2L82A

Solution nmr structure of de novo designed protein, p-loop ntpase fold, northeast structural genomics consortium target or32
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
162
structure length
162
Chain Sequence
MSQIFVVFSSDPEILKEIVREIKRQGVRVVLLYSDQDEKRRRERLEEFEKQGVDVRTVEDKEDFRENIREIWERYPQLDVVVIVTTDDKEWIKDFIEEAKERGVEVFVVYNNKDDDRRKEAQQEFRSDGVDVRTVSDKEELIEQVRRFVRKVGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESIGNED PROTEIN OR32
publication title Northeast Structural Genomics Consortium Target OR32
rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 66
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2010-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2l82A00
2N75A 2LNDA 2LTAA 2N3ZA 2L69A 2LCIA 2LR0A 4J29A 2L82A 2KPOA 2MR6A 2MR5A 2LRHA 5GAJA 2LV8A 2LVBA
chains in the Genus database with same CATH superfamily
3D2LA 5J4LA 5AUOB 1M67A 1BXGA 4ZYWA 5AW8A 2J33A 5EJ9A 2GVZC 2WWTA 2AOUA 2I6XA 4YRTA 1D1QA 3BQMB 2AV6A 2X1MA 1NA5A 1TRHA 4FZVA 1GG2A 1WXHA 2EEPA 4W5OA 4YCNA 5AKJA 2G1PA 3TUJC 4JI5B 4JVLA 2F3PA 2PKEA 3QHQA 1W85A 4Q4HB 1Z4QA 2H0RA 4BU0A 4FSXA 4F56A 1ZMTA 1AM4D 4DQLA 3AHHA 3HYNA 2ZYIA 1T5OA 5LLTA 1TF2A 3PL1A 4BP1A 3DE7X 3N07A 2DF8A 4PYQA 4RJTA 3HM9A 3GLGE 3U3OA 5ICMA 3PB3A 3W05A 4HB0A 4A73A 5JSYA 3H04A 4WGFA 5HGJA 3FGOA 1XFAA 5IPFA 2Q6KA 4DB4A 4OQYA 1OXUA 3INYA 3MN1A 2BEVB 1E2BA 1A9SA 4H3KB 3WGTA 1CSEE 2YXPX 1PFKA 4L85A 2CF5A 4TWIA 5B58C 5TF0A 2YASA 3GU3A 5KTRA 1YVRA 3GEEA 1RAIA 4H35A 1HKUA 1J00A 1ID1A 1QB8A 2GBGA 4R1PA 4B3MB 3B1JA 1RLMA 1ZM4A 3TM4A 3FMPB 4DIOA 3WNQA 2C1EA 2JIDA 4RDCA 1T8SA 1T4MA 5D01A 1A7JA 3OM0A 4ZT3A 1OFTA 2CBZA 3PEFA 4M1WA 3AUAA 3D4NA 3R40A 3W5CA 3HEAA 4MWCA 4WK4B 1DG1G 1E7YA 4Z9YA 2WE7A 1RZ3A 3I2JA 3U3XA 4BX3A 1Z6ZA 1EZZA 4TROA 5JI2E 3KTDA 4IOKA 3MOGA 5CIWA 3FSGD 3TQIA 2H2AA 2D5BA 1W47A 4ALJA 5IF3A 2C7PA 2NYUA 3WISA 3KOUA 2R7AA 2CZQA 3RHTA 1AK1A 1SULA 1JAZA 4HDNB 2J8ZA 4P08A 3WLHA 3SJUA 2QP9X 4K9LA 3DHNA 2XZTA 4LW8A 3KR1A 5F4ZA 3KAJA 3DFZA 3RRMA 3NHYA 4M9RA 3QU4A 4Q9NA 3QKRB 3SX0A 1AA6A 1R4AA 2ONYA 2YWGA 3X3HA 2AF4C 4WVFA 1BHO1 2CVFA 1GNTA 3EZ7A 2I76A 3OP1A 5JAHA 3QXJA 3AFHA 3U5TA 2BMJA 1QIEA 4JJ4A 4U0KA 4CHTA 2FFQA 3KQUA 1E99A 5F3RA 3UBMA 5L7YA 2IIBA 2C58A 3AEQA 2C7GA 2ZJ1A 1D1SA 2FP4A 3OQ6A 1BA2A 5LOVA 3NTRA 1XK7A 1ANKA 3SQXA 1BFUA 4P4NA 1EWTA 1MV8A 4U7TB 5CBPB 4JI7B 2W2XA 1QOZA 2E5FA 3KO8A 4FOSA 1FXWF 2YV5A 1QDEA 3CX6A 1Z2DA 1LX7A 4ONEA 5ENVA 3KKEA 4HP8A 4S24A 3SXJA 4UNNA 2GYUA 4Y2TA 2RK6A 2AG0A 4ZT7A 1UDXA 3RADC 5AI9A 4RZQA 3TF5A 2IUUA 4EX7A 1AGNA 3BL5A 3LC2O 2Z1MA 3DP9A 1JS1X 1THMA 1ZWKA 3ISVA 2QN9A 4G56A 4IHJA 4KIFA 1E0SA 1SKYB 2F3UA 1QWSA 3P9RA 2J6HA 3AF5A 1SJ9A 3ITDA 4MZDA 2OYCA 4MYDA 1GN9A 1VE7A 2WJPA 3M6FA 4U6SA 2FW7A 4YI3A 2AXNA 2J5RA 4CFYA 5E0OA 3LUGA 4P7BA 1KI2A 5EXSA 5AJWA 4UEWA 1OLXA 3CW2A 4NDAA 4B79A 3SIXA 2WYUA 1CTQA 3I32A 1ONNA 1GZ7A 3EVEA 3UK0A 2YJ6A 2C82A 3MELA 4GLLA 1Q7RA 5K0NA 1P7YA 4I50F 3ZHQA 1Z2PX 5E6UB 4D82A 3AYZB 4ETWA 4OGFA 4XVQA 1WCIA 2ZT6A 3EXFA 3I92A 4U2DA 1V16B 4IDNA 4GZLA 1EVZA 2W6JA 1BRTA 1RJDA 4OHWA 4AM8A 2JARA 3E9ZA 3QPBA 4K88A 4XYLA 4ZCIA 1U3GA 3KBOA 2EATA 3M8KA 1G7RA 3DONA 1NMXA 1R4NA 3FGPA 3HLYA 3KEGA 1G3MA 3NWEA 2JI7A 4TGLA 2ZT5A 3KDPA 4MVJH 1EP2B 1U7OA 3P7MA 2AUTA 5JZ9A 4KUEA 1PUJA 3BG5A 4JP8A 1JYEA 2Q1XA 5D6OA 1H0KA 3WJ7A 3VUEA 3QY9A 1E63A 4NCIA 4O2AF 2QVZX 2QTMA 4L0QA 4ZOEA 1HLFA 2HRQA 2IHTA 5CH8A 3HP7A 4RVOA 5LNK1 5DI3B 4LHSA 2BR4A 3O0TA 4LXQA 3MK31 3FOWA 3BMOB 1CY8A 2RGXA 4IEFB 3NBUA 3FRIA 2PIAA 3RS9A 5CGZA 3GJXC 3RK4A 1KEWA 1POXA 4KWCA 1UEJA 4FJ0A 4JP5A 5DCUA 3P94A 3W9BA 3H2JA 1A8PA 3DNPA 2G07A 3OZDA 4U8GA 3ZKAA 1HO3A 4PHFA 3AXSA 4A2QA 1JQ5A 1ZIPA 3CWZA 4O4JA 3IDFA 5DM0A 2OVBA 3U7IA 5ITWA 1N25A 1JPNA 2JLAA 2X6RA 3TGLA 1PG5A 2I6UA 2XX3A 3GLGB 2B4TO 4J1TC 1E1NA 1M7GA 2VQSA 2IIQA 3H9CA 2JFXA 3OFJA 4NJMB 3X0DA 2KB0A 4H3VA 3VAZA 3VR5H 3E0XA 3RTGA 5IJ9B 4TLCA 5ALYA 4TYYA 1KZ6A 1XMXA 4LZOA 3F4LA 3U4IA 5E1BA 4NPHA 2FDXA 2RJOA 1EGMB 2OCYC 2Z9DA 2ZR9A 4IQGA 4H3HB 4EW3A 1BJKA 1LJ8A 1NVXQ 3A9WA 3AJ9A 5KX5A 3BWEA 4COOA 2O2HA 1A5AB 2YRXA 1I14A 4L5BA 3WB1A 4B7UA 2R60A 3ASYA 3NTLA 3ER8A 1RI3A 5F78A 1ZUNA 1DQZA 1A8QA 5CB4A 4JYMA 3FFAA 2JATA 1II8A 4V0NA 1X8LA 4UMVA 5FPSA 2H57A 4CU5A 1PKEA 2JLBA 3BL8A 1I10A 4K8OA 3PUYA 3LOUA 1HFJA 5CA1B 4GO1A 5L3VA 1ORVA 1A8SA 1YV9A 3KAQA 3QQPA 4YLYA 2M6RA 1H5QA 2G3YA 2R65A 2VBFA 4XB1A 3L7IA 3G13A 4G0NA 4G65A 3T7CA 4DLLA 4K9NA 1SBYA 1HSZA 4G4JA 4YDRA 4MZXA 4RSHA 1Y98A 4OSEA 4H16A 10MHA 1NBIA 1EX9A 4HPJB 2G5TA 1HTBA 3V55A 1S2DA 2X9QA 2X8LA 3A6KA 4PAGA 5EJ8A 4O5AA 3JVVA 5D00A 3I6IA 3KXKA 2OK7A 2GBLC 4MQLA 4BYGA 3O8CA 2DWOA 1CB0A 3GOQA 1WMSA 3VTAA 2EX0A 1PL6A 1P73A 1WKBA 2OO7A 2BV3A 2WOJA 1NRJB 3Q0IA 2VA8A 1IM2A 4RTOA 4RMIA 5K0TA 5C3UA 2FNAA 1WUTA 1GZSA 1GKUB 2JNWA 1NU6A 3PI7A 1AURA 3FB1A 4MS1A 4OXQA 1PS0A 3G3EA 2FZ4A 3RVKA 3WGOA 1O0BA 4MW0A 2PUFA 1GLGA 2CKDA 4KNWA 4TTSA 5KREA 2BTQB 1EFPB 5ALFA 2XVYA 2G0AA 2OHHA 4H6VA 2Q49A 3FUWA 4D4GA 4BNHA 2D1SA 1FYVA 4MV1A 2HL6A 4QJIA 2AR9A 2C4TA 4H59A 4QOEA 4AS3A 4EGJA 4LV6A 4X93A 3IHTA 2R8RA 1J21A 1TQHA 1EE9A 3DOUA 1OVGA 3CUWA 3L82B 4O2RA 5EPUA 1HDOA 1W36B 2VYCA 5TC4A 1P1JA 1PZFA 1YCHA 3LPAA 1XXHE 3T1QA 4PRLA 2NXEA 2OD2A 1D04A 3JXEA 1SVNA 4BJ6A 1L5KA 2D13A 1IWOA 2IKQA 2GPSA 3LM8A 2IPNA 4K9DA 4MYHA 1SQGA 2X0NA 2X6TA 2ZS8A 4Y2VA 5EIBC 1IY9A 4IIJA 4WXRA 3PE3A 1YDMA 5FEMA 3CB4A 1BYUA 2QTZA 1SXJC 1JA0A 3FKSD 1G4UR 1WX1A 3CEMA 4GM1A 4DRXA 5L9AA 2C3UA 3GGDA 4S3MA 3ZGZA 3V2HA 5HM8A 1A96A 1GL7A 2HBRA 2RFLA 4P4TA 3LOPA 4BOYA 8GPBA 3ZCUA 1OX5A 3T61A 3HG7A 4R1LA 5CYPA 3TLMA 4DHEA 3NBMA 4DLWA 4CIAA 4S2UA 2IYXA 3UJ7A 1MX5A 1H2AS 1GGVA 3C1OA 4YRBA 1R8YA 4RTLA 2E6KA 4RQTA 1LDMA 2JGIA 2QTRA 5IARA 1G98A 4EUKA 1JHZA 5A4MS 2GPNA 3LX4A 3OTGA 5K3FA 3G5LA 5C1IA 4EA9A 2Z2IA 1J0CA 1FX1A 5AJYA 4HOYA 1NVEA 4K81B 4P8RA 3X1WA 2EFHB 4BRSA 2QENA 3SZUA 4ZDWA 1FYXA 1C7FA 3A6LA 3IC5A 3USES 1OV6A 2Y8EA 2RI1A 5JAIA 5DULA 1F2TA 1BVUA 4LQDA 2I9PA 4GW3A 5IS2A 2W98A 3PXDA 1QUEA 1ZU5A 3COZA 4GSYA 4GQAA 2XD4A 3LCCA 3Q5GA 2CMGA 2Q1WA 2R7LA 3ZE9A 3SLRA 1SWVA 4P31A 3KKPA 3ZBUA 3QELA 1ZS9A 4FT4A 3I0NA 4HAOA 2JAQA 3O74A 3VGJA 2HT1A 3M5PA 2G71A 3ETDA 1I32A 3HJRA 4WZBA 1SXHA 3K30A 3CLKA 3OJEA 4U4AA 2NVBA 3QI2A 2QUAA 2IX3A 3UJBA 2IQ5A 2ATCA 1XPUA 1G2QA 1P4GA 2MSLA 4TTTS 1GD1O 4P81A 2ZI4A 4MS4B 2A5GA 2ZSIA 3AGPA 1D8AA 2E21A 2XLBA 2YICA 4GOMD 3WGYA 4XYMA 6REQB 3JQ9A 3WJ2A 4LWOA 5LJLA 2FEPA 4EPTA 2WU4A 4WXPA 2ZETA 5CXUA 3IUJA 4R8LA 2HA6A 2VSQA 3OQIB 1Y5NA 4IGIA 3EGOA 2UZ0A 4N49A 2QAIA 1MCZA 5FUWA 4DIMA 3F4KA 3L5OA 1U63A 3UUEA 2DR3A 4LJAA 1OFHA 3CCCA 5IUJC 1KA9H 4NCHA 2PMDA 3FMFA 2PUAA 5DRYA 1Y1RA 3G23A 5GZ1A 2FH5B 1AQUA 2ZRMA 3ZGOA 3MAAC 1FFCA 4MRMB 4UHFA 1QK4A 5K3BA 4DJFC 3TB6A 2GK6A 4E13A 4EW2A 3F1KA 2R8ZA 1SVLA 1OI4A 1V2GA 3CZRA 2V7VA 2HA5A 3PSHA 4A6PA 3BHJA 4YP7A 5ADHA 2W2NA 1DAHA 4HYQA 3RYIB 5AUNB 4PZEA 4UHEA 4DSAA 3ROPA 3WIVA 4L02A 2XEXA 3ESDA 1EG2A 4Y2UA 1U7HA 4XSHA 3VQTA 3VJLA 2CDCA 1N33B 2BBTA 3V3KA 2LGJA 3X1JA 1P1KA 1IN5A 3D6TB 1H23A 1EVEA 2NU6A 4Y2GA 4M7WA 1OREA 3CIOA 2H08A 3CZPA 3QX9A 4YJFB 4M1SA 4A92A 1O9HA 2OHOA 3I72A 1AUVA 5EEHA 3UBTA 3L7LA 4K6HA 3V1TC 1BS2A 3OQBA 3RJMA 2EW1A 3JQ8B 3EGXA 1YZKA 1AQJA 1RQRA 5ELLA 2LR0A 1IEWA 3CRQA 4AB1A 4YONB 3OESA 2JS7A 4YP5A 3KX2A 1JEQB 2OB2A 3T12A 4JITA 5JQGF 2X4DA 3DQPA 3GFGA 2ZXUA 5LD2C 1HSOA 2R3SA 3ZKWB 3WFZA 4LXIA 4IFTA 2QI9F 4NOKA 3KPYA 4Z0NA 3JAMA 1QLHA 4DYDA 5CFQA 1RE0A 3ASZA 1NRXA 1GKKA 3MLAA 2BOVA 4Z8YA 5H81A 4E2XA 4X71A 1XXHB 1ZQ1A 5CDFE 4NZPA 3GLFA 2I1WA 2WHPB 5GM1A 4OX9Y 2PCLA 2OCIA 3PFHA 3PKZA 3G17A 4QEDA 4KL8S 2CE7A 5KVSA 2ACVA 4E2ZA 2OZKA 4X00A 3PKJA 4W5QA 1PWYE 3HU1A 2APJA 4MGEA 4X63A 3ZDBA 2WI8A 1EVQA 4ZVQA 3QYAA 2IFTA 5AM3A 4KKXB 3IQWA 5FCDA 1MO3A 4P5DA 4TZ6A 2X19A 2JCSA 3IMEA 3VU1A 2IP1A 4M8KA 4TRRA 4IFBA 3JCZA 3WTCA 1Q2XA 1OBFO 5HFNA 1VLLA 3JYLA 2BGJA 1KS9A 3CRZA 3G2KA 1DRVA 3QF4A 4GX5A 4X20B 4XD2A 2OP0A 2XF8A 2NZWA 5BQ3A 4HEHA 4LFCB 3NDBB 4A2PA 1NUAA 2AN4A 5IH3A 5ILGA 1J23A 1U7WA 2HLDA 3EXG2 5U9CA 2D5IA 1H1LB 1DTEA 5DLDA 1UKZA 1N77A 1BMDA 1DKRA 2UZ3A 3NALA 3WK4A 3U7EB 1KYQA 1I2DA 3B1WA 4RK0A 4RL6A 4TXLA 4EG6A 4QYIA 4XD7D 4EG5A 4Q24A 1N5JA 2Q5IA 3SQOA 2QDKA 2X5XA 2ZRQA 4J76A 5CT9A 1RR6A 4M4SA 3K94A 2CCKA 3FWKA 3OU7A 1QG0A 1UPCA 3A4IA 2ZUEA 4W5WA 1R0RE 3GELA 1SHJA 1HMYA 3C5WP 1XTBA 1W1WA 2WSIA 4M98A 3BQ9A 5LQSA 1COWA 4DJJA 4GBJA 4YMHA 4X44A 5GTDA 1DAEA 3GHYA 3KTFA 4GICA 2CXNA 4XKJA 2OB1A 4MA0A 3H9BA 4QUGA 4UNQA 5J40A 3FPJA 3OOJA 1JEAA 1X80A 2O57A 4MPJA 1YJ8A 3JQFA 4KSBA 4RVNA 5FBZA 3RBZA 2G0TA 1DTWB 5D6NA 1SH7A 2CNDA 2DULA 2HCJB 1E92A 3ASVA 3G2QA 4JQCA 4D4HA 1TFUA 5M5BA 3NORA 5A0VA 1ZVQA 4PXYA 5KSWB 3Q1KA 5B6JA 1E79A 4JLWA 4UQOA 1AKUA 2I54A 4CNBA 1MAUA 4AN0A 4QFDA 4QO7A 2WFMA 3GFSA 3N3BC 5IXSA 2OC4A 1SVOA 3Q10A 1WDTA 3RU7A 5DWQA 3DCYA 4ITVA 3E9EA 4KLZA 5CYGA 3LT5A 4AJNA 3GNSA 4AQDA 2GYYA 3EC1A 3PSAA 2M1ZA 4MVJI 4XIYA 4HWPA 2YS6A 2R48A 3OU2A 2A5LA 2V7XA 3GUHA 1GUFA 2GPJA 5IDQA 2DXIA 1CJCA 5KC9A 2XKBA 3UVEA 5BSHA 2X9NA 1P6XA 2W58A 3DA8A 3C2QA 2NACA 3OTQA 2YCBA 4YRJA 5REQA 1IIBA 5FLEX 3TCKA 3UANA 4TLBA 5EIXA 2QIOA 4MV5A 1P5HA 2FWJA 3BDIA 1E9AA 4FIDA 5D1NA 5JNUA 2AN3A 1WPRA 3R7BA 2QD3A 2BFMA 1XF1A 1JVBA 2WWIA 2PBZA 3BRWD 3HMKA 4BGVA 2EJVA 1D3AA 1A0OA 2J4FA 4CL2A 4F71A 2VP0A 3G2NA 4P6VF 4RJKA 1UAAA 4GM4A 3BN3A 1M75A 3F78A 4UFOA 4ZYVA 2PU5A 3WYNA 3AKEA 1RTTA 2EDAA 4C9BA 4FZJA 2BFDA 3RPEA 1XCBA 2PMBA 3WS7A 4CLEA 4F06A 3K4QA 3RFCA 4GPEA 4R41A 1PG2A 2QW8A 5B4VA 2V8BA 2UDPA 2Z3ZA 4E11A 4K7JA 3NP7A 3GW8A 2FJ0A 5ECWA 3RUDA 2D2IA 1OC2A 2EU8A 2Q4BA 1OXXK 2WYWA 1HDEA 1ZISA 3C8MA 4KO8A 3IA7A 1TKRA 4W8HA 3W3AD 4ZYXA 4AI6A 1Y6JA 4ZIRB 3JYNA 4JVMA 1KAMA 1UJBA 2ZZKA 2J0UA 2CXUA 2BFWA 1IRXA 4OI4A 1SHZA 4H7HA 5KJEA 4KPUB 3EJ6A 1QHNA 1UKBA 3PHBE 4BHTA 4RKRA 1S8FA 4ZHSA 4PXSA 4P1ZA 4R81A 1ENPA 2Z4SA 3ZHZA 5KYWB 3TUIC 1FJ2A 2JDIA 3LD9A 1TKBA 4IBOA 1QLJA 1MHPA 1PQUA 3AZPA 3L1HA 5E9AA 5A7FA 2RBGA 4AG6A 1QE5A 2W90A 4BMSA 2V5UA 3AKDA 4RVFA 2YRWA 1D0IA 4RIHA 1X7WA 3H0KA 3TW4A 5CFPA 1AQYA 3ZCQA 1DJOA 2ZATA 3COSA 3O31A 3QV1A 4CMBA 2JBAA 1KI8A 3GO4A 4QU8A 4XSGA 2V58A 4RYLA 4B81A 13PKA 4JUCA 4FM9A 1RZRA 2UYQA 3QPUA 1KP3A 4H0CA 1O4WA 1OMOA 1H2ZA 1HTTA 4UASA 3SPXA 3SOPA 1CERA 4JXJA 3K0BA 4DLVA 4E4YA 2ES4A 3NRCA 3INRA 4Y2XA 3ZU2A 4D4KA 5HQ3A 3L7NA 2G0NA 4UU7A 1TB4A 4GC9A 2IEGA 4B6QA 2WE8A 2YFHA 1GLNA 1XR3A 1JJVA 1NQOA 1UT8A 3AX6A 2RB5A 4F4FA 3HO8A 2D8MA 2AQ8A 4DYVA 2EKDA 1K0UA 1HBJA 1QUFA 2RGNA 2REBA 3F3KA 3WV4A 2J3KA 2NSLA 2DFKB 2Q8PA 2WTBA 4S0ZA 2Z2XA 4ER0A 1FYDA 3QLJA 4JFAA 2DHCA 1L8LA 2HK8A 2P7HA 4K6KA 4M7PA 2PBFA 1YJBA 4EHAA 1G5IA 1U04A 3UCEA 3X1XA 3IT3A 1H2BA 1V25A 3IE0A 3ZE1B 2Y1KA 2QXTA 4PM4A 5DEIA 4N1AA 2JLRA 3BBLA 2H9AA 3K1AA 3BHMA 4BKRA 1PVVA 1TU4A 3FPEA 4CLRA 2V7WA 3FD8A 3IKVA 5EIAA 4E46A 1TQ2A 4MKHA 3ZGNA 4G89A 4BN4A 1EUDB 2JVKA 4MULA 1PR6A 1QJCA 3TRKA 3OZRA 3C24A 4GLOA 2PLAA 3EIHA 2HC9A 2Z4RA 4YCAA 5DWVA 4JJAA 1E1QD 2B35A 2B4YA 2FUCA 2J3HA 3ISJA 4NZ9A 4JENA 4Y18A 2A2ZA 1L5QA 3SSAA 3U61B 1FSSA 3SMVA 3KZNA 2XB9A 4U3JA 1P7WA 2EGUA 4ZZIA 1H1TA 2BLLA 4I8IA 5K8CA 2W2MA 4X3OA 3RVLA 1QYVA 2CJWB 4HVLA 1A2BA 1Q20A 3O3MB 3NNDA 2IF2A 4GUDA 1YS9A 2BCEA 2WTAA 2NW6A 1KNXA 4U5QA 5EPOA 1PJTA 2PTGA 3AB7A 4ZVRA 3UW3A 2BGRA 2HNKA 3A2MA 5AJZA 1R4MB 5KYUA 2XMPA 3KQKA 4LWQA 4UHBA 4WA7A 4TKVB 3OPYB 4Y7DA 2PUEA 1B23P 2C2MA 2G7ZA 4HEA1 1K7SN 4PC6A 3KLPX 4PG6A 2ET6A 4EABA 4PONA 4C4XA 4EI2A 4ENUA 3OFSA 4KAFA 5EY5B 2ZYHA 2VDWB 2YINC 3ADKA 5TQ2A 3WGIA 1TZJA 3EWIA 4LNUB 2B3TA 3E7XA 2W7TA 3R3ZA 4MCHA 4M0KA 1TL7C 4OQMA 5FKJA 5P8WA 4D3XA 1Z13A 1RRGA 4K87A 4RHXA 4XEUA 1JR4A 5G02A 3TE7A 3MBOA 5FYDA 2ZUUA 3AKCA 4E1VA 4ISBA 3VMMA 3DMTC 2PT6A 2ANBA 4UATA 1NQTA 3W0LB 2PLRA 3CUTA 2WINI 3L4BA 3GFFA 3DJFA 4K9MA 5EQDA 2KHZA 4L3WA 3IMFA 3SZ3A 4I4NA 3SLGA 3I05A 2FCRA 4BLOA 2DFVA 3ICPA 2DPMA 1LTHR 2FN4A 3EFOB 4AS2A 2AOVA 7AT1A 3TOCA 2C3OA 1T9DA 3E27A 3UHJA 2NV2B 3K6RA 1YH3A 1JDPA 2DQKA 1U3FA 1PS9A 1UK6A 2WKRA 2XSZD 3OX3A 4PO9A 5DOZA 5EVCA 3OT1B 4BNMA 1Y7LA 2Q21A 3MGCA 4FI3F 4XFDA 2ZI5A 4O4LB 2FPIA 4OV6B 4GXNA 4Z4EA 3HU5A 4HXFB 2H4XA 3IPRA 1V8OA 2ZXFA 4EG4A 1RJGA 1VGQA 4M87A 4PX3A 1QZUA 4OHFA 4QQKA 1XJ5A 3O93A 4W82A 3SSNA 4DCVA 4JLDA 4LY3A 3T7JA 5AW4A 1XMQB 2V03A 5K0ZA 4YECA 1CDZA 1TVCA 5A5FA 3KTAA 5FA6A 4M99A 4X1YB 4FFOA 1JFRA 3MJSA 1PTJC 4HSGA 4Q1BA 2TMKA 2Y68A 3DNMA 2F8SA 5JBQA 3EHDA 4UAGA 1UPTA 2IYVA 1VHJA 3PGJA 4HGRA 1JUDA 4KMMA 4U7GA 3T0IA 3B9QA 3ICQB 3I2HA 4JLJA 2C0CA 5LLSA 3SY8A 4EYQA 3I64A 2GEDA 2R0QC 3UM9A 2D3TA 5F4BA 2BF4A 2HZBA 1KPGA 1QNLA 2QD5A 4RJIA 5JEDA 4OFBA 1YA8A 5EWLB 3ECCA 4HNVA 5A62A 3TD6A 3QVGA 2IEIA 2A9RA 2QVLA 2WOOA 2ZWOA 3IKLA 3KYDB 4PZDA 2VTDA 5H3CA 2ZULA 4C6TB 3NHFA 3OM1A 3FDJA 4DDVA 5BMVF 3JARA 2WWXA 4GYWA 2C7BA 4LV8B 4U7WA 8AT1A 3GX1A 5K09A 2VDMB 2GILA 1DC4A 5LKAA 4FP9A 4G84A 4NYMR 5H5JA 1U28A 3W8EA 5AVOA 5HR5A 1E2DA 3EWNA 4KLCA 4M9SA 1VG8A 4WJKB 4XD7A 1TT5A 1MAHA 1WCWA 2E4VA 2MDTA 2P3SA 4MYRA 4XEHA 3NPAA 3SAJA 2BFFB 3TQCA 2YJGA 2Q3DA 3ZY6A 4AIRA 2ZYGA 2GRAA 2OHFA 2QF7A 2VXCA 2X40A 2B1IA 5EZQA 4D1YA 1TVMA 2R1ZA 5H0IA 4DDMA 2C29D 3EDMA 3DZJA 2FZKA 3DUFA 4UU8A 1LY1A 2HFJA 2R6ZA 3PF9A 1J7JA 5J2UB 2NPOA 4Y1EA 3T4UA 4C88A 1PSWA 3WLOA 3UT5A 5KAPA 1HTWA 2IY7A 3WV5A 2I3BA 1U9JA 4QBGB 3ZZTA 5KWVA 1JBQA 2I7DA 3V1KA 3N5KA 3ZV4A 5JD3A 3ZCTA 5EP2A 3PEUA 1C3XA 2B37A 1JHYA 3EXHA 1MLDA 1CQPA 2IXBA 4NULA 2ID8A 2WF9A 4HZUB 3ZQKA 2XWBF 2VEOA 3DZ8A 2VDLB 2V7TA 4JB0A 1X8JA 2JIZA 5GY7A 1C4OA 2FX5A 4JQZA 4B4UA 2OV1A 1QG6A 3K0FA 5LIPA 3LZCA 5ADWA 3PJDA 3LQYA 1QKIA 3W3ZB 1IAQA 4IO0A 5BOSB 1DEKA 4FYHA 1BIFA 4QGFA 3KUKA 5GOTA 3RWOA 2VF8A 2DAPA 1JSZA 4I4LA 3P9CA 4KLNA 2XQVA 3D5TA 4XJXA 2OCDA 1TGYA 1CZKA 3PNVA 3R7FA 1K1EA 1E1KA 1Z0ZA 3G68A 2PQ2A 4KH1A 1FMFA 2HIGA 1QHEA 2EIHA 3TBKA 1M2HA 4LCJA 3U9LA 3C41J 3TM5A 3RS7A 4QFBA 3HZHA 5GM2A 4F9EA 2C98A 1EJ6A 5BN1A 1T3LA 1KJ8A 4C3VA 3SYMA 2BC9A 5FOUA 5AJVB 16PKA 4Y6SA 2MCFA 5AHKA 3DLPX 2OXRA 2PWPA 1F0NA 5IT0A 4ESVA 3E9NA 1F5NA 2QTVA 3MS2A 4JZKA 3S2GA 4EGQA 5KOYA 1FFSA 3EEOA 2C4NA 3GJ7A 2AC7A 1GUZA 1T5BA 2J4CA 1K3UB 5GONF 5IAOA 1AB5A 4NK5A 3OPXA 4TV9F 2BMWA 1RWQA 4N8SA 4BGDA 2HBZA 1DC3A 2C84A 2DVMA 1XA3A 3ND6A 3ZCVA 5FYQA 1BD4A 1K2WA 1XEXB 2L17A 4OH1A 4RAOA 5EJ2A 5G53C 2P5YA 3K9GA 4FDMA 4QA9A 4MLZA 2J4DA 1J25A 5IABA 5HKBA 3JQQA 4M83A 1ABEA 4CMAA 2C4WA 2BEWB 4BMDA 4BZXA 1M0WA 1NE2A 2FQWA 5TT1A 4RIGA 3AOEA 1U65A 4Z4FA 2AK2A 2AXQA 2GTPA 3CT6A 2HLPA 4JZYA 3I9MA 4YRLA 4NENA 4D3SA 2C7QA 4CEHA 2VNHA 3SC2B 1T10A 5KIAA 3PNLA 1GL9B 2JF0A 4OSOA 3UKJA 1NM5C 4ESEA 4NP6A 4EGSA 3AK4A 2IYUA 4Y6LA 1VL1A 2XDWA 3AB3A 3CM0A 1C1HA 2YV4A 1XTSA 4ZPJA 1ISGA 1E4OA 2ECPA 2ZBVA 3L46A 4JNKA 1U9ZA 2OVFA 4DDHA 3R76A 2ZB3A 3AETA 2X7JA 3OF2A 4NHEA 5CGQB 1SR8A 2YOFA 4I6GA 2VPZA 2YMQA 4K03A 3E35A 3AR7A 3TSOA 3VZRA 1QH8B 3R0ZA 4YDQA 1FQKA 2A59A 1NN1A 3BS4A 4RVSA 4EHJA 3BXOA 3DB2A 3GRYA 1CHNA 3MMNA 3KYBA 1CLEA 4B6OA 4GPZA 4YUWA 5CITA 3H0EA 4DQXA 5BWCA 5CXQA 3NH6A 5E2IA 3E9QA 2IBTA 2H0AA 2OQVA 3VYSB 2RGYA 2AD1A 3K9CA 1Z22A 2R8BA 4HGYA 5IC4A 2VDNB 2V0GA 1V8ZA 3C39A 1DBIA 1QS0B 2JJ2A 3PL5A 1CUWA 2J3QA 2G1AA 2FETA 2P9EA 4S1NA 3RIHA 4FNAA 3B70A 4ISCA 5JIBA 2PJUA 1RW4A 2X1HA 2ONZA 1FTWA 2EYQA 3M6WA 4Q3NA 5BR1A 3V4RA 5KMGB 4JCCA 1UC4B 1M6YA 4OYYA 1FXWA 4WKPA 1GKYA 3GRUA 3GFBA 4KXYA 1M6VA 3WWDA 4HC4A 1IC6A 1C0PA 2WIDA 2WTEA 4HL6A 1P9WA 1S8OA 1B16A 5CP8A 5DNUA 3LCJA 3FTCA 4E6PA 4P4UA 5LPNA 1YDGA 2W2OA 3EPLA 2FZLA 1J90A 1BZYA 2J7PD 5AKXA 3TJRA 4B17A 1P31A 2QV7A 3ZBTA 1XRLA 3BYZA 2IEYA 5FJJA 5ALJA 3ZPXA 4I55B 3JYQA 5AP9A 1VHQA 2QXUA 3HN6A 3QLEA 2P30A 1WEKA 3BFJA 3N70A 2FPUA 4M0DA 2C5GA 1W52X 1N6HA 1VA5A 1P0FA 5L3RA 1GAXA 1DCTA 3CU5A 3QUSA 4R9RA 2W6ID 2Y1FA 2YJNA 1U0EA 1V6CA 1YR2A 1C9KA 3FMIA 1WVIA 4KO1S 3ZZUA 2LDBA 1DJQA 1W5BA 2V7QD 1MIOA 2HWYA 3CSSA 4I50A 5C5IA 3RUPA 3LP6A 2ZJ4A 1QKKA 5E2AA 3N2EA 5GJVC 4MVJA 5E4TA 3CY6A 4EO4A 2KSQA 1RBYA 3PC4A 3DDWA 5EJ4A 2V54A 1JRLA 1GNRA 1IJKA 2XKAA 2O8DA 2E48A 1K8XB 2O2YA 3FOCA 1C3JA 3LBHA 4HH0A 4FFNA 3ZZMA 4LF7B 5DYIA 2D5LA 4HNQA 1F17A 3G49A 1HURA 2IHYA 3KKMA 2JJ1D 3WWZA 2YW9A 2Q27A 4LYJA 4NMXB 4DC9A 3U3MA 1GSIA 3CIFA 4AROA 4K2AA 1DIBA 1NDHA 2VTKA 3CVWA 4NBWA 5HFJA 5TQ0A 3BPSA 4BVLA 3ZDAA 3GC6A 4O2AA 4B46A 4Q3CA 1MUUA 5KOJB 1DIGA 2FP3A 4OAPA 3T0GA 1T35A 2LXNA 2VP2A 3NO4A 4PCUA 4NZZA 3IEMA 3RIEA 3DHWC 3ACCA 1FBNA 5B1HA 2PT5A 2XZOA 1A76A 3AV3A 3LL7A 1JZQA 3VR4H 4HS4A 1VECA 2IUEA 2Z8XA 5E6SA 1G0OA 3BULA 2WG0A 3OZWA 5SY6A 4EJSC 3FLBA 3TRFA 1FMJA 4B3JA 3VR5A 4YMUA 2Q2NA 2PRIA 2FWRA 4XR4A 5AHRA 1GPDG 4U7FA 4MCAA 4CIDA 1Y33E 1E5LA 4RGYA 1ODSA 3VYWA 3UHAA 3IAEA 3V8MA 1C7QA 3QXGA 2QAGC 5GOZA 2HWXA 4C0LA 4BQPA 1ESZA 3CG4A 4O63O 2DBRA 3BMXA 1LPNA 2Q0QA 1ZD1A 3QYPA 1O5OA 1SBTA 2VAWA 5CPBA 1N5KA 3RC3A 4JGGA 1V4VA 1FXUA 2YN2A 4JELA 1YI0A 3IBFA 2FX2A 5E1DA 5AVTA 4R9VA 4RJLA 4BNTA 1GAWA 4CG3A 3PDWA 2FOLA 5DYTA 2ZR7A 4QUKA 4MQ5A 3BA1A 4J0QA 2RHGB 2EQAA 2HXSA 1C7IA 4B3RB 1ZOOA 1CZLA 1JGTA 3TMYA 3PYMA 4F3TA 4FCVA 3MZ0A 3E1GA 1PQWA 4OLHA 3RYCA 1EXDA 2ZJ2A 5HRAA 4IEIA 3DEIA 4PQEA 3F1LA 3FVQA 3E3NA 2CXXA 2BKLA 4Q4DA 3VH1A 2BHRA 2PFKA 1IG3A 1U7ZA 2J30A 4KU4A 4XJVA 5JS6A 1M5RA 1QV7A 2FEMA 1VXRA 2FJUA 5DMXA 1DUSA 2PKQP 3HSYA 5AKLA 4D3YA 4IIUA 1Z74A 2ZSHA 2I1QA 2YHSA 1VG0B 2VUHB 4GOOD 1IY0A 4J3JA 1JMKC 2V9CA 2GJKA 4P4GA 2PUHA 1NJFA 2SICE 2YQ5A 4NMMA 4J8PA 5TE9A 1JFSA 1L9KA 2BE7A 3DC7A 3MGKA 4GBED 4Q9JA 2HRRA 2I29A 3SGLA 4A0GA 4CKEB 1SKMA 2Z8YA 3LWNA 1E1MA 4YJDA 3HB9A 3E82A 4B32A 3C3XA 1QFYA 5TRTA 3ZWXA 4W8OA 3TQSA 2DHDA 1M1NA 4FNMA 5K0EA 3TVTA 1N9GB 2P9TA 3B3QA 2J0VA 1NVVR 2JFQA 2VAXA 1UEXC 5B12A 1QRTA 2CZCA 4YT8A 1IN1A 4N01A 1QK5A 3SXPA 1EHCA 4C5AA 2FSFA 4G4IA 3UAWA 1M6EX 2B0JA 2OWDA 3DEYX 3SMQA 3VMFA 5I9IA 1LPMA 2P6UA 3N75A 1X1DA 4CZ2A 3LIIA 5AUQA 4KI7A 3RVNA 4YUAA 1MR3F 1EP3B 4BZPA 2PKYX 3LT2A 1EAMA 1I7PA 3LGXA 2SBTA 4CKWA 3GJQA 1FDTA 3W4KA 2GH1A 3EGVA 4KBFA 4H1VA 4IJKA 5H70A 4Z4CA 3HCDA 1RYZA 4PG4A 4JHXA 4ZCLA 5BUSA 1K8RA 1H5UA 1N6KA 4KPGA 2B20A 2VRCD 3FZNA 5ALHA 1KGDA 1E3DA 3RSSA 4X64B 2VK1A 4YJGB 1GN8A 1TLFA 4PAMA 1YA6A 1R37A 1XALA 4EI7A 2HK7A 2IDJA 4WLFA 1WQ3A 3LLCA 5ILQA 2ABWA 5I51A 1EZ1A 1TKAA 1URPA 1SOMA 3JPWA 2F4NA 4LDAA 4LTMA 4Q66C 1RSZA 2H1OA 3BE4A 3CW8X 1JMYA 2H11A 2GK4A 4RMNA 4NU5A 3TCXB 4E2YA 4ND8A 5PGMA 4MKGA 1M8JA 2FPGA 4RHYA 2XMDA 3A2NA 3UPUA 1N5LA 3UCXA 3H86A 3I3SR 1FZTA 2BEUA 5BV1A 3FCUB 5EZSA 1NQAO 5FNVA 3KU1A 2PS9A 4L4ZA 2UXCB 2Q4EA 4NOJA 1ZCFA 3IUNA 4EO7A 3ZGXA 3M2PA 1G8GA 3DKIA 2H3EA 2AMVA 2GLXA 721PA 2NT3A 5IWCA 4P34A 1OPRA 1UR5A 1FP4B 3MHTA 2I2AA 2H0QA 2P41A 3UNXA 1JB1A 1RDFA 1T2AA 3KLMX 5HMLA 4K0RA 5KHLB 1NXVA 4XOIA 3CO0S 4IVRA 2YV3A 4MUIA 5IYZB 3L5KA 5CDSA 4B3FX 2CN1A 3PWTA 2G63A 1JDBB 2QN6A 3JSXA 5A5EA 4JV5B 4MA5A 4JT8A 2WILA 2YX1A 2VWQA 5BN4A 2GFQA 4UD6A 5LXTF 5JNSA 3U56A 2X0DA 4QRIA 2V3WA 3UGTA 5G3ZA 4KXWA 4QSMA 4DR2B 5C4MA 1B42A 3IBCA 2HWKA 3KQSA 4JKOA 2SKEA 4UDOA 4QDXA 1X6VA 5JAQA 4HQFA 4HFMA 3ABQB 4M76B 1G18A 5IVDA 3VPCA 5BVGB 1Z2AA 5A1JA 2C9MA 3SEZA 1RBMA 2VT6A 1HORA 1L0BA 3N2NA 5HM6A 1NAHA 2A14A 2PUJA 1VI2A 1NJSA 1MN6A 2C99A 2C00A 2RH8A 3GLIA 1YDFA 2CNNA 3W2IA 1J4AA 1XEFA 1KEZA 2MR6A 3FZGA 1JQBA 4L4XA 4Q21A 4UAJA 1TJ4A 5E6RA 4P4LA 4REQA 3M49A 1KJYA 4EO9A 1W4BA 1VBMA 2J67A 1GGJA 1Q1GA 3GLKA 3OT4A 2CL7X 2XMZA 2JANA 3GGJA 2PWYA 1EVYA 2R2GA 5F9FA 2XWSA 3PFCA 4HR7A 3VX3A 4CTJA 4H7DA 1IPHA 4ZFNA 1THTA 1HM5A 2WHXA 3DOHA 3THWB 4PNEA 1UAYA 1XG5A 1ZNWA 1U90A 2JLUA 3VNQA 4F11A 2FA9A 2BZGA 2WAYA 4DLXA 3PFBA 4P54A 2XTZA 1GFWA 1LV8A 2OBFA 3ANNA 2M98A 4IMRA 3URKA 1LLFA 2MTBA 2L19A 5SZJA 1PT8A 2VI5A 3LHIA 4F21A 1UKEA 1M76A 3VR1A 1JLHA 3GXOA 4QTTB 1J0DA 1DFHA 4IIGA 4TXNA 2BFBB 3PGA1 4Z99A 3U40A 2HAEA 3HFGA 4HWOA 2TECE 4F8JA 2X8AA 2QLJA 3BAFA 1AIPA 2PUVA 1O95D 3DAGA 3EOBI 1A71A 3EIFA 3QYFA 2AOTB 3GJ4A 3L7AA 4K9RA 1MQ9A 4Q34A 1TDJA 4WFKA 4ZRNA 5BNTA 2ATEA 1AKQA 4IKOA 3GNQA 5IK2A 5A9SB 5JS7A 3QZUA 1C1DA 4F38A 2GN0A 2P1DA 2ZAOA 3GN1A 3IQGX 4TYNA 1EXNA 3QX3A 2HK6A 3IB3A 1ECCA 2P11A 1XE3A 3CINA 4N4AA 4BFXA 5B3LA 3E4CA 1CG6A 1VE1A 2GFIA 3UJNA 1PR5A 4OOEA 1X7ZA 2G06A 3FPLA 4F5EA 4BVKA 1NYQA 1JNYA 4DV1B 1KO8A 3JR3A 1VGVA 4DBLC 1BXGB 1G9XA 1OBOA 1II0A 3R8FA 3NHZA 1CJVC 1M0TA 3KETA 1XU7A 3MAJA 2J41A 1XD9A 1T3HA 2AOUB 3FRHA 4MAAA 1A82A 4NE7A 2A0YA 1TTPB 4LJ4A 1OVMA 4ZOBA 3CXUA 2AFRA 1W85B 1EFRD 1Z63A 1CNFA 1BWSA 3H11A 3ES9A 5DGTA 2JJQA 1P0PA 1T15A 2EOAA 4EYOA 4AKGA 3LI2A 2DMRA 2EZ4A 3PHGA 4PVCA 2WSMA 2F17A 1P0IA 3DKPA 4MUGA 2OD9A 3D54D 3HCEA 2OOKA 4PGAA 4U2BA 4MKIA 4X7MA 4A8HA 1KWKA 1C29B 1NHWA 3OZCA 2PD3A 2PWBA 2W8BA 3OZUA 1M5TA 4R8MA 3VAAA 1O97D 4F6CA 1E94E 1D4ZA 1ACLA 3IKJA 4CHGA 3ND9A 4BNGA 1X8XA 3P9ZA 2KQUA 3QA9A 4C4PA 1Y1LA 4IIDA 1YB6A 4H7FA 4U1RA 4MDHA 4D0SA 2CVQA 2Q7OE 2IEZA 1RWNA 1UXKA 4JR2A 2YJ3A 3PX7A 4ZI7F 3PVSA 2GHRA 1Y5MA 2Y4OA 2NZYA 3LT1A 3PUVA 1CNMA 1DO0A 1FQWA 1KYXA 2HF9A 3E5NA 3P2IA 5EE0A 1EXMA 1I3OA 2Q2QA 3DFMA 5HCIA 4EPRA 1OTYA 3RVRA 3H65A 4GX2A 4XQGA 2W0MA 2I4OA 1Z8FA 1L1QA 1PWHA 1GPWB 3NM4A 1TYDE 3LHFA 4YO7A 1L5VA 4KQGA 1LPBB 3IAM6 4INZA 3FSGA 4GX0A 1YZNA 2C95A 2Q4DA 1XCPA 3DLBA 3O4HA 4BLRA 1JU4A 4RETA 4YS6A 5ELXA 1I51A 1W5SA 2GD6A 4EATA 5AHWA 4MVJM 4QRHA 1XKLA 3KXDA 3QP9A 2XADA 2WZDA 3CUYA 1EI9A 2GS9A 4N54A 1AO3A 1G8KA 2ZR0A 2AOXA 3VKUA 5DO9A 1RCTE 2ZPUA 5FA5A 4MWZA 3EZ2A 1CUCA 2B69A 1Z4JA 4F60A 5FH9A 4B9EA 2BBSA 1CEYA 2OPHA 2Y76A 5LA6F 3C15C 4DYHA 4QUIA 2BCGY 2AW5A 1Y82A 4Y6PA 1E9VA 1KRXA 4PG7A 4C03A 1BFDA 2IZ7A 3AEQB 3AR8A 4WD3A 2FP4B 3LO5A 2OR3A 1NX9A 3LIPA 4HQKA 4B31A 3L1JA 4DA6A 1K5GA 3GDFA 4FSHA 4UJ3A 5LOVB 1JU9A 2XYQA 4YQZA 1Y1TA 3H7AA 3ROXA 1P2DA 1WSAA 3UOGA 4V2IA 3O1IC 1A3CA 2VRBA 4IJVA 3JTMA 4R2LA 3DAHA 1MA3A 2BFNA 2ORIA 3HR8A 2NVUA 1JIQA 1JDTA 2PM8A 4MW2A 3M3HA 4LRXA 2J3MA 2CMKA 3LUKA 2H18A 4M1ZA 1CY1A 2FEWB 3O7MA 4CCSA 1KDTA 3EXEA 4IHJB 4E0BA 4M1KA 1FFAA 3BXEA 2P75A 1KOJA 4UTRA 3IVGA 1ZHOA 3A6HA 3ICWA 4MTLA 3NYIA 1P6QA 1K7YA 1WSBA 4FEGA 4Q9AA 3U2QA 4B3HA 1KYVA 4ARVA 5HW0A 1LDBA 3BBPA 2A9JA 4QYXA 1YASA 3MAGA 1OLXB 1KPHA 4IMIB 4KIUA 3AP1A 4MUMA 3NTQA 4MR8A 2FMTA 4HLCA 1Y34E 5L7TA 1XAHA 5AKIA 4F97A 1KVSA 2ZP1A 1YZLA 1M2WA 1MAWA 4P0QB 1UDWA 1UJNA 3L7OA 3N0RA 1M8GA 1V1JA 2A33A 3P4YA 5I9TA 3HJUA 4CKXA 5K03A 2RHHA 4US1R 1WCIB 4ND3A 3EXFB 4MUFA 1CY7A 1HR0B 1TEVA 3OQPA 3ZS8A 1MOZA 1X1AA 1WO8A 3AF6A 1I7DA 2CXHA 3ZTTA 1R4NB 5ESDA 5MDHA 4E09A 2NO1A 4FW9A 3DR3A 1YU9A 3NEAA 2H1LA 1EAYA 2Q1TA 4RD2A 2NZVG 2OWEA 2LKCA 2JLXA 2X0KA 3BJRA 1W29A 3ICVA 2XXAA 3QTBA 1I7LA 1QOQB 2XB4A 2ZYWX 2A78A 2R6JA 2HIAA 1H0RA 3GMDA 5SYMA 1K6EA 4CXMA 3U39A 2P9YA 4RZUA 2QY9A 3IUQA 4MGKR 4GP6A 3GD7A 4YP0A 5B3AA 1E3TA 1VSBA 3OJXA 4PAOA 2NZXA 3TNYA 3WWYA 3GH1A 4MPTA 4NBKA 3PC2A 5AVSA 3DEAA 3T7RA 1DKNA 3L4BC 4DREA 3GJ8A 3EASA 3FYTA 3HDVA 3K9LA 3MRSA 1GQOA 1KJ9A 1P2SA 3OA2A 3R3VA 3E4DA 5I5GA 4ND7A 4O4JB 3AFMA 3LKBA 1K5DA 1PR2A 1RKXA 3DDZX 3GG9A 3KJIA 3GBPA 4H18A 4S0XA 4E5PA 1BXZA 3TLGA 3MB8A 4WZBE 1G6HA 2OESA 1N8NA 5T5QA 2OUKA 4EA6A 4HK4A 3AVWA 4HTAA 1WUKS 4MEAA 5BWLA 4GD3Q 3QWAA 2GDZA 4JGIA 2HZ7A 3R23A 4DIUA 3HKDA 4CIWA 2FW0A 2WTNA 4Q1VA 4YUYA 2G5CA 4KP7A 1JA9A 2P68A 3A3NA 5CLFA 1IZ9A 2CMFA 5SZHB 5TMPA 1R5BA 3REFA 5C4IA 3ZDQA 5KX5B 1KEUA 3DJYA 3D3EA 1OOEA 3GJZA 3QA3E 1P2VA 1U02A 2YWFA 4F5WA 3ZNNA 3GT7A 4NH4A 1P74A 4Q7KA 1EFTA 2O8FA 1CJTC 1ZUNB 2CFIA 3MGAA 2VOJA 3BD7A 5CB4B 2VT2A 5AXCA 2QGZA 3T35A 1II8B 2R85A 3VDNB 4Q3KA 1IUOA 1Y80A 1O03A 3KEMA 1Y3AA 2PH7A 2YNMD 4A5OA 4JLPA 3CLRC 3EN0A 1PHRA 2F9FA 3K1YA 1Q19A 3ED5A 3GEDA 4NBTA 4PFSA 2PKXA 1J99A 1A9PA 1HLPA 1XA0A 4AULA 2A8YA 1ZVVA 2H16A 3N76A 4HF7A 2HY7A 3F8SA 4J3NA 4RKQA 1XK6A 1S1MA 4Q47A 2Z57A 3EPPA 4QDJA 3VOAA 1KQFA 3A1FA 2JD2A 1D4OA 1OZHA 1H8HD 1GSHA 4PLGA 2O6HA 1CZHA 2HJVA 1N9ZA 2IELA 3QUBA 1CV2A 2VA9A 1FDWA 3FSJX 3GROA 3MMXA 1LBSA 3OJLA 4KW7A 4LK2A 4QQ8A 3VO9A 3WMEA 1GO2A 3PPWA 4C43A 4CL3A 2FKAA 1ZIYA 2QRPA 4N18A 2LIVA 1FPQA 2Q5HA 4GKJB 2RGWA 1S2GA 2PX3A 4UXIA 4RMGA 1HF3A 4MPPA 3RSGA 3TIXB 3WGGA 2D00A 3OZSA 2G25A 1BVYF 3MMSA 4MS1B 1L1EA 4BKQA 4AJ1A 1PD1A 4HRXA 1JG4A 4MWSA 4YLGA 2BUBA 1BGVA 3LX5A 3V8BA 4BFYA 1SKBA 5BQOA 3KJNA 2C5SA 5IZCA 3FHJA 3TG2A 5HILA 1UPAA 1HK7A 4DJTA 4MKXA 3OURA 4NDNE 2OHJA 1KC3A 1UBFA 1FP2A 1NOIA 3PUHA 1U6JA 1ZXXA 4MLDA 5DASA 5B3JA 3UWOA 4IZHA 3V7YA 3W8DA 1KQPA 4NYMQ 3OBIA 3WICA 2CD7A 3B1ZA 4D4LA 3MVEA 3Q98A 4X65B 2I87A 3S8MA 3ZU4A 3KVRA 2O05A 2ZIZA 1Z4LA 3O9VA 2ZQ5A 1BW9A 1O9BA 3BB1A 3RWMB 3UJHA 5DYNA 3IEUA 2HRCA 4O4HA 5DBIA 1EFKA 1Q0HA 3LW7A 3N8IA 2Z5VA 5FTJA 5FWDA 2IWHA 5KU7A 2QUBA 1JIUA 1WNTA 3MJCA 1MH9A 3AHJA 3LU1A 4MV0A 4Q12A 5DOVA 4J16A 5BNFA 3CMMA 4CT5A 3GLFE 1EK6A 4QHSA 4JBGA 4L15A 1FYFA 4KRGA 4OG2A 3RIXA 4UTPA 3N2LA 3PG5A 4IIJB 5H9VA 2QG9A 1FU8A 3IP3A 4EG1A 3C1UA 3FKSA 3QWBA 5C7LO 4DRXB 5J3JA 1UBHS 3C5HA 3M1AA 2J59A 5K0FA 4IIVA 3S2ZA 4DGQA 1JT2A 2ORVA 4DKJA 4B4VA 1X38A 2FRVA 3SHOA 4RKFA 2BFOA 3PDHA 3D59A 4FYKA 4TXHA 3W5BA 4ZQEA 3HHPA 2QJTA 1YA4A 1Z6TA 2I22A 4Y0VA 4BC1A 2VJMA 3IMCA 2NXCA 4O0LA 3HB7A 3VZQA 5MN6A 4J6EA 3H16A 5K3FB 5TF4A 4X54A 2CFSA 4CF5A 3VKHA 3Q3CA 3N2ZB 3ONVA 2TYSB 3ED1A 5BW5A 4BASA 2PGJA 2NP6A 1UBLS 1U2RA 1YGYA 3MM4A 2OBNA 2ZRPA 3DEFA 2EKLA 4C21A 1PZNA 1Q3KA 3ZVKA 1VKOA 4FD3A 1W19A 3M33A 2GRUA 4GVXA 4F5ZA 4I46A 1AN0A 2PXAA 5CA0F 1Z0AA 4AF8A 4K0KB 1F2TB 2H2HA 2I2BA 3AR4A 2XZDA 2K6GA 4I4TF 4RF4A 3AW9A 1IU9A 4I8DA 4LTNA 3ZH9B 2AEFA 3NYRA 3OZGA 4KQ9A 5C51B 1E2GA 5ALEA 3PNKA 3DTVA 3QELB 4DA9A 3FNBA 4L28A 3BHIA 2I5PO 4J6FA 2EKQA 5JDIC 4WZBB 1JQDA 1NOKA 3QU5A 4IFIA 2PUWA 1CUGA 1ZL2A 5CVDA 1KSGA 1A69A 1G42A 4QARA 3SZMA 1WG8A 1PL8A 3O1LA 1U0OC 1PNQA 2XMSA 4LSZA 1J2YA 1E3WA 1X0VA 3CPJB 5NULA 3WL6A 1D0SA 2ERCA 3BF8A 3LCRA 3OCYA 4DCNA 4EFLA 5FO0A 2IZ0A 3AF1A 1TD1A 5DHPA 1FLAA 5I4KA 3QX7A 4XVHA 3ZZNA 1FX0A 1PQ4A 4LC1A 3HS3A 3T1OA 4U9HS 1WBDA 2D1YA 5ES3A 4MI9A 1RPZA 4TXJA 1FB5A 2H4ZA 3CH6A 4R8SA 4N8DA 4XM0A 5DGDA 1SIUA 1LB1B 1H94A 1KI1A 1RI5A 2Y0BA 5JRDS 3KKZA 4MB2A 4OHZA 1NYLA 1HQYE 1YC2A 4KX5A 4R1OA 1W4LA 5HZMA 1MP0A 3H1FA 3RC1A 2EFYA 4H6XA 1S8AA 5BMVA 4ZMRA 1BAPA 1AUXA 4DIFA 1DJNA 5A3QA 2Z95A 3KNZA 1JKFA 4MXDA 4RPJA 3WIOA 4Y2PA 3ZW8A 4AS1A 1T13A 3G9XA 3R8XA 4GR5A 1JKJA 2P4QA 1ZIOA 1OTXA 4DNXA 1SCAA 2SKDA 3EG9A 5KVAA 3OJWA 1E2NA 4E5SA 2J32A 4CU2A 5LCXA 2JFZA 2VK2A 3EAQA 2IUYA 2J3DA 1CQJA 2GBCA 4GZ3A 1ZCJA 2NU6B 1LBTA 2VP4A 2JFHA 4HAWA 1Q0PA 1Y9ZA 2OLEA 3EODA 3OJCA 3TMAA 4YAUA 1SCNE 1A9YA 1UZLA 1R10A 1VCMA 2PJZA 3QOFA 4FS3A 5EIBD 1WETA 1XRQA 3HFJA 4LJLA 1HPLA 3IA2A 2C8VA 2IYEA 5LYJA 5GZ3A 3EGXB 1SIWA 5DZSA 3VX4A 4BB6A 4DB2A 1TF5A 1DFGA 1P1RA 1WVGA 3E5HA 3PC8C 3DFKA 5B2ZA 1Z56C 4KPFC 2R7NA 4YCJA 2Y66A 2PMWB 5DXJA 1YB7A 1U2DC 1BU5A 4TTAA 4FT2A 1TFRA 4ICIA 1P0MA 4MQFA 4XYEA 5FFNA 3FFTA 1DV2A 4AJIA 1UXJA 5J4KA 1EFHA 1EM8A 4IIFA 4BNLA 2NO6A 5CTJA 2E87A 1U1FA 1R5OA 2CLDX 1OWLA 1PG0A 3GLFB 3G8CA 1QHFA 4B4DA 5IBRA 1O0SA 1IQRA 1RZUA 3TBHA 5LMCA 3O8QA 2ZTUA 3N2YA 5A4FS 4LKOA 4G0QA 1H85A 3IO5A 1CBUA 1FVFA 2G72A 3CH5A 2WKPA 3N3AC 3V9AA 5HGXA 1R5NA 2GBIA 3FETA 3OSUA 5B53A 3U6BA 1PL7A 4RVDA 5CD1A 4BQOA 3OCZA 1GQFA 2AG6A 2QORA 3EAFA 4KZKA 4ZRMA 3M2TA 1CQZA 4IDGA 4F8EA 1R0ZA 1OKKD 1ZJZA 1GYQA 2ZCVA 5F9MA 3D3WA 4Y0NA 2XECA 1O6BA 4JVOA 1TJ5A 2C97A 4YH1A 2DZDA 2EW8A 3CF6R 1E9CA 1Z62A 1KP2A 2EJWA 3QF4B 4JUBA 5FPQA 5L3ZA 3UV6A 5JTUA 2XTAA 3NU1A 4KFCA 5JOQA 3PVZA 2ZBRA 1EVIA 2WU0A 3JW8A 4AZTA 1I7QB 2TRSB 1L4GA 3B1VA 3PXEA 1IYZA 1Q1ZA 2VR1A 3LQKA 4BYMA 3UMGA 2I62A 2O8CA 4OI1A 2XE4A 1TI7A 4JVSB 5I47A 3DBOB 2Q8QA 4C3UA 1RAAA 4WUVA 1JG6A 4QYIB 3SJBA 1UOQA 2Y1DA 2JGDA 2HH9A 1QF7A 2QVGA 3GRCA 1TCAA 4GLFA 4I66A 3K0CC 1QRRA 5GONA 2XT9A 4TV9A 5EEGA 5C4GB 3ZBPA 4BFCA 1ZD2P 3KR0A 4UVGA 2WR8A 3MCWA 4HX9A 3TX6A 1UMBA 3MTBA 1HNNA 1O7JA 2B2CA 1KO1A 2A0XA 1E8MA 2F43A 3VOBA 2XCRB 3NB0A 4DV5B 4KJZA 1G1MA 4LRUA 4XM1A 3ODGA 4TMFA 3VGPA 1JLSA 2IZ6A 2VPTA 3L49A 1CU1A 1DAFA 1RCFA 3ECAA 3LQFA 3PHCA 1MGOA 4P7JA 3IOEA 4GPAA 5DK6A 4MVJG 2I91A 1X80B 4BBZA 4I1RA 2H9YA 1KYWA 1GL6A 4UZFA 4IGKA 2R6FA 4INAA 4LS3A 1OLUA 4EL0A 6PFKA 2VSFA 3PUJA 1OXVA 5DM2A 2VNJA 4YXFA 1DX9A 1QMGA 3MWFA 4HAYA 5JPDA 4DFDA 1NKTA 4KFRA 2OECA 5TVGA 4UCWA 3WLNA 5BQFA 4WCDA 1U5CA 2FTKE 1MX3A 2GHQA 2X2FA 1OT3A 2YUIA 3BWBA 5DT9A 2PPLA 4ZAXA 1XPJA 1OXTA 4YQYA 2G04A 5K0CA 1UDBA 5ENDA 2J9FA 4GKAA 4QRDA 1W35A 3C3BA 4LJ6A 2HXGA 1C4WA 3L0PA 2PUGA 2R47A 4FN4A 4LISA 1SZDA 4NV0A 1WMDA 1ZI9A 3GQBA 1QP7A 4KR9A 4DTIA 4C2UA 1Q44A 2UUOA 1F6DA 5DDIP 4G23A 2ZREA 5BWBA 2AA3A 5JRZA 1P1CA 5REQB 3HRKA 2ZM5A 5GJCA 1S4MA 2FW6A 3X1DA 2BGLA 2QLFA 1NN5A 5KJCA 3HFRA 2C8LA 1D9XA 3QU9A 4IZ6A 2I8CA 4E12A 2NMVA 4P3XA 3G59A 1GZ3A 2FGJA 3ILSA 5KWIA 4TSFA 3D43A 4YC7A 2HR1A 4G5SA 1JQKA 2WBLC 1W75A 4YO8A 1WW8A 2GBFA 1H9CA 4KYVA 3Q8MA 3R09A 2IIPA 2VJPA 3K5IA 2NM0A 1L4HA 4KFUA 4G0ZA 3C45A 1NVVQ 3ELUA 3T7DA 2BFDB 4GBMA 3TPCA 1JR3A 4OHYA 1YRHA 4BQFA 2XBMA 2NXNA 4YP6A 1OIXA 1WY7A 2JFWA 3DH0A 1TX4B 3EF1A 3LH5A 1ISHA 1YWGO 4HGPA 4OFXA 1RHKA 2YY5A 4QPPA 1L5NA 1H4QA 3MFYA 3Q2KA 4Y67A 3DDCA 1VL5A 1JHDA 4XVCA 2X5OA 2PH3A 1COZA 4I5FA 3BC1A 1VB5A 3U3RA 3W3AA 2WT9A 4CV3A 1ZCBA 2GCIA 4OXNA 2IUSA 2J0UB 3VO2A 1VPLA 1ZOIA 3EDYA 4CL8A 2IU4A 4ZVSA 4PRYA 1S8NA 2N1BA 4KBYA 4QNRA 5E4YA 2YVUA 1ATZA 2O2CA 2FUG1 3A14A 1X13A 3HYCA 1J22A 4JDPA 2FQYA 2WLTA 1W5FA 4BO8A 4DKXA 5LQCA 1GG9A 4UXJA 4P32A 1I4OA 2GN8A 3DMHA 3F7TA 4J29A 4KQXA 1P2UA 4ON9A 1R50A 3HPRA 3QMMA 1M2NA 1G5RA 3QPVA 1VQ1A 1OILA 2FZEA 2UXDB 5AW5A 4JX8A 2Q0SA 1X7WB 4G6ZA 1TQDA 3TBFA 3UG6A 4EQ6A 1GTG1 3ZY2A 4L4RA 5C3MA 4OB7A 4QTXA 2JBAB 3SEFA 4TL9A 5K20A 4NU6A 3GV0A 4JB3A 3EEYA 3C4QA 3L7BA 1NQWA 4M9UA 3UPDA 3VR4A 1LV7A 1A8UA 1LWOA 2Q6LA 2AN1A 1P29A 1PFQA 2F1OA 1LS1A 3WIBA 2RG1A 3GJRA 4HGOA 1RRCA 2RARA 3QSGA 1EEXB 1WMAA 2ZS7A 4PSKA 3C74A 3MTDA 3GLQA 1RAFA 3B6EA 1E1CA 1SKAA 3FPFA 5HQ3B 2HKIA 1BKDR 3MSCA 2OILA 1E2FA 2ZRBA 3ONDA 4HBGA 1SVSA 3N2GA 1V7CA 2XYHA 4QUHA 1Z8DA 1NWCA 3MPUA 4CM1A 5CVUA 2DP4E 1O58A 2GLUA 4LHZA 3SJZA 5AW1A 2QMQA 2W2QA 2QMYA 4CWAA 3FUCA 5DK4A 3UJ8A 1L4EA 3K8OE 3ONNA 3N8NA 1HOTA 1ZVKA 4I08A 4I3HA 1OWNA 1PL0A 1ZI6A 2R5NA 1ETUA 1T5HX 4O6VA 4PIVA 5ALNA 4DCGA 5JRJA 1FVXA 2O3RA 2P6OA 1M7HA 3Q5DA 1PYOA 3FM9A 5BYJA 5BT8A 2IU6A 1GCOA 3GDHA 3AFOA 4J2TA 1MT3A 3KM0A 4RK5A 4P33A 3CVJA 3EDQA 4ZKEA 4B44A 5KYXA 3QRWA 1ORHA 4COKA 2QMZA 3WBKA 3L79A 4PZZA 3K1AB 3LDAA 4RQAA 2JH9A 2Z08A 3FNEA 2ZIGA 1QRDA 2ZRFA 1W93A 3C4JA 3FHOA 4P53A 5HF8A 4CLRB 1O94A 4CV1A 4QC2A 3IIEA 5ALPA 2OTCA 2PPVA 1J42A 1ENYA 2IW3A 1EWVA 3BFPA 3HC7A 5AIAA 3AB8A 3B3GA 3M6IA 5AK4A 1QG2A 5TY0A 3WRYC 3CF4G 4PPNA 4TM7A 1YRBA 1HNZB 3MGGA 3SYLA 1NW4A 1PJCA 2CD9A 1OA0A 4IDHA 2FE4A 3PC6A 3TLCA 3SQDA 5U1PA 1YR6A 2GPAA 2FW9A 4DTCA 5KQMA 1TA0A 4HY3A 2XKJE 5F2EA 2R6DA 1E1QA 5CFMA 4U6NA 2I66A 3I9V6 2I33A 3C70A 3QG1A 1Z33A 1QIJA 3G8YA 2VHYA 4G5XA 4MDEA 2WDPA 2X7XA 1NZDA 1T5LA 3LVRE 4U3JB 1HYBA 4NBSA 3T4PA 5KVCA 1GA4A 3R6TA 1XP8A 2HHLA 2VAMA 3BCSA 1XVAA 3NAGA 5U4XA 3TUZC 1CZUA 4CQMD 2UZAA 4NYIR 2VH5R 3FPSA 5AUPB 2JFVA 2RCNA 4HPXB 3ML1A 2G9NA 4QVGA 4BLWA 4QJ3A 4P38A 5JAMA 3CPHA 5KYUB 3O7WA 4F4JA 3GVIA 1BX0A 2A84A 3NBYC 2R9VA 2ETVA 2ZEJA 3UH0A 1Q1NA 1BMTA 1EVKA 1YNSA 3LT0A 3PCXA 4JXXA 1P6UA 3HCFA 4DN6A 4YJ3F 1VB3A 1IXSB 3GRRA 5HE9A 2XCLA 5DNYB 3Q0TA 2PL5A 3N6XA 4OMCA 1KEPA 3NDJA 3QE4A 4MA4A 4PS0A 4JR0A 5TQ2B 1H3NA 2IEDA 3ANSA 3CLUC 3I5UA 1M7BA 1Q1BA 2BTOA 3DR5A 5JCOA 3NIFB 1JWBB 4UQLA 3KQLA 4O33A 4XYGA 3LHSA 5F2KA 4BNDA 1DG3A 4CDMA 1CP3A 4KH0A 2GYVA 2ZITA 4KXFB 3BD6A 4F3KA 3DTTA 3UJDA 5B1DA 4ZEMA 2QWXA 3JWJA 3TQTA 5FWNA 5LQMA 1YSCA 1KI7A 5M34A 4DDTA 2G67A 4IYRA 4FFPA 5HOQA 3HCCA 2ETXA 1NJ8A 2ZAGA 5LP6A 4IQFA 1EFAA 3AUYA 2ZYUX 3AR6A 2FN9A 3NTOA 4R5MA 3KVYA 2H4JA 4DXDA 3OJOA 3ZY3A 1WS6A 3E70C 3FOEC 2VDJA 1N6LA 4Q16A 3ORYA 4FBMA 4Q4AA 2LP4Y 1CY4A 2YWEA 3RARA 1WIWA 3STHA 3ZU3A 4JYAB 1X7YA 3VZDA 4BFUA 5JH7F 1XVLA 2XSZA 4FEEA 3EQ7A 4KWIA 3TLKA 4AL4A 2O1XA 3FLMA 1U7DA 2FPIB 4AY5A 1U0HC 3PQ6A 1GKLA 1NPTO 1NW7A 1RYNA 4AMVA 4KR2A 2BSAA 4KBGA 5THKA 1J8VA 4WBNB 3BXPA 4HRAA 3LVFO 3G0BA 1Q77A 1CUHA 4HDQB 1CUZA 4PQYA 1I3NA 4OQXA 1TM4E 3FPCA 1L4MA 3NOXA 1Y8ZA 1BEEA 1U7XA 3A6DA 3KTAB 2C0QA 4M1QA 5LDHA 1ZH2A 5ER6A 3IEVA 4GL2A 3F49S 4NLLA 4R1NA 1DKMA 3BXZA 2PU7A 2VUUA 1DKOA 1ESCA 4PR3A 3MWJA 1RBQA 3W6NA 3JAKA 1FA9A 4QTYA 5CK4A 4EHDA 1FTYA 1ZMXA 4R7TA 1KJWA 1KMMA 2OA0A 4EB6A 1YHYA 3Q7TA 3WADA 2Q5FA 4IRXA 4M0LA 4F12A 5LXTA 3P96A 1C9NA 1Q16A 3O4RA 1YTLA 4B4OA 5I7EA 3ZX4A 5IVHA 3X1ZA 1I24A 4QHTA 3QVGB 3LCVB 3SBDA 1U0LA 3LDHA 1WV0A 4G86A 3UTCA 3FZEA 2CW5A 3F6CA 1ZO8A 2XWJI 3CCBA 4KSYA 2O2JA 1J8DA 1RT9A 2R6AA 3JARB 5ERYA 3ZW9A 2Y2VA 2ZIEA 3T06B 5K6TA 5K8LA 1BDMA 3AINA 3VR2A 3VSBA 3R3SA 5TR9A 1QGUA 4C08A 5ED4A 3KUUA 1DC7A 3PWKA 5A6SA 3H5IA 3QU7A 3VR3A 1HFKA 5KHAA 3NMUF 1TT5B 2HGZA 2JA2A 2WWFA 1Z6XA 3H5RA 4IWYA 1E59A 5IDWA 4HWGA 4JP1A 1HWYA 2XOXA 5DRTA 4EDFA 3KYCA 3UY4A 1EU1A 4PR0A 3VHRA 4AW9A 1CZOA 3OY2A 3F6RA 4IFEA 3RV4A 1KXJA 3RHFA 1IXKA 3M82A 2WFLA 4M88A 1JFFA 3ZTWA 3KXLA 1AMNA 2VF7A 3Q3EA 3DUFB 2E4YA 1EX6A 3H5OA 2EGGA 2NZ2A 1QWOA 3G9ZA 4MYCA 3VC1A 3IHWA 5HFAA 2WD9A 1SK8A 2ORYA 5C34B 3M4JA 4G5HA 1Z5NA 3M4XA 4B6GA 1I3MA 1PRYA 3UGJA 3EMVA 4ZHQF 3UT5B 3QF7A 5KNBH 2R8PA 3HY3A 3NUZA 1TC2A 3PXAA 2BI7A 4RD1A 4GPD1 1W88A 3NH9A 3PJGA 4GOLD 4LZAA 4PCVA 3HR7A 2ADFA 3S3TA 4ZI3A 4PLFA 4BE4A 1AF7A 3EXHB 1AF4A 2AMYA 1U2QA 1AKWA 2V6MA 2WPDD 2ZRHA 2GO1A 3GY0A 1OXKB 2QRZA 3C98A 4L50A 3U7QA 4ALIA 3T94A 1Z6YA 5JYDA 1V6AA 1DJPA 3M6LA 2FMIA 2BI4A 3NNNA 4GWKA 1EA7A 4Q7LA 2OAP1 3TIIA 4ZMSA 2HHJA 2UZ1A 3EF3A 5C8VA 4RV5A 3W6UA 4G1FA 5K3CA 5K8IA 3K0FB 4EZEA 5K8TA 3VU8A 4DA4A 1M34A 1PJQA 1J7KA 1PDVA 4QXOA 1VRWA 3C5VA 5ARDA 1Z7GA 2AJLI 1R6XA 2P9ZA 1JZSA 1OAOA 2QN1A 2COEA 2DU8A 3M0EA 4X1KA 4G0WA 4IICA 3HM2A 4A15A 3B52X 1O1YA 1B2RA 2CNLA 4N5MA 4NNOA 3B20A 2RMKA 1T8RA 4JT9A 1FPMA 1IDOA 1LGYA 1N6NA 2JZOA 4IV5A 4E03A 2E7ZA 3S70A 1W76A 4AP9A 2JLCA 2H5JA 1VYHA 4FGZA 1IQPA 1GAJA 4GR9A 4NATA 1GQRA 3KQOA 1NFQA 1RWBA 2IVZA 1J2JA 3AZOA 4GZ5A 4O1HA 1NXSA 3UW1A 2VH2A 4LJKA 5TLSA 1KOGA 1ZYUA 3DE5X 4FOLA 1QVWA 4LVNA 3JRXA 1MJ5A 1MPXA 2FZ5A 4G0PA 5FP0A 5FV4A 4CI9A 5KKCA 4PYJA 1D1PA 4JAVC 1W4RA 3WBBA 3I2IA 1PFVA 4HQNA 4Q3LA 2QTVB 4ML3A 2QV0A 4RPHA 2CLLB 4QBKA 1UBUS 1RYDA 4MRAA 3RT1A 5ILOA 521PA 5BQPA 2CZGA 2HEIA 5AVWA 1SQ5A 2H7VA 4D9EA 4KAJA 3VHQA 4EVSA 5JC1A 1MW8X 2CB9A 1JEJA 4ZI7A 1YUMA 2A1TR 4A82A 5BV7A 1VYTA 2ZRLA 5EJEA 2O0KA 3ABZA 5JAPA 4DOMA 1MEEA 1U7PA 3NRJA 4UJ5A 2GR9A 5EKSA 3WBFA 4FWIB 3A31A 4FUQA 3L18A 2ZSEA 4QX6A 4NENB 4J3FA 5FHRA 4NF2A 1MF7A 3T9DA 3LUCA 1CIVA 4CEHB 3MCUA 2C96A 1HZZC 3DUWA 5H7XA 4AUEA 1PD0A 1QHXA 3ZEAA 4E1AA 1WP9A 3ZJTA 2OFWA 3LBNA 3S27A 5F1KA 1NVFA 2ODWA 1CWUA 3PD0A 4LZZA 5T6MA 4BTLA 5LQUA 2GERA 2J0SA 4J1QA 1XXLA 1NNLA 4HLNA 1M2FA 2OAEA 1UMDA 4XTCS 3GWGA 2WVJA 3ZWCA 4BBJA 2VP5A 3G6WA 2PZBA 4NAVA 1VCHA 5JSUA 1U1DA 3UYKA 3ESYA 3MQFA 3AETB 1E3QA 4PPYA 3HUFA 3WKDA 3KHKA 4M1MA 4HGNA 3I01M 1FS6A 2PGLA 3R3HA 5BW8A 2FSSA 5GV7A 1USGA 3AJDA 2L82A 3E2IA 1LI7A 3IT1A 5DHQA 2XZPA 2ZPTX 1B0ZA 5EMMA 1OR8A 5HP4A 1II9A 3GP8A 2QOEA 3BEDA 3TCNA 1I7NA 4E5KA 1F4PA 1ABFA 4ZANA 3OEWA 2H7XA 4F2DA 1VMDA 1O96A 3Q9LA 5H02A 1AGXA 2FJPA 3ILXA 3ZQJA 3U3JA 1XD8A 2CF6A 3C8UA 3EIEA 1RQLA 3KQYA 1K3FA 1XZNA 3I5AA 4L9SA 1Y8RA 1NPDA 2P67A 3ZHYA 4G01B 2WQ7A 1M6VB 1E3LA 4BO7A 3P0IA 3U7GA 1NBWB 4U9IS 1Z7BA 2XGSA 4GI2A 4M7OA 4ECEA 2YFYA 2IPAB 3ZC3A 3WMGA 4LXXA 3ITKA 3KKOA 2CSXA 1T1IA 2PSDA 3BJMA 3G7NA 3IJPA 3USZA 1QRAA 3H8WA 4H31A 4TYPA 4UM5A 1QG4A 2XJ4A 1FMTA 3ZLUA 1PK9A 2ANCA 4NCJA 1IB6A 3ZHXA 4CM4A 4OJMX 3S2SA 1LFAA 4UUOA 1JSRA 2ADMA 4I1UA 1CUUA 5EIWA 3FI9A 3GGSA 4MHTA 4IKEA 1L9XA 3V7UA 4V38A 3U26A 3RAJA 4O1IA 1T5IA 2AYXA 4XZ3A 1M2EA 1MIOB 1XQXA 3EZXA 1IUPA 5AVQA 3GPBA 1ZGCA 3LKZA 2II6A 3EFBA 4I50B 2DCMA 3CJRA 2PO7A 3QWIA 3S2UA 3W9UA 5MF6A 2OZLA 1Z7YA 2VYND 1H05A 3DL7A 1WXEA 4K1LA 5EJAA 4FFMA 5E7QA 3R8CA 4M9XA 3OZIA 3B7WA 3GEMA 4D8WA 4P86A 1CVIA 1TM5E 1XTJA 4R2IA 1U8YA 4Y9DA 2BEJA 2ZTMA 4J0FA 2XGGA 4ARCA 2NTEA 2GBPA 3M70A 2O8DB 2F62A 4HLUC 4CUJA 5D3KA 2SKCA 2BKAA 2V0CA 4Q01A 4KITB 2N3ZA 3GA5A 2VQ6A 1O77A 1JLRA 1N8TA 2VK4A 1U2GA 4OKIA 1QZXA 1YR8A 1WB4A 3WMWA 1RD4A 4KYIB 2F64A 4TMXA 2Z9CA 4KWHA 4A10A 5LVAA 3R5HA 5TQ0B 3V1UA 1NNI1 2KS6A 3GAMA 3KTOA 4O2AB 5BSTA 4BP8A 5I7VA 3DVAA 4ZVUA 1L5MA 3E7WA 4FDAA 1UPXA 4MGZR 4N0EA 5DHAA 3ETEA 3V46A 2RHTA 4ZMBA 3OA0A 3T1VA 1YB1A 4KE9A 4BP9A 3IAS1 1B00A 2CYCA 3RYFA 3WGMA 1H2XA 1S2NA 1C80A 2HA0A 2GD1O 3OETA 2HMVA 4N6OA 1OSNA 5AK5A 2IP2A 3IT2A 1GCGA 4G07A 3S28A 1Z06A 3MD9A 5JXWA 3GLIE 3C8HA 4IRUB 4ZQFA 1JLLA 5J1SB 1E3SA 2EP8A 2AQHA 2X14A 4RY8A 4WLOA 4AUMA 3RU2A 5IX8A 3T5MA 4JLBA 4MNTA 5ALXA 2IPOA 4XLTA 2JHAA 2ZOSA 3TLYA 1RLUA 4IVNA 1LVGA 2HNBA 3DZCA 3KQTA 2FG6C 3AOGA 3DBLA 4E22A 4TTVA 4EEKA 2C8JA 2OORC 5DN6D 2WSYB 4D0GA 5CFRA 2AZDA 1G66A 3H83A 2R5FA 4E2WA 5JEEA 4EY8A 1DC5A 3L4JA 4EHHA 4JLOA 4ZP1A 1DEAA 5EMLA 1O5TA 1Z6AA 4RPIA 3TAXA 4NARA 4Z54A 3MIZA 5T8KA 4DY4A 3RYCB 1IN4A 3R7LA 4DRZA 2D7CA 2C4KA 4DV7B 2E3JA 4LOLA 2DY0A 4A0HA 2ESRA 2JK0A 5J9FA 3U4HA 5BUQA 3W9YA 5C31A 2AD5A 5I7SA 1F38A 1OJLA 4KXQA 4NAHA 2R86A 4HN2A 1ZOLA 3ZHSA 1PHPA 2IJGX 1O4VA 1YJXA 1F2DA 3R20A 2GZ2A 5JWHA 3F6EX 3IELA 2CDNA 3ULKA 3CW9A 2C2GA 3JQGA 4FYJA 5SZKB 3FTPA 4YN3A 1XZPA 4P0TA 1NG9A 1E3JA 1G8HA 5B4TA 3BRQA 4I9NA 2FSVC 4M21A 1CPYA 5I8PA 1YTUA 2XMRA 3ORRA 3TI7A 4DV3B 1M1NB 2FE1A 5CG2A 3A28A 1UFQA 4B34A 2J7KA 1AB6A 2YYZA 3RTDA 3D6MA 4I7EA 1UBTS 3OM9A 4A8JC 1NURA 1UXHA 2F90A 1EFUA 2FB9A 2RK3A 3C7DB 4UVDA 4C4OA 2KE5A 4XLLA 1YAJA 2AFIA 3MTGA 5LLDA 1LQUA 2QVYX 2XYVA 4UOZA 2J5XA 2Y1CA 5A0FA 3VVMA 3FY4A 3GYGA 4CKWB 5LQNA 1GYPA 3VAYA 2C20A 1TZMA 2XCUA 2RHDA 5EMKA 3VR6H 3PE4A 3E61A 1NY6A 2XRMA 2VPPA 4TKZA 1K92A 1F20A 4K05A 3A1DA 3OUZA 1IJEA 3FMVA 4XOUA 4ED9A 3LQRA 3FYUC 1GGNA 3D1VA 4LF6B 4JDUA 3GUZA 1JHRA 2H17A 2HJHA 2VRCA 1GNPA 3KU4A 3OPNA 2QT9A 4JN6B 4EUHA 1B8VA 3KL4A 2ZE5A 5J5CA 1BDIA 1W46A 3C6QA 4XUDA 1ZHHA 2YZMA 1RYEA 2NSJA 4G8BA 4ND8B 4UNIA 2HMUA 3DC2A 2FPGB 4RY9A 3UWKA 1BSVA 4HN4B 4X1IA 2VWHA 1I4TD 1WW2A 2BEUB 1AMOA 5FNVB 2F8TA 1GWNA 5GVSA 5HHTA 4ALMA 3UEOA 4FU0A 1NNSA 2C94A 1QZTA 3IO3A 1YRWA 2WNHA 5KDLA 5HZHA 3R9WA 4K6MA 1DLIA 1ZRMA 2EHDA 1KYYA 2G8LA 3HP1A 1ND6A 3UOWA 2QW1A 1F14A 4OXYA 4BNNA 1W36D 1ABBA 1DIAA 3BTOA 5KOIA 3NHAA 3M1IA 3KWFA 4RIIA 3DDNA 4MUHA 4GZ6A 5JBIA 1GTSA 2PRZA 5DHUA 3PQDA 1JFTA 4D5EA 3Q6MA 2VKTA 5BN4B 2I2WA 1YKSA 1FQJA 5KNDH 2ZRCA 3GNLA 4HDCA 1ONOA 1Y4AE 3BB4A 1MJNA 2XUJA 4BLVA 1Z18A 2F48A 2FAXA 3G79A 3RSLA 4Z1MD 1ILWA 2VAPA 2RHOA 3ZLBA 3H8VA 4GMXA 2XMBA 3GDOA 4HXGA 2AHRA 1HE1C 3KJHA 4IGAA 3MS7A 4FHDA 5DCWA 4TWRA 1FVOA 2OK8A 5CA0A 2WWYA 1R6BX 3QEAZ 3ERCA 3KL2A 2GT1A 1LRJA 1XN1A 2WJWA 1NLUA 3GEHA 4I4TA 3W04A 3GLIB 1H2HA 3D2CA 1XJWA 3JRNA 3PZRA 3SYTA 3I04A 1B0PA 1HEYA 3B6MA 4R9NA 5E6RB 2OGSA 3NI2A 4REQB 1GAQA 3EZGA 4MEJA 4RK7A 2O2DA 4MMYB 1ZM9A 2FY8A 1VSTA 2CEKA 3GAAA 3DLCA 3WK6A 2CXSA 2EL7A 3BH6A 1YQXA 1B26A 1CRWG 1YZ3A 2ERXA 3DBHA 1U8EA 3E81A 4E5NA 1US8A 2ORED 5C8XA 1GQQA 3R6DA 5I01A 2D2XA 3JQAD 3T9CA 3ZWAA 3C3YA 3O21A 1STOA 1G8PA 1H6CA 4ECAA 4NESA 2XBLA 1QR6A 1YZQA 1NLMA 1DUVG 4QREA 2EJCA 3UMBA 1YRAA 3D4BA 1C3LA 2WM3A 1V1RA 3NIBA 4JB8A 3WYAA 5F3WB 2PWZA 3Q8LA 4RLSA 1UT5A 1H2YA 4HQ0A 1H65A 4H08A 4XPZA 1RQPA 4A1OA 2VOEA 1X9GA 1IVNA 3MRVA 5BUCA 1U6IA 1O95A 2QR5A 2OENG 3K0HA 1PJBA 5AJUA 5GV8A 3RTCA 3CR8A 3WYCA 4LF9B 3NVDA 3Q7SA 1C1DB 3NHMA 4AY6A 1L5WA 1M5UA 4Q1CA 4MMZB 3HO1A 4OQLA 3TAUA 4B5LA 5F73A 1DRWA 4DR3B 1W5EA 3AM5A 4YBZA 2PNFA 1RXSA 1UDCA 4BV2A 4EKNB 3FWPA 1P3JA 3AW8A 4EFNA 1X7ZB 4Y98A 2ZUCA 1J2TA 3TSCA 4EY7A 4OQFA 4ZT2A 5L8VA 4G9GA 5E3JA 5EKXA 2GNOA 2QNIA 4LRSB 4NCNA 3TS1A 4U7PB 3T1TA 3NGMA 1DS6A 1ST2A 3FI0A 3BCHA 1V48A 1TKCA 4YRCA 3T9FA 2A35A 4XARA 4PZYA 4N65A 3QOXA 1PR1A 5K4HA 1I8TA 2C5EA 3H11B 4Z0PA 3TNLA 2MSDB 1HEIA 4IHKA 3I6QA 3FWHA 3L6BA 4PQRA 4TKUA 4YV2A 3FGNA 4Z9FA 2JGEA 2R87A 4ZVKA 3RNOA 3VPHA 2CXQA 4P3OA 3E53A 3CG0A 4NX2A 1ISJA 2V96A 4V24A 4XUEA 4RABA 2W8BB 1DELA 5J4YA 3LUBA 5LQJA 5KTTA 2R00C 3O8LA 4C78A 1PZXA 1O0CA 4WADA 1BE6A 4L5CA 3SZGA 4B5KA 2ACKA 1UZAA 1DQNA 1EQ2A 1EFLA 4W9NC 2YVAA 2GF9A 4B3SB 9ABPA 4OFZA 3DZHA 5LL6P 3DQQA 3QKWA 4MUEA 2ZDHA 4C7MA 4B8YA 2LBPA 1DBQA 2FSIA 1KORA 4RQUA 5KWEA 5JISA 3WQSB 2ZXEA 1PI3A 3A7EA 2QW0X 3DL4A 3RC8A 5K4AA 3VSAA 2ZAMA 1W8IA 2OCBA 2HU2A 3MRXA 3M83A 5BT9A 3JVIA 3LBYA 4BLQA 1E6CA 2H1FA 3WRXA 2IH4A 4P2GA 1JTVA 1DV1A 1VYUA 2G6BA 2F59A 1ZD4A 2P5TB 4I5GA 4L1KA 5AIBA 2QPOA 1N7GA 4BMYA 4NXMB 4I3GA 5CT6A 4MQ6A 1Q14A 5I9LA 1TUEA 4QOJA 1NG1A 4YMSA 2HWWA 3BK1A 2JAOA 2AEMA 5E0KB 3SG0A 1XZKA 4ZDKA 5AOBA 1C8LA 3WAKA 4U00A 5TPZD 3S6JA 3QKUA 5JXIA 3A58B 3QLUA 3BDVA 4BO1A 4CM8A 4L8LA 1B1AA 1DX4A 2H7YA 5INTA 2FPPA 2GEFA 2JCYA 3DVRX 5ESRA 1IG0A 1RRVA 1SCJA 2D74A 3H9UA 4EJFA 1RYHA 1MC5A 4URFA 4PWZA 5HIAA 2ASEA 1NV9A 3DEHA 3IUEA 2F3SA 4JEUA 5EE9A 1DGQA 1UJ5A 3EYWA 4PANA 5JYCA 4QM7A 2P0AA 2WD8A 1DTSA 1I3LA 3BMNA 3Q3IA 2PNJA 2HSWA 3JYOA 3TE6A 5HKKD 5CVJA 1GGFA 4ATNA 1QTNA 3OOWA 1NC1A 4BO3A 1X1QA 3GCGA 4MIOA 2PH5A 4QYMA 5FOTA 3RRNA 3JZAA 4OBWA 3EH1A 5LWHA 1K08A 2O2GA 2DQZA 1XAJA 2OEPA 2WYVA 4HNHA 5KYYA 1GZ4A 2GFHA 4TZKA 3G7SA 1XDDA 4ZJYA 2CXTA 1FTQA 2NVUB 3V7FA 1CEEA 5BWOA 2C2KA