  4MQ9 F;  3BRO A;  4GCV A;  5CYV A;  1RRJ A;  2Z5U A;  3CJN A;  4NC8 A;  5BNG A;  1D0Z A;  3ABT A;  3DFG A;  3BCB A;  3OYD A;  5JVT A;  3KP7 A;  3GO5 A;  3F72 A;  4X0G A;  5JR3 A;  3SDB A;  3OYN A;  2XDV A;  1D8J A;  2OQR A;  1W1W E;  4UVC A;  3W6J B;  4ITV A;  2AXT C;  1S8N A;  4RB0 A;  2COB A;  2AQF A;  3WTT C;  5DEQ A;  3K4K A;  3IP4 B;  4AVP A;  1X1P A;  3V8K A;  2WB1 N;  1J2X A;  2HQN A;  3DF8 A;  4RAG A;  3V4G A;  4C9Y A;  4F3Q A;  5CVV A;  3OYB A;  1YJW I;  1RR8 C;  3JTG A;  2STW A;  2KJC A;  2RDP A;  5E1X A;  1N78 A;  4XKV A;  2IXS A;  2CV2 A;  3FF5 A;  4I7H A;  3RQ4 A;  2VIX A;  3LA7 A;  2FNA A;  4PJN A;  5DD8 A;  1EH6 A;  3K0L A;  4YFN F;  3G1O A;  5BPD A;  5J47 A;  5IOZ A;  2CUF A;  3I53 A;  3CP8 A;  1P7J A;  3JTH A;  4AD9 A;  4EMS A;  2UWM A;  1X1A A;  4MQV A;  2X1C A;  3WTW C;  1JGG A;  4YII A;  2CH0 A;  2R5Y A;  3RKY A;  1YI2 I;  1X3U A;  2XF7 A;  3JSO A;  1VND A;  4D7N A;  2WV1 A;  2VL8 A;  5FGM A;  2Z33 A;  4EGZ A;  1BC8 C;  1J0R A;  3BP8 A;  1ULY A;  1Z7U A;  3U1K A;  3SFI A;  2HR3 A;  2L7Z A;  3EUA A;  3LL7 A;  4I0A A;  2KZG A;  5L3E A;  4OIN F;  4EJT A;  2ETH A;  2HVQ A;  4HNT A;  3R6S A;  3SZG A;  2A6T A;  4KMU X;  2P81 A;  3A0B C;  4HW0 A;  3HSE A;  3LAJ A;  5BOX A;  2FMY A;  3FKJ A;  3I3L A;  3D5L A;  4D5F A;  2R5Y B;  4DJA A;  2VKD A;  2EJR A;  2K9L A;  5CLS A;  3EQL F;  1U0J A;  1OKR A;  4ZC3 A;  1HKQ A;  4IPA A;  4II2 A;  5CVR A;  4CGZ A;  2K40 A;  1MJA A;  4U88 A;  3HPG A;  2WAQ A;  1E0E A;  1D1C A;  1BW6 A;  4XN0 A;  2IGO A;  4HQE A;  2LMD A;  2QSH X;  2I5U A;  4C2M J;  1I50 J;  3Q9S A;  2E5Z A;  4M9X A;  3PUF A;  3KEQ A;  1BIA A;  3VDX A;  3L09 A;  2XPV A;  4BQQ A;  2HDC A;  1A31 A;  2DU9 A;  1N75 A;  3CUO A;  2BEO A;  2QSF X;  2XRN A;  4XLH A;  1KQ0 A;  4A69 C;  3F8N A;  3PUB A;  2R3S A;  1YX5 A;  1X4O A;  2EB7 A;  2YX7 A;  1U8R A;  2E2J J;  3WTV C;  1MH3 A;  1TC3 C;  4IQJ A;  4XLC A;  1JTY A;  3HRT A;  1QU3 A;  4AWX B;  5FKL A;  2LSO A;  1PP7 U;  2XAH A;  1JT6 A;  4KIS A;  5GPA A;  2ELJ A;  5IPA A;  2HTS A;  1VQM I;  1A5J A;  4E7I A;  2VJJ A;  1WJ5 A;  1Y0U A;  2L9R A;  2PN6 A;  2V7F A;  3OYC A;  2XAJ A;  5GAE J;  4ENM A;  4K2E A;  5CKT A;  4S05 A;  4MEX F;  5LHI A;  1JKR C;  1WI3 A;  2CUZ A;  3Q0V A;  2MH2 A;  4IHX A;  4LLG F;  5DUK A;  3G6E I;  3WU2 C;  2UZK A;  4IHW A;  2A5Y B;  2DA1 A;  3KP5 A;  2A6E F;  3ESW B;  2B9S A;  1KYZ A;  4BNC A;  3O6B B;  2P5V A;  1ZRC A;  1L0O C;  3Q3S A;  4JBA A;  4S04 A;  2OV7 A;  4FCY A;  3FM5 A;  1ZLK A;  2JA7 J;  2K85 A;  1R4M B;  3S3N A;  1YIT I;  4RS8 A;  2X6W A;  1QBJ A;  5E3L A;  4BQN A;  1OCT C;  3EDP A;  2UXN A;  3ZMD A;  5F1J A;  3HEF A;  2M2E A;  5DTD A;  5M5Y J;  1BW5 A;  1O3Q A;  2XV4 S;  3IUO A;  2DMT A;  3BC8 A;  1Z6R A;  1K6Y A;  2LKP A;  2KIS A;  5FLV A;  2PFB A;  3F3X A;  2IS1 A;  1MGT A;  5HLT A;  3RKW A;  3OYK A;  3E6C C;  2QSG X;  2XF5 A;  3A01 A;  1V55 H;  1X2M A;  3CUQ C;  4WCG A;  3GWZ A;  3S14 J;  3RZD J;  4ZTJ A;  3HKZ N;  1YFH A;  1Z0X A;  1WJA A;  2QGU A;  2R7T A;  1MMG A;  3S1N J;  2ZJ2 A;  3DTK A;  5LHH A;  2R92 J;  2CUE A;  3HRM A;  3U1D A;  1QGP A;  1FOW A;  1O3S A;  3B73 A;  1IF1 A;  3HOU J;  3S32 A;  3M4O J;  1V3F A;  1J5Y A;  1Z77 A;  2XAS A;  1ZRF A;  4D1Q A;  4HF0 A;  1MJ9 A;  4I6Z A;  3DP7 A;  5FRM A;  2JTV A;  3A01 B;  2BE5 F;  2A6H F;  3ABM H;  3KP2 A;  2BHY A;  4PDK A;  4HOB A;  4PUS A;  1DDN A;  2FBH A;  2BW3 A;  4O3M A;  3BTL A;  4B4C A;  5DM6 F;  2EH3 A;  1SAX A;  3WE3 A;  1PYV A;  2D2W A;  2ZB9 A;  3U9G A;  5LGU A;  1STZ A;  5FJ8 J;  4YG2 F;  3MKZ A;  2HTJ A;  4ZYG A;  4V19 K;  2QCO A;  4AVZ A;  2W4S A;  3BDD A;  2VQH A;  1ZGW A;  1X1D A;  3H0D A;  2V1U A;  5LGT A;  1FYL A;  4QTR A;  2O0Y A;  2H27 A;  4UUS A;  2CV0 A;  5GPC A;  3KP3 A;  3P9I A;  5D5V B;  1Z1D A;  4XLF A;  2XAF A;  3DV8 A;  2X9D A;  4E7Z A;  4PJL A;  1WJE A;  3F9K A;  4HF1 A;  4BE0 A;  3EUH C;  3WG9 A;  2R7F A;  1QPI A;  1H9G A;  2CU7 A;  4O5V A;  1UHS A;  3GTL J;  1GXP A;  4HX8 A;  1B8I A;  4S0H B;  5FLX K;  4HDV A;  5IYC J;  3LFK A;  4Y3O A;  3E3V A;  3TO6 A;  2DMQ A;  4N4N B;  4A12 A;  2ZXJ A;  1I6X A;  4UUS B;  2Y0S N;  2MA3 A;  1AA7 A;  2M1B A;  1J9I A;  2O5R A;  3BPV A;  4D9J A;  5E8I A;  3HKZ A;  2RAE A;  4D7M A;  2ZSH B;  4EAT A;  3LA3 A;  2YU3 A;  2QZ8 A;  5FKN A;  2ZBK A;  3FMR A;  5IOY A;  2P7C B;  4MFD A;  3KZI C;  2KRF A;  1FP1 D;  3ML6 A;  2X85 A;  4GXO A;  3TO9 A;  1B8I B;  4CCO A;  4NQW B;  4OWR B;  3L2R A;  5E17 F;  3OSF A;  3OYF A;  2K27 A;  4AIH A;  3HG9 A;  2DLL A;  1P2F A;  4KT5 C;  1HW2 A;  3GXO A;  3H92 A;  2H6C A;  2IGK A;  3K10 A;  4Y7N J;  2DOF A;  3ZQC A;  2XPW A;  4XL9 A;  3DTI A;  1WCM J;  1JKP C;  4A3E J;  2GIZ A;  4A0Z A;  1SMT A;  1ZG5 A;  1GV5 A;  5M5X J;  2UUZ A;  1YTY A;  1LDJ A;  3AFH A;  3CMY A;  1SVL A;  3GME A;  1JTX A;  4A3J J;  4IQ4 A;  3S2D J;  2P4W A;  1R1U A;  5JFR A;  4IOC F;  1RC9 A;  2DDA A;  3TGN A;  2FX0 A;  2F5V A;  1IN8 A;  2Y48 A;  3CJQ B;  5D5U B;  3BWG A;  5K7H A;  4XSX F;  3TL4 X;  2CQN A;  3ERM A;  2Z99 A;  3CCR I;  5J3L A;  2XB5 A;  3ECH A;  4NNJ A;  3OYI A;  3GEZ A;  2XPU A;  2IEK A;  2DQL A;  4M9S A;  1X4P A;  2BY0 A;  3ZMU A;  4FE7 A;  3CF2 A;  1OPC A;  3K2A A;  5FFX A;  1X58 A;  5E3M A;  3GTP J;  3C2H A;  1HW5 A;  3CCJ I;  3OY9 A;  4ENJ A;  4HST A;  3GYH X;  2R7Z J;  2V1D A;  4C3J J;  1A6I A;  4R1H A;  4MFE A;  2DCE A;  5CVU A;  2DA3 A;  1ZQ3 P;  4YRV A;  1TNT A;  3OS0 A;  4HZF A;  3FX3 A;  1HDP A;  4A3G J;  4MNU A;  3WTY C;  2COM A;  2V4J C;  2WBM A;  1ON1 A;  2NVQ J;  4IKF A;  1NG6 A;  1S6L A;  1T0F A;  4DIQ A;  3K4J A;  3SJM A;  2CYY A;  4DYQ A;  5F6F A;  1FIA A;  4MTD A;  2AO9 A;  2JZY A;  2UXX A;  1G2H A;  1YYV A;  2IBD A;  1MMA A;  2YSR A;  1LE8 A;  2F4M B;  2DOA A;  5GAD J;  4ZYH A;  3RZO J;  1QNT A;  3OOP A;  4LMY A;  1AU7 A;  2YS9 A;  3QOD A;  5D8L B;  5ICF A;  2M8E A;  2Y31 A;  3ROU A;  4J01 A;  1O3R A;  1D5Y A;  4RMN A;  1H9T A;  3HBL A;  3DPU A;  2YPR A;  2LLK A;  4WK8 F;  3OL4 A;  1JHH A;  2QWW A;  4W1U A;  4ZJZ A;  1S29 A;  5TIS C;  2LBF A;  4JYK A;  3RPU A;  5LLQ A;  3JCU C;  4AIJ A;  1XGN A;  1PVE A;  5KHD A;  2LD5 A;  2MLG A;  1S9H A;  3SDG A;  1Z6T A;  2HYG D;  5GTI C;  2QA4 I;  1EF4 A;  2E1M B;  3FK7 A;  4FHT A;  1ORK A;  2DDB A;  4L9V A;  3KP6 A;  4G12 A;  4XMY A;  2LF7 A;  4B47 A;  4BQO A;  3H9Q A;  4M72 A;  1BI2 A;  1ZHF A;  4RA2 A;  1U9O A;  4GYG A;  3QP5 A;  1O57 A;  1RKW A;  4M6X A;  1U2W A;  2K4J A;  2L02 A;  2RC4 A;  4RLF A;  2ME6 A;  2L9N A;  3NEU A;  2LBF B;  1FEX A;  3BR3 A;  3FMS A;  1IO2 A;  3ASO H;  4Z2Y A;  5EEH A;  2HZT A;  2I10 A;  4EQQ A;  1K78 B;  2CV1 A;  2B7E A;  1HKT A;  3BJ6 A;  2OCE A;  2BXZ A;  1CF7 A;  4MHG A;  4UY8 I;  2OUM A;  4EJW A;  3KFW X;  1W7P D;  1KA8 A;  4UNO A;  1Q1H A;  3G4S I;  4LIU A;  3QPL A;  4XOR A;  5AIP A;  3ZQL A;  4RB1 A;  4CCM A;  3GW2 A;  2OTL I;  2EQR A;  3ZGK A;  3KCC A;  3PSI A;  4JX6 A;  3AAF A;  1GDT A;  1X1B A;  3V8L A;  2EZH A;  4BBS J;  1W0U A;  1OJL A;  3QPS A;  4A3B J;  2ICW G;  5J8F A;  5JLW A;  2P6S A;  3J7A Y;  2JSP A;  4KDP A;  3CQZ J;  1Y56 A;  4JQF A;  2FE3 A;  5CJ9 A;  2FF4 A;  2N8G A;  1R71 A;  3F6V A;  1LPQ A;  1IXR C;  3LSI A;  4IEJ A;  3LAP A;  3H9J A;  1IAW A;  2M5W A;  1TBX A;  2CJJ A;  4XR6 A;  4KUM A;  1JE8 A;  2ZJQ F;  2M87 A;  3KEY A;  1CGP A;  1XSD A;  3JR9 A;  3M8E A;  3I59 A;  3IL2 A;  3GZ5 A;  3UNG C;  3JAM K;  2HQR A;  2VBX A;  2TDX A;  1UMQ A;  3GZ6 A;  3JRF A;  3RI4 A;  4RM3 A;  3N4M A;  1BR4 A;  4GRI A;  2AHQ A;  2XRO A;  3K4C A;  4I2O A;  3WHC A;  4OU0 A;  1JGS A;  4PJ0 C;  3ZPL A;  3FXQ A;  3HOY J;  5M3F J;  3VOD A;  4IVN A;  5L3G A;  1EA3 A;  3PJR A;  1HXD A;  4I02 A;  1USS A;  1J59 A;  1I1G A;  1UZC A;  2IRF G;  3F8B A;  1YJ9 I;  3FWE A;  3A0H C;  3VPR A;  3OL3 A;  1MD0 A;  3D5S C;  2P5K A;  2KRC A;  3O8G A;  1XC5 A;  2RRE A;  1GVD A;  3H9G A;  1JT0 A;  1HCR A;  2IJL A;  4IO9 F;  5IP7 J;  2GXB A;  2ZXH A;  3DKX A;  5EEA A;  3QYE A;  2MAB A;  4G7O F;  3PNY A;  4ZH4 F;  3PIO F;  1R36 A;  1JUS A;  2DMU A;  3OS1 A;  2ELH A;  1KU2 A;  1FNN A;  3MVP A;  1GT0 C;  2PJR A;  1MMS A;  4C3H J;  3K70 C;  2VXZ A;  1Z7L A;  1G3T A;  2RQP A;  3S17 J;  1ZN2 A;  1MBH A;  1IV8 A;  1UAA A;  5BQT A;  2XKO A;  4HDU A;  2M7B A;  3FK6 A;  3CDH A;  4I09 A;  1HKS A;  2XSD C;  3WTS C;  2WAF A;  1LVA A;  2TCT A;  1SFX A;  4IXA A;  2LYC A;  5ICC A;  5HS7 A;  4P1W A;  4CYD A;  1MBK A;  5KK1 A;  2ZSI B;  1WJD A;  1B1B A;  3CC7 I;  3IAM 2;  2PJR B;  1BJA A;  3WTX C;  1QHH D;  3GTM J;  1V5E A;  3G1M A;  2VI6 A;  2A05 A;  2M30 A;  2R7U A;  3M07 A;  2VQG A;  2QKM B;  5GAH J;  5D4S A;  4F92 B;  2K9Q A;  3BR6 A;  1P7I A;  3P9K A;  3LSG A;  5FFZ A;  4MGR A;  4XRS A;  3BR2 A;  4HAM A;  3I4P A;  1GUU A;  1DGW Y;  1XMK A;  3GUD A;  3HPH A;  1WI9 A;  3JRB A;  4RGR A;  1OYI A;  5H6Q A;  3ZR8 X;  3AKZ A;  1X2N A;  1BI1 A;  3HC7 A;  4I01 A;  2GM4 A;  3MCZ A;  2BY2 A;  1KGS A;  2M7A A;  5EEG A;  2GZW A;  5LEK A;  1F43 A;  3CCU I;  1X3W B;  3B6A A;  3W3C A;  1IRG A;  1LFP A;  1O7L A;  1KYW A;  3ZN0 A;  4ENN A;  3DQV C;  1TLH B;  1ETQ A;  2W85 A;  2JPB A;  1OCR H;  3FZV A;  4EVI A;  1P92 A;  1T98 A;  2MG4 A;  3PSF A;  4ENK A;  2EIK H;  2FML A;  5B5E C;  5C3E J;  2HDD A;  2CFX A;  3ZRG A;  2WAQ N;  4EM1 A;  4Y17 A;  3S1M J;  5HLI A;  3T8R A;  4UVA A;  1SEU A;  2NS0 A;  2ISY A;  3HRU A;  5FKM A;  3CCV I;  2LKS A;  3MEX A;  1IC8 A;  3F0C A;  1LNW A;  2ELK A;  3DEW A;  4XRF A;  4ASN A;  3M9A A;  3G1L A;  3KX2 A;  4Y13 A;  1LVK A;  3BPX A;  5M5W J;  4I76 A;  4DYR A;  2DMN A;  5A2Q K;  1GLN A;  1KQ9 A;  3FXJ A;  2WC2 A;  3S3M A;  4E70 A;  4ZTF A;  3LST A;  4N0B A;  4XM3 A;  2PJP A;  1B59 A;  2X1D A;  5FB2 A;  1N77 A;  3QU3 A;  2WAD A;  5GAG J;  2F5C A;  2DAO A;  3KZY A;  3LNQ A;  2X1E A;  2XIG A;  3FMQ A;  1NG7 A;  2MYS A;  2QM3 A;  3SZP A;  4A0X A;  4MIM A;  2LKX A;  1S7E A;  2EZI A;  4LK0 F;  1XGO A;  1YQA A;  2LH9 A;  3ZQH A;  3GTG J;  3Q5F A;  3FDY A;  2XHK A;  3ZMS A;  3QOP A;  2ISZ A;  2BVM A;  1HC8 A;  2R7V A;  4C2T A;  4PK4 A;  4LOC A;  4HLY A;  3B6C A;  5E18 F;  2BY1 A;  3DTE A;  3FXK A;  4F52 A;  2VXD A;  2VBW A;  3FIS A;  5JLX A;  3H35 A;  1IGN A;  1YIJ I;  1LDD A;  2XGD A;  1BA5 A;  1SD5 A;  3JRA A;  3SQN A;  3FXL A;  2KJB A;  5TRD A;  2ZNY A;  5J6X A;  2F48 A;  1T38 A;  2X0L A;  4XNF A;  2HXI A;  1SD4 A;  3OOU A;  1IN5 A;  2H94 A;  3AG4 H;  3F8F A;  1ZR2 A;  4HV5 A;  2OQG A;  2QQB A;  4J19 A;  3VFZ A;  4U7B A;  2NRA C;  2JRT A;  3OIP A;  5ERI A;  4ZDO A;  1KU3 A;  4KN7 X;  1ZGJ A;  2CGP A;  2K9S A;  4L0Y B;  4BL0 B;  4AID A;  2W48 A;  2P0W A;  4XRS G;  2GXA A;  3HGY A;  4M71 A;  4WF2 A;  3WGG A;  1DP7 P;  2W84 A;  1Y1V J;  2L2O A;  1YLF A;  2XGC A;  5KAF C;  2NOJ B;  4KMF A;  3LWF A;  3DEE A;  1G4D A;  3LQQ A;  5F64 A;  5ED4 A;  2CQ7 A;  3V7R A;  2R7O A;  1FT9 A;  1Q1V A;  1MDM A;  5K7F A;  1MNM C;  2PQ8 A;  2R7D A;  1O4X A;  2PG4 A;  1V5F A;  2QEX I;  1Z3Y A;  2Z2S B;  4AU7 A;  1MH4 A;  2FOK A;  5JVG F;  4KJZ A;  5IT9 K;  1U5T A;  4IHV A;  2E2H J;  3KET A;  3CD6 I;  3IRR A;  4FTH A;  1G3S A;  4DW6 A;  5KCM A;  5IP6 A;  1PDN C;  3HTS B;  1TWG J;  2OF7 A;  5DDG A;  4RB3 C;  3S15 J;  4IL6 C;  3CCM I;  5F08 A;  4E7L A;  2IS6 A;  1IV6 A;  4Q5S F;  5C4X J;  2QQ9 A;  4RDU A;  1E3O C;  3TOA A;  2GXG A;  4ZYE A;  1MDM B;  2VPL A;  3REO A;  2MGQ A;  3QWL A;  3HRS A;  2IS4 A;  2HOT A;  4HX7 A;  2NVU B;  2NVX J;  3HUG A;  2JUC A;  4KA4 A;  1U5T B;  3EYI A;  5LRS A;  5ILU A;  3CC4 I;  4OMZ A;  1QQI A;  4PGG A;  1ODD A;  1W4M A;  1K61 A;  3BR1 A;  2W24 A;  3ZN1 A;  1R1V A;  2HYJ A;  1U3E M;  3S93 A;  1XSX A;  2FEZ A;  4M74 A;  2L54 A;  5K5R A;  3OIO A;  3OYG A;  2Y69 H;  4UVB A;  2ZFW A;  3HUG B;  5FKO A;  3GVA A;  3KP4 A;  4IF4 A;  2XGX A;  4XK4 A;  3MD2 A;  4BJ6 C;  4KYW A;  3FHZ A;  4H4K C;  2KL4 A;  1R5H A;  2EFN A;  1ETK A;  4XIC A;  3CCQ I;  5HS8 A;  3I64 A;  2GQQ A;  1XPX A;  1ZAO A;  3PNV A;  1KQ8 A;  2BGC A;  1I39 A;  1IDZ A;  4RLQ A;  1LFB A;  2L01 A;  2K3P A;  2YR2 A;  1IZ1 A;  5L3B A;  1HLV A;  2VAS A;  1RNL A;  1BL0 A;  5CQE A;  1G3W A;  2CWE A;  3OR1 C;  2M3A A;  2H6B A;  4O6J A;  3OYJ A;  3VOE A;  1S72 I;  2NAZ A;  2X4H A;  3ZOB A;  3WU0 A;  4A3L J;  4HPQ A;  1YRN A;  1T08 B;  4BBR J;  1RES A;  4CDG A;  1VQ8 I;  4YFK F;  2IW5 A;  4E6K G;  4E4H A;  2E35 A;  3I71 A;  1T0F C;  2CFO A;  4ON0 A; 
#chains in the Genus database with same CATH homology
 3ZQI A;  2R93 J;  1ENH A;  3GTJ J;  4AYB N;  2XRL A;  3FKI J;  3SJM A;  4DYQ A;  1FIA A;  2AO9 A;  1G2H A;  5C44 J;  2XGE A;  2IBD A;  3PO3 J;  1LE8 A;  2O9L A;  3CCY A;  3RZO J;  1JUM A;  1YRN B;  4DZP A;  4A93 J;  1AU7 A;  2YS9 A;  2Y31 A;  2VKE A;  2JMW A;  2QF7 A;  1VF9 A;  1H89 C;  1D5Y A;  3BG3 A;  4M3F A;  3HBL A;  2R0Q C;  4L5E A;  4A3C J;  2LK2 A;  1DU0 A;  2LLK A;  3BR5 A;  4W1U A;  1MBE A;  5M3M J;  1NK3 P;  2EBI A;  3E7L A;  2CQQ A;  4JYK A;  1XS9 A;  3BTC A;  5IYD J;  3ZQF A;  2LD5 A;  2NS8 A;  4X1E A;  3SDG A;  1EF4 A;  2DA6 A;  3L1P A;  3FK7 A;  3O8H A;  1T33 A;  1ORK A;  2G0E A;  5EG0 A;  4G12 A;  3TP0 A;  1U78 A;  2DA5 A;  3FIW A;  3MKL A;  4RBO A;  1U9O A;  1RKW A;  2DA2 A;  2HXO A;  2FJ1 A;  3TP3 A;  2ME6 A;  3D1N I;  3TED A;  3PO2 J;  3JRH A;  1FEX A;  1HF0 A;  3BR3 A;  3TW7 A;  4GFB A;  1QVU A;  3IH4 A;  4QIW N;  2I10 A;  1ITY A;  1MBJ A;  3BQZ A;  3BR0 A;  3OSG A;  1WPK A;  2JWT A;  1RPW A;  2Y9Z A;  1MBF A;  5EG0 B;  4Y52 J;  2IAI A;  2O8K A;  1Y1W J;  1T56 A;  1I6H J;  4C3I J;  1MSF C;  2M9H A;  3IH3 A;  5FLM J;  1W0T A;  4BKX A;  3QPL A;  5DS9 A;  2ECC A;  3ZQL A;  3BT9 A;  2DJN A;  2HOS A;  1QVT A;  1ETO A;  1APL C;  4HNV A;  1VFC A;  2EQR A;  4JX6 A;  5IP9 J;  1GDT A;  2KT0 A;  3I4N J;  1ZK8 A;  5GP9 A;  3HB9 A;  2EZH A;  4BBS J;  1RR7 A;  4FE4 A;  1W0U A;  1OJL A;  3QPS A;  2FQ4 A;  1TWF J;  1TWH J;  2TRT A;  2E2I J;  4A3B J;  5JLW A;  3GTQ J;  1K83 J;  5HOD A;  9ANT A;  3CQZ J;  1NK2 P;  5BNG A;  2N8G A;  4IEJ A;  4V2G A;  3JRE A;  3PM1 A;  2CJJ A;  1FJL A;  2DA7 A;  3WHB A;  3HDD A;  3Q0U A;  2COB A;  3JR9 A;  3BQY A;  1LFU P;  3HOV J;  2ME0 A;  2WB1 N;  1UMQ A;  5EZG A;  3JRF A;  3NAU A;  1BJZ A;  2LY9 A;  3BG9 A;  2AHQ A;  3LOC A;  1IJW C;  4JX4 A;  3WHC A;  2JK3 A;  1I3Q J;  4A3M J;  4JP0 A;  3HOY J;  4B3A A;  4EEF G;  1PUF A;  5M3F J;  3G1O A;  2NVQ J;  5IOZ A;  2CUF A;  1POG A;  2DN0 A;  4AC0 A;  2X6O A;  1P7J A;  2JN6 A;  2JA5 J;  2JA6 J;  1JGG A;  2R5Y A;  2ID6 A;  2JJ7 A;  1WH5 A;  3VPR A;  1VND A;  2LTP A;  2M8G X;  4XRM A;  4D7N A;  2WV1 A;  1OCP A;  3O8G A;  1XC5 A;  1GVD A;  1JT0 A;  3QQA A;  3SFI A;  1HCR A;  2L7Z A;  5J1Y A;  2NVY J;  1PUF B;  3H0G J;  2MSY A;  1ZTR A;  5IP7 J;  2P81 A;  1RET A;  1JKQ C;  5EEA A;  1IG7 A;  5IYB J;  1JUS A;  4M3D A;  2DMU A;  2NVT J;  4D5F A;  2R5Y B;  3S16 J;  3MVP A;  4JX5 A;  1GT0 C;  1HOM A;  1MBG A;  4C3H J;  4XID A;  5J1R A;  1B72 B;  3S17 J;  1DU6 A;  2EZL A;  1MBH A;  2YUS A;  4A3F J;  2K40 A;  3CDL A;  3FK6 A;  4CYC A;  3S1Q J;  3NAR A;  2XSD C;  1BW6 A;  4M6V A;  2TCT A;  2Y2Z A;  3RQI A;  4V2F A;  1I50 J;  4C2M J;  4A3K J;  1MBK A;  2MW8 A;  2HI3 A;  3DCF A;  5EF6 A;  2O7O A;  2XPV A;  2LVS A;  4D5C A;  3GTM J;  4A69 C;  2GLO A;  2CRG A;  3G1M A;  2VI6 A;  3GTK J;  1SFO J;  2E2J J;  3A03 A;  1MH3 A;  4CYC B;  1TC3 C;  1JTY A;  4NDL A;  2K9Q A;  2L7M P;  3BR6 A;  2ECB A;  1P7I A;  5FKL A;  3LSG A;  2B63 J;  1JT6 A;  4XRS A;  3BR2 A;  2KDZ A;  1GUU A;  5GPA A;  3MN2 A;  5IPA A;  2M0C A;  1A5J A;  3JRB A;  3I4M J;  2L9R A;  5EYR A;  3TW6 A;  1X2N A;  2GM4 A;  4BXX J;  3JRG A;  4A3I J;  2E19 A;  5J1U A;  1F43 A;  1JKR C;  1WI3 A;  3Q0V A;  3B6A A;  4IHX A;  1JUP A;  4DZJ A;  4IHW A;  3H3V K;  1ETQ A;  2DA1 A;  1H8A C;  5F0F A;  3W6V A;  1WGX A;  2MG4 A;  3Q3S A;  3LSP A;  4FCY A;  2JA7 J;  5C3E J;  3ZQG A;  1IUF A;  5K7Z A;  2HDD A;  2WAQ N;  5E3L A;  3S1M J;  1OCT C;  5E3O A;  5FKM A;  5F1J A;  3F0C A;  3DEW A;  2ELK A;  1IC8 A;  3HEF A;  2D5V A;  3HOX J;  2M2E A;  5DTD A;  5M5Y J;  1BW5 A;  3G1L A;  2L7F P;  2DMT A;  5M5W J;  4I76 A;  4DYR A;  2DMN A;  2LFB A;  5FLV A;  1SAN A;  2PMZ N;  1FIP A;  5C4J J;  4X6A J;  3A01 A;  1X2M A;  4DYC A;  3S14 J;  3JRI A;  3RZD J;  3HKZ N;  1Z0X A;  3GBG A;  4MO7 A;  5F0C A;  3LNQ A;  3S1N J;  3JRD A;  2R92 J;  2CUE A;  3HOU J;  4MIM A;  3M4O J;  2LKX A;  3LSJ A;  1S7E A;  2EZI A;  1JJ6 C;  3ZQH A;  1Z77 A;  3GTG J;  1VI0 A;  2NS7 A;  2CQX A;  4I6Z A;  1H88 C;  1ETW A;  3Q0W A;  4LOC A;  3B6C A;  1R9T J;  3A01 B;  1B72 A;  1JKO C;  2E1O A;  3BG5 A;  3FIS A;  5JLX A;  1AKH A;  3S1R J;  1IGN A;  3GTO J;  1AHD P;  3IV5 A;  3BTL A;  2OPT A;  4B4C A;  2EH3 A;  2XGD A;  3JRA A;  2FD5 A;  1BA5 A;  1XG1 A;  2VPR A;  2ZB9 A;  3A02 A;  4ABZ A;  5F27 A;  2DMP A;  2LR8 A;  2K9N A;  1ETV A;  5FKK A;  5FJ8 J;  1FTZ A;  4M3G A;  2HXI A;  2QCO A;  2R5Z A;  3OOU A;  3BTJ A;  1ZGW A;  5EGO A;  1ZR2 A;  4J19 A;  3HM5 A;  4QTR A;  2M34 A;  3JRC A;  1AKH B;  4UUS A;  5GPC A;  2K9S A;  2X9D A;  1IDY A;  2W48 A;  4XRS G;  1WH7 A;  4A3D J;  1LE8 B;  3HGY A;  2NOG A;  1MSE C;  3C2B A;  1Y1V J;  1QPI A;  2CU7 A;  1UHS A;  3GTL J;  2R5Z B;  2XGC A;  1U9N A;  5EGO B;  1B8I A;  2HQ5 A;  4S0H B;  5IYC J;  1JJ8 C;  2DMQ A;  4IHY A;  4UUS B;  1Q1V A;  2Y0S N;  5K7F A;  1MNM C;  3BTI A;  3HGG A;  4AUX A;  5E3N A;  1O4X A;  3LSR A;  5EDN A;  2H8R A;  2DA4 A;  1MH4 A;  2RAE A;  4D7M A;  1IRZ A;  3IH2 A;  4IHV A;  2E2H J;  5F04 A;  3M3Y J;  3HOZ J;  4FTH A;  5FKN A;  4DW6 A;  5F0H A;  5IOY A;  4MFD A;  1HDD C;  3K7A J;  5IP6 A;  1B8I B;  1TWG J;  2OF7 A;  3S15 J;  3OSF A;  2EZK A;  1QRY A;  5C4X J;  5F08 A;  1IV6 A;  4RDU A;  1E3O C;  1TWC J;  2MGQ A;  1FTT A;  2JA8 J;  2HOT A;  4BY1 J;  1ETY A;  2NVX J;  3RKQ A;  4Y7N J;  4FIS A;  3ZQC A;  2XPW A;  1ZR4 A;  1JKP C;  4A3E J;  3HOW J;  1UG2 A;  1GV2 A;  2GBY A;  2L0K A;  1K61 A;  3BR1 A;  1GV5 A;  5M5X J;  2HYJ A;  4MLO A;  3CMY A;  1JTX A;  2VKV A;  4A3J J;  3S2D J;  4UUT A;  2X48 A;  3OIO A;  2FX0 A;  3S2H J;  5FKO A;  5K7H A;  2Y30 A;  4XK4 A;  2DTZ A;  1RKT A;  4W97 A;  5J3L A;  2XB5 A;  2ID3 A;  2VUM J;  1ETK A;  4M3B A;  4XIC A;  1F36 A;  3UKG A;  2HOA A;  2XPU A;  2IEK A;  2H1K A;  4FE7 A;  3K2A A;  1NTC A;  1IDZ A;  1X58 A;  5E3M A;  1LFB A;  3GTP J;  4BY7 J;  5EZH A;  1ZKG A;  4B1R A;  1HLV A;  1CQT A;  2XB0 X;  1BL0 A;  2R7Z J;  4C3J J;  1U8B A;  1A6I A;  1OFC X;  4MFE A;  2Y9Y A;  4M3E A;  2DA3 A;  1ZQ3 P;  3ZOB A;  4A3L J;  1YRN A;  1TWA J;  4BBR J;  1RES A;  2LP0 A;  1HDP A;  4QSH A;  4A3G J;  2YU9 J;  1ETX A;  1WCM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...