2L82A

Solution nmr structure of de novo designed protein, p-loop ntpase fold, northeast structural genomics consortium target or32
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
162
structure length
162
Chain Sequence
MSQIFVVFSSDPEILKEIVREIKRQGVRVVLLYSDQDEKRRRERLEEFEKQGVDVRTVEDKEDFRENIREIWERYPQLDVVVIVTTDDKEWIKDFIEEAKERGVEVFVVYNNKDDDRRKEAQQEFRSDGVDVRTVSDKEELIEQVRRFVRKVGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords DESIGNED PROTEIN OR32
publication title Northeast Structural Genomics Consortium Target OR32
rcsb
source organism Artificial gene
total genus 66
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2010-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2l82A00
2KPOA 2LNDA 2LVBA 2LV8A 2MR5A 2N75A 2LCIA 2L69A 2MR6A 2LTAA 5GAJA 2L82A 2LRHA 2LR0A 4J29A 2N3ZA
chains in the Genus database with same CATH superfamily
2HM7A 3AOEA 2C4WA 4BYGA 4RTOA 4IDFA 4BX8A 3BH7A 3MCAA 3GCXA 1NNI1 5LZ2A 4BO0A 1DNPA 1R0LA 4ZAVA 3SC2B 2J45A 3JS5A 1RZUA 5ETJA 1E7SA 1VLJA 2HLDA 4DLRA 5FAKA 1EXWA 4DJ5X 2PV7A 3LCJA 3OHSX 3VUFA 5K0CA 4H08A 1R5OA 1T1SA 1UK7A 4MS4A 4ZKEA 3VVMA 1K6EA 4DRXA 4YRIA 5TPZD 2Q3EA 3P96A 2Z2KA 1JSCA 5G3ZA 4PSCA 2ZSEA 1K4MA 3CY6A 4ZZIA 1G3RA 2QG9A 3A70A 5DEIA 1BE0A 2XXAA 4CKXA 5H3CA 1A4RA 4DF3A 2FI1A 3PJGA 1NY5A 3KS9A 5SZKB 1SC6A 4C1NA 2V8BA 1JYSA 2JKVA 2VDNB 3IGFA 3L8GA 5DP2A 1VBMA 3SP1A 3TFQA 4ZYWA 1DKPA 2Y4NA 4G65A 4IDQA 1ZUHA 4WNAB 5H81A 4FYIA 4KSBA 5D7NA 3MWYW 3JZIA 1Q57A 1RP1A 2J67A 2G1KA 4GE0A 3T3HA 3CCFA 2WMDA 3L7AA 2I3ZA 3NRCA 1T4BA 3S1AA 3DULA 4KUEA 3R41A 1A95A 1AH2A 4LG1A 2IZ6A 4CDMA 3NG1A 3VJMA 4IV5A 2A9OA 3U9LA 1JDBC 2HZBA 3D8HA 2VKQA 1ZMOA 4RHFA 3AHHA 3EVZA 5DM0A 4MPTA 3RYHB 3SR0A 1R6TA 1JH9A 1SVWA 4MIOA 4JELA 2J8ZA 5E9WA 5B37A 1DEKA 3VZPA 1F9AA 1QB8A 1M76A 1ZUIA 1UM9B 4HAZA 2Z83A 3IR5A 2C0CA 4ID9A 5AJVB 3UK2A 2DFNA 2Z04A 1V8DA 3NPAA 4M1YA 4R31A 3ZD6A 3VGJA 1PJRA 3PD0A 2I6UA 3DTNA 1L4UA 1JBQA 1CY0A 3EQ6A 2DHCA 3EZ7A 3ZOZA 1HY3A 3MBIA 4NENB 1C30A 4PC6A 2A14A 1YBFA 4CIWA 3FZQA 3LPCA 1X2BA 2E2WA 1EDZA 1OPRA 2GK6A 2QUAA 4IDBA 3TIFA 4Q37A 3DEFA 4CV0A 5BT8A 1A9ZA 5EE5B 3TL3A 4MHTA 5THXA 1HFKA 2EYQA 3HI6A 4YRRA 3K3PA 3JWJA 1O9BA 2XGOA 4MRSA 3WVNA 1AY0A 4JJ8A 4ALJA 2PIAA 2XEXA 4Q12A 5HUQA 3AVXA 1XX6A 1WDKA 1YD7A 2HK9A 5K0LA 4AWXA 1XQ1A 4Y2RA 2ZR7A 1GG8A 3HDVA 3ILVA 5CR9A 1QQAA 1RHRA 1FNCA 4AJ9A 3LCMA 2MTBA 2VPXA 3UV3A 2CE7A 2FPSA 3BGOS 4UMEA 1GDDA 2GBGA 1ENZA 1ZX1A 4H27A 2PYDA 3VOAA 4IFIA 2PBZA 4FKMA 1NXQA 4WKCA 2H4ZA 1C7ZA 1J1IA 4IH4A 4Q03A 2HPZA 4Y1GA 5FYQA 1UPBA 2ZI4A 3A6FA 3ZHSA 5IABA 3JYLA 4UD6A 4FLMA 1QMGA 3C87A 5JCPA 1OGIA 3K5WA 1Z38A 2J9GA 2RGNA 2H1CA 3LUFA 4M8KA 1P77A 5CAEA 3CLTC 4ZTBA 2OBLA 3EYWA 1XTQA 2QTVA 1O6FA 4XM1A 1ETUA 1D09A 3NATA 2W0MA 3ZHOA 1U2EA 4HZGA 2O6HA 1HEYA 1LDBA 4MA5A 4XI9A 5EPUA 2HL6A 1UJMA 3SJUA 1P75A 5EJ7A 4CM7A 1BEEA 3OLQA 1A7JA 4Q3BA 4WK2B 5I8WA 2GILA 3WP0A 1ENYA 3D8NA 1XLVA 5AK0A 4B3XA 3DS8A 4YR7A 3W8NA 3VJKA 1EB9A 1SG0A 4BGDA 2DHRA 3KKOA 1ZP6A 2G71A 3G5TA 3QVSA 3VR5D 4E4RA 1J8VA 5FAXA 5D5HA 5F7ZA 4GOLD 2L17A 4EKIA 4EG8A 5B4VA 2ORYA 3KEGA 3C7CB 2VPYA 3ZV6A 4CMBA 3MJHA 4CUZA 1JT9A 4L9RA 3TOXA 1LTHR 3CIOA 1E98A 1IBCA 4J07A 4Q7KA 3ILYA 2RH9B 1D2AA 3A7EA 3FSGD 4RS3A 5LM3A 2XHZA 5C80A 1AO0A 3LWBA 3L0ZA 1GA6A 1UBCA 4JLPA 5LQDA 3L07A 4XIIA 3KSBC 3TLJA 4EZBA 2CUKA 3BIOA 4EY6A 2WQZA 2HF9A 3VU0A 2XXBA 2LTAA 3I52A 1FX0B 4II3A 2GD1O 2FDXA 3E7XA 3ZEAA 4LDNA 3HL4A 4QFMA 4WKBA 4K3VA 4NBVA 5B1DA 3NOQA 1W5TA 4JEMA 1C7RA 2IP2A 3I9OA 5LPNA 3WOHA 4B0OA 1SVMA 5MF6A 2QAGC 3LUAA 2W2KB 5D7BA 4QUKA 5SYMA 1L5MA 3QU4A 2WP0A 1UPTA 4RK6A 4RZQA 2OAEA 4YRCA 4ZARA 1KBOA 3MGBA 4URVR 5F98A 4QYIB 1VZ3A 2DFLA 4B6FA 3W5BA 2FR8C 4IQ8A 1EYZA 1A2OA 4PLWA 2WWWA 1W4RA 2AW5A 3G79A 1T9GS 2C2BA 2AG5A 2DBVO 1SXJE 1W49A 3GHYA 3QPWA 4KC0A 1XJCA 2GHIA 1XL1A 2ZYRA 2OZPA 4J0GA 5DBFA 4FCTA 3LCVB 4EH1A 2G5TA 5ICEA 4JLVA 3DE1X 4QT4A 2PX0A 5F2KA 1ENPA 1G3IA 1JR4A 2QTCA 3SHVA 5FIUA 3U4QA 3N2GA 1YMVA 2EERA 2XUFA 5K2MA 5CVVA 4M1OA 1A27A 1PCXA 1U4OA 3EE6A 3KJEA 1UM8A 4I2VA 4KIUA 3RVQA 1L5QA 2A4MA 2YNMA 3BCRA 1XLTA 2DH5A 2E4XA 3LHIA 2IQ5A 4GRIA 2HUPA 4LOAA 4H4DA 3L01A 3CUKA 5FWXA 2E18A 1PNRA 3ASUA 4WCFC 3ZOKA 3TRKA 4OMUA 4JYZA 1G1MA 2GSWA 4Z8XA 2PE5A 3T61A 3IP1A 3TTXA 5K0NA 1GARA 4D74A 1KZ7B 4AI6A 3N28A 1GCUA 1CZNA 1CJSA 1MO5A 3GGDA 4KPYA 2VJYA 4JOSA 2OP0A 2Z95A 5KOJA 4Q00A 5E6UA 1KSFX 4CIDA 3OFSA 4MVJG 3UMCA 1FP4B 3R7SA 1TPZA 2ODPA 4R4JA 4YRNA 3KFXA 2FXVA 3GLFE 4TYWA 1JLKA 4IDEA 2MDTA 4AU1A 2V9CA 4OMDA 1QU2A 5K3CA 4E15A 3ZDCA 1H3NA 4HPXB 1ZEJA 4Q3EA 3ZTTA 1H4VB 2BEKA 4KTVE 5B2FA 4JVMA 4NEGA 2Q5QA 1C5KA 4JC5A 2RGAA 2NU8B 3UC9A 4RH0A 1OYOA 4RKEA 5HOEA 1BEUB 4L8FA 2XVYA 3NHRA 3LUPA 3GA5A 3A6GA 5JG7A 2PVSA 4UUNA 1WDTA 1H23A 4MB0A 2FZLA 3NBXX 4BATA 4GZ3A 1P19A 1V4BA 1NBAA 4LI3X 1V3QE 2VAWA 2R48A 1JXMA 3LOUA 4ZVNA 4OD0A 5A04A 2WJGA 4HAUA 3UWSA 1WQ1R 4DIOA 3KE8A 2CHEA 2XMPA 1JHZA 1O8BA 2HU8A 1J8FA 1H2YA 1G8KA 2IYOA 2ZPAA 3G1TA 2W6MA 3W5IA 2MWMA 3W5AA 3VR1A 1C3JA 1QTIA 1IL0A 3I5AA 3OICA 4LHWA 4YCLA 2VYQA 2BM9A 4RHXA 3CR3C 4U7GA 4I5DA 2PKQP 1BZYA 2C2HA 3EA0A 1V5IA 2NO6A 3IV9A 1FYEA 2B82A 4XUGB 4AF7A 5BSGA 1A9RA 1D6NA 1RYBA 4XX1A 1C3LA 5FP0A 4ZCLA 3UMJA 3QFTA 4OXRA 1Z0KA 2IPXA 4KO2S 3DZKA 1NT4A 4FDTA 4TMZA 1WMDA 3FBWA 4QAQA 4DCVA 4H6VA 4N7BA 3OEEA 4KGVA 2XUGA 3M9WA 2ZK7A 4OA8A 4PTLA 5CJPA 3TG2A 1IDOA 4FDLA 1C81A 4E94A 1LX6A 2ADFA 4R8MA 3VC7A 2ALJA 4MHOA 2ASEA 2IEBA 1C7IA 1U3UA 2FZVA 2QQFA 2VT3A 4KAAA 4U39A 4YPOA 2WUFA 3ZGZA 1EXVA 3MLBA 2H4JA 2CDRA 1V16A 4CBVA 1ZPDA 2OHIA 1JEJA 1M2KA 5EWJB 1R8XA 5BYBA 3THRA 1RYHA 2QPTA 1ONPA 3I3SR 1E2FA 3M82A 4RMHA 1ZN8A 2GSDA 2BP7B 2ISQA 2ZIXB 4MA0A 2JPDA 1AA6A 1W0KA 1JAXA 3A1UA 1R3DA 2HQSA 2EJVA 3K4QA 3M0EA 4TQ9A 4WZAE 5EEGA 4FZVA 4N5HX 4R1SA 1Z0DA 3UGKA 4B85A 1O2DA 1ONSA 1L8XA 4P2GA 4DLPA 3ZQ6A 1C3OB 4ENPA 3OJLA 3MTJA 1YGPA 3OIGA 5DHSA 3RSCA 1EHYA 4LJYA 5DISB 1OFUA 3BIXA 1KI6A 5MN6A 1FTYA 4ZVTA 1WTCA 1RTTA 2JI9A 2JJ2D 1GAJA 1IN7A 3RHSA 5JYDA 1H0HA 5A9SA 4PSKA 3DLBA 4IZ6A 3FPEA 4IGIA 5FWYA 3M81A 3TG8A 5BV8A 4LYJA 3AVQA 3N3AC 2QTNA 2YZ7A 1LNSA 5CA0B 2JLXA 3LBNA 1SB8A 2VHQA 1ATIA 3Q7TA 1RMTA 1OYVA 3CW2A 3H0EA 4MV6A 5J4HA 1UC5B 2E9SA 4UEJA 4X97A 4W6QA 5FL3A 3TVTA 2R751 4AG6A 2CLMB 4QFBA 3DBLB 3U7QA 3JZFA 1O03A 3L0IB 3VSDA 2VXYA 3HA7A 3PUVA 2JFVA 1AN9A 3QTTA 1Q1NA 1WS6A 2XOKA 3PSHA 4NMLA 4PTZA 3TXAA 1XRQA 3EIQA 4ZALA 5L8VA 3NAQA 4C9BA 1KZGB 1UDWA 1LLFA 1ST2A 2P9TA 3D81A 4X00A 3GU3A 4LCBA 5CFRA 1Z4LA 4P5PA 5DYIA 1JAHA 1J2EA 3SFTA 1NG9A 2D1YA 2ZM5A 2R8XA 4FYHA 2JJYA 3KBOA 4LBWA 2HBRA 2P2LA 4QDXA 5KYVA 1Q11A 3TW4A 2C4HA 3IQHX 3E70C 3CZCA 4MVJE 1PJ8A 5AKZA 4JD5A 1TIKA 3W5VA 3ZR4B 2J4DA 1AXEA 5M29A 1E3JA 5ECYA 3WYFA 1TJYA 1VMAA 1XWFA 5EJ2A 1CDDA 3B6JA 2Y6VA 3RS2A 1XZEA 1UFRA 1EFVA 1PFKA 3DHYA 1DIAA 4IIGA 1PJQA 2WY2D 2JARA 2VHCA 3CE9A 4I66A 4LKRA 1YRAA 1E9VA 3KBBA 3H5WA 2QB5A 4ER3A 5KTKA 1PQYA 4FWIB 3S99A 3L0SA 5DZSA 5BRAA 3ILXA 3THWB 4FPXA 2PQ0A 3FVQA 1P4GA 4O2AA 3UFXA 5M5BA 2EJTA 2HQOA 3U81A 1C4WA 1ZGJA 8LDHA 1EP9A 2GYUA 1BO6A 5MGBA 3TBHA 1CR6A 3LF2A 1W2GA 1I3MA 2AW3A 3JWHA 4MGZR 5K4HA 1HDXA 3IEKA 1W1IA 3ONEA 3BGVA 1Z8HA 1L4MA 1Z4KA 1NYRA 1PZHA 1STOA 1Z2PX 3GNTA 1Y0BA 4DIMA 4YR9A 4LPSA 1XQYA 4G89A 1P6QA 4UM9D 2Z9CA 1TEZA 1Z12A 4C06A 4DRYA 5GGYA 3W77A 2M6KA 3FSJX 1S0UA 1VBFA 1RJFA 4LDPA 4LC9A 2C92A 1NSTA 1CY7A 4J6FA 1ZKDA 5T57A 4EIWA 4MARA 3IAS1 3NH9A 4YJFA 4Q4HA 3U62A 1CZKA 3KQSA 4RSGA 3A9UA 4OFZA 2KM1A 4CFZA 5K2OA 3KB8A 3VPGA 1PG5A 5I5EA 1LLDA 4BNVA 1JIKA 2IDMA 4HLCA 4ZGGA 4MR8A 2O1XA 3ZJ4A 4XQGA 2BI8A 2C88A 2O0KA 1MJFA 1E3WB 1Z5VA 1X1QA 2J3EA 1VHLA 1Y9DA 3BGWA 3MRVA 3PUYA 3Q2OA 1NXPA 3GWZA 3MMSA 4L5AA 4QOJA 3SPXA 2QD4A 4ALNA 4EVIA 1WVIA 4L5JA 4UMFA 1USVA 2M6SA 2R6CA 5B7QA 2CEKA 5EFOA 3ZIUA 5J59A 2PMKA 2O2SA 4IHJA 3KYDB 4EB6B 1KZ9A 4HWSA 3UWPA 5IAAA 3PYXA 4LXGA 3DBRA 4MYSA 2F8SA 4YRAA 3GFBA 4M1SA 2ILTA 3D8SA 2NSDA 4RF5A 1GTRA 3DT8A 3H87A 4YDQA 3BIJA 1Y63A 4RX1A 3UT5A 1NW4A 3KC2A 5CH8A 3OHMA 1ELOA 3A1NA 3Q87B 3LOQA 3F6RA 3VH1A 4V1CA 2B4QA 2BCEA 1NUUA 1FIUA 1ISIA 2LIPA 5EOVA 2A4KA 3N2YA 5TVKA 4BLUA 5KYYA 2MINB 4CGYA 4J9VA 5F23A 3Q3EA 3FPLA 4QICA 3B78A 3VU9B 5A4KA 5ICMA 5E4YA 1EEHA 4M3NA 4E07A 5LQMA 1JU9A 1WLSA 1S3SA 2ES4A 1T3ZA 2JFOA 2QJRA 2WJPA 2JATA 3AY6A 3PFIA 3ESBA 1LQ2A 4H77A 5JQWA 4LNUB 3V8PA 4EVSA 4LVNA 3T5CA 1R8QA 5B57C 4TN1A 3SN6A 4I4IA 2IZ7A 2WFLB 1YC2A 3HFJA 1EBFA 2OTCA 3NC1C 4Y1RB 2YZGA 4ZTZB 3IDSA 3SMQA 3HADA 1WOMA 4WN9B 5LWHA 5JQGB 2AZXA 2HMVA 4V2UA 4LI0A 5CM8B 1N0UA 2C3YA 1HR0B 3NEPX 2AEJA 2H51A 2YHAA 1X6VA 2HCJB 4FFOA 2QEQA 4A2WA 3G02A 4ECEA 8GPBA 2VDKB 3DFIA 4IICA 1PZMA 2QVGA 2ERCA 1LDGA 1E64A 2J87A 4RY2A 2BHSA 5KKAA 3FAKA 4GYYA 5DM60 4C0QC 2CFRA 4RGYA 3KQPA 2ZBFA 4NOMA 4ANFA 5KCMA 5JH7B 3G68A 3VYWA 1Z8DA 1Z47A 2IEAA 1RWKA 1C8LA 2R86A 3LM8A 4BLRA 1C7EA 4LFCB 1RQLA 2DBZA 2P1RA 5CP8A 1PU2A 1R0SA 1VJ1A 3HFRA 1FEZA 3IKLA 4EGCB 1A9XB 1W1WA 2VYND 1DPGA 2PH3A 1VYHA 1FFDA 4JK3A 4DAEA 5IH7A 2FUEA 2NWQA 2A7XA 2AI3A 1KZ1A 1MAAA 3BVPA 1SWWA 3OTHA 4TXLA 4PYLA 4OK6A 3HV2A 1UPFA 3A10A 2PSHA 3J81A 3DAYA 4AL4A 1NMYA 3ANLA 5I4CA 3E0QA 3NBKA 3QEJA 4ZT7A 4IUYA 4ZICA 2FMUA 4RZ2A 2I54A 5U1PA 2F2TA 3IE2A 3ESQA 2FW1A 1F5NA 3JR3A 4R9UC 4WVFA 3WRXC 4FCWA 2B4AA 3H5RA 1V8OA 5M3BA 2HHLA 4BO6A 3GUHA 5JD4A 1H6AA 5H68A 4FNAA 4DUPA 5FH9A 4O2BA 2I2WA 4N4AA 1GYQA 3UWOA 2PL3A 1L3IA 1MD9A 4M86A 1FU7A 2AXPA 2OHJA 4GBMA 4JKOA 3KZNA 1AZWA 4U00A 1Y42X 3MYYA 3MSCA 4XJTA 4COOA 4EGJA 2FOXA 4XVUA 5CEJA 1EQUA 5EIEA 2NP6A 2EHDA 3AF4A 1RD4A 1MIHA 4EUEA 4X85A 4JZKA 4V1CI 5IT9A 4BNJA 4CE6A 1SXJD 2VWHA 1YDHA 2IPLA 5EQFA 1AOXA 2XRYA 3EHEA 2CJYA 2NACA 1JWAB 5EKXA 3VNBA 2B25A 3WTCA 4TN5A 1GQ2A 4L16A 4LTMA 2YCBA 3ZYCA 2C0PA 1SG6A 2JLBA 1Q50A 4NG5A 4LK2A 1QK5A 3QFSA 2YJ3A 4M0MA 2ZRJA 3VR2D 2O5CA 2Z5GA 1BKYA 5B2ZA 3AEUA 3ZV3A 3H99A 1JWLA 4XARA 4G86A 1TM1E 5F7OA 2BFBB 5CH3A 2QP3A 4K86A 1JPUA 4IQFA 3FYUC 2BKXA 1VL5A 3ETCA 3GEPA 4YAIA 2OR3A 1N4AA 1EZ4A 4D0RA 3FYHA 3E9MA 1MQ9A 1P61B 1DXOA 1PR0A 4JJKA 2YWHA 4B3FX 5IDYA 3IOEA 3HC7A 1MJGA 5EERA 3U3MA 4YAJA 3ZI4A 1C7QA 1SCAA 2E37A 1DHRA 2QMOA 3N58A 3WK4A 4E4TA 4XDZA 3VKHA 1G7CA 2QY6A 1YA8A 2VJMA 1QUFA 3QSGA 5DHUA 2HYIC 3R2JA 1OXMA 1CETA 2JHGA 5DBEX 1M2NA 2GX6A 3WL5A 4B43A 2GTIA 2R87A 1P33A 1YGYA 2GARA 3F5DA 2DUMA 5FQOA 4DYHA 3HVJA 3ZLTA 4NWIA 1HT2E 1U2PA 1Y1LA 3CEHA 1KYWA 3EEQA 2RHHA 4BVEA 1Z45A 3P9PA 2QXTA 3KQWA 4OQQA 4QQFA 1ZEMA 1CS4C 1VXRA 4C21A 1ISHA 3IPLA 1BDIA 3DFMA 4CXMA 4DV7B 4Y2YA 3O3MB 2FSUA 1ZN2A 1FXSA 2QZ4A 3L1VA 1I0LA 3GGPA 4JUBA 2DY0A 2HC9A 5I6DA 3EF3A 3EZ9A 5A5VA 5JY6A 3GFTA 3CLHA 3M33A 2OV3A 1E6KA 3WL8A 3QPAA 1ECFA 2I4LA 4K03A 2XNDA 5IEBA 2ECFA 4ROTA 1UQUA 3I8SA 1LZLA 2CJFA 3PTLA 4GMKA 2RHJA 4UDNA 3GRCA 3R76A 2DF8A 3QY9A 1UFKA 3RJMA 2KX7A 2BY4A 3ACDA 4TTIA 4F04A 3R09A 1B6GA 2QRHA 1UBHS 3WSWA 2ZGVA 2GPYA 1GT91 4P0TA 4J0DA 1H9CA 2QUBA 4LMBA 1S02A 3W6PA 4ZZ0A 3MGCA 3KTOA 1JA0A 1NRIA 3FWNA 2ET6A 4TL7A 2ZUVA 3G9XA 5CA0F 3RANA 2P6UA 2VHXA 2ECKA 4QUAA 1K86A 2WMNB 4CM8B 5A1JA 1P6UA 2YWJA 1IIRA 5JXIA 1TZKA 4KQFA 1D2MA 2J41A 2ZU0C 2BSAA 1IHPA 3NQ41 3RBVA 2OBBA 3ME5A 3RHTA 3HXTA 2UYOA 1AKNA 2O8DA 4IH9A 4B74A 4DLWA 4LHXA 1DMSA 1M1NB 1SBTA 4TMFA 3LTNC 2HRDA 2VDLB 1H8HA 1TIPA 3QFCA 3AH8A 4OA5A 3I23A 2O8VA 2PGLA 4A0RA 1EHCA 2C31A 1N5OX 1YU6A 1F4PA 1F20A 3EAQA 3OJEA 3OQHA 1KK2A 1UBSB 1C50A 5TX7A 5J23A 3ETGA 4WXPA 1L5ZA 4L0MA 5KJ6A 3WGOA 2PUFA 3DHEA 2REXB 3GP3A 1FLVA 4IGAA 1WUHS 1QOQB 5FNVA 4OXNA 3QVVA 1A97A 3GFFA 4XFJA 3BSWA 1R6VA 3NETA 5ENDA 2BWJA 2V9ZA 1A4UA 5REQA 1RIFA 4Q7JB 1RPAA 3LFTA 3V8QA 3OAAD 1C8KA 4PAOA 2EJBA 4IWXA 4C4RA 1L4NA 1KDRA 3C5VA 4O1MA 1AQNA 2VTKA 2YVLA 2VOJA 4LE0A 1PAUA 5GIPE 4WZBB 1X0XA 4ZMRA 1DKLA 4D43A 3CRZA 4KK3A 3ESYA 2XQIA 3QXCA 5MGNA 2ZRQA 1BYUA 2WHRA 1T0PA 1ZVQA 4GR4A 4NE7A 2JS7A 3H19A 3MHTA 2CC2A 3NBFA 4LYFA 2ZUTA 1MEJA 2NZUG 2QLBA 4NQZA 1SJ9A 3DV9A 1FS6A 1G2OA 4MUHA 1DBWA 1T9GR 2YN4A 2IIBA 3GVHA 3RIGA 5CEFA 3NHZA 3UZUA 3BHJA 1YZLA 1TCAA 3CSSA 1ZD3A 2PKXA 5J9FA 3ZIAD 4EZEA 3GLFA 3E05A 1DSSG 4KXVA 2H5JA 1FX1A 3I58A 4Y30A 3OQ6A 3HEMA 1FRFS 2JIPA 3P2MA 4LTNA 2VQDA 1DARA 3WWZA 2OKCA 2BFDB 3AFHA 3A06A 4LVCA 2YR0A 2DYKA 2XT6A 1LQTA 3N2KB 5HILA 4NCXA 1TYDE 4OHZA 2O5VA 4CTNA 4BXOB 3PQ8A 5CCEA 2GPAA 4PPYA 5B6JA 5JANA 3USES 2PZAA 3AHJA 2PUWA 4GZ6A 5GP1A 3DBOB 1C0IA 3A1WA 3QUAA 1L7BA 2Q2QA 2QROA 3MS4A 1A9PA 1UK6A 4LC0A 2V6FA 4OHFA 5EZYF 3R74A 5JAZA 1UBUS 2HIHA 2UXDB 4ND4A 3V1NA 1B15A 1EDEA 3KKQA 4ENVA 1RRCA 1LD3A 1I0IA 2FEKA 3K8QA 4FHFA 4PFJA 2UUCB 1TVKB 3F7MA 2G08A 4DR4B 5I01A 4LRYA 1RRMA 4HVTA 4KXUA 5LA6F 3HBFA 3OZTA 2D1FA 4E08A 1JKFA 2PL9A 1YACA 1BHJA 4P7GA 2ZLBA 1KZHA 5AK4A 3PVZA 3CH5A 5IBQA 1BYIA 1QTRA 2PFKA 1L8QA 4NICA 1MVLA 2ZBUA 4YO8A 1UPXA 3ZXIA 5A0FA 5F3RA 1ODJA 3RWBA 1RXVA 4MIYA 1PR2A 5LQSA 1HWYA 1TKRA 4UM9B 1Q0UA 4KEAA 3JWPA 4IH1A 5JNSA 3OSZA 4L3OA 5GVRA 1Z4OA 4BUCA 2WAYA 3DAGA 3F0TA 3OT1A 4CCYA 3JVEA 3ND9A 2PMFA 4OJTA 1TU0A 2PZBA 3SJZA 3OPMA 2XZPA 2N0SA 3U1BA 1EGHA 3OC0A 4XOUA 721PA 5HZKA 4UJ3A 3MINA 5JUWA 4AMVA 1KZ4A 5JHHB 4P4SB 2VP3A 1LVHA 1E62A 3AHGA 4QVKA 1VIMA 4DMKA 2CK3D 2XGGA 3H9EO 4PRYA 5ALLA 1EGAA 4WZAA 1FF9A 4LV5B 5FLKA 2AB0A 2GJSA 2ZTLA 4ETMA 2JGLA 1RWPA 2XMCA 2Q7OE 4DDWA 1V7PC 3GDGA 5ICCA 2X9GA 2OSVA 4R16A 4IFBA 5TPWB 3QSYA 3HTXA 1W5AA 2G77B 1RYFA 1UXJA 3OOSA 2DGDA 3NIGB 1N1GA 1Z36A 4IVNA 4K1XA 4MKFA 4X1KA 3FDZB 4RTSA 1X2EA 4OBEA 2IOQA 1PUXA 1B4DA 3LT0A 4DREA 5A7HA 3D02A 4XVHA 1RU3A 4RZUA 3L7JA 3QBDA 4HQ6A 4QJ3A 5A5GA 4AYWA 5JZOA 5M7EA 1N6HA 3H5OA 4NMHA 2ENWA 3IP8A 5BR8B 4KQJA 2WSSA 4MEAA 4MA4A 5JH7F 2D8MA 2W37A 4JYMA 3ZLVA 2VYVA 3HA5A 2PXHA 2QMUA 3OQ1A 2SKCA 4Q9HA 3R7WA 4M2LA 2BYTA 1W88A 2QBYB 3MXOA 2IEZA 2OFOA 5H8WA 4QU9A 2CHUA 1CQJA 4OFWA 1W5SA 3CCCA 3A4NA 1KKUA 4W7SA 3I9FA 4DY4A 1KEZA 1W93A 4RV4A 3SBXA 4D56A 2XD4A 3CH4B 4JJEA 2BH9A 3QE2A 4HC4A 1TRHA 4HBGA 3BPSA 5E2AA 3OFJA 3HA3A 3GN2A 4J49A 1QGDA 2O8NA 1RYDA 4MVJA 3UKDA 5KO2A 4TLCA 1AC5A 1QIKA 4HB4A 3MLEA 3SSNA 2L19A 3TGPA 2IJGX 1TUIA 3M4JA 4DBVO 1OVGA 2FRXA 2VUHB 2QTHA 3AG5A 5AT1A 4LYEA 2YW9A 2Q3DA 3WDLA 4NPHA 4P4UA 1F3LA 4H31A 4QTTB 5DP1A 1T4GA 4F5ZA 2CHGA 4RJIA 2XE7A 4NZNA 1GO2A 2FPGB 2FPKA 3WZLA 3AR2A 1GTG1 3L6RA 3R3SA 5HDBB 2GPWA 4R81A 4ZVPA 4CU5A 2ID8A 1RYEA 2Q7XA 1IZZA 1ORRA 3NDJA 2JZCA 3SF8B 2FUG6 4GM4A 4L08A 1FXUA 3H1PA 3PYLA 4Z2YA 4WKGA 5E9JA 1XQWA 1AQJA 2HDHA 1O4VA 4WY5A 3IKMB 3OE1A 3VAYA 2R7AA 2ACEA 4NJMA 4Q6BA 4MQFB 2IPNA 1J39A 3IMEA 5BURA 1XOIA 5HE9A 3GLGA 2YXBA 1PQPA 2IVZA 1A5BB 3QEMB 3LE8A 4JX9A 5GQSA 4I9HA 1YJCA 3TLGA 2D0DA 2V1XA 1UMCB 1PLLA 3L0DA 4I1RA 4JGBA 2KPOA 5LZ7A 4WUVA 2XJ4A 4OK5A 5FV4A 3P0RA 3UB4A 2KW5A 4RPIA 3TRFA 2MSLA 5ICSA 1SURA 3LUGA 1E7RA 3QVJA 5KIAA 3ZG6A 5IJWA 2B7BA 4JLUA 5LQUA 2CVQA 1SA0A 3BOSA 4AMUA 1O77A 1V11A 5EPOA 3GG9A 3RBXA 2G17A 3BWCA 3KUKA 4QEZA 3EA5A 3I0MA 4YP5A 4OXIA 3VUEA 3B2QA 4RVOA 1NMEA 4A73A 1XVAA 1GG2A 4Z0NA 3AGPA 1IN4A 3KB1A 5DX1A 5ANRB 1TYAE 4EG7A 3SDSA 1APBA 3OIYA 4HGPA 3LU1A 2ZUSA 3ICOA 4OQFA 4RZIA 3UQYS 2WHPB 3D8BA 4LHZA 5DCYA 3KYIB 3QVXA 1GY8A 4R1QA 2HSWA 2VS1A 1PUIA 4JR2A 1SXJB 4TQGA 4L75A 4QM6A 2B37A 5CG1A 1P9RA 4OLBA 2HHCA 2L82A 1SCQA 2W11A 2J7PA 1LY1A 2IE8A 2OXRA 121PA 2HU5A 2WPNA 1M2OA 3QVGB 4INJA 5FBLB 5P8WA 4JODA 2BFFB 4MWEA 1DS6A 2Y3IA 3F9CA 1Z35A 3PNMA 4PTYA 2GUGA 5EJ6A 5HM8A 3WMWA 1FTSA 1I2DA 4HDMB 1Z0SA 2I2DA 5IC5A 4ND8B 3RCBA 1P1KA 2PH5A 3TPFA 3X2EA 4C05A 1G9SA 2WJ6A 2ZBDA 3VHRA 4ZHSA 3A37A 4HDNB 1NRWA 2DX7A 3BHNA 5JHGB 3AFGA 2WU8A 2HDOA 3AJ8A 2BKVA 4RABA 4RFSB 3SXUA 2IE0A 2HBQA 4NYJR 4WK0B 1HT1E 3C5HA 4OOEA 5JROA 4ZYTA 3L4BC 3H13A 4FMCB 4CLRA 1CRPA 1KNQA 3M9XA 3I72A 4IJKA 4R1NA 2ADMA 4X1YB 2JB9A 3SDZA 1QPBA 2XUHA 3L8YA 1CUWA 4DYVA 1EVKA 4IFTA 5L4LA 3QNMA 1KJNA 1Y8QA 4MRVA 4PZDA 4ALMA 2OB1A 2HWYA 3A2MA 1S5PA 2ANBA 2C2GA 4WOPA 2Z3ZA 4X8OA 2G04A 1TLFA 2AHRA 2EW2A 4TVOA 4C20A 1K0FA 1XVIA 3A31A 4NZYA 5AJXA 4MUXA 1BDBA 3JVIA 3C4JA 4P7KA 4N0DA 3P2EA 3I92A 3QLEA 3D5EA 4H0NA 4LRTB 2FQ1A 3VU1A 2IU6A 1SZPA 2LCIA 3ECSA 5CNIA 3EF0A 3ORYA 3P20A 3EXEA 3J7TA 1AQIA 4PLHA 3ICVA 2ZAGA 3E2PA 4AZWA 3GJXC 1F0PA 2WU1A 1F51E 1T15A 2NN3C 2ESRA 4IKPA 3KAQA 2ZT8A 2CKMA 4JMLA 3QE3A 4W8GA 1NLMA 1M9NA 1E4VA 1XGKA 3MTEA 1BCSA 3R40A 4KFSA 3VKUA 1YZUA 1JFVA 1Y3DE 2PLNA 3DBHB 1WDWB 5C34B 4M7WA 2N3ZA 3VZBA 2R8BA 3TVYA 5FX2A 1VJRA 3TDNA 1JQLB 1UIMA 2ZVJA 3TD9A 5HP4A 3IT0A 3TINA 2BELA 4CEIA 4LRSB 2OGUA 3O4IA 1XJ5A 2GKSA 3B5EA 2DM6A 2VFAA 4FFDA 3IQZA 2I4IA 4WLUA 4MVWA 3RTDA 4XRGA 1WZ2A 1VSBA 1YDMA 1JN0A 2QI9F 3KB2A 3UH1A 2AJ8A 2F1IA 3VZRA 5GPBA 3W1EA 4CDNA 1SU7A 1W76A 3AQIA 3ND8A 4C0SA 2JJQA 2TECE 4OQZA 5JSHA 5L3SB 1FYFA 1UBTS 4GC9A 5EJMA 2JI4A 1KEEA 4LDJA 1C0PA 3N9IA 3D8RA 1M1XB 4F4IA 4BO9A 1MBZA 1Y34E 4H1HA 1P5ZB 3QM1A 4NULA 1QZUA 4BNDA 1PG2A 2IS2A 4KAXA 3WYDA 4WHMA 3L7IA 4JXZA 3ETHA 2H7YA 4DOMA 1UINA 4MTCA 3T7CA 4OJYA 1SEPA 4LJSA 1VLMA 4TTQA 5LIRA 1GADO 2JGDA 3VJLA 1H85A 2KLBA 3HUFA 3INRA 4WUTA 3HYRA 5DM4A 4QUGA 3RIXA 3CVYA 1RADA 4DV6B 1UP7A 4Z1OA 2WZCA 3EH1A 4JI5B 3FZYA 1DEOA 1HPLA 4CG0A 4GPIB 3AUTA 2TMYA 3AEQB 4BVFA 1VRCA 3JTMA 4EA9A 1S3FA 2NMVA 1XXLA 4GE3A 2VF7A 5IM5A 1XD2A 3TGWA 5LWQA 3EX7C 5JU6A 5KSOA 3WO0A 4O25A 1B8NA 1X7DA 2RHCA 4NZOA 5I7SA 5K45A 2EDAA 3CLRC 3IEPA 4OQDA 1M0TA 2C4NA 3FPHA 5ESWA 3AVVA 1XR3A 3ZD7A 4RQTA 3LBYA 3FUUA 1UZLA 1KAGA 4G0UA 1H9BA 2R7LA 2HK7A 3G8YA 3MWFA 4Q19A 4CDRA 3D6NB 4HTFB 5AI8A 3ZHTA 5AKHA 2P4SA 2B5VA 3OP4A 1ONNA 5T6BA 1JKMA 4DZTA 5JJKA 2W6ZA 3I9LA 5HMLA 2DFPA 1E5XA 3DXFA 1QGAA 4KYIB 3KJXA 2ZWVA 3BJEA 3I28A 4JH0A 3GG2A 4KREA 1KWKA 1VJ0A 3AR9A 1OILA 3KKPA 2ZPUA 4ON9A 2WF9A 4DIBA 3BF8A 1U5CA 3RSQA 4YLGA 1JR6A 3GCGA 1R4AA 1WZNA 3LX6A 4JI1B 1O6ZA 1RHQA 1FFSA 3TDMA 4XM0A 1XVLA 4TSRA 4EFKA 5TQVA 3FTFA 3M3DA 2NVWA 4EMTA 5EKUA 3N07A 2IUYA 3MUFA 1HZZC 2D1RA 3WL4A 4RPKA 3GLTA 3L1KA 5CX1A 4QWWA 2WNSA 4J0FA 3EGCA 4BGIA 3QWHA 1V8BA 5HJ2A 2PGNA 4WNAA 5FWNA 2B61A 5CVDA 1X86B 3O8OB 2FUKA 1ORIA 5ALPA 4M46A 4AVYA 1FMTA 3U3JA 1CJKC 3PQ4A 3D9QX 1BVYF 1T8UA 2ZULA 3MWDB 4U9UA 3RFFA 3QVLA 4BMCA 1K8QA 4OLHA 4WQMA 1I33A 4RIHA 2PZLA 2VCEA 4N5DA 5J4VA 3R5XA 2OD7A 1NJ6A 2Y6UA 1XZAA 3L0PA 4P35A 5E0KB 1RKVA 3RYHA 4BQQA 3R8FA 3CF4G 1L5HA 4UBKA 4PAQA 3HDQA 1P80A 3A27A 5DBGA 2QWXA 4RH1A 3CKKA 2IOYA 1UM9A 2QU8A 2YHUA 4QVGA 4D4IA 2HT6A 2Y76A 3WLMA 1MAHA 3IJ5A 2ZJBA 4B34A 1Y4AE 5JDIA 5ERYA 1UR5A 3ZWDA 3J80A 1DJLA 4KRXA 4ZJYA 2FCRA 3T1VA 4FMDF 3IPCA 3M6VA 1OV4A 2FGKA 1K63A 1RS0A 2RKBA 4YCJA 1N3YA 5JO9A 4EELA 4J3NA 3FHOA 4EY7A 4GHWA 2CYCA 4OHVA 4NENA 3FCAA 1JRLA 2I29A 4QO8A 4KUGA 3GDHA 1ACLA 4RANA 3WGZA 4PRLA 3VR2A 3AHCA 4C6SA 4ZDWA 4WNYA 3CUEF 4I4NA 2CNLA 3QKIA 3O74A 2QZSA 1K2WA 3LA8A 5HWSA 4GIBA 5DDIP 4BRSA 4DDMA 1I4WA 1GSIA 3NO4A 1MB9A 3K5PA 3HGQA 1AVTA 1NG1A 1Q1QA 1WG8A 2NNLD 2H2GA 5KNDH 1W85B 2XLBA 2YYYA 4D5EA 4DC1A 1MTZA 2YOFA 3DCIA 3R3UA 4B5KA 2VHYA 1M8GA 3B1YA 2RE8A 3GT4A 4MDFA 3HB7A 3RFTA 2Y0BA 4TWRA 2GNOA 4XR9A 3LCUA 1RQXA 1FNBA 4QXAA 1K7FB 1PGQA 4KW7A 621PA 5DI3B 1U5BB 2P68A 3QVKA 3ZZNA 1JYEA 4V0LA 4EPWA 5LMZA 2EX1A 2BKAA 3AVTA 2GJ8A 3MLAA 1C2TA 2A59A 3ZWKA 4EARA 1ZZGA 5ED0A 2ZIZA 1E59A 2OXCA 3K2EA 4LWQA 4ZOAA 3P52A 3UOWA 4DA0A 2GO1A 1EFTA 5G1OA 1NUHA 3N3BC 3ZDAA 1GZ7A 4ZV9A 3SSOA 3AL2A 1ILEA 3P32A 4D4LA 1NJ8A 4MUFA 4Q9JA 3C4VA 5C8XA 1X7ZA 1F1JA 4J4TA 5A3QA 3DAOA 5AVJA 5I7WA 1EFDN 4I4CA 3F3YA 4N7MA 1ZCBA 2AQHA 3HJTA 2WT4A 2DQYA 4RPCA 3ZXUB 2FPPA 1QVZA 1E4OA 3FIJA 3NHJA 3D6TB 2J33A 1VMDA 4XQEA 1I2BA 5JLAA 1U0FA 2XZOA 1VIVA 3AY3A 1NAIA 2RJOA 1QG2A 4DILA 2GPSA 2J3IA 3OWHA 3HXQA 2O9JA 4G41A 4JJAA 3MCZA 3IKVA 5B3JA 4GKKB 2GD0A 1X15A 5KYXB 4J0HA 2QW0X 1PIWA 1R37A 3TRHA 5C8DA 1EUQA 5KVCA 2OCYC 2OLEA 4D9GA 4HNUA 3ZGOA 3A1TA 3WLOA 1SUBA 1J99A 1V37A 2R8PA 3C3YA 2PT7A 2ZXEA 3STVA 1R4ZA 3W8RA 1J7JA 5KC9A 3UT6A 2CNWA 2IHKA 2C84A 1O94C 4FLEA 1M8KA 5KVAA 1P2TA 4MWOA 3LUBA 4WBNF 1ZJ4A 3BXZA 3NC0C 3WGNA 1OXTA 4OM7A 1Y89A 3PR1A 4TT8A 3IT2A 1FQJA 2HF2A 3PZBA 4XWYA 1Y9EA 2FZCA 3DMNA 3QNUA 1N2HA 4KMMA 3TOSA 4N41A 1JIUA 1MVOA 4RVFA 3SS8A 5IDWA 5B3AA 3HNRA 4U6NA 2L42A 2W2KA 1O7JA 8AT1A 2QT9A 2V3VA 2WT9A 1OWMA 1UAYA 1MIOB 1TGYA 2J9YB 3K70D 4Y2PA 3OCZA 2ZI7A 1HFJA 3KXLA 1CRZA 4BNYA 4YAUA 4MTLA 3UAVA 3NFRA 1VJCA 1CEXA 1RHUA 5J1SB 4Y9SA 2YL2A 4NV3A 5AW4A 3DL0A 1NKSA 1TQ4A 3HU3A 5DH9A 4RA9A 1NNEA 2CJWB 5HOQA 5EE0A 4P22A 3FNHA 1EVJA 4LBYA 4RA6A 2JLQA 4DLAA 4BNWA 2KJQA 4CZ2A 2N1MA 2PZEA 4IIVA 4CMEC 2XB9A 1N78A 1V6AA 2AEEA 2FEXA 4G3XA 3EIUA 2P9EA 3MJEA 4GP9A 3U1TA 2ERYA 1OZHA 1SG9A 2MHCA 1JR3A 3KHTA 3O8BA 3JQDA 4RQBA 2W6CX 3GLHE 2W83A 2QIOA 5E8JA 1MFZA 2W9XA 4QOSA 2I65A 2QQEA 1JIJA 4ENQA 3X1XA 4EFLA 1TZCA 2IW3A 2Q5JA 3R0QA 4RE5A 3UUGA 4BE7B 4MV0A 1NF2A 3TMAA 4A8TA 3P2JA 5JZMA 5DT2A 4AG3A 3TNLA 1XA0A 3DD1A 4J1NA 5AK6A 4NEHB 4G4SO 3AR7A 4Q82A 4F6RB 2IH5A 1KKLA 3FMGA 3P97A 4RPGA 2DWOA 2QRZA 4DPKA 2Y1OA 1PZEA 1HKHA 1GILA 2WJJA 2A5LA 1NM5C 2XECA 3AETB 3IP9A 1C1HA 2HRBA 1FP4A 3K53A 1XRPA 4QG7A 3CPEA 1U8CB 1D2HA 1QDUA 1YCFA 4JI7B 3E22A 3D2LA 1LNZA 2WWRA 2O5EA 3UW1A 4ZI5A 4O59O 2VRWA 1C4XA 1FTGA 2QMEA 3VI3B 5B6IA 4P4NA 1UL1X 2NU8A 4CHGA 3PNQA 2AC2A 1AMUA 2YFKA 3TZCA 1PJLA 1SQSA 1BWPA 1U2SA 1ZVVA 5KC8A 4MW1A 4MRPA 1NMQA 2PBLA 4PNZA 3HJFA 3NDBB 4B9AA 1EWVA 5FR2A 3ZLBA 2D4AA 4JHLA 1CYEA 4QGSA 2ZEJA 2ENUA 2XTNA 3BWXA 4YACA 1OXXK 4B47A 1LNQA 4YUWA 3NJRA 1IULA 1ZNZA 3ETJA 2ZRBA 3PFGA 4PCAA 3KLMX 2VH1A 3M6LA 3E9QA 3S7TA 1ST3A 2FCAA 3OJWA 3GAMA 3HCWA 4YC7A 3EG9B 3L8ZA 1VXOA 1HXHA 3QGMA 1NLZA 5I7VA 2OL4A 1T1GA 3HYSA 3TBFA 4L6AA 4C87A 3ICQB 2A9JA 2P1DA 4RMGA 3L6OO 5E2IA 2JLYA 1GUZA 1I14A 4B75A 2E6KA 3I2FA 3G6WA 1EJ0A 1KDVA 4JXXA 3IALA 4Q47A 5HQ3B 3C14C 3THSA 1C1YA 2OOSA 1RBQA 3OWOA 5KX5B 1SVLA 1ECLA 3R44A 4RJKA 4TTAA 2WIKA 3I4CA 1LRLA 3U4IA 5JCJA 5AESA 3DZJA 3CBQA 2OBXA 1G0OA 2PZJA 3EULA 2EKLA 1RQ2A 1SQ0A 4BO8A 5ALSA 2HK6A 3KEMA 3PXBA 4REMA 4S35A 3AF6A 3JSXA 2JJ1A 1JEEA 5AM4A 1GRNA 1H93A 3W1WA 1S4QA 5EWJA 3LDUA 3PPYA 3WA6A 4BC0A 3LGSA 2QDKA 3AI1A 4K9LA 4Y9RA 3CXRA 3UMVA 1NBOA 2ZIXA 1E6UA 1OYWA 3HDHA 3U80A 5B3KA 4KRGA 4NYIR 4FCVA 5BO5A 3PRKE 1MEEA 3AWIA 4CMHA 1UPCA 3JYQA 3A1SA 3KJGA 4GM0A 4UCWA 4PNPA 4F2GA 5AVZA 1CEYA 5DTRA 1C3OA 3NV9A 1HDRA 2P8JA 3I8OA 5HX7A 3ITDA 4BMVA 3AVOA 5LIPA 4HEHA 5D84A 2QR5A 3WFIA 3G0DA 5CK5A 4D9CA 2Z2XA 3C1UA 1QOPB 2H9AA 3RVKA 1E6CA 3VSBA 1U0JA 2SHKA 1Y6ZA 2R4UA 5KNCA 2WSYB 3RSLA 4JLWA 3MJCA 4Z9XA 4NTZA 5KAPA 1G4UR 1QAOA 1TC2A 2YFYA 1OI3A 3G9TA 5D3ZA 5CA0A 2SBTA 3ZCQA 2H2FA 4OATA 1OTYA 3T7TA 5CFQA 3BB1A 1LPSA 2A3NA 4MV7A 4MRNA 3W90A 3OEWA 1NNUA 2IYYA 3WIUA 1QVAA 1U2QA 3OETA 3UAOA 2X0FA 5DW0A 3P9YA 2WHEA 2XMQA 1O97C 4PAMA 4RTPA 4WCDA 2C95A 4RLFA 2HV9A 3PGVA 1SCNE 4IOMA 1N7JA 4QBHA 4U7PB 3ZEIA 3LC7O 2ZRHA 3INGA 3Q4GA 1LXCA 1NE2A 4UUAA 2XCTB 4PPNA 1XYYA 1VL6A 4K9PA 3R9KA 4ZVOA 2R9VA 3H2YA 2MYUA 4RTNA 3D0QA 4UHFA 2ZBRA 4X90A 4AO7A 1BH6A 1VG0B 3ID6C 2XWJI 4Y2JA 3TO5A 4KWEA 1XMIA 4YMHA 5IF9A 2VP0A 1SD1A 4OBXA 4QODA 3V9AA 2JGRA 1FBTA 4DKXA 4JBNA 4QKQA 5KZMB 3OZCA 4W1PA 2UZ4A 4AN0A 1RQRA 3OSUA 4NBLA 1Z5UA 4N76A 1EUYA 1EEXB 3DD5A 3H2SA 3ZHQA 1DINA 4J0EA 4X3OA 5KVSA 3THWA 3AJRA 1N2GA 1ZW6A 3SE7A 4TRRA 4IIJB 2X13A 2MR5A 3CM0A 2I2CA 4N6NA 1XLWA 1N2IA 3RK1A 1K3TA 6REQB 2AWNA 5AVXA 1CTQA 1HDZA 5ES4B 1MOQA 4N5NA 4DNFA 4F96A 4X6UA 2OY0A 2VHJA 1L5VA 1XTJA 1XO1A 4GDMA 4J03A 3WGTA 5K0BA 1IJEA 1IY0A 2BFNA 4BMNA 3AYZB 3GIDA 3OIVA 3VRHA 3CIFA 1VGRA 5CT5A 1V9CA 5K1ZA 2YWEA 1B0PA 1OPXA 4PIVA 2VSYA 2XNCA 2FW0A 3QZUA 4XCXA 4CTMA 5LQCA 3FLMA 5LP1A 2WJAA 3R24A 1NV8A 4HYEA 5KKNB 3BXFA 2ETVA 5A2QA 5JS6A 2SKEA 1FJHA 3L05A 3GEGA 4ESOA 5HW0A 1A8IA 3BFKA 1AQYA 3NB0A 1ODSA 3R7LA 1RHJA 4WNCA 4MYRA 1X7XB 5LCXA 2DBYA 3UAYA 4KFUA 1YUNA 2I2BA 1U0SY 4NYMR 5HFJA 2J5QA 1GNQA 4Z54A 3GLIE 1N3IA 2J9FA 3O4FA 5BUCA 3VO9A 2X6RA 3NR2A 2QY9A 1ZH4A 1ZL0A 4Q9IA 5JYEA 4E32A 3RF6A 4ZJUA 4B09A 3PKIA 1CQIB 1G60A 1KO1A 1J2YA 5EZYA 1XZLA 3B6IA 3EY4A 3HA2A 4NLLA 3X0DA 2XPCA 3HUUA 5FHRA 3JYPA 5J58A 1JPJA 4G9EA 3JD0A 5CLGA 3SIRA 5HQTA 4RM2A 2N47A 4R3UC 4GKJB 4Q7QA 4EL0A 1C9NA 3LP5A 4PSVA 2I2AA 5LA6A 4TS9A 5IJ0B 4P3NA 5ALTA 5CXXA 3MAJA 3WLQA 2P5SA 4BMYA 4DPLA 3KYDA 4EB6A 4YAKA 1QJCA 3VR6H 4UUBA 4NU0A 4X8LA 2R3SA 1VPLA 3KX2A 3R7AA 4AROA 2VWQA 3CZMA 5FI3A 5EZQA 3V80A 1IBKB 1S7GA 1LC3A 4N3AA 4DUGD 4GPTA 5JD3A 4DLKA 3H2KA 3I12A 3DZCA 2UXCB 3PI7A 3RHFA 3WNDA 2YUTA 4CL3A 5JNLA 2AVDA 1WU7A 3CLTD 1CG6A 3BD7A 3C8ZA 1G1AA 2Y05A 4IDGA 2GEDA 1YVEI 2ZYHA 1PFGA 13PKA 1YZHA 3W5HA 3EXHC 1LPOA 3W79A 5M2QA 1G63A 2JH9A 4BTVA 2B0JA 4S1NA 2ODWA 1PL8A 3DVAB 4TV8B 3TE6A 3K35A 1JEYA 1ANKA 3QLUA 3VU9A 2I4MA 1WAMA 1NMXA 2OO5A 3LUJA 1ZH0A 1Q1AA 3ZU6A 5A03A 2QSZA 1QB7A 3OHPA 4WBXC 1CEQA 3D4NA 2NSHA 1IXZA 5I51A 3DDZX 4GPAA 3TR6A 2P0EA 1UOOA 3QPVA 3V55A 4JBHA 1N4DA 1T6NA 2DHQA 1H9AA 3MMZA 3PQ7A 4QNNA 4W6ZA 5DO9A 4W9MC 2WFLA 3HU2A 4JX8A 4Y1RA 2E48A 4RY8A 2W8BB 3H8WA 1CUSA 2Y1DA 3K0FB 3J81k 2PY6A 2H1IA 2PUGA 4ML3A 5TIIA 2LNDA 2OXFA 4TRJA 3C6MA 2GWRA 2F55A 5EYPB 3HB0A 3W9YA 1OBOA 2HIGA 1JFFB 1OLSB 1IATA 1PFUA 1J97A 2CXNA 3ADKA 2VYCA 5LDGA 5IDXA 1ZAKA 1SBYA 5BY2A 4FILA 2R4QA 3NEYA 1FDWA 4KIGA 1SZCA 4UU1A 4YUYA 4Y0NA 2VRBA 1P4RA 3UIEA 4NOKA 4AICA 4MUEA 1H6BA 4AZ3A 2VDRB 1LBHA 2LGJA 5B58T 4WPGA 2V7QA 1GIAA 4QJ5A 5DASA 5EUQB 4ZVQA 2NQ8A 4BKQA 1SH7A 3FR7A 2UZAA 5JH7A 3R3VA 2XUJA 5JSQA 4WI1A 1L4EA 3BKWA 4BOYA 4ENSA 4M8LA 2CDCA 1JUDA 3RUEA 3EFHA 2KQUA 3LJKA 4DM3A 2NW6A 1ODTC 5CEEA 1SC4A 1USIA 2Q5OA 3Q6MA 1A9XA 4C3UA 1NF3A 1NZFA 3DV0B 1WKCA 1VBNA 4I1VA 4MYDA 3VR3D 4B17A 4NL4H 2IV2X 3LS2A 4ZCMA 2I8CA 1U2GA 1NV9A 1WMAA 2C5GA 1L4YA 2W6ID 5JOQA 1GL3A 2EFYA 1F8GA 4OEHA 1CQXA 3THYB 1PWEA 2JEOA 1HBJA 1R0WA 2OVFA 3WISA 4AZ0A 5AOCA 2PMBA 4LE2A 4RJLA 2OYRA 2DBQA 3H4VA 1C9KA 2HXSA 3ROEA 1JSLA 2AN9A 3NT2A 1WXIA 4URZR 3WYGA 3H1EA 1VIAA 3OZDA 2P27A 1GAQA 1NYQA 1TT5A 2XDYA 1E66A 1F2VA 1L1FA 2R1TA 4E6EA 3NBUA 3ETDA 3WA7A 5FLXA 2F3QA 4HN2A 3AHFA 4PHTA 3HXOA 4OSPA 1YR1A 1RAEA 1DAOA 1SMKA 5E95A 5K3DA 3FNIA 5DWQA 1QHGA 1K5GA 3ROPA 2WNIA 4RXMA 2H8KA 2BGNA 2ZVPX 2JCGA 1T5IA 1O95C 1ACMA 3QQPA 2CYAA 1YKSA 3RREA 2AJTA 4AZSA 4MQ4A 1XC7A 1YZQA 4BFWA 4EEKA 3CUSA 1G8MA 3O2NA 4H2DA 2IYWA 1Q12A 4MULA 5KQPA 2Y68A 2P41A 3I1FA 4GGPA 1J42A 2I0FA 3IP6A 2PD6A 4O1IA 4L85A 2R8YA 5AI4A 5JMWA 1IG3A 1R10A 3EVTA 5DCWA 2ZUUA 1MABB 3HCRA 1FFWA 1Y1TA 2KHZA 3M5PA 3IYLW 2FPWA 4YONB 1TA0A 1IOZA 1WP4A 2GLUA 5E7JA 3ZY4A 3O2SB 1OBHA 4L73A 1EZ1A 1U9IC 2ZR0A 1YR2A 1ZC4A 1YDEA 2JD2A 1LRJA 3GNLA 5HFNA 4UMVA 1C7JA 1K08A 1Z28A 3BQNB 4FB4A 5BV7A 2ZI6A 2OZEA 4WX2B 2C9BA 4G0YA 5CLQA 5I7RA 1TDJA 1XTVA 3CX8A 1QYIA 3DPSA 4BU0A 4W1QA 6Q21A 3GJ5A 1BMTA 2PBFA 3KP1A 3NHUA 4EMSA 5KX5F 2OGWA 3O5AA 1QBGA 2ODAA 4L4RA 5FADA 1VECA 2YS7A 1EAMA 1Z18A 2F1RA 3IP5A 1SXIA 1HQDA 1Z68A 1GTZA 4KH1A 1NOIA 1NMZA 4FKZA 1QXSA 1IQRA 3FKSA 2WYUA 2OBMA 3JQ9A 3REGA 1M33A 2QZZA 4RDXA 2JBHA 4IGFA 4N0MA 4C22A 2ZUCA 5J43A 1RWBA 4MGHA 4RULA 3KQQA 1QG4A 1Y3BE 5G0TA 4G5SA 1QQBA 3I37X 2XMRA 3EPPA 3IB3A 5EIOA 2FV8A 3VR4A 2VP5A 2X0RA 3H42B 3N0RA 3HJNA 1CK4A 4LNHA 2JD1A 1P1IA 3KV3O 4Z3OA 1V3VA 2RHGB 3LTEA 3X2SA 1PJ3A 5H3LA 2VZ9A 4F71A 3TTTA 4CN8A 5GZ3A 3OURA 4BNGA 3U39A 2PPLA 2ZUEA 1U31A 4XWTA 3URKA 2JIOA 2X5NA 2BLLA 3GNQA 1E2NA 3GW8A 4IMRA 2VBGA 1B41A 2XAUA 3CO0S 1L6RA 2WAXA 4QXMA 1QK3A 5JZSA 5F9MA 5FORA 1HE5A 5ITVA 1NDUA 3OCJA 4R8LA 3SR4A 1QF6A 4QREA 1EUZA 3NX4A 2OENG 3UHJA 4G07A 3AUAA 5G53C 2V1UA 1W46A 4DCSA 4CM8A 1A98A 2YIJA 1R9NA 3SBOA 5LKAA 2E85A 3HYCA 1AKQA 3CLSC 4RMJA 3T99A 3TYXA 1RFGE 3GX1A 2HY7A 1JGTA 2UUOA 2ZS8A 1E1RD 3BFJA 3H6KA 4UQOA 3WGMA 4BGVA 4PN3A 4CW7A 1M1NA 1X70A 1KRHA 2QGNA 1T24A 2E1RA 2UVDA 2D74A 1Q7GA 3GAAA 3WMRA 1W4LA 3RODA 3HMQA 3LXRA 4YJ3B 1NC1A 3IELA 2X0IA 3H2GA 4FK8A 2YW2A 4QLAA 4UU0A 3SY8A 1I7SB 1RXSA 1FMCA 1KIAA 5AM5A 1BE1A 1GTJ1 2A9RA 2G5PA 4YP7A 3USZA 5FWAA 3QHPA 3CRNA 3EVCA 2MCFA 5DIZA 2O3UA 3QFRA 2QENA 3NGMA 3NJ8A 3I9V1 5CT6A 4ZQEA 4B40A 4XWWA 4GMFA 3HDYA 1YZVA 4UVEA 4ZEVA 3K71B 3MTIA 3EF1A 4MI1A 3ED1A 5HF6A 4IIJF 5IRCD 1PLJA 1W52X 2FU5C 3OUUA 5DNEA 3JU3A 3PXGA 1Q44A 2C9OA 4V0ME 1FOEB 3HN7A 3CKYA 1VQ1A 3C15C 4RF2A 1RIIA 2QK4A 2P2ZA 2W4QA 4HAOA 3RUIA 2AVNA 4BNTA 2D54A 4J43A 1W5EA 3GRFA 2F8MA 3GA0A 1D4AA 3COZA 1XG5A 2O7QA 4LSZA 2ZS7A 2F1HA 4P83A 3ROQA 3SKXA 3I8XA 1HO3A 4V3BA 4RCZA 4EG3A 3MBKA 2NTVA 1NBMA 1F6DA 4DLLA 4K6HA 4DLVA 4HZUA 4ATNA 5F7XA 1S6YA 1UKCA 1WSDA 3L41A 1GPNA 5K8LA 2CCKA 4N8EA 2N75A 3V1MA 2BFCB 2W5UA 9MHTA 4QQKA 5DNYB 3QXGA 1CUUA 4H7PA 4C6RA 3CSUA 3OF5A 1NXSA 1W6UA 4RFLA 2FWBA 4EF4A 4XDYA 1L9KA 1NP7A 1VKNA 1DAGA 2PN1A 2ZYAA 1R6BX 5K7SA 1XTUA 4R01A 4HQOA 1TADA 3FMFA 2BBOA 1YT5A 3AGQA 1TUGA 1ZIYA 4Z9BA 3UAZA 1NXOA 5G3YA 1MN6A 1VL0A 3DMGA 3ML1A 3B1ZA 2HU2A 1Z4NA 2C2YA 1YZFA 3DZHA 5CTAA 1IXSB 2ZREA 4TYNA 1QHIA 1Y3FE 2IF2A 4G1MB 3EDQA 3KR1A 1JEQB 1IZ7A 2G4VA 2G72A 1ODLA 3H1GA 3DTVA 4H9GA 4HNRA 5CCDA 3RV4A 1N2JA 3JAWA 2WSBA 2C2KA 1QP7A 1T0JB 2DE0X 3NHFA 4QTUB 2WU3A 1VDMA 4DZRA 3MC1A 4OP3A 2I7DA 5HEKA 1ECCA 2ZQZA 3R4VA 5EWMA 4TKZA 4KFCA 4ZOLB 4KRYA 1I1HA 3H4MA 1JDBB 3DCYA 1YXMA 4MUGA 4QEDA 4A91A 1YHZA 1XZJA 2DCUA 2VH2A 2NUTB 4TRNA 1CB0A 1FNDA 4QJIA 1T36B 2CNDA 1R16A 2XT0A 3OU7A 2PX2A 4P4GA 4YQFA 4LY0A 1UPUA 3NOVA 3AF3A 3LY9A 4Z4QA 2H65A 2J0EA 1H8EA 3BWYA 1KAEA 1OT5A 4OKSA 4FDAA 1MJHA 5IF3A 3ST7A 3MRXA 3H9QA 5AJYA 4JB0A 5H9WA 5FUWA 3F6BX 5HG0A 3VU3A 3NWBA 3PQEA 3CCBA 5FBKA 2JBAB 1MC1A 2LCQA 4OTZA 4TV8F 2PEYA 2JK1A 5E8RA 4EECA 4MS1B 1VJGA 1W75A 4FYKA 1I32A 1KNXA 3S4YA 3VKWA 1BXGB 1XRJA 3PPXA 3VFDA 4P4SA 3O9ZA 1TCCA 4P31A 5FOTA 1X7WA 1UBEA 4I6JA 3L43A 4RU1A 4CLDA 1GKKA 1X9GA 2FPIB 2P35A 4M1QA 4XLLA 2PKRA 6PFKA 3RYFB 4F60A 4HLQB 1VCHA 1HC7A 1UC8A 1UBLS 3KZCA 1OWOA 3H86A 5FOWA 4B7AA 4LJRA 3IUYA 2XCLA 4MP6A 4MQMA 3OTIA 1BU5A 3V1KA 5FT9A 4JLNA 2FZEA 1NOJA 1CF4A 3EC7A 4E70A 2DECA 3U16A 1TF5A 1ZRNA 1PNTA 4N3NA 4S2UA 3UCFA 2X0EA 4FZ5A 2QL6A 3G1UA 3ZUPA 3FDJA 1G6OA 1T4CA 4A1FA 4LF4B 3N86A 1TYEB 4ZOBA 3KZMA 4FKBA 4L50A 2R6ZA 2ORVA 1IQ0A 2HX1A 4Y6QA 4BKPA 4ZZ1A 4RTRA 3R3YA 1KEUA 4X9XA 2FLVA 1F0KA 1G20E 2ATCA 2OV1A 2MSCB 2WAAA 1V5FA 3AT1A 2A5YB 4J0IA 3AJ9A 3CWCA 3I61A 1M34A 3DZGA 3K7EA 2I3DA 3QWAA 4EJSA 2QBYA 2H11A 3FHLA 4N8DA 4Q4JB 5F4ZA 1NN3A 4G4IA 4X7PA 4GXQA 1I13A 4YECA 2PGOA 2CV2A 1PI3A 3FM9A 4M99A 3IOCA 4OAPA 3W78A 3ZGYA 4D99A 2X19A 4HBZA 3URMA 2QLFA 1YONA 4INAA 3BE6A 4WIAA 1QAMA 2B8TA 5JWRA 3CZ5A 1KK3A 1XBTA 1P2UA 3EDYA 1AGNA 4Q34A 3IEUA 2XODA 1NFRA 1UEIA 2HEIA 1S2MA 2R44A 4KDRA 1UDXA 2Q8NA 2YICA 3KL4A 1D6JA 4R6XA 1IMJA 1HRDA 5KVVA 2HHJA 1PVDA 2FVYA 2Q6TA 1QGZA 1PR3A 3QPCA 4OGWA 5ILGA 3WNVA 3I2YX 3UK1A 2V7GA 3X1JA 4QE3A 2OG1A 1PSDA 2XQJA 5KNDD 3V00A 3HO1A 4BL5A 1LDMA 2O05A 1IPEA 4ZQCB 4G5HA 3QIAA 2FPGA 2EP8A 1C4KA 1ABEA 1RBYA 1WXHA 3QF4B 4LECA 4NBWA 1KIMA 1B3RA 1FDIA 3IQEA 3P0FA 4JU8A 1PX2A 4YDRA 4HS4A 4BV3A 4FGKA 5BMOA 1WUJS 3SZUA 1VIYA 3WFZA 2GBPA 3KAPA 3P9KA 1JALA 3GUYA 3CNBA 3DLHA 3JPYA 4EL5A 3FNFA 3OOJA 3PIIA 2VPTA 3VZSA 4HLUC 1I01A 4FFRA 4D4MA 1YQXA 5DNAA 4D4HA 3KSRA 2OGSA 3JQGB 2RBEA 4Z49A 3C6KA 1VPEA 2WBLC 4PX9A 2PXXA 4JLOA 4MQFA 2XDQB 3K0CC 1OBFO 3N2IA 3OEHA 4MUIA 1JBEA 2A67A 2OOKA 4J2HA 5D87A 5FFFA 3NRBA 3HM2A 3WBKA 2NTNA 2CNOA 4QPDA 3QEMA 5BSRA 2E49A 1KQNA 3WGIA 1FJGB 1MEOA 4ZFNA 1SWVA 3QVWA 3IUSA 2J3QA 1F17A 2HA4A 1BJTA 2XQGA 1O57A 5CYOA 2GN9A 1N0VC 1JTEA 2DFDA 4ROSA 4X95A 1ZD8A 4BFSA 4YXWA 4RVNA 2GHTA 3EIWA 2VOEA 2GVDC 4AMYA 3GLIA 4KXLA 1QH8B 2VK8A 2Z0MA 5C32A 4ZO8A 1YS9A 1K8XB 2OGZA 3JASB 2XRMA 2WHXA 2IY8A 4M0PA 4M55A 2WHQA 2AFHB 1WCIB 2KMLA 1N2CA 5LVAA 2JLUA 3M6MD 2PNFA 3TFOA 3DHVA 1KA9H 1B6TA 3B9BA 1S2DA 4QD3A 2WM8A 4O0LA 4F72A 2XYPA 2QRGA 4I4TA 4PEVA 2DFTA 4B31A 4COKA 4EJ2A 3SVLA 4EVQA 4DN6A 4RVUA 4AW9A 4HNGA 4FOSA 1DG1G 3HDGA 2ZVQX 3N6VA 3MT9A 4UD2A 2DPMA 3GBSA 4L6CA 5ESRA 1NRXA 4XAQA 1AKRA 3PEVA 5HKLA 4CF6A 3ZGLA 3PDJA 3BQMB 4WBNA 5C8VA 1WQ4A 2VRNA 2B3TA 3JD2A 3QVGA 2IS6A 3H8SA 2QPOA 2PZGA 3EGIA 2BFFA 3L7BA 5TV2A 4AM8A 2O7VA 1MO4A 3MCWA 1EVEA 3BMCB 4IEEA 3I9NA 4CETA 2VLIA 3IXMA 4U6QA 2J08A 1DAIA 5IAOA 3A04A 1G6HA 4LRQA 2BKEA 4ND8A 1NUTA 1ULZA 1XEFA 2O0HA 3GLRA 2HA0A 1EX6A 3LT4A 3CU5A 2NSLA 3FUWA 3HKEA 3BAFA 1ZESA 1AX9A 1SELA 2EW8A 4KLNA 3W6ZA 3PXEA 4DWVA 2I1QA 2IHZA 4HDNA 2O06A 4LOIA 3P5SA 1PS8A 1MRSA 1OZGA 2H2DA 2ZCUA 4RFSA 1HG0A 5FO1A 2HWKA 5GOTA 3WGJA 2IZOA 2XLCA 3MUNA 1JVBA 1XLTC 1AQ6A 1V26A 2RHDA 4V0RA 4UPVA 5LLSA 2B8NA 1P1CA 2AD5A 3JZAA 5DX0A 3V33A 2DKFA 2XUOA 1T2NA 4X1YA 2PJZA 5HKBA 1B7GO 2ZJ6A 4LHYA 1KH2A 6ADHA 4AUMA 3DEAA 3DFZA 3DW3X 1ZZEA 4N5MA 5F1KA 1ZD1A 3ICWA 4PLPA 4YI3A 3AYXB 3L0CA 3I76A 4XGQA 1G64A 5KI6A 3DSRA 1LJLA 4D3FA 2CZGA 3OPXA 3KSMA 1YBVA 1BN6A 5BQFA 3WRYA 1CVLA 1I7LA 1KS2A 1CUCA 3ZXSA 3AEXA 5LP6F 4FU0A 1KI1A 3G8AA 3NDPA 3NM5A 2E4WA 4AJKA 4FR5A 2Y1XA 2C4MA 4BNKA 1M74A 1Z83A 4YJ3F 3TJZA 1QRRA 1E1QD 3E1GA 3VMMA 4XYLA 4AWBA 4D96A 1PNQA 3WK5A 3VISA 1HNNA 4HGYA 3TRJA 5DNUA 4LX0A 1MORA 2QRQA 3FYSA 4OHOA 4MQUA 4DGSA 3ESCA 3RU9A 5AVUA 3DEHA 1TJ3A 1DTWA 2I62A 4HJXA 5GV8A 5HK9A 2YASA 2J5XA 3QJ5A 1EP2B 4RHUA 1TRKA 4RK0A 2BPOA 4WJKB 1W44A 1YUBA 3CPJB 2PUHA 3DBHA 2J5BA 3VPDA 3W3ZB 3KQKA 1Z9BA 3NP7A 1GSOA 4DNOA 3LSYA 4G25A 1NBEA 1HE3A 3DWIA 3YASA 3ELUA 4RZXA 4E88A 2JIBA 4NZPA 4QUHA 4LSGA 2HREA 1H2AS 3BUSA 5EIXA 3GBVA 2G9NA 4F4HA 1KY5A 2C20A 3BJZA 5FUXA 5KJEA 2O23A 3UMRA 1JHAA 1CP2A 3W8EA 3D4OA 3D54D 1JP7A 4OJNA 4YRFA 1XNGA 4PG6A 1G0NA 2PNJA 1TXGA 1Z7YA 1XTSA 2NU6B 4JXJA 1ML3A 1UDAA 3HJHA 2WUWE 4L9SA 1ODIA 4MVJP 3VTFA 4YMVA 3GZNA 1Y7LA 3T3EA 4RKFA 1S3IA 3RUHA 1JZQA 2AYZA 2UZIR 4II7A 4E1VA 5JYBA 2ZAYA 3AVPA 3LIPA 4MKGA 5DHRA 2E4YA 4X66B 2OK8A 1DX4A 3E48A 1AGRA 4BFYA 2JBWA 1HDYA 4HPJB 3S8MA 3QOFA 4DSAA 5TGTA 1PTJA 2GFHA 3T5BA 1E2JA 3VSEA 4B6JA 2BEWA 3ZWBA 2DFVA 3O83A 3FCOA 4JB3A 2V96A 1ZGCA 1RLOA 2XADA 5EWLA 3RRJA 2VP9A 1N2XA 4L07A 2QNRA 4UM8B 4BEWA 4YHBA 1DQRA 4LOKA 1T8SA 3GB9A 4QTXA 1I36A 4YI5A 5K0GA 5BVHA 1NUPA 1A50B 2XDAA 2ZUDA 5F7JA 1H94A 3UMSA 1TL7C 2GAFA 2OQ2A 2GDZA 4O1HA 5G0WA 4FIZA 5LQKA 2NO7A 3D59A 2Q2WA 1U1EA 2O0MA 2ZTUA 3GP5A 4HRXA 4MI3A 1ZM7A 5DSZA 3WGHA 4EI9A 4J29A 3RSGA 1H3FA 1PKXA 1QC5B 1ESZA 1B42A 4DBLE 1AKEA 1I94B 3ZNOA 1XMQB 4WFQA 4XYGA 1PV1A 1XQ6A 4ZOLF 2BMVA 1B00A 1KMQA 2XUQA 3B3JA 2EQBA 2GRAA 4GAEA 2C9DA 3TQHA 1IG0A 3L93A 1IQPA 4HTFA 5JIBA 5A6SB 4XIJA 2P6OA 1I1OA 2DQSA 3IJEB 2CXRA 3D1LA 4A92A 5JDCA 2YH2A 2JLRA 4FW9A 4Q7LA 5HKOA 1RPZA 1XJWA 4EEXA 2R0QC 2BCGY 4B2IA 4DIFA 5TS2A 4L7VA 2FPMA 2EIHA 5ER6A 1QYDA 1BG6A 1MAVA 2BGTA 1AZTA 4F4JA 2Y1GA 1YIOA 3AVYA 1GQYA 2P3QA 3I42A 1SCDA 1VE5A 3IA2A 3SJ7A 3WE7A 1P0IA 2J3HA 2XOEA 3CUWA 1JHQA 2IDKA 2V65A 1WKVA 5AKIA 1WF6A 3EW7A 4KX3A 5AQ1A 2XA2A 3PI6A 4U3JB 4YWJA 3SMVA 4RENA 1MUUA 5LUAA 2YDXA 3HK2A 2VP2A 4P33A 5TARA 5JLJA 3AHIA 3QITA 5TS3A 3KZKA 4CQMA 4YDHB 4URUR 2CHFA 5L9AA 2HBZA 3QTBA 3DQQA 4WT7A 4D8TA 4MDEA 1TA9A 3ZNPA 4ZKDA 1AE1A 4WCVA 5JZVA 5LMNB 4CCSA 4TXHA 4M1WA 2R8EA 3HRHA 4U8HA 3LUCA 3TAUA 1IB6A 3O1HB 1OU0A 3K9GA 1OWPA 4Q48A 5KWEA 3PXCX 2ZG6A 4V0OA 4O4HF 4Z4FA 5EXPA 4JMPA 1BQ3A 3D0OA 3ZXXA 3GEHA 3EGEA 1RAFA 4L4YA 3L1UA 3IMKA 3WNCA 4UTOA 4GWGA 3DB2A 3B51X 5C4IA 5LDDC 3IUBA 1P5FA 3QLJA 4UARA 4Q3KA 1TD1A 1ECGA 1DC7A 3M4YA 2ZJ0A 1YBHA 1E5TA 2GM3A 3E7PA 1PD1A 2EG5A 3NRJA 4ASUD 2JA2A 1C9EA 2ECOA 3EIFA 4N5LA 4OYRA 4QDZA 1AJEA 3STHA 1HT3A 4CEJA 3V4ZA 4R0MA 4IEFB 1MV8A 4X6YA 4CMJA 1NIJA 1VP9A 4R2HA 4BCCA 3IPXA 3LWZA 1XNJA 4GECA 2W6NA 2AFIA 2RFLA 3G8BA 1W48A 1DKUA 2XKBA 2GPTA 4DMLA 1T8YA 1KFBB 3K1JA 3JD4A 1WPQA 1EI9A 1KJ9A 3NTOA 2RG1A 5DI3A 4MIEA 2PZ8A 3PKJA 4L8GA 4P3PA 3LQQA 3ND5A 2BUAA 3S81A 1NKVA 4D4KA 3C0KA 4TQAA 5KKCA 2Z4TA 2E21A 2P8SA 3P4YA 4FVTA 5C5DA 3PGMA 1ARZA 1UBGA 2W0SA 4BMDA 2HW8A 1Y1KE 4QNMA 7MHTA 2LWIA 3VYTB 2PS1A 3CG0A 4AIIA 4YIKA 4K0KB 1R12A 3IVAA 4QOEA 4CLXA 3RTCA 3MNFA 2W42A 4JITA 1N57A 5T64A 3WRVA 1E9SA 2HAEA 1QGOA 4NHEA 1ZSNA 4HJRA 4HAYA 3EHDA 4H7IA 2E5FA 1OH6A 5KEIA 4F21A 4WVLA 1PQUA 2QKYA 1OZAA 3EIHA 1EHIA 3J7AC 1KBQA 3D64A 3L6UA 2PKCA 3E0XA 5K9ZA 2G28A 2C07A 1HH4A 1NXWA 3E3MA 2WJIA 2FQWA 3I5XA 2VAXA 3JQEA 3VYUB 1IUKA 5K4AA 5KJCA 1AGYA 4W7HA 4F8EA 1B26A 1WV1A 3G5UA 4U2EA 4O3MA 4TYQA 1U2TA 3I04A 3VHXB 2FA9A 4C0WA 4JYBA 1QRDA 1M2VB 1PW5A 3H65A 1WUTA 3RC3A 3IB6A 3D5TA 3Q98A 4HDKB 2HSDA 1GD1O 1WZEA 5KYXA 4XW2A 1I9GA 4PO1A 1W0JD 2XIJA 1RJDA 1E4EA 1ZIXA 1XELA 4D9NA 3FR8A 4TS4A 2E1PA 2P4HX 4HDOB 4KGDA 4CKBA 4PGMA 3LQFA 1BXRB 1G5TA 3I9JA 4IS2A 1F38A 2Q3MA 2ZIWB 4YGXB 3QA9A 2H2HA 4J9UE 2R1VB 2K2WA 3BXXA 3EVNA 3LP6A 3F2VA 4MWSA 2EEPA 2JAOA 2D1TA 1A72A 4OBWA 1I7PA 3RKRA 1I5RA 1IHYA 2DEUA 4KO8A 2DAPA 2V9PA 4HDSB 1ZBQA 2G0AA 1I5OA 1KQ3A 3R7BA 1P3DA 3FF4A 5AWFC 1KP2A 3E9CA 4BP8A 1GZUA 3JQAB 4EPXA 1I3OA 1GQSA 3ER9A 1QH9A 5BR1A 2OO3A 2J0QA 2R8RA 5FFMA 1MT0A 1Y1PA 3TZEA 4NFLA 2JFWA 1N34B 1VYTA 3G2OA 2EZ9A 2FX3A 2UVPB 1V6SA 2D5IA 3O92A 1DRUA 1L4LA 2ZYGA 1CVIA 1A8PA 1RJ9A 1I8TA 3N39C 3L84A 1OX4B 4ND2A 4OKNA 1R8JA 2CJWA 3SZOA 3RKUA 2XCSB 2BIFA 3GMSA 1REQB 4EYSA 2OO7A 2O59A 3JXEA 1RM5A 1TU4A 4B4WA 4C4TA 5K8JB 1YE8A 4IW3B 1X80B 4LV6A 1OHHD 3NONA 1SUSA 4FX5A 2EP7A 4KDFA 2I91A 4FYVA 2BFPA 3H8VA 2QUIA 4PS1A 1YRHA 4ZXFA 5JD6A 1NJGA 5HDQA 4BB6A 1G6Q1 5BN5A 4IDHA 2W2OA 3QPBA 1AUPA 4C88A 4KV7A 1A5TA 2DHEA 5DRTA 2N46A 1JDUA 3FYUB 4I7EA 4KVZA 4P5EA 2O8CB 2B2NA 1C0LA 2NNWB 1P4JA 3NHPA 4Y7DA 5AW3A 1RRVA 1USKA 3KU4A 3IHLA 2PRYA 4CPDA 1O5TA 2B7LA 1Y6GA 1KI4A 2X3FA 1G8JA 1ISPA 3OKCA 2XRZA 3BICA 5EKSA 3GRAA 1NF9A 1Y1QA 2FN8A 2GF0A 1NVVR 2ZJOA 4HKTA 4XKJA 3DV2A 2X23A 4ZDIA 2BE7A 3TFWA 1YVDA 5E3JA 2G9VA 2XCQA 3ESRA 4FEAA 4PZUA 4DNQA 1RZRD 4EOGA 1ZGHA 4L4ZA 1U0GA 1MJ5A 3I4LA 3EZGA 3GVPA 4FOTA 4QUEA 3RC2A 2FZ4A 2W6QA 4R2WA 4KG7A 2D5LA 3G2NA 3I2IA 3VVBA 4D0GA 1QKIA 3HJCA 3T9BA 1Z6TA 1ZINA 3ER6A 3MWEB 4D0NA 1H6CA 4GNRA 1R8SA 4FONA 4QUDA 2NG1A 4JKYA 1WSBA 4XTRA 3VR6A 1ZXLA 3LKDA 1G5RA 1G21B 2ZJYA 2AQIA 1XTPA 1IOLA 2PQ2A 4BO3A 1Q16A 1Q20A 3MJDA 2OFFA 4KE6A 1IM8A 2DWQA 1L1EA 3THOA 4D4GA 2JFGA 2R00C 1G7SA 1KBZA 1YVUA 4AMGA 2YY7A 3RE1A 3EG9A 1YDWA 3NDIA 3SJAA 4AYXA 5ALXA 4C1BA 1ZUNB 1L4HA 2PA3A 3DVLA 2C59A 4C0HA 2QTBA 5K6AC 4LC1A 1BS2A 3WJ1A 3LT2A 3SQXA 4BVGA 4M7PA 2ZWOA 4OHBA 1XCMA 4JQSA 4NV0A 3DKKA 2ONJA 4V0NA 2PU5A 3GOHA 3TLXA 4CKYA 4CMCA 5L40A 1CSEE 1EJBA 5IK2D 1TAGA 1XVUA 1E6WA 1P29A 2DCMA 4UHEA 4X5OA 5AW9A 1BVUA 3CV3A 3QWBA 3WBFA 2HKIA 5HQ3A 1MZPA 4BLTA 3QMMA 5KX5A 3NTUA 1CERA 4UDOA 5FFNA 4GOJA 3KSUA 4IJQA 3A1FA 4QQ8A 5SZHB 2WWTA 1TQ8A 2XVXA 3HWSA 2IEYA 3PBKA 1R0XA 4MRRA 3W5JA 2VSNA 4CODB 5TQJA 3K0EA 4EPYA 4R3WA 3ZZTA 1IN6A 3HEBA 1WXXA 3C7AA 5D51S 4J7CA 4DCTA 1XZDA 4F1WA 4R1TA 3BXOA 5CMLA 5KUTA 1GZ3A 1MHPA 4CEHB 5EXEA 2XF2A 1E2UA 3HZOA 3C39A 4UNIA 5FPYA 1MQAA 3TQQA 1NVTA 1HYBA 2GB4A 2GFIA 3HY4A 3OESA 4PVCA 1G8YA 1N9KA 3GQBB 3NP9A 4FD2A 3AJAA 1WZIA 3QG1A 1M6VB 2O3SA 4EG0A 3TGLA 2JASA 3T7EA 3UTCA 3STUA 5KNBD 1ZA2A 2PSSA 4LOHA 1PDWA 1NPDA 1IH8A 4AKHA 3B36A 2Y0CA 2YMQA 4XB2A 1KK1A 5JJ5A 2H0QA 2IHTA 1YQQA 1B73A 4HGQA 2PEZA 1DZIA 2SCUB 4FYWA 1R9MA 1J0AA 3ZJVA 4V39A 1JMYA 1XMPA 3U37A 2VDWB 3K6RA 1IYZA 2Y77A 2HWXA 2ZT7A 4P3YA 2B8WA 4HRVA 1B0AA 2P1ZA 1KRXA 3TLAA 3ILSA 3O21A 3T34A 4RUKA 2WTUA 2X9LA 1SXJC 2ZI3A 1YZNA 4UVGA 1U0HC 5KTMA 1Q7RA 4Q6WA 4C29A 1ZMBA 4UXHA 1XRMA 1U8AA 3KOUA 3FKJA 3TZHA 2CMFA 3F1KA 3W7VA 4C6TB 1KJQA 1GXSA 1L7PA 3EISA 1JZTA 3LBFA 2QZJA 4LV8B 4QXRA 5F2OA 5C5IA 1MC8A 1ONOA 4HYYA 4JQYA 3DEJA 1SQGA 3EVAA 3QMPA 4OB6A 5LYYA 3UJ8A 1N6PA 4BX9A 4NE2A 3CR7A 1IE3A 3BJIC 1CRQA 3DZ8A 4TV9B 5DJ5A 4EWLA 5C7IO 1FU4A 4RMNA 3OTOB 1OB5A 3PWTA 4H3SA 5JXWA 1T9KA 4M9QA 1BW9B 2R62A 3U4MA 3D0RA 4Q0MA 4RTJA 2SICE 1KQOA 5B7GA 4CF3A 4E14A 1NVKA 5JJBA 1VL2A 4IHAA 4LXHA 4IVRA 1YFZA 4J94A 4RGQA 1ZHOA 1USWA 4IIJA 1LI4A 4RSRA 4WLFA 5B1SA 3WS7A 3U49A 2D2FA 2IDJA 6REQA 3AM5A 2XOXA 3KJZA 5K8TA 2OM2A 1HE2A 1V7ZA 3C74A 3IO3A 4W4TA 4LIPD 3RSOA 3MYRA 5HCUA 4MW2A 1O08A 1TM7E 2EGHA 3IS3A 1MPTA 1BHSA 5J4YA 1F6BA 3VMFA 1TA4A 1P9WA 3HCFA 3AHDA 4K8OA 3D7RA 1SFRA 2WPDA 1T8WA 2OCKA 5DCLA 4EDHA 1FJXA 4QLBA 2O2JA 3O3CA 3WJAA 1KGSA 4QBGB 4Q9NA 5EMJA 1N3BA 3PNBA 4S24A 4QPCA 1ZOSA 2OB2A 3JQBC 5AJHA 3RVNA 3HABA 3OQIA 3WYNA 5KNLA 1U04A 4ZZ2A 4EA7A 1X94A 5CA1B 5SZIA 3MW8A 1DB3A 1B6RA 3K6SB 3T1TA 2WWVD 1J09A 2WI8A 1JQKA 4F7DA 3SG0A 3UT0A 3WZMA 3DG9A 3G85A 4E2XA 3W5CA 1PD0A 3M4ZA 1U3VA 4HP8A 4PCVA 2HWWA 4KSCA 4ZV7A 3GJ0A 3KXDA 5ESDA 4C5BA 3FOFC 2DUUA 4BJ6A 2MOKA 4GF5A 5IHXA 3DOJA 4YP9A 1T9DA 4I36A 2BI4A 3COSA 3ZYZA 3K9HA 3ZW9A 5IWCA 2RK6A 2ZJZA 3BSFA 3IT3A 4E4YA 2FY8A 1CS0B 4IS3A 5FL7A 1CQIA 2XZTA 2IK8A 1ORWA 5I47A 2PS3A 4D46A 4Q9KA 5LC1A 2ONKA 2VJPA 3GV0A 4UUQA 4P82A 5FBRB 3U9TA 3UA3A 4EX7A 4P4LA 5BMVB 3TSYA 2WUDA 2E4UA 4BMZA 1GPUA 2DPLA 3TMKA 4X65B 1EG7A 3SYTA 4DSNA 1H2EA 2FW6A 3D6HA 2JIZD 1TTPB 2Z1NA 4TWBA 4BIMA 3U3ZA 1BD3A 2DHDA 3EGDB 4EW1A 4GR5A 2VK4A 1LA2A 1OAOA 1QV9A 2FQQA 5TXGA 3ZVNA 1KQFA 2IV7A 2C29D 2JFYA 3M4NA 2W2XA 4RCVA 2ZRLA 2HYDA 1Z6PA 1BNCA 2ZU6A 3EZLA 3G1WA 4K40A 4N7RA 4NDNE 3QE9Y 1LFAA 4CM4B 1W7AA 2P9CA 4JVSB 2QJFA 3HB4X 4B6PA 3PC4A 3LUKA 1W2WB 4CLOB 2FPLA 1V96A 3JYOA 4IXWA 4EFMA 1M67A 5AQEA 4DG9A 1Y4SA 3KRTA 1AT1A 5DM1A 4PG7A 3MN1A 1NSFA 1AB5A 1ZITA 3DVAA 4TV8A 2JK0A 5B1EA 5DEOA 5F9HA 3D3EA 1RWMA 5BUQA 2E55A 2NU7A 3W4KA 3LA6A 1Z82A 2C42A 2P6PA 2VBFA 3L2OB 2QD2A 4BBJA 1QO0D 2O2CA 3CNEA 3MS7A 3SJBA 2CXSA 3NIWA