2L7MP

Solution structure of the pitx2 homeodomain r24h mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNHYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Pitx2 Homeodomain R24H mutant
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Pituitary homeobox 2
total genus 25
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l7mP00
2COBA 3TP0A 5F0FA 3SFIA 1MNMC 9ANTA 3QPLA 4M6VA 1HLVA 3C2BA 1EF4A 2NVXJ 1JJ6C 5FJ8J 3HKZN 3S2DJ 2L7FP 1MSEC 2LVSA 5IYBJ 5EGOB 4B3AA 2EZKA 4BY1J 1FTZA 3FISA 4W97A 5GPAA 4A93J 2HXIA 2MGQA 3LSGA 2R92J 4UUSB 2HYJA 4DYRA 2HI3A 1K83J 1LFBA 2WB1N 1GV5A 2DJNA 2IBDA 2PMZN 3O8GA 2VPRA 3BQZA 5M3MJ 2JA5J 1T33A 4XK4A 1UMQA 3K2AA 3JRDA 2JK3A 1RKTA 1AKHA 4ABZA 2R0QC 2JMWA 1YRNA 1Y1WJ 2DMUA 4A3GJ 2L9RA 1P7IA 1AKHB 1IDYA 1B72A 4M3BA 4J19A 4XRSG 2KT0A 1NK3P 2ME0A 3FIWA 5EZGA 1TWFJ 1IUFA 1MBJA 1QVTA 2CUEA 2VI6A 1I50J 3H0GJ 3ZQHA 2B63J 3Q0WA 3BR0A 2K40A 3S1QJ 2QF7A 1FIAA 1IV6A 2JJ7A 4DZJA 5IOZA 3QPSA 2JA7J 1ZR2A 2DA5A 3BR1A 2AO9A 3PM1A 1APLC 1D5YA 3JRIA 2X48A 1T56A 2WV1A 1RETA 1RKWA 3S16J 1Q1VA 5IP6A 2XGEA 2H1KA 3GTKJ 2E2IJ 1FTTA 1G2HA 3A02A 4I6ZA 3PO3J 1ETKA 3ZQLA 1IJWC 1X2MA 5JLWA 1XC5A 1QPIA 4DYCA 2O8KA 2LKXA 1RESA 1TWCJ 3BR6A 3CMYA 4XRSA 3BT9A 1W0TA 2JN6A 3G1OA 4UUTA 3WHBA 2ZB9A 1GDTA 3HGYA 4LOCA 5HODA 3HOYJ 3MKLA 1IGNA 4MIMA 5GP9A 1H88C 1XG1A 5E3OA 1BW6A 2IAIA 5F04A 5IYCJ 2R5YB 1VF9A 1QRYA 3GTJJ 4V2GA 2NS7A 5EYRA 1TWAJ 3M4OJ 2XSDC 4FCYA 4IEJA 2JWTA 3RZOJ 5J1YA 2FD5A 3B6CA 5K7ZA 2VUMJ 4A69C 4JYKA 2HXOA 3JREA 5EG0A 1XS9A 2WAQN 2M9HA 3RKQA 2VKVA 3I4MJ 4AUXA 4FISA 4MO7A 3OSGA 2FJ1A 4EEFG 3L1PA 2IEKA 2KDZA 5DTDA 1WCMJ 2HOAA 1OCPA 5J1RA 1AHDP 5GPCA 5FLMJ 2ME6A 5J1UA 4BY7J 3S1RJ 4NDLA 3Q0VA 1GT0C 2GBYA 1ETWA 4C2MJ 1JTXA 3GBGA 5EG0B 5M5WJ 2DA3A 2I10A 4FTHA 2CQQA 4A3BJ 1P7JA 2LP0A 5C4JJ 3NAUA 1JJ8C 1B8IA 3GTLJ 1UG2A 2QCOA 2EZIA 2LK2A 1YRNB 3G1LA 2XPVA 2M0CA 3Q0UA 4JX6A 1MBHA 5JLXA 3TW7A 1TC3C 2R5ZA 1MBFA 2E2JJ 4L5EA 3S2HJ 2NOGA 4M3EA 1IC8A 2R7ZJ 2FQ4A 3S15J 1F36A 2XB5A 1HDPA 4M3GA 3CCYA 2Y9ZA 1JT0A 3RZDJ 2NVQJ 1NTCA 2YS9A 3LSRA 3PO2J 1VFCA 4Y52J 2MG4A 2X9DA 3IV5A 2EBIA 2ELKA 4XRMA 4IHWA 3BQYA 4CYCB 4IHXA 1BA5A 2HOSA 2DN0A 3LSPA 4MFEA 3ZQCA 3HOXJ 2L7MP 1E3OC 2NVTJ 5IYDJ 3IH4A 4BBRJ 3SJMA 2NS8A 4X1EA 3A01A 1ZKGA 3TW6A 3TEDA 1IRZA 1ZGWA 3HOZJ 1FJLA 3BG9A 2LD5A 4A3DJ 2Y31A 3MN2A 3JRBA 1ETXA 3BG5A 1I6HJ 3TP3A 4M3DA 1DU6A 1PUFB 3GTPJ 5EZHA 1F43A 4HNVA 1MBEA 5EEAA 3QQAA 4BXXJ 4C3HJ 1JKOC 2O9LA 3HOUJ 2LTPA 5IPAA 2MW8A 2E2HJ 3Q3SA 1ZR4A 3GTOJ 1A5JA 3IH2A 5C3EJ 2EZHA 1IG7A 2DA1A 3BTJA 3JR9A 1PUFA 1OCTC 3WHCA 5E3NA 3LNQA 5F08A 3ZQGA 1BL0A 1MH3A 3GTMJ 1HF0A 2G0EA 4XICA 5M5XJ 4A3LJ 4RBOA 2Y9YA 1MBKA 4B4CA 3I4NJ 1RR7A 2TRTA 5F0CA 3G1MA 4I76A 1GUUA 1OJLA 1SFOJ 5BNGA 4JP0A 1S7EA 5EF6A 3S1NJ 1GVDA 3MVPA 4UUSA 3A03A 3E7LA 1LE8B 1A6IA 3A01B 3JRCA 4GFBA 2JA8J 1UHSA 5K7FA 5C4XJ 2DMTA 2OF7A 4DYQA 4A3JJ 2R5ZB 4C3JJ 1Z0XA 2HQ5A 2CJJA 1ORKA 2DMPA 2Y30A 1Y1VJ 2E19A 3IH3A 5M5YJ 2VKEA 4DW6A 2R5YA 1ITYA 1O4XA 3JRFA 4QSHA 2M2EA 5F1JA 5K7HA 1CQTA 2DA6A 2HDDA 3B6AA 1U9OA 3S17J 1TWHJ 3FK7A 4A3MJ 3HB9A 3RQIA 2M8GX 3VPRA 1LFUP 4JX5A 3ZQFA 1LE8A 2Y0SN 2CUFA 2DA4A 5FLVA 1GV2A 1POGA 1VNDA 4JX4A 3JRGA 1U78A 1IDZA 3K7AJ 4G12A 1SANA 3BTLA 5E3MA 2NVYJ 2OPTA 4FE7A 1JGGA 1ZQ3P 2DMQA 2TCTA 2K9SA 2XPUA 4QTRA 2N8GA 3OIOA 3FK6A 4C3IJ 2XGDA 1MSFC 3BR3A 5FKMA 4MFDA 5FKNA 1OFCX 4IHYA 5M3FJ 4MLOA 1WH5A 2K9QA 3H3VK 2XGCA 2YU9J 3UKGA 5J3LA 5F0HA 2RAEA 1HCRA 5FKOA 3GTGJ 4D7MA 5E3LA 1Z77A 1JT6A 3JRHA 4BBSJ 4D5FA 1VI0A 3HGGA 2XRLA 2LR8A 1FEXA 2L7ZA 1U8BA 2JA6J 1ZTRA 1WH7A 4AYBN 2W48A 1MH4A 4A3CJ 3NARA 3CDLA 2EZLA 4W1UA 2CRGA 3DEWA 2LFBA 4D7NA 1ENHA 1X2NA 3CQZJ 2EH3A 4Y7NJ 2R93J 3HOWJ 4V2FA 3BG3A 1MBGA 1BJZA 1X58A 1JKRC 3GTQJ 2O7OA 4S0HB 1ETQA 1R9TJ 4A3FJ 4FE4A 3ZQIA 3FKIJ 4A3IJ 2X6OA 3BR2A 1K61A 3D1NI 3S14J 2DTZA 4D5CA 1JUPA 3O8HA 3JRAA 2Y2ZA 3F0CA 3LSJA 1ETYA 4BKXA 2P81A 4CYCA 3HOVJ 1FIPA 1DU0A 5IP9J 2GM4A 4X6AJ 1ETVA 3HDDA 2AHQA 5DS9A 3M3YJ 2MSYA 1HOMA 5C44J 3BTIA 2ID6A 1H89C 3ZOBA 3HBLA 1WPKA 4IHVA 1JUMA 4M3FA 2LY9A 4A3KJ 1NK2P 2D5VA 2FX0A 2ECBA 3BTCA 1RPWA 1I3QJ 3W6VA 2H8RA 3S1MJ 1TWGJ 1ZK8A 3HEFA 5FKKA 1HDDC 4AC0A 3OOUA 3OSFA 1JKQC 1H8AC 5EDNA 2HOTA 1AU7A 3SDGA 3DCFA 5IOYA 5F27A 1B8IB 3HM5A 2CU7A 4B1RA 1U9NA 4DZPA 4QIWN 1WGXA 1ETOA 2XB0X 2YUSA 2DA2A 1JTYA 2ID3A 2DA7A 2L0KA 2M34A 4RDUA 2EQRA 1BW5A 1JKPC 2DMNA 2LLKA 2XPWA 2GLOA 2CQXA 1QVUA 1WI3A 2E1OA 4XIDA 5EGOA 2ECCA 2K9NA 1W0UA 3LOCA 1B72B 5FKLA 4A3EJ 5IP7J 1JUSA 3BR5A
chains in the Genus database with same CATH superfamily
1BM9A 4Y4RA 4BJ5C 3CP8A 4ASNA 4RS8A 3OR1C 4KA4A 1XMXA 9ANTA 1HLVA 3I53A 1FOXA 2ICWG 1Z7LA 2EINH 3V7SA 1DDNA 4F93B 2EFQA 2NOJB 3FXOA 5DM7F 5DCMB 4YEJA 2K9MA 3T0YA 2M7AA 4A12A 2IS4A 4RMNA 3FX3A 3MKZA 5D6FA 1ZG5A 3S2DJ 2L7FP 3M1CA 1LNWA 5IYBJ 1QZZA 3GW2A 2XF5A 3OIQA 2CMPA 2MYSA 1WI9A 3FISA 4CSWA 3KPHA 5GPAA 2VT2A 1IW7F 1O3QA 4I0AA 2IW5A 1W7PB 3HPGA 2HYJA 1O7LA 4UUSB 3OYMA 1WZ2A 1GV5A 4A2UA 2FOWA 3O8GA 2XVCA 1T33A 1A6QA 4CDGA 4E7KA 2F4OB 4QWQA 4RAYA 4JQFA 1W5TA 1YW9A 3KETA 3IKVA 3K2AA 5CVUA 3JRDA 1G4DA 3N97A 1HW2A 4CCKA 2LKPA 1YRNA 1Y1WJ 2DMUA 4G7OF 2L9RA 1IDYA 3FWEA 3VDXA 1MNDA 4M3BA 3A0BC 4J19A 1VQ6I 1CGPA 1R7JA 1Q1HA 2ME0A 5ERIA 1ZG1A 3JSOA 2CG4A 4EGYA 4DBQA 3I59B 3ZQHA 2WY7Q 2DBBA 3Q0WA 2K40A 1ZREA 4XN0A 4HX7A 1I6XA 3RJPA 3QYBA 1LDDA 3KEYA 1NG7A 4PZJA 3OYNA 3HC7A 2ZMEC 3PM1A 2ZXWH 3ECHA 4XSXF 3CCVI 1T56A 3ZQ7A 2DK8A 4KICA 4Z2YA 4Q4ZF 3K4BA 1RETA 1G3YA 2P6TA 2V1DA 1Q1VA 5IP6A 3GTKJ 4XL9A 1G2HA 2P0WA 1D0YA 4I6ZA 3SHFA 1RZ4A 2P5KA 3ZQLA 1XC5A 2VJJA 1OCOH 2LKXA 2RVCA 3VSLA 4F91B 4XRSA 3BT9A 3WG7H 3CCEI 4UV9A 1W0TA 1HKTA 1F4KA 2QLZA 2DFHA 3WHBA 1GDTA 2OUMA 4LOCA 2IGMA 4LLNA 2VQCA 2W1OA 1BI2A 3HOTA 5GP9A 1S5LC 3Q9VA 5E1XA 3PNTA 4L5IA 4LB5A 3H9JA 2IAIA 2BY2A 1F1ZA 1VF9A 3ZXSA 5FLXK 2H1LA 2FNPA 3H92A 5D8KB 1U3EM 2EWNA 1W4MA 3M4OJ 4NQWB 2KHMA 4I98B 2XSDC 2IJLA 4IEJA 3KP3A 5E79C 4A69C 4UY8I 3JREA 2K3PA 2FA5A 3BPXA 5EG0A 2WAQN 2Z16A 4ZH4F 4P96A 2VKVA 1O3SA 3I4MJ 2Q0OA 4AUXA 5H6RA 3FXKA 2XF6A 4FISA 4HOBA 3OSGA 4ZYEA 2FJ1A 4EEFG 2IT0A 5FFZA 2M30A 3L1PA 3OYAA 2KDZA 5DTDA 2PN6A 2F2EA 2HYFA 2JPCA 4BU2A 2JVGA 5FLMJ 2EILH 3J81Z 2ME6A 3HUGB 1LUJB 5J1UA 4BY7J 3F22A 3VEPA 4ENMA 1KYZA 1GT0C 2GXAA 2M0MA 3OYHA 2RDPA 1WJ5A 1PDNC 1DP3A 2VL8A 4EJVA 2CQQA 2PMHA 4A3BJ 3HZJA 2LP0A 3IL2A 3QRFF 4M73A 5C4JJ 1B8IA 3D5LA 4IJAA 1HKQA 2ZXHA 3GTLJ 1U2WA 4KFCA 1K78B 2V6CA 1YW8A 3G1LA 2ZSIB 2M0CA 4JX6A 3TW7A 2L4MA 4U0VA 4H0EA 1TC3C 2XAGA 1NHAA 1MBFA 1BIAA 2FBHA 2EV0A 2NOGA 1IC8A 3DKWA 2FQ4A 2A6HF 2JTVA 3CTAA 1WJFA 3F6OA 4Q48A 2XB5A 1J2XA 3C7JA 2IVMA 4XONA 1S9HA 3CCYA 4WXHA 4A5NA 2O3FA 3C18A 1W5CC 4KNYA 2A5YB 3LAJA 2UZKA 1N77A 3RQ4A 2MG4A 3OYJA 4YIRX 2ZKZA 3ERED 1S7OA 2CH0A 1GXPA 2UXNA 3BG7A 1R58A 3ERMA 2VJIA 2HOSA 2DN0A 3GLLA 3LSPA 2NVUB 3HOXJ 2L7MP 1D0ZA 1K7AA 2NVTJ 2QM3A 5CKTA 3SJMA 1IUYA 1LEAA 4UVBA 2ZMEA 3ZR8X 1VQKI 4O3MA 4G6TB 3TEDA 1YE9A 1ZGWA 1H9GA 1IRZA 2KFDA 1IRFA 4A3DJ 3K1NA 3JRBA 2QQ9A 3JCUC 5LGNA 3TP3A 3EUHC 1X3UA 1R4NB 3E5UA 4P1WA 3L2RA 4BJ6C 4HNVA 1MBEA 2H09A 2KIFA 5EEAA 2R7RA 3RIRA 4XRFA 4FX4A 2B9SA 3H3ZA 5JVTA 3DPLC 4C3HJ 4BGDA 2QYOA 3CMAI 1O3TA 1OISA 1T95A 2MC4A 1HSJA 4EJUA 2WAEA 4HDVA 3Q3SA 4Q5SF 3IH2A 1JHFA 3QYFA 3HRMA 1YX5A 2UWMA 4YG2F 3HTUA 3OYBA 3JR9A 3PSFA 5E3NA 2D1HA 2W84A 4XICA 1IF1A 4BL0B 3D5SC 2Y9YA 1MBKA 4BQNA 1EH8A 1CF7A 1MKMA 3TL4X 5HDGA 4V19K 3BJOA 3GZNB 1IN6A 3RPUD 1Z21A 2P5VA 2Y69H 4G8XA 1S7EA 2QQAA 2IXSA 5FLXZ 1XX5A 1FNNA 4HNUA 5K7FA 5C4XJ 5E20A 1V4RA 2DMTA 4NHJA 3KYCB 3K70D 3BWGA 4A3JJ 3WTVC 4YFKF 1YJ9I 4OIQF 3AKZA 2LKSA 1Y1VJ 1W7PD 2E19A 3V7CA 3L7WA 1U5TC 3C2GA 2ZC2A 2O6GE 2V1UA 1O4XA 1Y0UA 2VQHA 1V5EA 1CQTA 4AWXB 2DA6A 2HDDA 4LG0A 4JBAA 4KT5C 3S17J 1TWHJ 4A3MJ 4HV5A 4D9JA 2W25A 2Y0SN 4EM1A 2OJED 5GTIC 4IRHA 4B8XA 1IDZA 1J0RA 1AWCA 3TO7A 4BACA 1SANA 1WVRA 4NNJA 2VJ4A 5FD5A 1GLNA 2V1XA 2DMQA 2XPUA 2YSRA 2VXDA 1YTYA 3CCRI 4C3IJ 2XGDA 2JVHA 4ESJA 3HUGA 4MLOA 4C30A 4WK8F 2KMUA 3GUDA 3H3VK 1XCBA 2EA4A 1R5HA 4PJMA 3UKGA 1Z3XA 1HCRA 5HLHA 5E3LA 4IOCF 1V5FA 5E8GA 4BBSJ 4XKWA 4D5FA 2GA2A 5J40A 4MQ9F 1FYLA 3GLXA 4PGHA 2I5UA 2KIMA 2ELHA 1ZTRA 2ESNA 2OBPA 1WH7A 3ECOA 4AYBN 4EV0A 3G4SI 4BDZA 2ZNZA 4M9ZA 4A3CJ 5EEGA 1VQOI 5TISC 3N4MA 1ENHA 3EDPA 1RRJA 3BG3A 1MBGA 5ICCA 1TQIA 5BPDA 2D45A 3CMMA 1X58A 2BEOA 1R4MB 1JKRC 3GTQJ 2HYGD 4S0HB 1ETQA 3BY6A 1QO0D 4A3FJ 3RI4A 3ROUA 5DD8A 2X6OA 1K61A 3S14J 2VASA 3ZRGA 3KE2A 2Y2ZA 1YYVA 1S72I 3ZPLA 3LSJA 3WTSC 2W00A 4RM2A 1DU0A 2IS1A 2CFOA 1BR1A 4HNTA 4X6AJ 1ETVA 1A04A 3LAPA 3HDDA 3LSTA 3M3YJ 2KZVA 2IGNA 2GA1A 2RC4A 2BVMA 3H3UA 2ID6A 3DF8A 3HIFA 1JUMA 2QSGX 2ZJPF 3AFHA 2LY9A 4A3KJ 2HKOA 2UUZA 1SAXA 2FX0A 2ECBA 2DI3A 4NC6A 1YITI 5D8LB 1A35A 3PSIA 3BG6A 2DYSH 1K4SA 2H8RA 4PUSA 4HA8A 3VFZA 1BI0A 2CQNA 4AC0A 4KMUX 3E6MA 2FF4A 1PUEE 1H8AC 2GOMA 1XDUA 2YPRA 4TV7A 3SDGA 2W4SA 5ILUA 1WJDA 5IOYA 5F27A 3HM5A 3I71A 4DZPA 5HLTA 4F3QA 2YUSA 1USSA 2XB0X 2GXBA 1OQYA 4IRGA 1KQ8A 2XPWA 3ASNH 3R4KA 3DLLF 2OTJI 4ON0A 3CCJI 2E1OA 4XLEA 5E8IA 4F55A 3OYDA 4PCQA 3FXQA 1P2FA 2R3SA 3G2BA 4U87A 1B72B 4A3EJ 4II3A 3S3OA 5LHHA 4HRIA 2Z5UA 2HOEA 2ZFWA 1BR2A 1R1UA 1Z6RA 1MMAA 2BHZA 4RB1A 3SZPA 1QQIA 4PDKA 3KEQA 5F0FA 1FP2A 1FMWA 3CCSI 1X4OA 2KL4A 1MNMC 3CC4I 4YELA 5L3BA 4M6VA 1S29A 2HVRA 2EV6A 3ZMVA 4E70A 3C2BA 5D4RA 3GF2A 3C2HA 1BR4A 2HR3A 2FXAA 5LLQA 2CQ7A 2ZBKA 1KU2A 3PIPF 2LOOA 1RNLA 2K27A 4H4KC 4AYBA 3VWBA 3DKXA 2HNHA 3DTEA 3S8PA 2RKHA 3H9QA 1J7KA 1Z91A 5B5EC 1W5SA 4HZFA 5EGOB 4BY1J 1DUXC 2A07F 2DPUA 4IZZA 3W2WA 4W97A 4A93J 1MW7A 2DQRA 3K0LA 1WQ2A 3GFLA 3LSGA 2M1BA 4BEHA 1LFBA 2IGOA 4RAZA 1I39A 2V79A 2DJNA 3HRUA 2Y75A 5M3MJ 3ZCOA 2ZJ2A 4XK4A 3B73A 5FRMA 1CF7B 1SMTA 1RKTA 2QKMB 4ABZA 3G3ZA 1FBUA 4XKBA 2JMWA 1W36C 4XORA 3ZMSA 3SXYA 4BXFA 4XOPA 2Y48A 3F21A 2L9VA 1OR7C 4XRSG 4ZJZA 3K4MA 4NB5A 1JI8A 2ZXIA 4AIDA 3FIWA 2ISZA 5EZGA 2Y0MA 1TWFJ 2CUEA 2RREA 1I50J 4HPQA 4I0BA 1FSHA 2D2WA 2PEXA 1X1CA 2LBFB 2KIQA 5IT9K 1TTYA 3S1QJ 2QF7A 4FASD 3E0JB 2JJ7A 2JA7J 3QPSA 3DP7A 3SYTA 1DQUA 4BXUA 1R1VA 3JRIA 3E6CC 2OQGA 2ZCWA 2WV1A 1RKWA 5K5OA 1WKMA 1XSXA 3DEEA 3GMEA 2O8XA 2H94A 3KP7A 2GZWA 3PO3J 1GHCA 1ETKA 5KNLA 4EMSA 1IJWC 1X2MA 3FZVA 1EV7A 4DYCA 2O8KA 4I02A 3OS2A 1RUNA 1N78A 1XDSA 2JN6A 1ZHFA 2BY0A 5H2FC 2JPBA 1KA8A 1LEBA 5L3GA 3QYEA 3CUQA 3HGYA 4U88A 2IP2A 4A6DA 5HODA 2GIVA 2P5LC 1FBQA 2CW7A 3DBRB 3KIOA 3P9KA 2DLLA 2DT6A 1VQPI 5F04A 3CDIA 5LEJA 4EGZA 1QRYA 3GTJJ 2DT5A 1H9TA 2NS7A 2HPIA 2FQ3A 5EYRA 3RCOA 1KQ9A 4OIOF 4PK4A 4I7HA 4UB8C 1ZN2A 5AIQA 3RZOJ 1I1SA 3T5XA 3OS0A 5K7ZA 3B6CA 4HSTA 4JYKA 2HXOA 2M9HA 3RKQA 3PFIA 2PMZA 1T0FC 3PQKA 3CO7C 3K70C 3JTHA 2E7WA 2L9NA 2HDCA 2IEKA 1IV8A 4X0GA 5H20A 3L2WA 3E5XA 4PJJA 1A36A 1ZLKA 4D1QA 2OTLI 4RA2A 1OCPA 5J1RA 3CZ6A 2DO7A 1UHWA 1TNTA 3QU3A 4BHCA 3S3MA 3S1RJ 2XAQA 4NDLA 5JHUA 4JK1X 3GZ5A 1KQ0A 1ETWA 2GQQA 4C2MJ 3GBGA 3PUBA 1Z3YA 2DDBA 3T8RA 1YX3A 1JJ8C 1R1TA 5CVRA 4L9TA 1G3SA 1SD6A 2QCOA 1ERDA 2ZNYA 2XPVA 5J4VA 4LFUA 3OYLA 1LVAA 1MBHA 5JLXA 3H36A 2KJCA 2ZSHB 4XKVA 4OINF 2R5ZA 4XLPF 4L5EA 1V54H 5GAHJ 1SD4A 3HXLA 2R7ZJ 4Q47A 3J80Z 4O6JA 2QBYB 1Z7UA 3W2AA 4LIVA 2ACJA 1OPCA 1HDPA 3QP5A 2KRFA 3RZDJ 3O6BB 5ED4A 2GIZA 1EKEA 1NTCA 2NRAC 1P4XA 3M7GA 3PO2J 3WTYC 2DFEA 1KU7A 4IHWA 4HLXA 4WCGA 3HSEA 1BA5A 1SAUA 2FE3A 4KMFA 4MFEA 2JA2A 3F23A 1I1GA 2QQ8A 3J7AY 5CQEA 1T98A 3X2QH 3MKYB 1T39A 1ZKGA 4GRIA 3OYIA 2BV6A 1X19A 2GWRA 3GX4X 3CF2A 5DYMA 3ABMH 2LD5A 3MN2A 4UVAA 3BG5A 1SFUA 3KP5A 4M3DA 4ZC3A 1BOBA 4LLLA 1PUFB 1DU6A 1MJBA 1ZLJA 2H6BA 2NXNB 1F43A 1WJEA 5EZHA 2VQGA 3C3WA 2L7KA 4HV6A 2MH2A 1OR7A 3LA2A 1VQ8I 2GAUA 5ICFA 3HOUJ 2LSOA 1ZR4A 1A5JA 5C3EJ 3KFWX 5A2QK 2CV2A 1UB9A 2DA1A 1PP8F 3BTJA 2V4JC 1O3RA 3MQ0A 2LC2A 2BY1A 4FX0A 3ZQGA 1MH3A 3COAC 1FT9A 2F5VA 1QA6A 3GTMJ 1ZRDA 2KP6A 3A1YA 1FZPB 3QPHA 4C9YA 3DWLE 1K79A 3I4NJ 1J09A 2TRTA 2VT3A 3ONQA 3K1PA 5F1RA 2V7FA 1P4WA 5CYVA 1ON2A 3OMYA 1MDMB 4M6XA 1GVDA 4UUSA 3NRVA 2XROA 5LFAA 1U8RA 4QLCU 4CGZA 2A68F 2XF7A 1VQ7I 3IUOA 2XDVA 3F3XA 1XGOA 2R5ZB 1EH7A 2L01A 2HZTA 1VQLI 1YIJI 2BXZA 2MA3A 1D0XA 4RGUA 3IRRA 2NAZA 3UNGC 1SD5A 1Z6TA 4LG3A 5M5YJ 3R0AA 4RLFA 4LJZF 2EFWA 2QENA 3J7ZI 4XLHA 1U9OA 2JSCA 1UJ8A 4F92B 2M8GX 3VPRA 3ZQFA 3IWFA 5LEKA 1S8NA 4CXFA 3G71I 1G3WA 4XLCA 2X6XA 3U1KA 3RTRA 4E7LA 2L54A 3BDDA 1WHUA 1XMAA 1I3AA 5KAIC 1RUOA 3V42A 3K7AJ 4XSZF 1R5GA 3KP4A 2O5RA 2M4KA 4U7BA 2EJRA 4N0BA 2DCEA 4FE7A 1VQ9I 4E6KG 2TCTA 4QTRA 1Y8QB 4M71A 2ISYA 4ZTJA 2LNBA 3I5UA 4I99C 3K4KA 1MSFC 5IT9Z 2QVOA 3I58A 4C2TA 2COMA 4N9HA 3EUKL 4IHYA 2HKXA 3P9CA 5M3FJ 2EIKH 4E7IA 3BOQA 4GGGA 1YQAA 2RAEA 2XAJA 3I4PA 3OYGA 5DV5A 1DGRM 1XPXA 4N4NB 2CFXA 3J80K 1Z77A 2F4IA 2L2OA 5FFXA 1BIBA 4CICA 2XUBA 1MZBA 1L3LA 3WE2A 2R7DA 2LR8A 4P5OA 1U8BA 4IHTA 2P8TA 2JUGA 2W48A 3OL3A 4HSRA 2W82A 3WODF 1SC7A 4NQWA 2EZLA 1YI2I 2VOOA 2CRGA 4D7NA 1XSVA 3CQZJ 1LVKA 1PVEA 4V2FA 3FXUA 1DPUA 1NH3A 3ML6A 1XGNA 5FROA 1BJZA 4G6QA 1QPMA 2DYRH 3HPHA 1QU3A 4D0PA 2O7OA 1J59A 1R9TJ 3EYYA 4FE4A 2L9SA 4HYEA 2O0YA 3K4LA 3NQOA 3PJRA 1X4PA 2K85A 3SEZA 3JAMZ 1ETYA 3BP8A 1STZA 3M8JA 1KYWA 1SVLA 4CYCA 2HGCA 3IKTA 4BH9A 2Z9OA 4OAYA 4P55A 1WRJA 2A61A 1FIPA 2R4GA 3OOPA 3D0SA 3TDZC 3WTZA 5IP9J 3NEUA 3VSKA 1FP1D 4JOMA 3V4GA 2DK5A 5E17F 2AHQA 5DS9A 2VKHA 3DPTA 3FM5A 4LGWA 2RQPA 5C44J 4L9NA 3WTWC 3ZMTA 2UXXA 2R7WA 4XLAA 4IHVA 3F8FA 4M3FA 4UB6C 5L3FA 4RB0A 2V6EA 2NNNA 1BC7C 3C1DA 1BBYA 3BTCA 1T6SA 3O2PE 3JTGA 3DU6A 3TKYA 1FPQA 3PNVA 1I3QJ 2YU3A 1IXSB 3W6VA 1TWGJ 1ZK8A 4A0XA 2VBZA 1HDDC 1D1BA 2OZUA 3OOUA 1PP7U 1JKQC 3F8NA 2X0LA 5EDNA 2QA4I 3K9TA 1AU7A 3VB2A 5LD2C 1B8IB 4YIIA 2H8WA 1U9NA 1ZRFA 2OAZA 2KKOA 3FDYA 1WGXA 1ETOA 2BHYA 2TDXA 1V5GA 2W24A 2DA7A 2WA0A 2EV5A 2M34A 3K2ZA 4U0YA 2W85A 2LLKA 2HFHA 3E3VA 4EM2A 3AL0B 3LSIA 5F6FA 3T1BA 1QVUA 1WI3A 1OYWA 4L0ZB 1YHQI 2LYCA 2FEZA 2EK5A 1T2KA 5FKLA 4ENNA 4BE0A 3MWMA 2PX9A 3HSRA 2YX4A 3CJQB 1JUSA 2UV1A 2B7EA 2ESHA 3TP0A 1GXQA 2M8EA 3I54A 1X1DA 4UV8A 2ADUA 3QPLA 3OYKA 3ZMZA 3QP6A 2DDAA 1EF4A 3BPVA 5HS7A 2HVSA 3L2VA 5FJ8J 4CCLA 4IRIA 5HS9A 1J5YA 2PJRA 1VQNI 2P4WA 2J5OA 2F5FA 4EQQA 2PLYA 1MSEC 1YJWI 5KAFC 4B3AA 1TL8A 2Z2SB 3G73A 5CVIA 1YW7A 2MFZA 1H0MA 1AA7A 4AD9A 1HW1A 3PQJA 1OCRH 2HXIA 2MGQA 2VLAA 1G3TA 3O3KA 5LGUA 3IWZA 1Y6IA 5CPRB 3OL4A 2HQNA 3VOEA 2O61A 3QAHA 2VPRA 1G6NA 3PFYA 3BZ6A 4BYYA 1KU9A 3LQQA 4Y17A 1WJAA 3K10A 4XBFA 2M87A 2JK3A 2MLKA 2R0QC 1VQ4I 1HA8A 3HTSB 5B1AH 5D4SA 1B72A 1TQPA 4B3XA 4R79A 3I55I 1SFEA 2KT0A 2VPLA 2QKLB 4P9FA 1WJCA 5F64A 4GYGA 4M74A 4A0YA 3DLAA 2VI6A 1IUFA 1MBJA 1QVTA 3Q9SA 3W6JB 4BE1A 1VTNC 4CUGA 4UHTA 1JHHA 1JE8A 4BNCA 2CQKA 2HS5A 2B63J 1G8XA 1ZGAA 2WV0A 3H5AA 2Z3YA 5BMZA 4OWRB 1FIAA 3EUHA 1IV6A 5IOZA 4G7ZF 3U2RA 1UAAA 1PYVA 2DA5A 3ABUA 5EEHA 3BR1A 1OYIA 2AO9A 2KISA 2QUFA 3L2UA 2FNAA 1W7PA 4PJLA 1D5YA 1Y56A 2X48A 3WG9A 1X1BA 3GYHX 3PIOF 3SZGA 3OYCA 1FWZA 2H1KA 2XGEA 4HG2A 2HQRA 2Z33A 2E2IJ 1FTTA 3A02A 1IN4A 4GO1A 2E1CA 1QNTA 3A4CA 4CCNA 1QPIA 2AXTC 4G9YA 2A05A 1MNEA 2V9PA 3SDBA 4EVIA 3QOEA 4XN3A 4XLFA 3OYFA 2CUJA 1D3YA 4XR6A 3CCUI 4Y33A 4IX7A 4ZTFA 1KONA 2DODA 3I9V2 4NC8A 3V8JA 5HDKA 3HOYJ 4KIGA 4DIQA 3KZZA 3I0TA 4MIMA 1XG1A 4AIJA 5E3OA 4HF1A 2Z99A 3FBIB 3P7NA 3K1MA 3CCLI 2P7VB 1D8JA 5IYCJ 2OV7A 1FOYA 1RR8C 3A2KA 4R1HA 2CGPA 2VJ5A 2J5PA 4MHGA 3GCMA 4F7ZA 2CO5A 1FOKA 4Y13A 1TWAJ 4WX9A 3D5RC 4IXAA 1FOWA 3L2QA 2JWTA 1ON1A 3CCMI 2FD5A 2HTJA 2XHKA 2FBIA 2L5QA 3EQLF 3BLYA 3NWSA 3J81K 4S04A 2LBFA 3OV8A 3WTXC 2RN7A 2QGUA 2MD5A 1FBSA 2VE8A 2EB7A 3GVAA 3I56I 2CUZA 3KEOA 2DT7B 1WCMJ 1HC8A 4N4OB 4J01A 2HOAA 5FB2A 2QWWA 1AHDP 2JRTA 6PAXA 2XASA 2VBYA 2CW0F 4M6YA 3MZHA 1QGPA 5HDNA 2NS0A 3VODA 3HG9A 4R8HA 2M5WA 2F5CA 5M5WJ 2KQRA 2DA3A 3RKXA 2L02A 1P7JA 4M9XA 1YS6A 2NNYA 1R00A 1TT5B 4UUVA 3BZKA 4P9UA 1O57A 3FF5A 3PNYA 4AVZA 1P4AA 1SVMA 1X3WB 1UG2A 3SQNA 1LDKB 2EZIA 2LK2A 1MMNA 1YRNB 4GDFA 3RPQA 3Q0UA 3KP2A 4LD5A 1R49A 1FX7A 3FXLA 5B3SH 3WTTC 2E2JJ 3I3LA 4EJOA 3S2HJ 4PJNA 4WF2A 4M3EA 4KDPA 2M4GA 2BW3B 2JQ7A 2XIGA 4PFPA 1IN8A 2IA1A 1F36A 4XKCA 3J7YJ 1MD0A 2BOLA 2R7FA 5L3DA 1YG2A 2IA2A 2Y9ZA 1FMVA 1LB2A 1R6RA 2FU4A 2NVQJ 3M9AA 4IQ4A 4ZDPA 3FXMA 4RAGA 2BW3A 3N05A 3ESWB 3R6SA 3S93A 2YX7A 2A6TA 5DUIA 3LSRA 2PJRB 1VFCA 4CZZA 3SZTA 2R7SA 2X9DA 2K4JA 3AAFA 3IV5A 1IRXA 2ELKA 3WGHA 1V55H 1Z05A 4BQOA 4CYCB 4IHXA 4E7JA 4KISA 2HTSA 2VC1A 1K78A 3L09A 2E7XA 1E3OC 5IYDJ 3IH4A 3FMRA 3KYDB 4BBRJ 3WU2C 3CJTB 2BGCA 2QSFX 3E6BA 3A01A 4YRVA 3TW6A 3ABLH 4U7DA 3HOZJ 1FJLA 4II2A 1UFMA 2Y31A 1DGWY 3QWLA 1I6HJ 1E0EA 1I27A 2VKDA 2FOKA 5D6EA 5LRRA 5DCFA 4ZYDA 4FETA 3GTPJ 1B4AA 2CV0A 2D1VA 1IXCA 3QQAA 3IHUA 4BXXJ 4L5JA 4OIPF 2OC6A 2F48A 1DP7P 2O9LA 2ZJRF 1LQ1A 3FM3A 1MMSA 4B47A 1HXDA 2ZO4A 4F52A 2E2HJ 1V3FA 3GTOJ 3W6KB 1U0JA 4EJTA 1FLIA 2IRFG 4RB3C 5J6XA 4LITA 3JSPA 1VZ0A 2E71A 1BC8C 1XGMA 1OCTC 2STTA 3LNQA 1B9MA 1YS7A 1BL0A 2G0EA 2OCEA 2KLOA 2RV8A 3EETA 1YIOA 1Y8RB 5M5XJ 4B4CA 1FSEA 4RBOA 3MFKA 3HOSA 1W36D 4A3LJ 2K02A 2QSHX 1T0FA 3E1SA 1G59A 1MMDA 3G1MA 1USTA 3TO9A 1GUUA 4OU0A 4MEXF 1LKXA 1T08B 5GAGJ 2STWA 1SFOJ 2VE9A 4LMYA 3QOPA 3U9GA 3S3NA 2LMDA 3S1NJ 4AIKA 2CV1A 3E7LA 3CJRB 3A01B 2C6YA 3TDUC 2R7VA 5JR3A 2GOXB 3DTIA 4HW0A 1UHSA 1KGSA 4XQFA 2DXIA 2E34A 5DEQA 5LGTA 4DYQA 3HKZA 3JAMK 3KLNA 2CJJA 1ORKA 2DMPA 2Y30A 2X6WA 3DPUA 3A0HC 1MDMA 1P6RA 3IH3A 4HF0A 4XOTA 4B44A 3KP6A 3FMQA 2VKEA 4AU7A 2FBKA 5LBQA 4E7HA 2M2EA 2OA4A 5K7HA 4L18B 4NC7A 1BJAA 4BDYA 1QHHD 3HB9A 1LFUP 5CJ9A 2DOEA 2R7OA 1IN5A 2AXLA 2X85A 3BROA 2CUFA 2DA4A 4HX4A 1LE8A 3CLQA 2LRDA 2DPDA 2G9WA 4JX4A 1U78A 5BOXA 5J8CA 3LSHA 4HEA2 2V9VA 4G12A 3ZGKA 2ZFUA 4HAMA 3BTLA 1ZGJA 5D5UB 2OPTA 2K4BA 3AG1H 4RAFA 1ZQ3P 2N8GA 1NG6A 3OIOA 3LWFA 5TGTA 2E60A 3MMYB 1W1WE 1XSDA 5FKMA 3V7RA 4MFDA 5FKNA 5FRNA 2IPQX 2EIMH 1WH5A 3DFGA 1J75A 3FHZA 2XGCA 5K5RA 2YU9J 1QZYA 5AIPA 3V8KA 2BBYA 2OCCH 3GO5A 2OQRA 1T38A 4IKFA 1S3JA 2LG4A 2O03A 2VIXA 4D7MA 1XN7A 2EIJH 3AG2H 1JT6A 4MQVA 1YLFA 1M1EB 2VN2A 4XNFA 3JRHA 1TT0A 1WWXA 1VI0A 3DU5A 3HGGA 3MKWB 2XRLA 2DQLA 1U5TA 2HWVA 1FEXA 1BI3A 3H0DA 2AQFA 2MABA 2WWYA 3IAS2 2JA6J 2FUG2 4L9VA 1MH4A 2DOAA 4ESFA 3NARA 4W1UA 3DEWA 4IVNA 4C2UA 2VQLA 1X2NA 2LDUA 4Y7NJ 2V9KA 3MEXA 3HOWJ 4ENJA 4ENKA 3L00A 1TW2A 3GFJA 2JZYA 3H9GA 4HX8A 2BXYA 2CYYA 2X6YA 1A31A 3ZQIA 2CWEA 5JVGF 4A3IJ 3BR2A 4D5CA 1JUPA 3O8HA 3DBHB 3F0CA 1RIOH 2RGVA 4BQAA 2KRCA 3OR2C 3SEQA 3LL7A 4WXDA 2GM4A 1S7AA 1R22A 4LLGF 4IL6C 5LHIA 5L3EA 3WTUC 4LIUA 5E18F 3BTIA 2DTRA 5CQGA 1H89C 2Z1DA 3I59A 3HBLA 3VYTB 1NK2P 3KZYA 4LK1F 3CMEI 3REOA 2XGXA 5K5QA 5B66C 5D5XB 1RPWA 2K9LA 3AG3H 1JGSA 2F4MB 1ODDA 3S1MJ 1E2XA 5K1YA 5FKKA 4E7SA 4ESBA 1U5TB 4IQJA 1SFXA 3QU6A 4LK0F 1K6YA 2X4HA 2VOPA 2HOTA 1LJ9A 1Y39A 4KN7X 3H1CA 4HLYA 2R7UA 1R36A 4GCVA 3TQNA 2CU7A 1XB4A 4B1RA 1PJRA 4QIWN 5L3CA 4L0YB 1VQMI 4DQ2A 4DBRA 3KZIC 5AONA 2EQRA 3CC7I 2WAFA 2DMNA 3L9FA 2GLOA 2CQXA 3GEZA 2XRNA 3LA3A 2FRHA 1IXRC 3DTKA 5H6QA 1YJNI 4XIDA 2ECCA 3T8TA 3VYUB 5BQTA 1W0UA 4PJ0C 3EPZA 4B48A 4CHUA 1B59A 1MGTA 2EFNA 2M7BA 2XKOA 1ZRCA 4S05A 4NBQA 2F5EA 2X1EA 5CVJA 4PSWA 3BR5A 4PSXA 2COBA 3F8BA 5BPIA 1BN5A 1O7FA 5ICGA 2V1NA 2DOFA 4Y15A 2JRMA 3SFIA 3ABKH 2KRHA 3R0JA 1B1BA 4GXOA 3I64A 2PQ8A 3B02A 2Q2EB 3GXOA 2NVXJ 1KZHA 1JJ6C 4I2OA 1OCZH 5DUKA 3HKZN 2Q2EA 4XMYA 2JT1A 2EPFA 1QZEA 3RKWA 5D5VB 4XLNF 3CDHA 5DD4A 4DJAA 3DKYA 2H27A 4YIFA 2XKPA 2LVSA 4YFNF 1FTZA 2EZKA 5DCMA 3H5NA 1C0WA 2I8DA 4ZZLA 4ZZDA 3BJAA 4UVCA 1IN7A 2F6CA 2R92J 4M9SA 3IP4B 1Z67A 1SD7A 4DYRA 2HI3A 1K83J 5E1ZB 2WB1N 5J47A 2IBDA 2PMZN 3BQZA 3CP2A 2JA5J 4HF2A 5ILVA 2KJBA 5GAEJ 2DFFA 3HHGA 2ETHA 3ZN0A 1D1AA 1BI1A 1UMQA 5J4YA 2K86A 2BVLA 3QPTA 5BS6A 1E3HA 4RB2C 2V26A 1T8IA 1AKHA 1AOYA 5HNHA 4A3GJ 1P7IA 3F9KA 4WXCA 2EA2A 1AKHB 1QBJA 1HW5A 2MBFA 4G94A 2YR2A 3OYEA 1TP4A 4E4HA 1NK3P 1B9NA 2ZXJA 1I5ZA 4M72A 4OAZA 5CVVA 3H0GJ 5LHGA 4CZCA 3BR0A 3M1EA 4RGRA 1XTAA 4RGSA 3ULQB 4BS9A 2DFIA 5KCMA 4DGWB 1L0OC 4KN4X 4QPQA 3M8EA 4DZJA 3CC2I 3S2WA 1TNSA 1ZR2A 4CH7A 4ZDLA 3BJ6A 4UNOA 3CUQB 1APLC 2LY1A 3BC8A 3IRQA 3TOBA 2RNJA 4BJTA 2ELJA 2EFPA 4CCJA 2XV4S 3S16J 2IS2A 1WFXA 4E7ZA 1XCVA 2HZDA 2W57A 3KYLA 1IZ1A 4B43A 2A3SA 5JLWA 1RESA 2OZ6A 2OD5A 1TWCJ 2A69F 3BR6A 1BOAA 1X1PA 4KT6A 5EJCA 5HLGA 3CMYA 1ZH5A 3G1OA 4UUTA 2ZB9A 3M8FA 1EA3A 4NUBA 3TOAA 3G6EI 3R60A 2PI0A 3WGIA 3MKLA 2IS6A 1IGNA 1E17A 1MMGA 1H88C 2G7HA 4K2EA 1OMIA 4OOIA 1BW6A 3LSMA 2R5YB 3ABTA 4O5VA 1UG0A 2LF8A 2XAUA 4V2GA 5KK1A 2HU9A 1X1AA 2GXGA 3H35A 2R7QA 2RNGA 4MTDA 1ZELA 2FMYA 2DW4A 1ZARA 4RM3A 3ZMDA 3DXJF 4FCYA 3F8MA 4DOZA 2Q8KA 5J1YA 2VUMJ 4Y3OA 3QODA 3K4JA 1XS9A 3K6GA 2QQBA 3FMSA 4HBLA 4ZYAA 5GTHC 4AIHA 4MO7A 3LFKA 2F5DA 5IPAA 4EM0B 2MD0A 1RI7A 2XSJC 3HJEA 3EUAA 3FXRA 3W2VA 1KU3A 5GPCA 2HVQA 2OU2A 2QZ8A 2ZJQF 4G7HF 3HRSA 1ZG3A 3HSFA 3LA7A 3KX2A 3EYIA 3Q0VA 5LRSA 4N9IA 3KCCA 4EJWA 2GBYA 1IAWA 1JTXA 2A5WA 4MGRA 5EG0B 1YFHA 3ZN1A 2I10A 4FTHA 2VONA 5JFRA 3NAUA 1JXSA 1SVOA 4GYIA 4XM3A 5IT3A 5IY5H 3RKYA 2EFOA 1OKRA 1S6LA 5DDGA 2E35A 2LY2A 1B6AA 4OMYA 1SMYF 3R61A 3CUOA 2PFBA 3P9IA 4LG0B 2W7NA 3PUFA 5DM6F 3GFIA 3S15J 3W3CA 5ILSA 3Q5FA 4I09A 4I01A 4KJZA 1ULYA 2P7CB 1YO5C 4M3GA 4LB6B 3CO6C 1JT0A 5E1WA 4BHBA 2YS9A 5HLIA 3M07A 2Q1ZB 1TW3A 2CS3A 4Y52J 1GVJA 1UCRA 5FGMA 1X3ZB 2EBIA 2IA0A 2WBMA 3RSNA 3BQYA 4XRMA 2AS5F 4BHPA 3HRTA 1R5ID 3LFUA 5ICEA 4CA0A 3VYSB 2DU9A 3WE3A 3ZQCA 1R23A 2WAQA 2MC3A 2NS8A 2RQQA 4X1EA 1U6GA 2BYVE 1SFKA 4A5MA 4BUPA 4CYDA 5HS8A 4KUMA 2PG4A 4U0WA 3BG9A 2WADA 4RGXA 1QHGA 5KHDA 2VXZA 1ETXA 1RC9A 1OYYA 3ISPA 2QEXI 3H5RA 4FHTA 3U21A 4CCOA 1D1CA 1K6OA 5D5WB 4KIBA 3MCZA 3WGGA 3L2CA 1J9IA 1K4TA 1OCCH 1JKOC 2E1MB 1D8KA 1IO2A 1ZAOA 2LTPA 2K7LA 2MW8A 3GWZA 2WC2A 3KLOA 4FT8A 3OIPA 3RYPA 4ZDOA 1XGSA 5HOOA 3U1DA 4EATA 2EZHA 1IG7A 4IPAA 3NWTA 3HL2A 4OMZA 5JI6A 3LMMA 5HVQC 3RDIA 3LQRA 1WSUA 2VB6A 1Z1DA 3AG4H 2A6EF 2WTEA 3V8LA 5TRDA 2X1DA 1DPRA 3WHCA 1PUFA 1FYKA 4OIRF 3ELKA 2E5ZA 2KPMA 1P92A 4BAYA 5F08A 1Y0NA 1HF0A 3S32A 4IO9F 3OS1A 2E1NA 2XAHA 2LREA 2ZMEB 4YFXF 1SEUA 1RR7A 1UHMA 2K5CA 5F0CA 4HQEA 1XMKA 4I76A 3CCQI 4BE2A 3DEUA 1OJLA 2HEOA 2X51A 5BNGA 3OY9A 2CSOA 4JP0A 5EF6A 3PL8A 4ANJA 3MVPA 3A03A 1HBXG 1LE8B 1A6IA 3P5JA 3LSKA 3JRCA 2E36A 4GFBA 2JA8J 2R7TA 2BE5F 3MZYA 2OF7A 4Z6YA 4C3JJ 1FYMA 1Z0XA 2HQ5A 3GFMA 4B09A 3DQVC 4UXNA 3FHNA 2PMUA 4IF4A 2FMLA 3OWTA 3DBLB 4G6DA 1LPQA 2R5YA 4DW6A 2K3FA 1ITYA 3JRFA 4QSHA 5F1JA 5JHFA 4A6EA 1TBXA 2QBYA 4ZYGA 3B6AA 2PBIA 3IC7A 3CJNA 1HKSA 1EJ9A 4KITB 3FK7A 3RQIA 1YOVB 4JX5A 2LH9A 4MEYF 3WU0A 2HDWA 5FO5A 5FLVA 1GV2A 1POGA 3E97A 1VNDA 4PFOA 3JRGA 1XD7A 3CD6I 4DNCA 5E3MA 2NVYJ 1HQCA 1JGGA 3F6VA 2JSPA 4L9JA 3TGNA 1HSTA 2K9SA 3FXJA 5FD6A 4CO8A 3FK6A 4KIFA 4A0ZA 3J7AO 3CESA 3DV8A 3BR3A 4J00A 2KDOA 1OFCX 4IOAF 2DJIA 2K9QA 4BQQA 2L3DA 1ONVA 2VC0A 5J3LA 5F0HA 3GTGJ 5FKOA 5B1BH 3VYRB 1TLHB 1REPC 2XC7A 4AM3A 5KVRA 5J8FA 1E3PA 1F5TA 3K4CA 4KYWA 2L7ZA 2P6SA 4FQGA 3F72A 3CDLA 2LFBA 2JUCA 2WB1A 1FY7A 1VQ5I 1LFPA 2EH3A 2R93J 3K69A 2BY3A 3FKJA 1Z9CA 3F8CA 1R71A 4RLQA 2KIUA 1MJ9A 4MNUA 5A2QZ 3AL0C 3FKIJ 2M45A 3MZ8A 3BCBA 3D1NI 2DTZA 1TZLA 3WU1B 3JRAA 2MLGA 3ASOH 2G7UA 1LDJA 2DAOA 4BKXA 2P81A 2X1CA 3CLOA 4ETSA 3HOVJ 2AQEA 2XAFA 3HYIA 4QPOA 1OLTA 5CLSA 1P9QC 3CF5F 1ACIA 3E6DA 4CCMA 2MSYA 1MIJA 1HOMA 4IHSA 2L4AA 2E5NA 1F9NA 2VBXA 3RYRA 5HNFA 4HQMA 3ZOBA 2PJPA 3TO6A 1WPKA 1MJAA 3ZMUA 2R7XA 1FC3A 1WJBA 3CUQC 2D5VA 1ZYRF 3HHHA 4ITVA 2FSWA 1EH6A 3JW4A 2IGKA 2WY8Q 3HEFA 1N25A 3BCAA 3OSFA 2VODA 2M3AA 4ZYHA 2H6CA 5GADJ 2HQAA 2NYXA 1UELB 3UR3C 3IAM2 2KZGA 3DCFA 4AVPA 4WWCA 3K4NA 1D5VA 2VBWA 3MD2A 2LF7A 4BEHB 4MTEA 2DA2A 1JTYA 4PGGA 4HDUA 2ID3A 2L0KA 4RDUA 1BW5A 3ZP5A 5TJJA 1JKPC 2MH9A 3ZQQA 3GZ6A 3FBNB 2B0LA 3MAJA 5EGOA 3BZCA 2HPMA 3SFZA 2Y0SA 3E5QA 2K9NA 3RPUA 3TMOA 2E1MC 3LOCA 1TQMA 1N75A 3TBIA 2BZTA 1IRGA 5IP7J 1UZCA 2CW8A
chains in the Genus database with same CATH topology
2COBA 3TP0A 5F0FA 3SFIA 1MNMC 9ANTA 3QPLA 4M6VA 1HLVA 3C2BA 1EF4A 2NVXJ 1JJ6C 5FJ8J 3HKZN 3S2DJ 2L7FP 1MSEC 2LVSA 5IYBJ 5EGOB 4B3AA 2EZKA 4BY1J 1FTZA 3FISA 4W97A 5GPAA 4A93J 2HXIA 2MGQA 3LSGA 2R92J 4UUSB 2HYJA 4DYRA 2HI3A 1K83J 1LFBA 2WB1N 1GV5A 2DJNA 2IBDA 2PMZN 3O8GA 2VPRA 3BQZA 5M3MJ 2JA5J 1T33A 4XK4A 1UMQA 3K2AA 3JRDA 2JK3A 1RKTA 1AKHA 4ABZA 2R0QC 2JMWA 1YRNA 1Y1WJ 2DMUA 4A3GJ 2L9RA 1P7IA 1AKHB 1IDYA 1B72A 4M3BA 4J19A 4XRSG 2KT0A 1NK3P 2ME0A 3FIWA 5EZGA 1TWFJ 1IUFA 1MBJA 1QVTA 2CUEA 2VI6A 1I50J 3H0GJ 3ZQHA 2B63J 3Q0WA 3BR0A 2K40A 3S1QJ 2QF7A 1FIAA 1IV6A 2JJ7A 4DZJA 5IOZA 3QPSA 2JA7J 1ZR2A 2DA5A 3BR1A 2AO9A 3PM1A 1APLC 1D5YA 3JRIA 2X48A 1T56A 2WV1A 1RETA 1RKWA 3S16J 1Q1VA 5IP6A 2XGEA 2H1KA 3GTKJ 2E2IJ 1FTTA 1G2HA 3A02A 4I6ZA 3PO3J 1ETKA 3ZQLA 1IJWC 1X2MA 5JLWA 1XC5A 1QPIA 4DYCA 2O8KA 2LKXA 1RESA 1TWCJ 3BR6A 3CMYA 4XRSA 3BT9A 1W0TA 2JN6A 3G1OA 4UUTA 3WHBA 2ZB9A 1GDTA 3HGYA 4LOCA 5HODA 3HOYJ 3MKLA 1IGNA 4MIMA 5GP9A 1H88C 1XG1A 5E3OA 1BW6A 2IAIA 5F04A 5IYCJ 2R5YB 1VF9A 1QRYA 3GTJJ 4V2GA 2NS7A 5EYRA 1TWAJ 3M4OJ 2XSDC 4FCYA 4IEJA 2JWTA 3RZOJ 5J1YA 2FD5A 3B6CA 5K7ZA 2VUMJ 4A69C 4JYKA 2HXOA 3JREA 5EG0A 1XS9A 2WAQN 2M9HA 3RKQA 2VKVA 3I4MJ 4AUXA 4FISA 4MO7A 3OSGA 2FJ1A 4EEFG 3L1PA 2IEKA 2KDZA 5DTDA 1WCMJ 2HOAA 1OCPA 5J1RA 1AHDP 5GPCA 5FLMJ 2ME6A 5J1UA 4BY7J 3S1RJ 4NDLA 3Q0VA 1GT0C 2GBYA 1ETWA 4C2MJ 1JTXA 3GBGA 5EG0B 5M5WJ 2DA3A 2I10A 4FTHA 2CQQA 4A3BJ 1P7JA 2LP0A 5C4JJ 3NAUA 1JJ8C 1B8IA 3GTLJ 1UG2A 2QCOA 2EZIA 2LK2A 1YRNB 3G1LA 2XPVA 2M0CA 3Q0UA 4JX6A 1MBHA 5JLXA 3TW7A 1TC3C 2R5ZA 1MBFA 2E2JJ 4L5EA 3S2HJ 2NOGA 4M3EA 1IC8A 2R7ZJ 2FQ4A 3S15J 1F36A 2XB5A 1HDPA 4M3GA 3CCYA 2Y9ZA 1JT0A 3RZDJ 2NVQJ 1NTCA 2YS9A 3LSRA 3PO2J 1VFCA 4Y52J 2MG4A 2X9DA 3IV5A 2EBIA 2ELKA 4XRMA 4IHWA 3BQYA 4CYCB 4IHXA 1BA5A 2HOSA 2DN0A 3LSPA 4MFEA 3ZQCA 3HOXJ 2L7MP 1E3OC 2NVTJ 5IYDJ 3IH4A 4BBRJ 3SJMA 2NS8A 4X1EA 3A01A 1ZKGA 3TW6A 3TEDA 1IRZA 1ZGWA 3HOZJ 1FJLA 3BG9A 2LD5A 4A3DJ 2Y31A 3MN2A 3JRBA 1ETXA 3BG5A 1I6HJ 3TP3A 4M3DA 1DU6A 1PUFB 3GTPJ 5EZHA 1F43A 4HNVA 1MBEA 5EEAA 3QQAA 4BXXJ 4C3HJ 1JKOC 2O9LA 3HOUJ 2LTPA 5IPAA 2MW8A 2E2HJ 3Q3SA 1ZR4A 3GTOJ 1A5JA 3IH2A 5C3EJ 2EZHA 1IG7A 2DA1A 3BTJA 3JR9A 1PUFA 1OCTC 3WHCA 5E3NA 3LNQA 5F08A 3ZQGA 1BL0A 1MH3A 3GTMJ 1HF0A 2G0EA 4XICA 5M5XJ 4A3LJ 4RBOA 2Y9YA 1MBKA 4B4CA 3I4NJ 1RR7A 2TRTA 5F0CA 3G1MA 4I76A 1GUUA 1OJLA 1SFOJ 5BNGA 4JP0A 1S7EA 5EF6A 3S1NJ 1GVDA 3MVPA 4UUSA 3A03A 3E7LA 1LE8B 1A6IA 3A01B 3JRCA 4GFBA 2JA8J 1UHSA 5K7FA 5C4XJ 2DMTA 2OF7A 4DYQA 4A3JJ 2R5ZB 4C3JJ 1Z0XA 2HQ5A 2CJJA 1ORKA 2DMPA 2Y30A 1Y1VJ 2E19A 3IH3A 5M5YJ 2VKEA 4DW6A 2R5YA 1ITYA 1O4XA 3JRFA 4QSHA 2M2EA 5F1JA 5K7HA 1CQTA 2DA6A 2HDDA 3B6AA 1U9OA 3S17J 1TWHJ 3FK7A 4A3MJ 3HB9A 3RQIA 2M8GX 3VPRA 1LFUP 4JX5A 3ZQFA 1LE8A 2Y0SN 2CUFA 2DA4A 5FLVA 1GV2A 1POGA 1VNDA 4JX4A 3JRGA 1U78A 1IDZA 3K7AJ 4G12A 1SANA 3BTLA 5E3MA 2NVYJ 2OPTA 4FE7A 1JGGA 1ZQ3P 2DMQA 2TCTA 2K9SA 2XPUA 4QTRA 2N8GA 3OIOA 3FK6A 4C3IJ 2XGDA 1MSFC 3BR3A 5FKMA 4MFDA 5FKNA 1OFCX 4IHYA 5M3FJ 4MLOA 1WH5A 2K9QA 3H3VK 2XGCA 2YU9J 3UKGA 5J3LA 5F0HA 2RAEA 1HCRA 5FKOA 3GTGJ 4D7MA 5E3LA 1Z77A 1JT6A 3JRHA 4BBSJ 4D5FA 1VI0A 3HGGA 2XRLA 2LR8A 1FEXA 2L7ZA 1U8BA 2JA6J 1ZTRA 1WH7A 4AYBN 2W48A 1MH4A 4A3CJ 3NARA 3CDLA 2EZLA 4W1UA 2CRGA 3DEWA 2LFBA 4D7NA 1ENHA 1X2NA 3CQZJ 2EH3A 4Y7NJ 2R93J 3HOWJ 4V2FA 3BG3A 1MBGA 1BJZA 1X58A 1JKRC 3GTQJ 2O7OA 4S0HB 1ETQA 1R9TJ 4A3FJ 4FE4A 3ZQIA 3FKIJ 4A3IJ 2X6OA 3BR2A 1K61A 3D1NI 3S14J 2DTZA 4D5CA 1JUPA 3O8HA 3JRAA 2Y2ZA 3F0CA 3LSJA 1ETYA 4BKXA 2P81A 4CYCA 3HOVJ 1FIPA 1DU0A 5IP9J 2GM4A 4X6AJ 1ETVA 3HDDA 2AHQA 5DS9A 3M3YJ 2MSYA 1HOMA 5C44J 3BTIA 2ID6A 1H89C 3ZOBA 3HBLA 1WPKA 4IHVA 1JUMA 4M3FA 2LY9A 4A3KJ 1NK2P 2D5VA 2FX0A 2ECBA 3BTCA 1RPWA 1I3QJ 3W6VA 2H8RA 3S1MJ 1TWGJ 1ZK8A 3HEFA 5FKKA 1HDDC 4AC0A 3OOUA 3OSFA 1JKQC 1H8AC 5EDNA 2HOTA 1AU7A 3SDGA 3DCFA 5IOYA 5F27A 1B8IB 3HM5A 2CU7A 4B1RA 1U9NA 4DZPA 4QIWN 1WGXA 1ETOA 2XB0X 2YUSA 2DA2A 1JTYA 2ID3A 2DA7A 2L0KA 2M34A 4RDUA 2EQRA 1BW5A 1JKPC 2DMNA 2LLKA 2XPWA 2GLOA 2CQXA 1QVUA 1WI3A 2E1OA 4XIDA 5EGOA 2ECCA 2K9NA 1W0UA 3LOCA 1B72B 5FKLA 4A3EJ 5IP7J 1JUSA 3BR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COB A;  3TP0 A;  5F0F A;  3SFI A;  1MNM C;  9ANT A;  3QPL A;  4M6V A;  1HLV A;  3C2B A;  1EF4 A;  2NVX J;  1JJ6 C;  5FJ8 J;  3HKZ N;  3S2D J;  2L7F P;  1MSE C;  2LVS A;  5IYB J;  5EGO B;  4B3A A;  2EZK A;  4BY1 J;  1FTZ A;  3FIS A;  4W97 A;  5GPA A;  4A93 J;  2HXI A;  2MGQ A;  3LSG A;  2R92 J;  4UUS B;  2HYJ A;  4DYR A;  2HI3 A;  1K83 J;  1LFB A;  2WB1 N;  1GV5 A;  2DJN A;  2IBD A;  2PMZ N;  3O8G A;  2VPR A;  3BQZ A;  5M3M J;  2JA5 J;  1T33 A;  4XK4 A;  1UMQ A;  3K2A A;  3JRD A;  2JK3 A;  1RKT A;  1AKH A;  4ABZ A;  2R0Q C;  2JMW A;  1YRN A;  1Y1W J;  2DMU A;  4A3G J;  2L9R A;  1P7I A;  1AKH B;  1IDY A;  1B72 A;  4M3B A;  4J19 A;  4XRS G;  2KT0 A;  1NK3 P;  2ME0 A;  3FIW A;  5EZG A;  1TWF J;  1IUF A;  1MBJ A;  1QVT A;  2CUE A;  2VI6 A;  1I50 J;  3H0G J;  3ZQH A;  2B63 J;  3Q0W A;  3BR0 A;  2K40 A;  3S1Q J;  2QF7 A;  1FIA A;  1IV6 A;  2JJ7 A;  4DZJ A;  5IOZ A;  3QPS A;  2JA7 J;  1ZR2 A;  2DA5 A;  3BR1 A;  2AO9 A;  3PM1 A;  1APL C;  1D5Y A;  3JRI A;  2X48 A;  1T56 A;  2WV1 A;  1RET A;  1RKW A;  3S16 J;  1Q1V A;  5IP6 A;  2XGE A;  2H1K A;  3GTK J;  2E2I J;  1FTT A;  1G2H A;  3A02 A;  4I6Z A;  3PO3 J;  1ETK A;  3ZQL A;  1IJW C;  1X2M A;  5JLW A;  1XC5 A;  1QPI A;  4DYC A;  2O8K A;  2LKX A;  1RES A;  1TWC J;  3BR6 A;  3CMY A;  4XRS A;  3BT9 A;  1W0T A;  2JN6 A;  3G1O A;  4UUT A;  3WHB A;  2ZB9 A;  1GDT A;  3HGY A;  4LOC A;  5HOD A;  3HOY J;  3MKL A;  1IGN A;  4MIM A;  5GP9 A;  1H88 C;  1XG1 A;  5E3O A;  1BW6 A;  2IAI A;  5F04 A;  5IYC J;  2R5Y B;  1VF9 A;  1QRY A;  3GTJ J;  4V2G A;  2NS7 A;  5EYR A;  1TWA J;  3M4O J;  2XSD C;  4FCY A;  4IEJ A;  2JWT A;  3RZO J;  5J1Y A;  2FD5 A;  3B6C A;  5K7Z A;  2VUM J;  4A69 C;  4JYK A;  2HXO A;  3JRE A;  5EG0 A;  1XS9 A;  2WAQ N;  2M9H A;  3RKQ A;  2VKV A;  3I4M J;  4AUX A;  4FIS A;  4MO7 A;  3OSG A;  2FJ1 A;  4EEF G;  3L1P A;  2IEK A;  2KDZ A;  5DTD A;  1WCM J;  2HOA A;  1OCP A;  5J1R A;  1AHD P;  5GPC A;  5FLM J;  2ME6 A;  5J1U A;  4BY7 J;  3S1R J;  4NDL A;  3Q0V A;  1GT0 C;  2GBY A;  1ETW A;  4C2M J;  1JTX A;  3GBG A;  5EG0 B;  5M5W J;  2DA3 A;  2I10 A;  4FTH A;  2CQQ A;  4A3B J;  1P7J A;  2LP0 A;  5C4J J;  3NAU A;  1JJ8 C;  1B8I A;  3GTL J;  1UG2 A;  2QCO A;  2EZI A;  2LK2 A;  1YRN B;  3G1L A;  2XPV A;  2M0C A;  3Q0U A;  4JX6 A;  1MBH A;  5JLX A;  3TW7 A;  1TC3 C;  2R5Z A;  1MBF A;  2E2J J;  4L5E A;  3S2H J;  2NOG A;  4M3E A;  1IC8 A;  2R7Z J;  2FQ4 A;  3S15 J;  1F36 A;  2XB5 A;  1HDP A;  4M3G A;  3CCY A;  2Y9Z A;  1JT0 A;  3RZD J;  2NVQ J;  1NTC A;  2YS9 A;  3LSR A;  3PO2 J;  1VFC A;  4Y52 J;  2MG4 A;  2X9D A;  3IV5 A;  2EBI A;  2ELK A;  4XRM A;  4IHW A;  3BQY A;  4CYC B;  4IHX A;  1BA5 A;  2HOS A;  2DN0 A;  3LSP A;  4MFE A;  3ZQC A;  3HOX J;  2L7M P;  1E3O C;  2NVT J;  5IYD J;  3IH4 A;  4BBR J;  3SJM A;  2NS8 A;  4X1E A;  3A01 A;  1ZKG A;  3TW6 A;  3TED A;  1IRZ A;  1ZGW A;  3HOZ J;  1FJL A;  3BG9 A;  2LD5 A;  4A3D J;  2Y31 A;  3MN2 A;  3JRB A;  1ETX A;  3BG5 A;  1I6H J;  3TP3 A;  4M3D A;  1DU6 A;  1PUF B;  3GTP J;  5EZH A;  1F43 A;  4HNV A;  1MBE A;  5EEA A;  3QQA A;  4BXX J;  4C3H J;  1JKO C;  2O9L A;  3HOU J;  2LTP A;  5IPA A;  2MW8 A;  2E2H J;  3Q3S A;  1ZR4 A;  3GTO J;  1A5J A;  3IH2 A;  5C3E J;  2EZH A;  1IG7 A;  2DA1 A;  3BTJ A;  3JR9 A;  1PUF A;  1OCT C;  3WHC A;  5E3N A;  3LNQ A;  5F08 A;  3ZQG A;  1BL0 A;  1MH3 A;  3GTM J;  1HF0 A;  2G0E A;  4XIC A;  5M5X J;  4A3L J;  4RBO A;  2Y9Y A;  1MBK A;  4B4C A;  3I4N J;  1RR7 A;  2TRT A;  5F0C A;  3G1M A;  4I76 A;  1GUU A;  1OJL A;  1SFO J;  5BNG A;  4JP0 A;  1S7E A;  5EF6 A;  3S1N J;  1GVD A;  3MVP A;  4UUS A;  3A03 A;  3E7L A;  1LE8 B;  1A6I A;  3A01 B;  3JRC A;  4GFB A;  2JA8 J;  1UHS A;  5K7F A;  5C4X J;  2DMT A;  2OF7 A;  4DYQ A;  4A3J J;  2R5Z B;  4C3J J;  1Z0X A;  2HQ5 A;  2CJJ A;  1ORK A;  2DMP A;  2Y30 A;  1Y1V J;  2E19 A;  3IH3 A;  5M5Y J;  2VKE A;  4DW6 A;  2R5Y A;  1ITY A;  1O4X A;  3JRF A;  4QSH A;  2M2E A;  5F1J A;  5K7H A;  1CQT A;  2DA6 A;  2HDD A;  3B6A A;  1U9O A;  3S17 J;  1TWH J;  3FK7 A;  4A3M J;  3HB9 A;  3RQI A;  2M8G X;  3VPR A;  1LFU P;  4JX5 A;  3ZQF A;  1LE8 A;  2Y0S N;  2CUF A;  2DA4 A;  5FLV A;  1GV2 A;  1POG A;  1VND A;  4JX4 A;  3JRG A;  1U78 A;  1IDZ A;  3K7A J;  4G12 A;  1SAN A;  3BTL A;  5E3M A;  2NVY J;  2OPT A;  4FE7 A;  1JGG A;  1ZQ3 P;  2DMQ A;  2TCT A;  2K9S A;  2XPU A;  4QTR A;  2N8G A;  3OIO A;  3FK6 A;  4C3I J;  2XGD A;  1MSF C;  3BR3 A;  5FKM A;  4MFD A;  5FKN A;  1OFC X;  4IHY A;  5M3F J;  4MLO A;  1WH5 A;  2K9Q A;  3H3V K;  2XGC A;  2YU9 J;  3UKG A;  5J3L A;  5F0H A;  2RAE A;  1HCR A;  5FKO A;  3GTG J;  4D7M A;  5E3L A;  1Z77 A;  1JT6 A;  3JRH A;  4BBS J;  4D5F A;  1VI0 A;  3HGG A;  2XRL A;  2LR8 A;  1FEX A;  2L7Z A;  1U8B A;  2JA6 J;  1ZTR A;  1WH7 A;  4AYB N;  2W48 A;  1MH4 A;  4A3C J;  3NAR A;  3CDL A;  2EZL A;  4W1U A;  2CRG A;  3DEW A;  2LFB A;  4D7N A;  1ENH A;  1X2N A;  3CQZ J;  2EH3 A;  4Y7N J;  2R93 J;  3HOW J;  4V2F A;  3BG3 A;  1MBG A;  1BJZ A;  1X58 A;  1JKR C;  3GTQ J;  2O7O A;  4S0H B;  1ETQ A;  1R9T J;  4A3F J;  4FE4 A;  3ZQI A;  3FKI J;  4A3I J;  2X6O A;  3BR2 A;  1K61 A;  3D1N I;  3S14 J;  2DTZ A;  4D5C A;  1JUP A;  3O8H A;  3JRA A;  2Y2Z A;  3F0C A;  3LSJ A;  1ETY A;  4BKX A;  2P81 A;  4CYC A;  3HOV J;  1FIP A;  1DU0 A;  5IP9 J;  2GM4 A;  4X6A J;  1ETV A;  3HDD A;  2AHQ A;  5DS9 A;  3M3Y J;  2MSY A;  1HOM A;  5C44 J;  3BTI A;  2ID6 A;  1H89 C;  3ZOB A;  3HBL A;  1WPK A;  4IHV A;  1JUM A;  4M3F A;  2LY9 A;  4A3K J;  1NK2 P;  2D5V A;  2FX0 A;  2ECB A;  3BTC A;  1RPW A;  1I3Q J;  3W6V A;  2H8R A;  3S1M J;  1TWG J;  1ZK8 A;  3HEF A;  5FKK A;  1HDD C;  4AC0 A;  3OOU A;  3OSF A;  1JKQ C;  1H8A C;  5EDN A;  2HOT A;  1AU7 A;  3SDG A;  3DCF A;  5IOY A;  5F27 A;  1B8I B;  3HM5 A;  2CU7 A;  4B1R A;  1U9N A;  4DZP A;  4QIW N;  1WGX A;  1ETO A;  2XB0 X;  2YUS A;  2DA2 A;  1JTY A;  2ID3 A;  2DA7 A;  2L0K A;  2M34 A;  4RDU A;  2EQR A;  1BW5 A;  1JKP C;  2DMN A;  2LLK A;  2XPW A;  2GLO A;  2CQX A;  1QVU A;  1WI3 A;  2E1O A;  4XID A;  5EGO A;  2ECC A;  2K9N A;  1W0U A;  3LOC A;  1B72 B;  5FKL A;  4A3E J;  5IP7 J;  1JUS A;  3BR5 A; 
#chains in the Genus database with same CATH topology
 1BM9 A;  4Y4R A;  4BJ5 C;  3CP8 A;  4ASN A;  4RS8 A;  3OR1 C;  4KA4 A;  1XMX A;  9ANT A;  1HLV A;  3I53 A;  1FOX A;  2ICW G;  1Z7L A;  2EIN H;  3V7S A;  1DDN A;  4F93 B;  2EFQ A;  2NOJ B;  3FXO A;  5DM7 F;  5DCM B;  4YEJ A;  2K9M A;  3T0Y A;  2M7A A;  4A12 A;  2IS4 A;  4RMN A;  3FX3 A;  3MKZ A;  5D6F A;  1ZG5 A;  3S2D J;  2L7F P;  3M1C A;  1LNW A;  5IYB J;  1QZZ A;  3GW2 A;  2XF5 A;  3OIQ A;  2CMP A;  2MYS A;  1WI9 A;  3FIS A;  4CSW A;  3KPH A;  5GPA A;  2VT2 A;  1IW7 F;  1O3Q A;  4I0A A;  2IW5 A;  1W7P B;  3HPG A;  2HYJ A;  1O7L A;  4UUS B;  3OYM A;  1WZ2 A;  1GV5 A;  4A2U A;  2FOW A;  3O8G A;  2XVC A;  1T33 A;  1A6Q A;  4CDG A;  4E7K A;  2F4O B;  4QWQ A;  4RAY A;  4JQF A;  1W5T A;  1YW9 A;  3KET A;  3IKV A;  3K2A A;  5CVU A;  3JRD A;  1G4D A;  3N97 A;  1HW2 A;  4CCK A;  2LKP A;  1YRN A;  1Y1W J;  2DMU A;  4G7O F;  2L9R A;  1IDY A;  3FWE A;  3VDX A;  1MND A;  4M3B A;  3A0B C;  4J19 A;  1VQ6 I;  1CGP A;  1R7J A;  1Q1H A;  2ME0 A;  5ERI A;  1ZG1 A;  3JSO A;  2CG4 A;  4EGY A;  4DBQ A;  3I59 B;  3ZQH A;  2WY7 Q;  2DBB A;  3Q0W A;  2K40 A;  1ZRE A;  4XN0 A;  4HX7 A;  1I6X A;  3RJP A;  3QYB A;  1LDD A;  3KEY A;  1NG7 A;  4PZJ A;  3OYN A;  3HC7 A;  2ZME C;  3PM1 A;  2ZXW H;  3ECH A;  4XSX F;  3CCV I;  1T56 A;  3ZQ7 A;  2DK8 A;  4KIC A;  4Z2Y A;  4Q4Z F;  3K4B A;  1RET A;  1G3Y A;  2P6T A;  2V1D A;  1Q1V A;  5IP6 A;  3GTK J;  4XL9 A;  1G2H A;  2P0W A;  1D0Y A;  4I6Z A;  3SHF A;  1RZ4 A;  2P5K A;  3ZQL A;  1XC5 A;  2VJJ A;  1OCO H;  2LKX A;  2RVC A;  3VSL A;  4F91 B;  4XRS A;  3BT9 A;  3WG7 H;  3CCE I;  4UV9 A;  1W0T A;  1HKT A;  1F4K A;  2QLZ A;  2DFH A;  3WHB A;  1GDT A;  2OUM A;  4LOC A;  2IGM A;  4LLN A;  2VQC A;  2W1O A;  1BI2 A;  3HOT A;  5GP9 A;  1S5L C;  3Q9V A;  5E1X A;  3PNT A;  4L5I A;  4LB5 A;  3H9J A;  2IAI A;  2BY2 A;  1F1Z A;  1VF9 A;  3ZXS A;  5FLX K;  2H1L A;  2FNP A;  3H92 A;  5D8K B;  1U3E M;  2EWN A;  1W4M A;  3M4O J;  4NQW B;  2KHM A;  4I98 B;  2XSD C;  2IJL A;  4IEJ A;  3KP3 A;  5E79 C;  4A69 C;  4UY8 I;  3JRE A;  2K3P A;  2FA5 A;  3BPX A;  5EG0 A;  2WAQ N;  2Z16 A;  4ZH4 F;  4P96 A;  2VKV A;  1O3S A;  3I4M J;  2Q0O A;  4AUX A;  5H6R A;  3FXK A;  2XF6 A;  4FIS A;  4HOB A;  3OSG A;  4ZYE A;  2FJ1 A;  4EEF G;  2IT0 A;  5FFZ A;  2M30 A;  3L1P A;  3OYA A;  2KDZ A;  5DTD A;  2PN6 A;  2F2E A;  2HYF A;  2JPC A;  4BU2 A;  2JVG A;  5FLM J;  2EIL H;  3J81 Z;  2ME6 A;  3HUG B;  1LUJ B;  5J1U A;  4BY7 J;  3F22 A;  3VEP A;  4ENM A;  1KYZ A;  1GT0 C;  2GXA A;  2M0M A;  3OYH A;  2RDP A;  1WJ5 A;  1PDN C;  1DP3 A;  2VL8 A;  4EJV A;  2CQQ A;  2PMH A;  4A3B J;  3HZJ A;  2LP0 A;  3IL2 A;  3QRF F;  4M73 A;  5C4J J;  1B8I A;  3D5L A;  4IJA A;  1HKQ A;  2ZXH A;  3GTL J;  1U2W A;  4KFC A;  1K78 B;  2V6C A;  1YW8 A;  3G1L A;  2ZSI B;  2M0C A;  4JX6 A;  3TW7 A;  2L4M A;  4U0V A;  4H0E A;  1TC3 C;  2XAG A;  1NHA A;  1MBF A;  1BIA A;  2FBH A;  2EV0 A;  2NOG A;  1IC8 A;  3DKW A;  2FQ4 A;  2A6H F;  2JTV A;  3CTA A;  1WJF A;  3F6O A;  4Q48 A;  2XB5 A;  1J2X A;  3C7J A;  2IVM A;  4XON A;  1S9H A;  3CCY A;  4WXH A;  4A5N A;  2O3F A;  3C18 A;  1W5C C;  4KNY A;  2A5Y B;  3LAJ A;  2UZK A;  1N77 A;  3RQ4 A;  2MG4 A;  3OYJ A;  4YIR X;  2ZKZ A;  3ERE D;  1S7O A;  2CH0 A;  1GXP A;  2UXN A;  3BG7 A;  1R58 A;  3ERM A;  2VJI A;  2HOS A;  2DN0 A;  3GLL A;  3LSP A;  2NVU B;  3HOX J;  2L7M P;  1D0Z A;  1K7A A;  2NVT J;  2QM3 A;  5CKT A;  3SJM A;  1IUY A;  1LEA A;  4UVB A;  2ZME A;  3ZR8 X;  1VQK I;  4O3M A;  4G6T B;  3TED A;  1YE9 A;  1ZGW A;  1H9G A;  1IRZ A;  2KFD A;  1IRF A;  4A3D J;  3K1N A;  3JRB A;  2QQ9 A;  3JCU C;  5LGN A;  3TP3 A;  3EUH C;  1X3U A;  1R4N B;  3E5U A;  4P1W A;  3L2R A;  4BJ6 C;  4HNV A;  1MBE A;  2H09 A;  2KIF A;  5EEA A;  2R7R A;  3RIR A;  4XRF A;  4FX4 A;  2B9S A;  3H3Z A;  5JVT A;  3DPL C;  4C3H J;  4BGD A;  2QYO A;  3CMA I;  1O3T A;  1OIS A;  1T95 A;  2MC4 A;  1HSJ A;  4EJU A;  2WAE A;  4HDV A;  3Q3S A;  4Q5S F;  3IH2 A;  1JHF A;  3QYF A;  3HRM A;  1YX5 A;  2UWM A;  4YG2 F;  3HTU A;  3OYB A;  3JR9 A;  3PSF A;  5E3N A;  2D1H A;  2W84 A;  4XIC A;  1IF1 A;  4BL0 B;  3D5S C;  2Y9Y A;  1MBK A;  4BQN A;  1EH8 A;  1CF7 A;  1MKM A;  3TL4 X;  5HDG A;  4V19 K;  3BJO A;  3GZN B;  1IN6 A;  3RPU D;  1Z21 A;  2P5V A;  2Y69 H;  4G8X A;  1S7E A;  2QQA A;  2IXS A;  5FLX Z;  1XX5 A;  1FNN A;  4HNU A;  5K7F A;  5C4X J;  5E20 A;  1V4R A;  2DMT A;  4NHJ A;  3KYC B;  3K70 D;  3BWG A;  4A3J J;  3WTV C;  4YFK F;  1YJ9 I;  4OIQ F;  3AKZ A;  2LKS A;  1Y1V J;  1W7P D;  2E19 A;  3V7C A;  3L7W A;  1U5T C;  3C2G A;  2ZC2 A;  2O6G E;  2V1U A;  1O4X A;  1Y0U A;  2VQH A;  1V5E A;  1CQT A;  4AWX B;  2DA6 A;  2HDD A;  4LG0 A;  4JBA A;  4KT5 C;  3S17 J;  1TWH J;  4A3M J;  4HV5 A;  4D9J A;  2W25 A;  2Y0S N;  4EM1 A;  2OJE D;  5GTI C;  4IRH A;  4B8X A;  1IDZ A;  1J0R A;  1AWC A;  3TO7 A;  4BAC A;  1SAN A;  1WVR A;  4NNJ A;  2VJ4 A;  5FD5 A;  1GLN A;  2V1X A;  2DMQ A;  2XPU A;  2YSR A;  2VXD A;  1YTY A;  3CCR I;  4C3I J;  2XGD A;  2JVH A;  4ESJ A;  3HUG A;  4MLO A;  4C30 A;  4WK8 F;  2KMU A;  3GUD A;  3H3V K;  1XCB A;  2EA4 A;  1R5H A;  4PJM A;  3UKG A;  1Z3X A;  1HCR A;  5HLH A;  5E3L A;  4IOC F;  1V5F A;  5E8G A;  4BBS J;  4XKW A;  4D5F A;  2GA2 A;  5J40 A;  4MQ9 F;  1FYL A;  3GLX A;  4PGH A;  2I5U A;  2KIM A;  2ELH A;  1ZTR A;  2ESN A;  2OBP A;  1WH7 A;  3ECO A;  4AYB N;  4EV0 A;  3G4S I;  4BDZ A;  2ZNZ A;  4M9Z A;  4A3C J;  5EEG A;  1VQO I;  5TIS C;  3N4M A;  1ENH A;  3EDP A;  1RRJ A;  3BG3 A;  1MBG A;  5ICC A;  1TQI A;  5BPD A;  2D45 A;  3CMM A;  1X58 A;  2BEO A;  1R4M B;  1JKR C;  3GTQ J;  2HYG D;  4S0H B;  1ETQ A;  3BY6 A;  1QO0 D;  4A3F J;  3RI4 A;  3ROU A;  5DD8 A;  2X6O A;  1K61 A;  3S14 J;  2VAS A;  3ZRG A;  3KE2 A;  2Y2Z A;  1YYV A;  1S72 I;  3ZPL A;  3LSJ A;  3WTS C;  2W00 A;  4RM2 A;  1DU0 A;  2IS1 A;  2CFO A;  1BR1 A;  4HNT A;  4X6A J;  1ETV A;  1A04 A;  3LAP A;  3HDD A;  3LST A;  3M3Y J;  2KZV A;  2IGN A;  2GA1 A;  2RC4 A;  2BVM A;  3H3U A;  2ID6 A;  3DF8 A;  3HIF A;  1JUM A;  2QSG X;  2ZJP F;  3AFH A;  2LY9 A;  4A3K J;  2HKO A;  2UUZ A;  1SAX A;  2FX0 A;  2ECB A;  2DI3 A;  4NC6 A;  1YIT I;  5D8L B;  1A35 A;  3PSI A;  3BG6 A;  2DYS H;  1K4S A;  2H8R A;  4PUS A;  4HA8 A;  3VFZ A;  1BI0 A;  2CQN A;  4AC0 A;  4KMU X;  3E6M A;  2FF4 A;  1PUE E;  1H8A C;  2GOM A;  1XDU A;  2YPR A;  4TV7 A;  3SDG A;  2W4S A;  5ILU A;  1WJD A;  5IOY A;  5F27 A;  3HM5 A;  3I71 A;  4DZP A;  5HLT A;  4F3Q A;  2YUS A;  1USS A;  2XB0 X;  2GXB A;  1OQY A;  4IRG A;  1KQ8 A;  2XPW A;  3ASN H;  3R4K A;  3DLL F;  2OTJ I;  4ON0 A;  3CCJ I;  2E1O A;  4XLE A;  5E8I A;  4F55 A;  3OYD A;  4PCQ A;  3FXQ A;  1P2F A;  2R3S A;  3G2B A;  4U87 A;  1B72 B;  4A3E J;  4II3 A;  3S3O A;  5LHH A;  4HRI A;  2Z5U A;  2HOE A;  2ZFW A;  1BR2 A;  1R1U A;  1Z6R A;  1MMA A;  2BHZ A;  4RB1 A;  3SZP A;  1QQI A;  4PDK A;  3KEQ A;  5F0F A;  1FP2 A;  1FMW A;  3CCS I;  1X4O A;  2KL4 A;  1MNM C;  3CC4 I;  4YEL A;  5L3B A;  4M6V A;  1S29 A;  2HVR A;  2EV6 A;  3ZMV A;  4E70 A;  3C2B A;  5D4R A;  3GF2 A;  3C2H A;  1BR4 A;  2HR3 A;  2FXA A;  5LLQ A;  2CQ7 A;  2ZBK A;  1KU2 A;  3PIP F;  2LOO A;  1RNL A;  2K27 A;  4H4K C;  4AYB A;  3VWB A;  3DKX A;  2HNH A;  3DTE A;  3S8P A;  2RKH A;  3H9Q A;  1J7K A;  1Z91 A;  5B5E C;  1W5S A;  4HZF A;  5EGO B;  4BY1 J;  1DUX C;  2A07 F;  2DPU A;  4IZZ A;  3W2W A;  4W97 A;  4A93 J;  1MW7 A;  2DQR A;  3K0L A;  1WQ2 A;  3GFL A;  3LSG A;  2M1B A;  4BEH A;  1LFB A;  2IGO A;  4RAZ A;  1I39 A;  2V79 A;  2DJN A;  3HRU A;  2Y75 A;  5M3M J;  3ZCO A;  2ZJ2 A;  4XK4 A;  3B73 A;  5FRM A;  1CF7 B;  1SMT A;  1RKT A;  2QKM B;  4ABZ A;  3G3Z A;  1FBU A;  4XKB A;  2JMW A;  1W36 C;  4XOR A;  3ZMS A;  3SXY A;  4BXF A;  4XOP A;  2Y48 A;  3F21 A;  2L9V A;  1OR7 C;  4XRS G;  4ZJZ A;  3K4M A;  4NB5 A;  1JI8 A;  2ZXI A;  4AID A;  3FIW A;  2ISZ A;  5EZG A;  2Y0M A;  1TWF J;  2CUE A;  2RRE A;  1I50 J;  4HPQ A;  4I0B A;  1FSH A;  2D2W A;  2PEX A;  1X1C A;  2LBF B;  2KIQ A;  5IT9 K;  1TTY A;  3S1Q J;  2QF7 A;  4FAS D;  3E0J B;  2JJ7 A;  2JA7 J;  3QPS A;  3DP7 A;  3SYT A;  1DQU A;  4BXU A;  1R1V A;  3JRI A;  3E6C C;  2OQG A;  2ZCW A;  2WV1 A;  1RKW A;  5K5O A;  1WKM A;  1XSX A;  3DEE A;  3GME A;  2O8X A;  2H94 A;  3KP7 A;  2GZW A;  3PO3 J;  1GHC A;  1ETK A;  5KNL A;  4EMS A;  1IJW C;  1X2M A;  3FZV A;  1EV7 A;  4DYC A;  2O8K A;  4I02 A;  3OS2 A;  1RUN A;  1N78 A;  1XDS A;  2JN6 A;  1ZHF A;  2BY0 A;  5H2F C;  2JPB A;  1KA8 A;  1LEB A;  5L3G A;  3QYE A;  3CUQ A;  3HGY A;  4U88 A;  2IP2 A;  4A6D A;  5HOD A;  2GIV A;  2P5L C;  1FBQ A;  2CW7 A;  3DBR B;  3KIO A;  3P9K A;  2DLL A;  2DT6 A;  1VQP I;  5F04 A;  3CDI A;  5LEJ A;  4EGZ A;  1QRY A;  3GTJ J;  2DT5 A;  1H9T A;  2NS7 A;  2HPI A;  2FQ3 A;  5EYR A;  3RCO A;  1KQ9 A;  4OIO F;  4PK4 A;  4I7H A;  4UB8 C;  1ZN2 A;  5AIQ A;  3RZO J;  1I1S A;  3T5X A;  3OS0 A;  5K7Z A;  3B6C A;  4HST A;  4JYK A;  2HXO A;  2M9H A;  3RKQ A;  3PFI A;  2PMZ A;  1T0F C;  3PQK A;  3CO7 C;  3K70 C;  3JTH A;  2E7W A;  2L9N A;  2HDC A;  2IEK A;  1IV8 A;  4X0G A;  5H20 A;  3L2W A;  3E5X A;  4PJJ A;  1A36 A;  1ZLK A;  4D1Q A;  2OTL I;  4RA2 A;  1OCP A;  5J1R A;  3CZ6 A;  2DO7 A;  1UHW A;  1TNT A;  3QU3 A;  4BHC A;  3S3M A;  3S1R J;  2XAQ A;  4NDL A;  5JHU A;  4JK1 X;  3GZ5 A;  1KQ0 A;  1ETW A;  2GQQ A;  4C2M J;  3GBG A;  3PUB A;  1Z3Y A;  2DDB A;  3T8R A;  1YX3 A;  1JJ8 C;  1R1T A;  5CVR A;  4L9T A;  1G3S A;  1SD6 A;  2QCO A;  1ERD A;  2ZNY A;  2XPV A;  5J4V A;  4LFU A;  3OYL A;  1LVA A;  1MBH A;  5JLX A;  3H36 A;  2KJC A;  2ZSH B;  4XKV A;  4OIN F;  2R5Z A;  4XLP F;  4L5E A;  1V54 H;  5GAH J;  1SD4 A;  3HXL A;  2R7Z J;  4Q47 A;  3J80 Z;  4O6J A;  2QBY B;  1Z7U A;  3W2A A;  4LIV A;  2ACJ A;  1OPC A;  1HDP A;  3QP5 A;  2KRF A;  3RZD J;  3O6B B;  5ED4 A;  2GIZ A;  1EKE A;  1NTC A;  2NRA C;  1P4X A;  3M7G A;  3PO2 J;  3WTY C;  2DFE A;  1KU7 A;  4IHW A;  4HLX A;  4WCG A;  3HSE A;  1BA5 A;  1SAU A;  2FE3 A;  4KMF A;  4MFE A;  2JA2 A;  3F23 A;  1I1G A;  2QQ8 A;  3J7A Y;  5CQE A;  1T98 A;  3X2Q H;  3MKY B;  1T39 A;  1ZKG A;  4GRI A;  3OYI A;  2BV6 A;  1X19 A;  2GWR A;  3GX4 X;  3CF2 A;  5DYM A;  3ABM H;  2LD5 A;  3MN2 A;  4UVA A;  3BG5 A;  1SFU A;  3KP5 A;  4M3D A;  4ZC3 A;  1BOB A;  4LLL A;  1PUF B;  1DU6 A;  1MJB A;  1ZLJ A;  2H6B A;  2NXN B;  1F43 A;  1WJE A;  5EZH A;  2VQG A;  3C3W A;  2L7K A;  4HV6 A;  2MH2 A;  1OR7 A;  3LA2 A;  1VQ8 I;  2GAU A;  5ICF A;  3HOU J;  2LSO A;  1ZR4 A;  1A5J A;  5C3E J;  3KFW X;  5A2Q K;  2CV2 A;  1UB9 A;  2DA1 A;  1PP8 F;  3BTJ A;  2V4J C;  1O3R A;  3MQ0 A;  2LC2 A;  2BY1 A;  4FX0 A;  3ZQG A;  1MH3 A;  3COA C;  1FT9 A;  2F5V A;  1QA6 A;  3GTM J;  1ZRD A;  2KP6 A;  3A1Y A;  1FZP B;  3QPH A;  4C9Y A;  3DWL E;  1K79 A;  3I4N J;  1J09 A;  2TRT A;  2VT3 A;  3ONQ A;  3K1P A;  5F1R A;  2V7F A;  1P4W A;  5CYV A;  1ON2 A;  3OMY A;  1MDM B;  4M6X A;  1GVD A;  4UUS A;  3NRV A;  2XRO A;  5LFA A;  1U8R A;  4QLC U;  4CGZ A;  2A68 F;  2XF7 A;  1VQ7 I;  3IUO A;  2XDV A;  3F3X A;  1XGO A;  2R5Z B;  1EH7 A;  2L01 A;  2HZT A;  1VQL I;  1YIJ I;  2BXZ A;  2MA3 A;  1D0X A;  4RGU A;  3IRR A;  2NAZ A;  3UNG C;  1SD5 A;  1Z6T A;  4LG3 A;  5M5Y J;  3R0A A;  4RLF A;  4LJZ F;  2EFW A;  2QEN A;  3J7Z I;  4XLH A;  1U9O A;  2JSC A;  1UJ8 A;  4F92 B;  2M8G X;  3VPR A;  3ZQF A;  3IWF A;  5LEK A;  1S8N A;  4CXF A;  3G71 I;  1G3W A;  4XLC A;  2X6X A;  3U1K A;  3RTR A;  4E7L A;  2L54 A;  3BDD A;  1WHU A;  1XMA A;  1I3A A;  5KAI C;  1RUO A;  3V42 A;  3K7A J;  4XSZ F;  1R5G A;  3KP4 A;  2O5R A;  2M4K A;  4U7B A;  2EJR A;  4N0B A;  2DCE A;  4FE7 A;  1VQ9 I;  4E6K G;  2TCT A;  4QTR A;  1Y8Q B;  4M71 A;  2ISY A;  4ZTJ A;  2LNB A;  3I5U A;  4I99 C;  3K4K A;  1MSF C;  5IT9 Z;  2QVO A;  3I58 A;  4C2T A;  2COM A;  4N9H A;  3EUK L;  4IHY A;  2HKX A;  3P9C A;  5M3F J;  2EIK H;  4E7I A;  3BOQ A;  4GGG A;  1YQA A;  2RAE A;  2XAJ A;  3I4P A;  3OYG A;  5DV5 A;  1DGR M;  1XPX A;  4N4N B;  2CFX A;  3J80 K;  1Z77 A;  2F4I A;  2L2O A;  5FFX A;  1BIB A;  4CIC A;  2XUB A;  1MZB A;  1L3L A;  3WE2 A;  2R7D A;  2LR8 A;  4P5O A;  1U8B A;  4IHT A;  2P8T A;  2JUG A;  2W48 A;  3OL3 A;  4HSR A;  2W82 A;  3WOD F;  1SC7 A;  4NQW A;  2EZL A;  1YI2 I;  2VOO A;  2CRG A;  4D7N A;  1XSV A;  3CQZ J;  1LVK A;  1PVE A;  4V2F A;  3FXU A;  1DPU A;  1NH3 A;  3ML6 A;  1XGN A;  5FRO A;  1BJZ A;  4G6Q A;  1QPM A;  2DYR H;  3HPH A;  1QU3 A;  4D0P A;  2O7O A;  1J59 A;  1R9T J;  3EYY A;  4FE4 A;  2L9S A;  4HYE A;  2O0Y A;  3K4L A;  3NQO A;  3PJR A;  1X4P A;  2K85 A;  3SEZ A;  3JAM Z;  1ETY A;  3BP8 A;  1STZ A;  3M8J A;  1KYW A;  1SVL A;  4CYC A;  2HGC A;  3IKT A;  4BH9 A;  2Z9O A;  4OAY A;  4P55 A;  1WRJ A;  2A61 A;  1FIP A;  2R4G A;  3OOP A;  3D0S A;  3TDZ C;  3WTZ A;  5IP9 J;  3NEU A;  3VSK A;  1FP1 D;  4JOM A;  3V4G A;  2DK5 A;  5E17 F;  2AHQ A;  5DS9 A;  2VKH A;  3DPT A;  3FM5 A;  4LGW A;  2RQP A;  5C44 J;  4L9N A;  3WTW C;  3ZMT A;  2UXX A;  2R7W A;  4XLA A;  4IHV A;  3F8F A;  4M3F A;  4UB6 C;  5L3F A;  4RB0 A;  2V6E A;  2NNN A;  1BC7 C;  3C1D A;  1BBY A;  3BTC A;  1T6S A;  3O2P E;  3JTG A;  3DU6 A;  3TKY A;  1FPQ A;  3PNV A;  1I3Q J;  2YU3 A;  1IXS B;  3W6V A;  1TWG J;  1ZK8 A;  4A0X A;  2VBZ A;  1HDD C;  1D1B A;  2OZU A;  3OOU A;  1PP7 U;  1JKQ C;  3F8N A;  2X0L A;  5EDN A;  2QA4 I;  3K9T A;  1AU7 A;  3VB2 A;  5LD2 C;  1B8I B;  4YII A;  2H8W A;  1U9N A;  1ZRF A;  2OAZ A;  2KKO A;  3FDY A;  1WGX A;  1ETO A;  2BHY A;  2TDX A;  1V5G A;  2W24 A;  2DA7 A;  2WA0 A;  2EV5 A;  2M34 A;  3K2Z A;  4U0Y A;  2W85 A;  2LLK A;  2HFH A;  3E3V A;  4EM2 A;  3AL0 B;  3LSI A;  5F6F A;  3T1B A;  1QVU A;  1WI3 A;  1OYW A;  4L0Z B;  1YHQ I;  2LYC A;  2FEZ A;  2EK5 A;  1T2K A;  5FKL A;  4ENN A;  4BE0 A;  3MWM A;  2PX9 A;  3HSR A;  2YX4 A;  3CJQ B;  1JUS A;  2UV1 A;  2B7E A;  2ESH A;  3TP0 A;  1GXQ A;  2M8E A;  3I54 A;  1X1D A;  4UV8 A;  2ADU A;  3QPL A;  3OYK A;  3ZMZ A;  3QP6 A;  2DDA A;  1EF4 A;  3BPV A;  5HS7 A;  2HVS A;  3L2V A;  5FJ8 J;  4CCL A;  4IRI A;  5HS9 A;  1J5Y A;  2PJR A;  1VQN I;  2P4W A;  2J5O A;  2F5F A;  4EQQ A;  2PLY A;  1MSE C;  1YJW I;  5KAF C;  4B3A A;  1TL8 A;  2Z2S B;  3G73 A;  5CVI A;  1YW7 A;  2MFZ A;  1H0M A;  1AA7 A;  4AD9 A;  1HW1 A;  3PQJ A;  1OCR H;  2HXI A;  2MGQ A;  2VLA A;  1G3T A;  3O3K A;  5LGU A;  3IWZ A;  1Y6I A;  5CPR B;  3OL4 A;  2HQN A;  3VOE A;  2O61 A;  3QAH A;  2VPR A;  1G6N A;  3PFY A;  3BZ6 A;  4BYY A;  1KU9 A;  3LQQ A;  4Y17 A;  1WJA A;  3K10 A;  4XBF A;  2M87 A;  2JK3 A;  2MLK A;  2R0Q C;  1VQ4 I;  1HA8 A;  3HTS B;  5B1A H;  5D4S A;  1B72 A;  1TQP A;  4B3X A;  4R79 A;  3I55 I;  1SFE A;  2KT0 A;  2VPL A;  2QKL B;  4P9F A;  1WJC A;  5F64 A;  4GYG A;  4M74 A;  4A0Y A;  3DLA A;  2VI6 A;  1IUF A;  1MBJ A;  1QVT A;  3Q9S A;  3W6J B;  4BE1 A;  1VTN C;  4CUG A;  4UHT A;  1JHH A;  1JE8 A;  4BNC A;  2CQK A;  2HS5 A;  2B63 J;  1G8X A;  1ZGA A;  2WV0 A;  3H5A A;  2Z3Y A;  5BMZ A;  4OWR B;  1FIA A;  3EUH A;  1IV6 A;  5IOZ A;  4G7Z F;  3U2R A;  1UAA A;  1PYV A;  2DA5 A;  3ABU A;  5EEH A;  3BR1 A;  1OYI A;  2AO9 A;  2KIS A;  2QUF A;  3L2U A;  2FNA A;  1W7P A;  4PJL A;  1D5Y A;  1Y56 A;  2X48 A;  3WG9 A;  1X1B A;  3GYH X;  3PIO F;  3SZG A;  3OYC A;  1FWZ A;  2H1K A;  2XGE A;  4HG2 A;  2HQR A;  2Z33 A;  2E2I J;  1FTT A;  3A02 A;  1IN4 A;  4GO1 A;  2E1C A;  1QNT A;  3A4C A;  4CCN A;  1QPI A;  2AXT C;  4G9Y A;  2A05 A;  1MNE A;  2V9P A;  3SDB A;  4EVI A;  3QOE A;  4XN3 A;  4XLF A;  3OYF A;  2CUJ A;  1D3Y A;  4XR6 A;  3CCU I;  4Y33 A;  4IX7 A;  4ZTF A;  1KON A;  2DOD A;  3I9V 2;  4NC8 A;  3V8J A;  5HDK A;  3HOY J;  4KIG A;  4DIQ A;  3KZZ A;  3I0T A;  4MIM A;  1XG1 A;  4AIJ A;  5E3O A;  4HF1 A;  2Z99 A;  3FBI B;  3P7N A;  3K1M A;  3CCL I;  2P7V B;  1D8J A;  5IYC J;  2OV7 A;  1FOY A;  1RR8 C;  3A2K A;  4R1H A;  2CGP A;  2VJ5 A;  2J5P A;  4MHG A;  3GCM A;  4F7Z A;  2CO5 A;  1FOK A;  4Y13 A;  1TWA J;  4WX9 A;  3D5R C;  4IXA A;  1FOW A;  3L2Q A;  2JWT A;  1ON1 A;  3CCM I;  2FD5 A;  2HTJ A;  2XHK A;  2FBI A;  2L5Q A;  3EQL F;  3BLY A;  3NWS A;  3J81 K;  4S04 A;  2LBF A;  3OV8 A;  3WTX C;  2RN7 A;  2QGU A;  2MD5 A;  1FBS A;  2VE8 A;  2EB7 A;  3GVA A;  3I56 I;  2CUZ A;  3KEO A;  2DT7 B;  1WCM J;  1HC8 A;  4N4O B;  4J01 A;  2HOA A;  5FB2 A;  2QWW A;  1AHD P;  2JRT A;  6PAX A;  2XAS A;  2VBY A;  2CW0 F;  4M6Y A;  3MZH A;  1QGP A;  5HDN A;  2NS0 A;  3VOD A;  3HG9 A;  4R8H A;  2M5W A;  2F5C A;  5M5W J;  2KQR A;  2DA3 A;  3RKX A;  2L02 A;  1P7J A;  4M9X A;  1YS6 A;  2NNY A;  1R00 A;  1TT5 B;  4UUV A;  3BZK A;  4P9U A;  1O57 A;  3FF5 A;  3PNY A;  4AVZ A;  1P4A A;  1SVM A;  1X3W B;  1UG2 A;  3SQN A;  1LDK B;  2EZI A;  2LK2 A;  1MMN A;  1YRN B;  4GDF A;  3RPQ A;  3Q0U A;  3KP2 A;  4LD5 A;  1R49 A;  1FX7 A;  3FXL A;  5B3S H;  3WTT C;  2E2J J;  3I3L A;  4EJO A;  3S2H J;  4PJN A;  4WF2 A;  4M3E A;  4KDP A;  2M4G A;  2BW3 B;  2JQ7 A;  2XIG A;  4PFP A;  1IN8 A;  2IA1 A;  1F36 A;  4XKC A;  3J7Y J;  1MD0 A;  2BOL A;  2R7F A;  5L3D A;  1YG2 A;  2IA2 A;  2Y9Z A;  1FMV A;  1LB2 A;  1R6R A;  2FU4 A;  2NVQ J;  3M9A A;  4IQ4 A;  4ZDP A;  3FXM A;  4RAG A;  2BW3 A;  3N05 A;  3ESW B;  3R6S A;  3S93 A;  2YX7 A;  2A6T A;  5DUI A;  3LSR A;  2PJR B;  1VFC A;  4CZZ A;  3SZT A;  2R7S A;  2X9D A;  2K4J A;  3AAF A;  3IV5 A;  1IRX A;  2ELK A;  3WGH A;  1V55 H;  1Z05 A;  4BQO A;  4CYC B;  4IHX A;  4E7J A;  4KIS A;  2HTS A;  2VC1 A;  1K78 A;  3L09 A;  2E7X A;  1E3O C;  5IYD J;  3IH4 A;  3FMR A;  3KYD B;  4BBR J;  3WU2 C;  3CJT B;  2BGC A;  2QSF X;  3E6B A;  3A01 A;  4YRV A;  3TW6 A;  3ABL H;  4U7D A;  3HOZ J;  1FJL A;  4II2 A;  1UFM A;  2Y31 A;  1DGW Y;  3QWL A;  1I6H J;  1E0E A;  1I27 A;  2VKD A;  2FOK A;  5D6E A;  5LRR A;  5DCF A;  4ZYD A;  4FET A;  3GTP J;  1B4A A;  2CV0 A;  2D1V A;  1IXC A;  3QQA A;  3IHU A;  4BXX J;  4L5J A;  4OIP F;  2OC6 A;  2F48 A;  1DP7 P;  2O9L A;  2ZJR F;  1LQ1 A;  3FM3 A;  1MMS A;  4B47 A;  1HXD A;  2ZO4 A;  4F52 A;  2E2H J;  1V3F A;  3GTO J;  3W6K B;  1U0J A;  4EJT A;  1FLI A;  2IRF G;  4RB3 C;  5J6X A;  4LIT A;  3JSP A;  1VZ0 A;  2E71 A;  1BC8 C;  1XGM A;  1OCT C;  2STT A;  3LNQ A;  1B9M A;  1YS7 A;  1BL0 A;  2G0E A;  2OCE A;  2KLO A;  2RV8 A;  3EET A;  1YIO A;  1Y8R B;  5M5X J;  4B4C A;  1FSE A;  4RBO A;  3MFK A;  3HOS A;  1W36 D;  4A3L J;  2K02 A;  2QSH X;  1T0F A;  3E1S A;  1G59 A;  1MMD A;  3G1M A;  1UST A;  3TO9 A;  1GUU A;  4OU0 A;  4MEX F;  1LKX A;  1T08 B;  5GAG J;  2STW A;  1SFO J;  2VE9 A;  4LMY A;  3QOP A;  3U9G A;  3S3N A;  2LMD A;  3S1N J;  4AIK A;  2CV1 A;  3E7L A;  3CJR B;  3A01 B;  2C6Y A;  3TDU C;  2R7V A;  5JR3 A;  2GOX B;  3DTI A;  4HW0 A;  1UHS A;  1KGS A;  4XQF A;  2DXI A;  2E34 A;  5DEQ A;  5LGT A;  4DYQ A;  3HKZ A;  3JAM K;  3KLN A;  2CJJ A;  1ORK A;  2DMP A;  2Y30 A;  2X6W A;  3DPU A;  3A0H C;  1MDM A;  1P6R A;  3IH3 A;  4HF0 A;  4XOT A;  4B44 A;  3KP6 A;  3FMQ A;  2VKE A;  4AU7 A;  2FBK A;  5LBQ A;  4E7H A;  2M2E A;  2OA4 A;  5K7H A;  4L18 B;  4NC7 A;  1BJA A;  4BDY A;  1QHH D;  3HB9 A;  1LFU P;  5CJ9 A;  2DOE A;  2R7O A;  1IN5 A;  2AXL A;  2X85 A;  3BRO A;  2CUF A;  2DA4 A;  4HX4 A;  1LE8 A;  3CLQ A;  2LRD A;  2DPD A;  2G9W A;  4JX4 A;  1U78 A;  5BOX A;  5J8C A;  3LSH A;  4HEA 2;  2V9V A;  4G12 A;  3ZGK A;  2ZFU A;  4HAM A;  3BTL A;  1ZGJ A;  5D5U B;  2OPT A;  2K4B A;  3AG1 H;  4RAF A;  1ZQ3 P;  2N8G A;  1NG6 A;  3OIO A;  3LWF A;  5TGT A;  2E60 A;  3MMY B;  1W1W E;  1XSD A;  5FKM A;  3V7R A;  4MFD A;  5FKN A;  5FRN A;  2IPQ X;  2EIM H;  1WH5 A;  3DFG A;  1J75 A;  3FHZ A;  2XGC A;  5K5R A;  2YU9 J;  1QZY A;  5AIP A;  3V8K A;  2BBY A;  2OCC H;  3GO5 A;  2OQR A;  1T38 A;  4IKF A;  1S3J A;  2LG4 A;  2O03 A;  2VIX A;  4D7M A;  1XN7 A;  2EIJ H;  3AG2 H;  1JT6 A;  4MQV A;  1YLF A;  1M1E B;  2VN2 A;  4XNF A;  3JRH A;  1TT0 A;  1WWX A;  1VI0 A;  3DU5 A;  3HGG A;  3MKW B;  2XRL A;  2DQL A;  1U5T A;  2HWV A;  1FEX A;  1BI3 A;  3H0D A;  2AQF A;  2MAB A;  2WWY A;  3IAS 2;  2JA6 J;  2FUG 2;  4L9V A;  1MH4 A;  2DOA A;  4ESF A;  3NAR A;  4W1U A;  3DEW A;  4IVN A;  4C2U A;  2VQL A;  1X2N A;  2LDU A;  4Y7N J;  2V9K A;  3MEX A;  3HOW J;  4ENJ A;  4ENK A;  3L00 A;  1TW2 A;  3GFJ A;  2JZY A;  3H9G A;  4HX8 A;  2BXY A;  2CYY A;  2X6Y A;  1A31 A;  3ZQI A;  2CWE A;  5JVG F;  4A3I J;  3BR2 A;  4D5C A;  1JUP A;  3O8H A;  3DBH B;  3F0C A;  1RIO H;  2RGV A;  4BQA A;  2KRC A;  3OR2 C;  3SEQ A;  3LL7 A;  4WXD A;  2GM4 A;  1S7A A;  1R22 A;  4LLG F;  4IL6 C;  5LHI A;  5L3E A;  3WTU C;  4LIU A;  5E18 F;  3BTI A;  2DTR A;  5CQG A;  1H89 C;  2Z1D A;  3I59 A;  3HBL A;  3VYT B;  1NK2 P;  3KZY A;  4LK1 F;  3CME I;  3REO A;  2XGX A;  5K5Q A;  5B66 C;  5D5X B;  1RPW A;  2K9L A;  3AG3 H;  1JGS A;  2F4M B;  1ODD A;  3S1M J;  1E2X A;  5K1Y A;  5FKK A;  4E7S A;  4ESB A;  1U5T B;  4IQJ A;  1SFX A;  3QU6 A;  4LK0 F;  1K6Y A;  2X4H A;  2VOP A;  2HOT A;  1LJ9 A;  1Y39 A;  4KN7 X;  3H1C A;  4HLY A;  2R7U A;  1R36 A;  4GCV A;  3TQN A;  2CU7 A;  1XB4 A;  4B1R A;  1PJR A;  4QIW N;  5L3C A;  4L0Y B;  1VQM I;  4DQ2 A;  4DBR A;  3KZI C;  5AON A;  2EQR A;  3CC7 I;  2WAF A;  2DMN A;  3L9F A;  2GLO A;  2CQX A;  3GEZ A;  2XRN A;  3LA3 A;  2FRH A;  1IXR C;  3DTK A;  5H6Q A;  1YJN I;  4XID A;  2ECC A;  3T8T A;  3VYU B;  5BQT A;  1W0U A;  4PJ0 C;  3EPZ A;  4B48 A;  4CHU A;  1B59 A;  1MGT A;  2EFN A;  2M7B A;  2XKO A;  1ZRC A;  4S05 A;  4NBQ A;  2F5E A;  2X1E A;  5CVJ A;  4PSW A;  3BR5 A;  4PSX A;  2COB A;  3F8B A;  5BPI A;  1BN5 A;  1O7F A;  5ICG A;  2V1N A;  2DOF A;  4Y15 A;  2JRM A;  3SFI A;  3ABK H;  2KRH A;  3R0J A;  1B1B A;  4GXO A;  3I64 A;  2PQ8 A;  3B02 A;  2Q2E B;  3GXO A;  2NVX J;  1KZH A;  1JJ6 C;  4I2O A;  1OCZ H;  5DUK A;  3HKZ N;  2Q2E A;  4XMY A;  2JT1 A;  2EPF A;  1QZE A;  3RKW A;  5D5V B;  4XLN F;  3CDH A;  5DD4 A;  4DJA A;  3DKY A;  2H27 A;  4YIF A;  2XKP A;  2LVS A;  4YFN F;  1FTZ A;  2EZK A;  5DCM A;  3H5N A;  1C0W A;  2I8D A;  4ZZL A;  4ZZD A;  3BJA A;  4UVC A;  1IN7 A;  2F6C A;  2R92 J;  4M9S A;  3IP4 B;  1Z67 A;  1SD7 A;  4DYR A;  2HI3 A;  1K83 J;  5E1Z B;  2WB1 N;  5J47 A;  2IBD A;  2PMZ N;  3BQZ A;  3CP2 A;  2JA5 J;  4HF2 A;  5ILV A;  2KJB A;  5GAE J;  2DFF A;  3HHG A;  2ETH A;  3ZN0 A;  1D1A A;  1BI1 A;  1UMQ A;  5J4Y A;  2K86 A;  2BVL A;  3QPT A;  5BS6 A;  1E3H A;  4RB2 C;  2V26 A;  1T8I A;  1AKH A;  1AOY A;  5HNH A;  4A3G J;  1P7I A;  3F9K A;  4WXC A;  2EA2 A;  1AKH B;  1QBJ A;  1HW5 A;  2MBF A;  4G94 A;  2YR2 A;  3OYE A;  1TP4 A;  4E4H A;  1NK3 P;  1B9N A;  2ZXJ A;  1I5Z A;  4M72 A;  4OAZ A;  5CVV A;  3H0G J;  5LHG A;  4CZC A;  3BR0 A;  3M1E A;  4RGR A;  1XTA A;  4RGS A;  3ULQ B;  4BS9 A;  2DFI A;  5KCM A;  4DGW B;  1L0O C;  4KN4 X;  4QPQ A;  3M8E A;  4DZJ A;  3CC2 I;  3S2W A;  1TNS A;  1ZR2 A;  4CH7 A;  4ZDL A;  3BJ6 A;  4UNO A;  3CUQ B;  1APL C;  2LY1 A;  3BC8 A;  3IRQ A;  3TOB A;  2RNJ A;  4BJT A;  2ELJ A;  2EFP A;  4CCJ A;  2XV4 S;  3S16 J;  2IS2 A;  1WFX A;  4E7Z A;  1XCV A;  2HZD A;  2W57 A;  3KYL A;  1IZ1 A;  4B43 A;  2A3S A;  5JLW A;  1RES A;  2OZ6 A;  2OD5 A;  1TWC J;  2A69 F;  3BR6 A;  1BOA A;  1X1P A;  4KT6 A;  5EJC A;  5HLG A;  3CMY A;  1ZH5 A;  3G1O A;  4UUT A;  2ZB9 A;  3M8F A;  1EA3 A;  4NUB A;  3TOA A;  3G6E I;  3R60 A;  2PI0 A;  3WGI A;  3MKL A;  2IS6 A;  1IGN A;  1E17 A;  1MMG A;  1H88 C;  2G7H A;  4K2E A;  1OMI A;  4OOI A;  1BW6 A;  3LSM A;  2R5Y B;  3ABT A;  4O5V A;  1UG0 A;  2LF8 A;  2XAU A;  4V2G A;  5KK1 A;  2HU9 A;  1X1A A;  2GXG A;  3H35 A;  2R7Q A;  2RNG A;  4MTD A;  1ZEL A;  2FMY A;  2DW4 A;  1ZAR A;  4RM3 A;  3ZMD A;  3DXJ F;  4FCY A;  3F8M A;  4DOZ A;  2Q8K A;  5J1Y A;  2VUM J;  4Y3O A;  3QOD A;  3K4J A;  1XS9 A;  3K6G A;  2QQB A;  3FMS A;  4HBL A;  4ZYA A;  5GTH C;  4AIH A;  4MO7 A;  3LFK A;  2F5D A;  5IPA A;  4EM0 B;  2MD0 A;  1RI7 A;  2XSJ C;  3HJE A;  3EUA A;  3FXR A;  3W2V A;  1KU3 A;  5GPC A;  2HVQ A;  2OU2 A;  2QZ8 A;  2ZJQ F;  4G7H F;  3HRS A;  1ZG3 A;  3HSF A;  3LA7 A;  3KX2 A;  3EYI A;  3Q0V A;  5LRS A;  4N9I A;  3KCC A;  4EJW A;  2GBY A;  1IAW A;  1JTX A;  2A5W A;  4MGR A;  5EG0 B;  1YFH A;  3ZN1 A;  2I10 A;  4FTH A;  2VON A;  5JFR A;  3NAU A;  1JXS A;  1SVO A;  4GYI A;  4XM3 A;  5IT3 A;  5IY5 H;  3RKY A;  2EFO A;  1OKR A;  1S6L A;  5DDG A;  2E35 A;  2LY2 A;  1B6A A;  4OMY A;  1SMY F;  3R61 A;  3CUO A;  2PFB A;  3P9I A;  4LG0 B;  2W7N A;  3PUF A;  5DM6 F;  3GFI A;  3S15 J;  3W3C A;  5ILS A;  3Q5F A;  4I09 A;  4I01 A;  4KJZ A;  1ULY A;  2P7C B;  1YO5 C;  4M3G A;  4LB6 B;  3CO6 C;  1JT0 A;  5E1W A;  4BHB A;  2YS9 A;  5HLI A;  3M07 A;  2Q1Z B;  1TW3 A;  2CS3 A;  4Y52 J;  1GVJ A;  1UCR A;  5FGM A;  1X3Z B;  2EBI A;  2IA0 A;  2WBM A;  3RSN A;  3BQY A;  4XRM A;  2AS5 F;  4BHP A;  3HRT A;  1R5I D;  3LFU A;  5ICE A;  4CA0 A;  3VYS B;  2DU9 A;  3WE3 A;  3ZQC A;  1R23 A;  2WAQ A;  2MC3 A;  2NS8 A;  2RQQ A;  4X1E A;  1U6G A;  2BYV E;  1SFK A;  4A5M A;  4BUP A;  4CYD A;  5HS8 A;  4KUM A;  2PG4 A;  4U0W A;  3BG9 A;  2WAD A;  4RGX A;  1QHG A;  5KHD A;  2VXZ A;  1ETX A;  1RC9 A;  1OYY A;  3ISP A;  2QEX I;  3H5R A;  4FHT A;  3U21 A;  4CCO A;  1D1C A;  1K6O A;  5D5W B;  4KIB A;  3MCZ A;  3WGG A;  3L2C A;  1J9I A;  1K4T A;  1OCC H;  1JKO C;  2E1M B;  1D8K A;  1IO2 A;  1ZAO A;  2LTP A;  2K7L A;  2MW8 A;  3GWZ A;  2WC2 A;  3KLO A;  4FT8 A;  3OIP A;  3RYP A;  4ZDO A;  1XGS A;  5HOO A;  3U1D A;  4EAT A;  2EZH A;  1IG7 A;  4IPA A;  3NWT A;  3HL2 A;  4OMZ A;  5JI6 A;  3LMM A;  5HVQ C;  3RDI A;  3LQR A;  1WSU A;  2VB6 A;  1Z1D A;  3AG4 H;  2A6E F;  2WTE A;  3V8L A;  5TRD A;  2X1D A;  1DPR A;  3WHC A;  1PUF A;  1FYK A;  4OIR F;  3ELK A;  2E5Z A;  2KPM A;  1P92 A;  4BAY A;  5F08 A;  1Y0N A;  1HF0 A;  3S32 A;  4IO9 F;  3OS1 A;  2E1N A;  2XAH A;  2LRE A;  2ZME B;  4YFX F;  1SEU A;  1RR7 A;  1UHM A;  2K5C A;  5F0C A;  4HQE A;  1XMK A;  4I76 A;  3CCQ I;  4BE2 A;  3DEU A;  1OJL A;  2HEO A;  2X51 A;  5BNG A;  3OY9 A;  2CSO A;  4JP0 A;  5EF6 A;  3PL8 A;  4ANJ A;  3MVP A;  3A03 A;  1HBX G;  1LE8 B;  1A6I A;  3P5J A;  3LSK A;  3JRC A;  2E36 A;  4GFB A;  2JA8 J;  2R7T A;  2BE5 F;  3MZY A;  2OF7 A;  4Z6Y A;  4C3J J;  1FYM A;  1Z0X A;  2HQ5 A;  3GFM A;  4B09 A;  3DQV C;  4UXN A;  3FHN A;  2PMU A;  4IF4 A;  2FML A;  3OWT A;  3DBL B;  4G6D A;  1LPQ A;  2R5Y A;  4DW6 A;  2K3F A;  1ITY A;  3JRF A;  4QSH A;  5F1J A;  5JHF A;  4A6E A;  1TBX A;  2QBY A;  4ZYG A;  3B6A A;  2PBI A;  3IC7 A;  3CJN A;  1HKS A;  1EJ9 A;  4KIT B;  3FK7 A;  3RQI A;  1YOV B;  4JX5 A;  2LH9 A;  4MEY F;  3WU0 A;  2HDW A;  5FO5 A;  5FLV A;  1GV2 A;  1POG A;  3E97 A;  1VND A;  4PFO A;  3JRG A;  1XD7 A;  3CD6 I;  4DNC A;  5E3M A;  2NVY J;  1HQC A;  1JGG A;  3F6V A;  2JSP A;  4L9J A;  3TGN A;  1HST A;  2K9S A;  3FXJ A;  5FD6 A;  4CO8 A;  3FK6 A;  4KIF A;  4A0Z A;  3J7A O;  3CES A;  3DV8 A;  3BR3 A;  4J00 A;  2KDO A;  1OFC X;  4IOA F;  2DJI A;  2K9Q A;  4BQQ A;  2L3D A;  1ONV A;  2VC0 A;  5J3L A;  5F0H A;  3GTG J;  5FKO A;  5B1B H;  3VYR B;  1TLH B;  1REP C;  2XC7 A;  4AM3 A;  5KVR A;  5J8F A;  1E3P A;  1F5T A;  3K4C A;  4KYW A;  2L7Z A;  2P6S A;  4FQG A;  3F72 A;  3CDL A;  2LFB A;  2JUC A;  2WB1 A;  1FY7 A;  1VQ5 I;  1LFP A;  2EH3 A;  2R93 J;  3K69 A;  2BY3 A;  3FKJ A;  1Z9C A;  3F8C A;  1R71 A;  4RLQ A;  2KIU A;  1MJ9 A;  4MNU A;  5A2Q Z;  3AL0 C;  3FKI J;  2M45 A;  3MZ8 A;  3BCB A;  3D1N I;  2DTZ A;  1TZL A;  3WU1 B;  3JRA A;  2MLG A;  3ASO H;  2G7U A;  1LDJ A;  2DAO A;  4BKX A;  2P81 A;  2X1C A;  3CLO A;  4ETS A;  3HOV J;  2AQE A;  2XAF A;  3HYI A;  4QPO A;  1OLT A;  5CLS A;  1P9Q C;  3CF5 F;  1ACI A;  3E6D A;  4CCM A;  2MSY A;  1MIJ A;  1HOM A;  4IHS A;  2L4A A;  2E5N A;  1F9N A;  2VBX A;  3RYR A;  5HNF A;  4HQM A;  3ZOB A;  2PJP A;  3TO6 A;  1WPK A;  1MJA A;  3ZMU A;  2R7X A;  1FC3 A;  1WJB A;  3CUQ C;  2D5V A;  1ZYR F;  3HHH A;  4ITV A;  2FSW A;  1EH6 A;  3JW4 A;  2IGK A;  2WY8 Q;  3HEF A;  1N25 A;  3BCA A;  3OSF A;  2VOD A;  2M3A A;  4ZYH A;  2H6C A;  5GAD J;  2HQA A;  2NYX A;  1UEL B;  3UR3 C;  3IAM 2;  2KZG A;  3DCF A;  4AVP A;  4WWC A;  3K4N A;  1D5V A;  2VBW A;  3MD2 A;  2LF7 A;  4BEH B;  4MTE A;  2DA2 A;  1JTY A;  4PGG A;  4HDU A;  2ID3 A;  2L0K A;  4RDU A;  1BW5 A;  3ZP5 A;  5TJJ A;  1JKP C;  2MH9 A;  3ZQQ A;  3GZ6 A;  3FBN B;  2B0L A;  3MAJ A;  5EGO A;  3BZC A;  2HPM A;  3SFZ A;  2Y0S A;  3E5Q A;  2K9N A;  3RPU A;  3TMO A;  2E1M C;  3LOC A;  1TQM A;  1N75 A;  3TBI A;  2BZT A;  1IRG A;  5IP7 J;  1UZC A;  2CW8 A; 
#chains in the Genus database with same CATH homology
 2COB A;  3TP0 A;  5F0F A;  3SFI A;  1MNM C;  9ANT A;  3QPL A;  4M6V A;  1HLV A;  3C2B A;  1EF4 A;  2NVX J;  1JJ6 C;  5FJ8 J;  3HKZ N;  3S2D J;  2L7F P;  1MSE C;  2LVS A;  5IYB J;  5EGO B;  4B3A A;  2EZK A;  4BY1 J;  1FTZ A;  3FIS A;  4W97 A;  5GPA A;  4A93 J;  2HXI A;  2MGQ A;  3LSG A;  2R92 J;  4UUS B;  2HYJ A;  4DYR A;  2HI3 A;  1K83 J;  1LFB A;  2WB1 N;  1GV5 A;  2DJN A;  2IBD A;  2PMZ N;  3O8G A;  2VPR A;  3BQZ A;  5M3M J;  2JA5 J;  1T33 A;  4XK4 A;  1UMQ A;  3K2A A;  3JRD A;  2JK3 A;  1RKT A;  1AKH A;  4ABZ A;  2R0Q C;  2JMW A;  1YRN A;  1Y1W J;  2DMU A;  4A3G J;  2L9R A;  1P7I A;  1AKH B;  1IDY A;  1B72 A;  4M3B A;  4J19 A;  4XRS G;  2KT0 A;  1NK3 P;  2ME0 A;  3FIW A;  5EZG A;  1TWF J;  1IUF A;  1MBJ A;  1QVT A;  2CUE A;  2VI6 A;  1I50 J;  3H0G J;  3ZQH A;  2B63 J;  3Q0W A;  3BR0 A;  2K40 A;  3S1Q J;  2QF7 A;  1FIA A;  1IV6 A;  2JJ7 A;  4DZJ A;  5IOZ A;  3QPS A;  2JA7 J;  1ZR2 A;  2DA5 A;  3BR1 A;  2AO9 A;  3PM1 A;  1APL C;  1D5Y A;  3JRI A;  2X48 A;  1T56 A;  2WV1 A;  1RET A;  1RKW A;  3S16 J;  1Q1V A;  5IP6 A;  2XGE A;  2H1K A;  3GTK J;  2E2I J;  1FTT A;  1G2H A;  3A02 A;  4I6Z A;  3PO3 J;  1ETK A;  3ZQL A;  1IJW C;  1X2M A;  5JLW A;  1XC5 A;  1QPI A;  4DYC A;  2O8K A;  2LKX A;  1RES A;  1TWC J;  3BR6 A;  3CMY A;  4XRS A;  3BT9 A;  1W0T A;  2JN6 A;  3G1O A;  4UUT A;  3WHB A;  2ZB9 A;  1GDT A;  3HGY A;  4LOC A;  5HOD A;  3HOY J;  3MKL A;  1IGN A;  4MIM A;  5GP9 A;  1H88 C;  1XG1 A;  5E3O A;  1BW6 A;  2IAI A;  5F04 A;  5IYC J;  2R5Y B;  1VF9 A;  1QRY A;  3GTJ J;  4V2G A;  2NS7 A;  5EYR A;  1TWA J;  3M4O J;  2XSD C;  4FCY A;  4IEJ A;  2JWT A;  3RZO J;  5J1Y A;  2FD5 A;  3B6C A;  5K7Z A;  2VUM J;  4A69 C;  4JYK A;  2HXO A;  3JRE A;  5EG0 A;  1XS9 A;  2WAQ N;  2M9H A;  3RKQ A;  2VKV A;  3I4M J;  4AUX A;  4FIS A;  4MO7 A;  3OSG A;  2FJ1 A;  4EEF G;  3L1P A;  2IEK A;  2KDZ A;  5DTD A;  1WCM J;  2HOA A;  1OCP A;  5J1R A;  1AHD P;  5GPC A;  5FLM J;  2ME6 A;  5J1U A;  4BY7 J;  3S1R J;  4NDL A;  3Q0V A;  1GT0 C;  2GBY A;  1ETW A;  4C2M J;  1JTX A;  3GBG A;  5EG0 B;  5M5W J;  2DA3 A;  2I10 A;  4FTH A;  2CQQ A;  4A3B J;  1P7J A;  2LP0 A;  5C4J J;  3NAU A;  1JJ8 C;  1B8I A;  3GTL J;  1UG2 A;  2QCO A;  2EZI A;  2LK2 A;  1YRN B;  3G1L A;  2XPV A;  2M0C A;  3Q0U A;  4JX6 A;  1MBH A;  5JLX A;  3TW7 A;  1TC3 C;  2R5Z A;  1MBF A;  2E2J J;  4L5E A;  3S2H J;  2NOG A;  4M3E A;  1IC8 A;  2R7Z J;  2FQ4 A;  3S15 J;  1F36 A;  2XB5 A;  1HDP A;  4M3G A;  3CCY A;  2Y9Z A;  1JT0 A;  3RZD J;  2NVQ J;  1NTC A;  2YS9 A;  3LSR A;  3PO2 J;  1VFC A;  4Y52 J;  2MG4 A;  2X9D A;  3IV5 A;  2EBI A;  2ELK A;  4XRM A;  4IHW A;  3BQY A;  4CYC B;  4IHX A;  1BA5 A;  2HOS A;  2DN0 A;  3LSP A;  4MFE A;  3ZQC A;  3HOX J;  2L7M P;  1E3O C;  2NVT J;  5IYD J;  3IH4 A;  4BBR J;  3SJM A;  2NS8 A;  4X1E A;  3A01 A;  1ZKG A;  3TW6 A;  3TED A;  1IRZ A;  1ZGW A;  3HOZ J;  1FJL A;  3BG9 A;  2LD5 A;  4A3D J;  2Y31 A;  3MN2 A;  3JRB A;  1ETX A;  3BG5 A;  1I6H J;  3TP3 A;  4M3D A;  1DU6 A;  1PUF B;  3GTP J;  5EZH A;  1F43 A;  4HNV A;  1MBE A;  5EEA A;  3QQA A;  4BXX J;  4C3H J;  1JKO C;  2O9L A;  3HOU J;  2LTP A;  5IPA A;  2MW8 A;  2E2H J;  3Q3S A;  1ZR4 A;  3GTO J;  1A5J A;  3IH2 A;  5C3E J;  2EZH A;  1IG7 A;  2DA1 A;  3BTJ A;  3JR9 A;  1PUF A;  1OCT C;  3WHC A;  5E3N A;  3LNQ A;  5F08 A;  3ZQG A;  1BL0 A;  1MH3 A;  3GTM J;  1HF0 A;  2G0E A;  4XIC A;  5M5X J;  4A3L J;  4RBO A;  2Y9Y A;  1MBK A;  4B4C A;  3I4N J;  1RR7 A;  2TRT A;  5F0C A;  3G1M A;  4I76 A;  1GUU A;  1OJL A;  1SFO J;  5BNG A;  4JP0 A;  1S7E A;  5EF6 A;  3S1N J;  1GVD A;  3MVP A;  4UUS A;  3A03 A;  3E7L A;  1LE8 B;  1A6I A;  3A01 B;  3JRC A;  4GFB A;  2JA8 J;  1UHS A;  5K7F A;  5C4X J;  2DMT A;  2OF7 A;  4DYQ A;  4A3J J;  2R5Z B;  4C3J J;  1Z0X A;  2HQ5 A;  2CJJ A;  1ORK A;  2DMP A;  2Y30 A;  1Y1V J;  2E19 A;  3IH3 A;  5M5Y J;  2VKE A;  4DW6 A;  2R5Y A;  1ITY A;  1O4X A;  3JRF A;  4QSH A;  2M2E A;  5F1J A;  5K7H A;  1CQT A;  2DA6 A;  2HDD A;  3B6A A;  1U9O A;  3S17 J;  1TWH J;  3FK7 A;  4A3M J;  3HB9 A;  3RQI A;  2M8G X;  3VPR A;  1LFU P;  4JX5 A;  3ZQF A;  1LE8 A;  2Y0S N;  2CUF A;  2DA4 A;  5FLV A;  1GV2 A;  1POG A;  1VND A;  4JX4 A;  3JRG A;  1U78 A;  1IDZ A;  3K7A J;  4G12 A;  1SAN A;  3BTL A;  5E3M A;  2NVY J;  2OPT A;  4FE7 A;  1JGG A;  1ZQ3 P;  2DMQ A;  2TCT A;  2K9S A;  2XPU A;  4QTR A;  2N8G A;  3OIO A;  3FK6 A;  4C3I J;  2XGD A;  1MSF C;  3BR3 A;  5FKM A;  4MFD A;  5FKN A;  1OFC X;  4IHY A;  5M3F J;  4MLO A;  1WH5 A;  2K9Q A;  3H3V K;  2XGC A;  2YU9 J;  3UKG A;  5J3L A;  5F0H A;  2RAE A;  1HCR A;  5FKO A;  3GTG J;  4D7M A;  5E3L A;  1Z77 A;  1JT6 A;  3JRH A;  4BBS J;  4D5F A;  1VI0 A;  3HGG A;  2XRL A;  2LR8 A;  1FEX A;  2L7Z A;  1U8B A;  2JA6 J;  1ZTR A;  1WH7 A;  4AYB N;  2W48 A;  1MH4 A;  4A3C J;  3NAR A;  3CDL A;  2EZL A;  4W1U A;  2CRG A;  3DEW A;  2LFB A;  4D7N A;  1ENH A;  1X2N A;  3CQZ J;  2EH3 A;  4Y7N J;  2R93 J;  3HOW J;  4V2F A;  3BG3 A;  1MBG A;  1BJZ A;  1X58 A;  1JKR C;  3GTQ J;  2O7O A;  4S0H B;  1ETQ A;  1R9T J;  4A3F J;  4FE4 A;  3ZQI A;  3FKI J;  4A3I J;  2X6O A;  3BR2 A;  1K61 A;  3D1N I;  3S14 J;  2DTZ A;  4D5C A;  1JUP A;  3O8H A;  3JRA A;  2Y2Z A;  3F0C A;  3LSJ A;  1ETY A;  4BKX A;  2P81 A;  4CYC A;  3HOV J;  1FIP A;  1DU0 A;  5IP9 J;  2GM4 A;  4X6A J;  1ETV A;  3HDD A;  2AHQ A;  5DS9 A;  3M3Y J;  2MSY A;  1HOM A;  5C44 J;  3BTI A;  2ID6 A;  1H89 C;  3ZOB A;  3HBL A;  1WPK A;  4IHV A;  1JUM A;  4M3F A;  2LY9 A;  4A3K J;  1NK2 P;  2D5V A;  2FX0 A;  2ECB A;  3BTC A;  1RPW A;  1I3Q J;  3W6V A;  2H8R A;  3S1M J;  1TWG J;  1ZK8 A;  3HEF A;  5FKK A;  1HDD C;  4AC0 A;  3OOU A;  3OSF A;  1JKQ C;  1H8A C;  5EDN A;  2HOT A;  1AU7 A;  3SDG A;  3DCF A;  5IOY A;  5F27 A;  1B8I B;  3HM5 A;  2CU7 A;  4B1R A;  1U9N A;  4DZP A;  4QIW N;  1WGX A;  1ETO A;  2XB0 X;  2YUS A;  2DA2 A;  1JTY A;  2ID3 A;  2DA7 A;  2L0K A;  2M34 A;  4RDU A;  2EQR A;  1BW5 A;  1JKP C;  2DMN A;  2LLK A;  2XPW A;  2GLO A;  2CQX A;  1QVU A;  1WI3 A;  2E1O A;  4XID A;  5EGO A;  2ECC A;  2K9N A;  1W0U A;  3LOC A;  1B72 B;  5FKL A;  4A3E J;  5IP7 J;  1JUS A;  3BR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...