2L89A

Solution structure of pdp1 pwwp domain reveals its unique binding sites for methylated h4k20 and dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
b'SADDRLNFGDRILVKAPGYPWWPALLLRRKETKDSLNTNSSFNVLYKVLFFPDFNFAWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKTPPDLKEESSTDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PWWP domain-containing protein 1
molecule tags Protein binding
source organism Schizosaccharomyces pombe
publication title Solution structure of Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA
pubmed doi rcsb
total genus 18
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l89A00
2GF7A 3OA6A 3ASKA 2X4WA 4Q5WA 2WACA 4IUTA 3OYEA 4A4FA 5J26A 2VYTA 4CRIA 3UWNA 1H3ZA 2BIVA 2D9TA 4L59A 4QW2A 4BD3A 5KCHA 2X4XA 1OZ3A 3KUFA 4N4IA 1MHNA 3NTHA 2LRQA 4QQGA 3MP1A 4GY5A 3QBYA 3QKJA 3P8DA 5FRNA 4RG2A 4Z02A 2G3RA 2R5MA 2R57A 2EQKA 2RHUA 3MEAA 4IUVA 4E7JA 3S3NA 2EQJA 3H8ZA 3MEVA 2MWOA 2QQSA 4QVZA 2P0KA 3MO8A 5D6WA 4BDZA 2RHZA 4ZTJA 1OI1A 4BE0A 2HQXA 2PQWA 3OYNA 2EKOA 3NTKA 3EAEA 1G5VA 2GFUA 2LVMA 3M9QA 1KHCA 3FEOA 5D6XA 1SSFA 3OYKA 3OYDA 2BKDN 4ZTFA 5M9OA 2RI2A 4FU6A 2K3XA 3ZEHA 5IAYA 2CKKA 3OQ5A 3PMIA 2NLUA 5FROA 2RJDA 3QJ6A 4NS5A 2MWPA 5KH6A 4HCZA 5J39A 2RJCA 5CIUA 3OYMA 3OYHA 2RHYA 4IUUA 3FC3A 4BE2A 1OYXA 5C6SA 3OMGA 3L2QA 3L2VA 5KE3A 4E7LA 1OZ2A 3MP8A 3S6WA 2O4XA 4QQDA 2LDMA 3BDLA 3E9GA 3OYLA 3H6ZA 2L8DA 2RI5A 3O8VA 2RO0A 3LGLA 5KE2A 3DLMA 2R58A 3OYBA 3MEUA 2F5KA 4E7HA 2E6NA 3LLRA 3PMTA 3NTIA 4IUQA 4EDUA 2XK0A 2RHXA 3E9FA 5C0MA 4E7KA 3MEWA 4II1A 4PL6A 3L2WA 2E5QA 4C5IA 4BDYA 2K3YA 2L3RA 4B9XA 4E7IA 3PNWC 4UC4A 4PLIA 3FLGA 2FHDA 2M0OA 4FL6A 2DAQA 4A4EA 3S3OA 3OYIA 1WGSA 2RHIA 2IG0A 4N4HA 4IKFA 2DIGA 2XDPA 1WJQA 3LX7A 4OVAA 5IN1A 4B9WA 3FDRA 3OYAA 1RI0A 3OYFA 2R5AA 2LCCA 4LD6A 2RI3A 4C5GA 3OYJA 3LYIA 3MP6A 3OYCA 3UT1A 2X4YA 3ME9A 3OS1A 2JTFA 2YRVA 2RJFA 2RJEA 3LH0A 4A4HA 4IURA 3L2RA 2EQMA 3OB9A 5KCOA 1WJSA 3OMCA 5D6YA 2O4XB 3META 3F70A 2M1HA 3OY9A 2L89A 2BUDA 5FRMA 3DB3A 3OS0A 4IUPA 2EFIA 4QQ6A 3C4SA 2M16A 2JZ2A 3SD4A 4BE1A 2QQRA 4PLLA 3L2UA 2LTOA 3Q1JA 1XNIA 1WJRA 3P8HA 3CEYA 3GOXA 2B8AA 4BACA 3LGFA 2GFAA 4C5EA 3QIIA 2HQEA 3OYGA 2DIQA 2EQUA 4N4GA 2X35A 3DB4A 1N27A 3PFSA 4C5HA 3OS2A 3S3MA 4A4GA 4X34A 3L42A
chains in the Genus database with same CATH superfamily
3LWIA 1XTDA 1H3ZA 2VUBA 1FXXA 1IGQA 4AG2C 4ZGJB 5LJ5h 1UE9A 4HT9A 1GBQA 2KXCA 1VOMA 2RQVA 2I2LA 1BCMA 4AT1B 3THKA 3C95A 2Y4YA 3CD6A 2HSEB 3FRNA 5IHIA 2YLBA 2CSIA 1YHQQ 2K9GA 2NUPB 3G71A 4JDSA 4LDWA 5IHKA 3MPUB 1H8KA 1QVFS 2CKKA 2NLUA 3EFOA 3GPLA 1GCQC 2BE7D 4M7DA 4FSSA 1BKBA 2RQRA 2K5LA 1YHQA 1ACMB 2RO0A 4A53A 5IHNA 3TSZA 2KEAA 1OPKA 2L3RA 1ZUYA 1K4US 4E7IA 1MNDA 4KH1B 1QCOA 2EJFA 3LH5A 4AFSC 3EG0A 4E47A 2VXEA 1M3AA 4OVAA 1R8OB 2PUKB 3I55T 1OX9A 3A1PA 2LCCA 4XTUA 2RD1A 3LYIA 3MJXA 3OS1A 2JTFA 2XDBA 1PNJA 1YCYA 2KAFA 3RBBB 1JXMA 1TH7A 2NUPA 5KYYA 3JCMX 2EFIA 2ZPGB 1PRLC 4OMFB 1RI9A 1Y0MA 1Q81C 1RAHB 4DEXA 4PKCC 1IZ6A 1WJRA 1YITT 2CP0A 1RAEB 2DKGA 1H92A 2IPOB 4KT0E 3X28B 2HAXA 3VUZA 2H8HA 5CK9A 1X75C 3RMQA 4LE9A 2HD0A 1M1KU 4DQ2A 3CCJA 1YJ9A 3L42A 2O31A 2DF6A 4A4FA 1CSKA 2PNIA 1TOVA 4Z88A 1Q7YU 4C92E 4JJCA 3M59A 3G1JA 1EX4A 2VXFA 4C8QF 2COYA 2ENMA 2XICA 4M78A 1YJ9Q 1WFWA 2KK4A 3V8KA 4M78B 1VQOT 4QT7A 4C8QD 1NLOC 5L23A 1PHTA 4OMPA 4HXJA 4XAXB 1A0NB 5GMKe 2RJDA 1VQ8Q 1YFNA 3INZA 4KH0B 1W2BP 3OYMA 2QAZA 2RHYA 3VKIA 1QLYA 1X2QA 1AWOA 4OMQA 1KC8C 4AG1C 1NE8A 2RI5A 2R58A 4E7HA 2JN0A 1WZOA 4F04B 3PMTA 1B34B 2QG9B 2J6FA 3M0PA 4F7UA 2XU8A 1LNXA 4BDYA 4J9DA 1YIJQ 1MUZA 3VJPA 1QP2A 3CC7T 4PJOB 2DEUA 4JJBA 1TSFA 2DXCA 2FRWA 4FIBA 1WGSA 4IKFA 4N4HA 1T3SA 1YWOA 2LJ1A 3FDRA 1W2BS 4OB1B 1Y7XA 3VS2A 3CMEA 4R55A 3NPFA 3QZ5B 2AHJB 4JPBW 1BIAA 1S72T 3A5ZB 5FU6B 5GAOm 4ATOA 4O5VA 2RPNA 3G4SA 2IVWA 3ER0A 2XG8D 2CH4W 4M77F 2CS7A 4N4GA 1VIFA 5GAMe 2MMPA 2C0OA 4KGXB 1E7OA 3CMAT 4BI8B 4OMNA 3L1AA 4DBQA 3A8LB 2DNUA 3JCMJ 3OA6A 3EGDB 3I9QA 3CCLT 4IUTA 4RUGA 3OYEA 4RMOA 1V1CA 1KFZA 4RTYA 2OX7A 1NJIR 2X4XA 3CMAQ 2KXDA 4KGVB 3HP9A 4JLGA 3JCMf 3TSWA 3ZBDA 1AWWA 5GMKi 3G71T 4AFQC 2G3RA 5GAN2 2EQKA 3C0CA 2NWMA 4M7AC 2LX7A 1KQ2A 2RA2A 1QWEA 4J6YA 3JB9F 1PKSA 1G3SA 1RAFB 4V2SA 4ZGDB 1G8XA 2QGGA 3IQLA 2ZGWA 3VS4A 2E41A 4HVVA 2K5IA 5C6SA 3CBPA 1IXDA 2DXUA 1OZ2A 4DA4A 4RTWA 4M78G 4C92C 3CCEA 2XKOC 3H6ZA 2L8DA 3NGPA 4LDUA 4J9GA 3VV0A 1VQ6T 1Y57A 1UB4A 2D0NA 3MKDA 3PNWC 3CCEQ 2GBQA 3LX7A 3JSCA 2K4YA 1HXDA 4LDXA 3OYJA 2RQTA 2CP7A 1FMVA 2VWFA 1G3WA 2EPDA 2M02A 3H0IA 1JEGA 2L3QA 4IUPA 1VQKQ 1D3BB 3SWNA 2EW3A 1WQ7A 1VQ5A 4M75C 3REBB 2GFAA 2FB7A 1N5ZA 1Q82U 2GTJA 2QQAA 2YDLA 2RMOA 4C5HA 4PJOD 1N9RA 4M7DF 5KYXB 3M4GA 2K6DA 5CKBA 3HHTB 5GAN3 4M77E 2D8HA 4EIKA 5LJ5j 1ZBXA 1S72A 3G71Q 4QQGA 1W6XA 2E3HA 4M75F 1UGVA 1PM3A 1D3BA 2DRMA 3C94A 1M9SA 4R56A 1NEBA 2L0AA 4KRTA 3MEVA 3PIOA 2KSSA 5CCAA 4F17A 2XDDA 4JZ4A 3CC7Q 1OI1A 1FMWA 2GFUA 5GAOp 2E3IA 2BKDN 1JRIA 3ZEHA 4M77A 2X51A 1VQPA 4JS5A 1SRMA 5FLXE 1M30A 4ESRA 5I22A 2F1LA 4D8KA 1MMGA 1YNZA 1WNLA 1Z9QA 4KUDK 1NPRA 3O8VA 2QTXA 2EIFA 1M2VB 3M0UA 1I07A 1U06A 2A3LA 1NG2A 4LD9K 2KDSA 3MEWA 3EGXA 2BZXA 4PL6A 2FPFA 1MV0B 3RDVA 5GANd 1WX6A 2E5KA 2ABLA 2MI6A 4BY6B 3CCLQ 1QQJA 2A08A 1HSQA 3HPWA 2V1QA 2XDPA 4MZMA 1K73U 5I2MA 3G4SQ 2A7YA 3OYFA 2OTLQ 4E7SA 2MYSA 3MP6A 3KXTA 1U8RA 4J9BA 4PJJA 2DD5A 2K7AA 5GJVB 8ATCB 2E4HA 5HY6A 2QASA 1NEGA 1XOVA 1K0XA 5LJ3h 3V7CA 5A0LA 1Q82C 2V26A 2MAMA 2DJZA 5GAN5 1QVFP 2EQUA 3ULRB 4FCYA 1FWZA 2BTTA 4M7AB 3OS2A 4OB2B 4K11A 2Y90A 2CUBA 3EGDA 2X4WA 4XTYA 1JBMA 2DRKA 1M90C 5CQXA 1FX7A 2JOYA 3JB9J 4XU2A 2FVUA 4X9CA 1AZGB 1UFFA 4GY5A 4WCIA 4C0FA 3UATA 3OSVA 3G7ZA 9ATCB 1U3OA 3VS0A 4MDXA 2YUOA 3CCUA 3QSUA 4A4KA 4C0GA 2HKQB 1T0JA 4QVDA 1KIKA 1B7TA 3A8GB 1VQ5T 1W4SA 4PJNA 3RKYA 2ATCB 1EIFA 1YN8A 2EJ9A 5GJWB 4JJDA 2G6FX 5GAN4 4F7UF 3CCQQ 1IHVA 2H3JA 2KQWA 1KQSS 5GAMh 4DBFA 2ZCFB 5GANj 1XQHA 3A8OB 2VASA 3A8HB 4PLIA 3JCMP 2D6FA 4J9FA 4XU1A 2E70A 2WSCE 3CCSA 1M2OA 2A0FB 1WHHA 1X43A 2JM9A 4LD6A 3CPWA 3KBGA 5DY9A 5KYNA 2AK5A 1LOJA 2LT1A 2RJFA 3M0TA 2A36A 1PRMC 1D1CA 1O9SA 4FYVB 1D1BA 5KCOA 1WJSA 3RERA 1H641 3QUIA 2QQRA 4RTVA 2QA4Q 4F7UE 4QKUA 3GBQA 1P92A 3JCMb 4DOWA 2CYZB 2VVKA 1K0SA 4F16A 4HT8A 4A4GA 2GGRA 3M55A 2YUNA 3QDFA 2WACA 1JJ2P 5J26A 4GBQA 4WF2A 2JJ9A 5KCHA 3M57A 4HCKA 2D1XA 3G4ST 1M8VA 4XU0A 4RCCA 2YXYA 5KYYB 3X20B 4M75E 2P0QA 2DLPA 2DVJA 3EAEA 3CC2A 2AKLA 1NJIC 2LQ8A 2LT4A 2VKNA 3CD6T 1WLPB 5CQYA 5IAYA 4M7DG 3T9NA 2RJCA 3OYHA 1H3HA 2RQUA 4PJOE 1GL5A 1N8RR 3MP8A 3BDLA 1ZBJA 2K2VA 2RF0A 1GCQA 2QYZA 1O75A 5GMKm 2E12A 2KT1A 3QO3A 2XIDA 5GANf 4PJMA 4B9XA 4TVRA 4MMKA 2HCKA 3WVDB 3S3OA 4J7FA 2QK0A 2DIGA 1WJQA 4ANJA 1WHMA 2YRCA 2CZ6B 1JB0E 3H0FA 1X2KA 1KSWA 2F5TX 4P5NA 2YHTA 2HMAA 4QQ6A 3C4SA 4XK8E 1DJ7B 3L2UA 4HVUA 4XTVA 5I11A 3GF5A 1RADB 3UA7A 3HRTA 2GQVA 2X35A 2BE9B 1AWJA 1VQKT 1HJDA 2AIRB 3CC7A 1VQ7Q 3CCQT 4J7IA 5DM7R 5GAMf 1WQWA 4JUVA 4PJOF 5KYXA 4JRIA 5A0GA 1Q82R 3MP1A 1KHIA 2EGAA 2C06A 3I56A 3P8DA 3QJYA 2V1RA 1YP5A 1VQ8A 2R57A 2OAWA 3CCVQ 3HKSA 2KT8A 1M27C 4PNOA 1VQLT 2ECZA 1G83A 1SSFA 1VQ6Q 1OPLA 4J9HA 2DVEA 1X69A 2COZA 4C8QB 1HYOA 3L2ZA 3OQ5A 4FYYB 2B86A 1SKUB 3JV3A 3WXMB 1KC8R 5A0DA 2M51A 4PJLA 4JRPA 3SEMA 1KQSA 3L2VA 1VUBA 1VQOQ 3DLLA 3JCMV 4CI0C 1YBYA 2EQIA 3OYBA 3MEUA 1AVZC 2GCXA 2RHXA 1ZQ1A 1ZUUA 4BB7A 1KQ1A 4QVCA 1GRIA 2FHDA 2DAQA 3X26B 2SEMA 4YTLA 3CXCP 2RH2A 3OS5A 3UT1A 2J6KA 3M0SA 3RESA 1T0HA 1YJNQ 4PJOC 3JCMW 3CCVT 1RAGB 3EG2A 1UECA 1QCFA 3OMCA 1IREB 1AT1B 5L8RE 1D1AA 2FPDA 2FPEA 4NOYA 4L5GA 2DTHA 1IB8A 1VIEA 1KK7A 1AEYA 2RN8A 1RUWA 2PVOB 3EGUA 2DBKA 2L5QA 3VS6A 1SPKA 2DEQA 3SFMA 2CZ0B 1PKTA 1OEBA 3EFOB 3QHSA 2NYSA 2JM8A 2LMJA 1M1FA 1YITA 2DZ9A 2C0IA 5GAOq 2JUFA 3UWNA 2BZYA 4L59A 3OBYA 2QI2A 3EFRA 3VS3A 1Y71A 5GAN7 3URGA 2PVDB 4XTZA 1Q81R 1NYFA 2EQJA 1BI0A 3PGGA 3CPWS 1OV3A 3NTKA 4MDWA 1TTHB 3RMSA 1BIBA 5D6XA 2EGEA 5GANg 3OYKA 4C92D 2IIMA 1YJWA 2V8KA 3UPUA 2DFUA 4CC7A 4GLMA 5CKEA 3E1SA 1RLPC 4OMLA 3V8JA 1SF9A 2HBWA 2JXBA 5KYUB 3CCUQ 1HK9A 1WHKA 2JT4A 2DL5A 2MIOA 2CP3A 4ELYC 4M77C 4JJNK 5FU7C 1Y96B 2YUQA 5I2SA 1UEBA 4J9IA 1KC8U 1YI2A 3JCMc 1YI2T 4FYXB 2RHIA 3FJPA 1GBRA 1VYUA 2EKHA 4M7DC 2FG0A 3EG9B 2DD4A 1X6BA 3TQ7P 1W2BA 1WXBA 1JQQA 2YT6A 4J9CA 2PZ1A 3HRUA 4M75D 4A4HA 1NYGA 4C8QG 5HK3A 2BUDA 4BY6C 4DBRA 5FWCA 1W1FA 1VQLQ 4BE1A 4PLLA 2E6ZA 4N0AC 2L2PA 1S72Q 2B8AA 3HTRA 2DL8A 4C5EA 2KE9A 4OF1A 3E19A 2FYKA 2JW4A 3EH2A 2HZYA 3S3MA 3SWNC 3VS1A 4AFUC 2CREA 4Q5WA 3M54A 3P8BB 4BI3A 2QA4A 2AZSA 4M75B 4OB0B 5FU6C 1UTIA 3EFSA 2LP5A 2EYQA 4AMCA 4M78F 2LNHB 3OBWA 1U5SA 3ZFJA 4EMHA 1VQPQ 2DTOA 1QVGS 4LDVA 3R6OA 2YWWA 2QEXT 3J80E 1B07A 2CDTA 3RR6A 2QEXA 4O6JA 2DZCA 2RI2A 3CMET 2Z0WA 2XHCA 2KYMA 2DJQA 1Q86R 3JCMg 3HFOA 4J6XA 4BE2A 4NL2A 3C12A 1N8RC 4QQDA 2LDMA 3JCMh 1UDLA 4WTOB 2EGCA 3E9GA 3OSSC 1WDXA 1X6GA 5KE2A 4PK4A 3AT1B 1ZX6A 4ZNXA 1R0BG 4JLIA 1GCPA 2COWA 1WXTA 2IG0A 4B6MA 2VV5A 4LUDA 3CC4T 1M90U 3QYHB 1LPLA 2ROTA 4RG8A 1K9AA 1ZLMA 3VYGA 4AFZC 3CCJT 2KBTA 3EG3A 1CKAA 2EQMA 2HBPA 2M1HA 2KI7A 1B34A 4JZ3A 3DB3A 1TUGB 2FRYA 2M16A 4DEYA 2FZKB 2LTOA 1BI2A 2NUTB 5EC7A 3PTAA 3I55Q 3VRYA 1G2BA 1MMNA 3H9NA 2LQWA 2GF7A 2FZGB 1OX8A 3UF4A 2JTEA 1VQ6A 3OW2S 3SDZA 1MNEA 4LN2A 5A2QE 1PD1A 2QDYB 3RKXA 1UUEA 3QPHA 2X3XD 4C8QC 3H8ZA 4M4ZA 2QQSA 2YSQA 3JCMQ 3G6EA 3X25B 4BE0A 3JB9I 3CCRQ 1IHWA 4EPCA 2LQKA 3PMIA 1TUCA 1I5LA 3QJ6A 4NS5A 1M5Q1 3VYHB 1VQ4T 4IUUA 5LJ5g 3G6EQ 4HCCA 1SHGA 2E10A 2NUTA 1NM7A 2KMTA 3BDUA 1Y07A 2MF2A 1Q86C 3QG1A 2F5KA 4PFZA 2QA4T 1RABB 1OU9A 2O9SA 2E5QA 2RQWA 1E6HA 1KD1U 4CC3A 2F69A 2EWNA 3I5SA 2CP6A 2LC4A 2CUDA 3CBMA 2DL3A 3CCMT 2LX9A 3VRZA 1T3LA 2D0QB 4X9DA 1Q7YC 5LJ5d 1X01A 1AHJB 1AWXA 3EH1A 3A98A 4C5GA 3M56A 3ME9A 3LH0A 4RTXA 1XJWB 3CPFA 1UJ0A 2RM4A 5FWBA 5GAN6 4L6V5 3CCLA 5D6YA 4EMKA 1IGUA 2AKKA 1V29B 1ARKA 3CCUT 1XNIA 1GXIE 1ZA1B 1AOJA 4M7DB 3HRSA 4M77D 2EYWA 5GAN8 3JCMd 5LJ3e 2RK2A 5GANe 1N27A 2XD0A 3OW2P 3CD6Q 4LDYA 2XMFA 2OTJQ 2HQHA 4KBMB 3R6NA 2VYTA 2LQNA 3HSBA 1WA7A 3VUBA 5HKCA 1LCKA 3KUFA 1QVFA 1YWPA 1MMAA 2LRQA 1KQSP 5CR2A 4M7AG 5FRNA 4EMGA 4XU3A 1FYNA 5LJ3g 2R5MA 4E7JA 1K8AR 4D8DA 2M0YA 4QVZA 2RHZA 2D8JA 2PQWA 1K9MU 2L3SA 3FEOA 4XTXA 2E64A 4J83A 2P84A 2XI9A 1RACB 1VQ4Q 2ZPBB 2M9UA 1SSHA 3M53A 4LXCA 5CKHA 5CIUA 3EG1A 2PUOB 3VS5A 3CXCA 3L2QA 1NLPC 1E6GA 1K1ZA 2DX1A 4EMKB 2KRNA 1M3CA 2CZ7B 3CC4A 4OGEA 4E7KA 5CKFA 3BW1A 1I5OB 2F2VA 2DA9A 2DO3A 4HVWA 3AHUA 3QDRB 2M0OA 3CQTA 2ZPEB 4D6WA 3SHWA 3PVLA 4M77B 2MPXC 5FU7B 1MGQA 5LJ5f 2RJEA 1KD1R 1KD1C 3L2RA 2J7IA 3J7AF 1Y96A 1VQ9Q 5CAIA 1VQ7A 2E65A 3M58A 1OULA 1QWFA 1YJWT 4XTWA 4BACA 1TUDA 2MCNA 4R0KA 1PD0A 4FW2A 1I81A 4IIMA 2DE0X 1OQKA 3CCET 1QVPA 5LL6S 2HNIA 4C0DB 2KY9A 4RKUE 2QQBA 4LUEA 5AT1B 2D9TA 4HA8A 5IT9E 1MHNA 1VQMQ 1JU5C 3SWNB 2KVQG 3DKMA 3V8LA 2J6OA 3BY7A 3TVTA 4CC2A 3MO8A 1NPPA 1VQOA 1ABQA 2E1HA 1G5VA 4M78E 1SG5A 2F2WA 3KFVA 4ZN3A 2LVMA 3HL8A 4M7AA 4EMKC 1M4ZA 4FM4B 1F1BB 4C0ZA 3PIPA 4ORZA 1BK2A 1PCXA 5GAMj 4FW1A 2LZ6B 2WSFE 2X9HA 3BFMA 1J3TA 2DPPB 4BUGA 4ZGEB 5D7UA 2HEQA 1OYXA 4Z89A 3E2UA 2PTKA 3OYYA 3CC2T 1QVGA 1RL2A 1JXOA 5C0MA 2Y4XA 4II1A 2DERA 2GTOA 3U23A 3G6ET 4M7AE 4M75G 2QXFA 4J6WA 1ZA2B 1D0YA 2OTJT 1G3TA 1SHFA 3QZ9B 4OMOA 1AD5A 4B9WA 1K9MR 3TCJA 1QKWA 1ZSZA 4FYWB 5KYWA 3JB9H 2BZ8A 4FSXA 3I55A 3I5RA 2O9VA 4C8QE 3CCJQ 3M0QA 5DLOA 3M0RA 1IO6A 1RAAB 2EJGA 2LNVA 1I4K1 2DL7A 1K9MC 2JZ2A 5GAOr 3SD4A 1I0CA 1Q81U 1G3YA 5LJ3f 3HFNA 4MZPA 5GMKh 2CH4A 2FZCB 3RUXA 3PT9A 4A63B 2FEIA 2DK3A 3GNGA 5CO7A 2DTIA 4MMLA 1Q86U 1VQNQ 1WPYA 2OI3A 1WHLA 2ROLA 2FL7A 1WHJA 3GNFB 2OTLT 3LW5E 4F7UG 3JCMe 4BD3A 2OJ2A 3H41A 4N4IA 1VQNT 2DYBA 2F2XA 4C0DC 4IUVA 4M75A 2C0TA 2MWOA 1BBZA 4BI4A 1C1AA 1Q95G 2P0KA 4ZTJA 3OYNA 2QTVA 5CVIA 1KJWA 5GAMg 1KHCA 4HKEA 4Z8AA 4FU6A 3CC4Q 3I56Q 1GFCA 4M78C 4C92G 3EHQA 1Q7YR 2HKNA 2MWPA 4X1VA 2FO0A 2LJ0A 2HL3A 3CXCS 1X27A 2PU9B 3CCVA 2YRDA 2A28A 1V76A 5LJ5e 4XQ3A 3CCSQ 2W0ZA 3UA6A 2O01E 3LLRA 3NTIA 3E9FA 3N5BB 2KRSA 7AT1B 4C5IA 3CCMA 2ED0A 3MCAB 1YJ9T 1TWBA 3TU4K 5IH2A 4E7ZA 4M77G 4J9EA 1VQ9A 1VYTA 2ZPIB 1BI3A 3VU3C 1UGRB 1VQLA 1EFNA 4RTUA 2LCLA 4HCBA 1RI0A 4M7AF 1JJ2A 2RI3A 1VQ8T 2X4JA 2AT1B 2VC8A 3CCMQ 1I8FA 2A37A 3X24B 3ZL7C 3PE0A 4PFOA 1QMCA 3NMZC 4M7AD 3META 1VQPT 4JS4A 1RAIB 4KULA 5KYUA 2J06A 2YLCA 1ABOA 3Q1JA 2CP2A 3CMAA 3GOXA 3J81E 2KRMA 2VGNA 3OYGA 1YJNA 1N6AA 3JB9G 3CMEQ 2CZ1B 4VUBA 2NUZA 2ED1A 3CPWP 1M1KC 3CC2Q 2AZVA 4LNPA 2QGFB 4M7DE 1BU1A 1SEMA 4ELZC 4M78D 3SB2A 4DBHA 1N9SA 4KUIA 4RG2A 5FW9A 2OTJA 3VS7A 4BDZA 3JRZA 2QDLA 1CKBA 1PSEA 3M9QA 5GAMd 1VA7A 2MK5A 4OP0A 2W10A 4OB3B 4KGZB 1ZUKA 2X3WD 3M4YA 5J39A 4OGCA 3FC3A 3PVQA 1ZSZB 1C0MA 2GQIA 2QEXQ 5IXFA 1LJOA 4FT4A 2I0NA 2JMAA 2OTLA 4EDUA 4IUQA 2ZPHB 3JAME 3L2WA 2DXTA 3RNJA 4MZTA 5GANh 5HCKA 3EGXB 3FJ5A 1BYMA 1SRLA 2P4RA 2DXBA 3A8MB 1YCSB 1N8RU 3FLGA 1M2VA 1UJYA 4PJOG 3TEEA 2CT3A 5IN1A 1UGSB 2CSQA 3OYAA 5I21A 2R5AA 3I35A 1UHFA 4Y28E 2K57A 4F14A 4JRQA 3QXEB 4OMMA 1MMDA 1K8AU 3QYGB 2YUPA 4IURA 4C92F 1OOTA 2O4XB 2K3BA 2OAUA 2DMOA 3QWYA 1R0CB 5FRMA 4E2FB 5CKDA 1NJIU 2KR3A 5LJ3d 3CEYA 3QIIA 1QKXA 2HQEA 2KGTA 1FMKA 4E6RA 2LJ3A 3GLXA 1VQKA 1QCNA 1PWTA 4NL3A 1ZHIA 1TXQA 4FT2A 4CRIA 2BIVA 2O2OA 5AYFA 1OZ3A 2V8JA 1ZSGA 2P0PA 1D0XA 1EZZB 3CCRA 5HK0A 2RNAA 2ZAEA 3M5AA 3TREA 2EYXA 1VQMT 5GAOl 5IXBA 1M8MA 2RHUA 1U1SA 5D6WA 1UHCA 2EKOA 1UG1A 2CP5A 2PVGB 2JVVA 4RCBA 1X6OA 3OYDA 2EYZA 3NHNA 2VB6A 2JS0A 4J8OA 3BE3A 5KH6A 3LWHA 3CBOA 3EG9A 4E7LA 2ZPFB 2O4XA 2HDAA 1VQ9T 3DLMA 3I56T 1WXUA 8AT1B 2E6NA 1I1JA 2XK0A 3CCST 2H3EB 1D0ZA 2K3YA 1ZSZC 2RB6A 1PC0A 1NZ9A 4UC4A 4GLKA 4FL6A 3OYIA 2DETA 1K73R 1K73C 1UGPB 4RTZA 1YHQT 5GMKj 2DL4A 3OYCA 4DOVA 2YRVA 3H0HA 5ECAA 1PSFA 3JB9D 1PG5B 3UDCA 3OB9A 3OY9A 1WI7A 5EG2A 4C92A 2L89A 1YITQ 2EYYA 1W70A 3REAB 2GNCA 1QVGP 3P8HA 2QQ9A 3LGFA 4JRKA 2DIQA 1S1NA 1QP3A 3DB4A 3V7RA 3PFSA 1M1KR 1YJNT 4X34A 5GAOn 3ASKA 2K5FA 3O5ZA 2KROA 1GFDA 2ESWA 3QWXX 2EBPA 4QW2A 1IRXA 2KYBA 5DLQE 2JS2A 3NTHA 4IIOA 2O88A 3QBYA 3QKJA 1TS9A 4Z02A 3MEAA 1VQNA 2ZZDA 3S3NA 5GMKl 3OW2A 2P4TA 3RKWA 1JJ2S 2HQXA 1BI1A 1VQ7T 3MHXA 2WSEE 1UGQB 1TG0A 1M90R 1M3BA 2VGMA 5KYWB 4C92B 1BCOA 3CCQA 4ZTFA 5M9OA 2K2MA 2K3XA 2MOXA 1LVKA 3FB9A 1D09B 4RTTA 5LJ3j 1K8AC 3D7SB 3WVEB 5FROA 3NFCA 1WIEA 1YI2Q 2K79A 4HCZA 2EVRA 6AT1B 2HL5C 4J5YA 2HSPA 3OMGA 1YIJT 1Z9ZA 1R77A 2CT4A 5KE3A 3S6WA 2JMCA 1QW1A 3OYLA 4ZN1A 3LGLA 2DILA 1YJWQ 4PJOA 1OU8A 1M1GA 2JNGA 1B3QA 1VQ4A 4PFPA 1AZEA 4Y91A 1WYXA 1JO8A 1TU0B 2L3PA 4F7UB 5J3BA 4A54A 1KG1A 1MV3A 2KNBB 4A4EA 4ME7A 4C8QA 1VQ5Q 1C6VX 2EAYA 2X4YA 1WHGA 2DBMA 1RLQC 1YIJA 2DM1A 2DYIA 1BB9A 3GP8A 3GIBA 1U1TA 3F70A 3OS0A 2SRCA 1VYVA 1K76A 1NBEB 3FIFA 4M7DD 3RIRA 1VQMA 4CC4B 2V8IA 2J05A 4Y92A 3EHRA 2CGHA 1HD3A 3V7SA 3CCRT 2RK1A 2LCSA 4N0AA 2JTMA
chains in the Genus database with same CATH topology
3LWIA 2X4WA 4Q5WA 1JBMA 1XTDA 2FL7A 3M54A 3P8BB 4XTYA 3GNFB 2QA4A 2OTLT 4BI3A 1H3ZA 2VUBA 1FXXA 3LW5E 4M75B 5CQXA 4F7UG 4OB0B 1FX7A 4ZGJB 5LJ5h 2JOYA 5FU6C 4BD3A 3JCMe 4HT9A 3JB9J 4XU2A 3EFSA 4N4IA 1VQNT 2EYQA 4E7LA 4M78F 2FVUA 4X9CA 2I2LA 4GY5A 3OBWA 3ZFJA 4C0FA 4EMHA 3OSVA 3G7ZA 4C0DC 4IUVA 2DTOA 3C95A 4M75A 1QVGS 4LDVA 2Y4YA 3CD6A 4MDXA 2MWOA 3R6OA 4BI4A 2P0KA 4ZTJA 3CCUA 3OYNA 3FRNA 2QEXT 2YLBA 3J80E 5CVIA 3QSUA 4A4KA 5GAMg 1KHCA 4C0GA 4HKEA 2QEXA 4QVDA 4O6JA 2DZCA 2RI2A 4FU6A 4JDSA 4LDWA 3G71A 3CMET 2XHCA 1QVFS 2CKKA 4M78C 4C92G 2NLUA 3JCMg 3A8GB 3HFOA 1W4SA 2MWPA 3GPLA 1VQ5T 3RKYA 4J6XA 4BE2A 4NL2A 3CXCS 1EIFA 3C12A 1M90C 2PU9B 3CCVA 1N8RC 4M7DA 2EJ9A 1BKBA 4QQDA 2LDMA 5LJ5e 3JCMh 3E9GA 4XQ3A 2K5LA 1YHQA 3OSSC 5GAN4 2RO0A 5KE2A 4F7UF 4A53A 2O01E 3LLRA 3NTIA 2H3JA 2KQWA 3E9FA 3N5BB 1KQSS 5GAMh 4C5IA 3CCMA 3MCAB 1YJ9T 2ZCFB 2L3RA 5GANj 1XQHA 3TU4K 3A8OB 3A8HB 4E7IA 4M77G 2EJFA 4PLIA 3JCMP 1VQ9A 4JLIA 2ZPIB 2D6FA 1BI3A 3VU3C 1UGRB 4XU1A 2IG0A 2E70A 4E47A 2VV5A 2VXEA 1VQLA 2WSCE 3CC4T 4OVAA 3CCSA 1R8OB 2PUKB 3QYHB 2LCLA 3I55T 1M90U 4HCBA 1RI0A 4M7AF 2LCCA 4LD6A 3CPWA 3KBGA 2RI3A 4XTUA 5DY9A 2RD1A 1JJ2A 1VQ8T 2X4JA 3LYIA 2VC8A 4RG8A 1LOJA 2LT1A 3VYGA 2JTFA 3OS1A 1I8FA 2RJFA 3X24B 3CCJT 2XDBA 1YCYA 1O9SA 2EQMA 2HBPA 2KAFA 5KCOA 1WJSA 4M7AD 1TH7A 3META 2M1HA 3RERA 1H641 1VQPT 1B34A 4JS4A 3DB3A 4KULA 3JCMX 2EFIA 2ZPGB 3QUIA 2M16A 4OMFB 2YLCA 1Q81C 2QQRA 2LTOA 4F7UE 3Q1JA 4PKCC 1IZ6A 1BI2A 1WJRA 1YITT 1P92A 2DKGA 3CMAA 3GOXA 4KT0E 3X28B 3JCMb 4DOWA 3VUZA 3J81E 2VGNA 3OYGA 3PTAA 2HAXA 5CK9A 1YJNA 2CYZB 1X75C 3RMQA 1N6AA 3JB9G 2HD0A 1M1KU 4DQ2A 3CCJA 2CZ1B 4VUBA 4A4GA 1YJ9A 4HT8A 3M55A 3L42A 2GF7A 2WACA 4A4FA 5J26A 1M1KC 1Q7YU 4WF2A 4C92E 5KCHA 3M59A 1VQ6A 3OW2S 3SDZA 4M7DE 2VXFA 4C8QF 5A2QE 2QDYB 4ELZC 3RKXA 2XICA 3M57A 4M78D 3SB2A 3QPHA 1N9SA 4M78A 3G4ST 4KUIA 4RG2A 1M8VA 4XU0A 2KK4A 4RCCA 4C8QC 3V8KA 3H8ZA 4M78B 1VQOT 2OTJA 2QQSA 3X20B 4C8QD 3JCMQ 3G6EA 4BDZA 3X25B 4BE0A 4M75E 2P0QA 3EAEA 3CC2A 3JB9I 1NJIC 3JRZA 2LQ8A 2LT4A 5GAMd 1PSEA 3M9QA 3CD6T 4OP0A 4XAXB 5CQYA 5GMKe 4EPCA 5IAYA 2LQKA 4OB3B 3PMIA 1I5LA 4M7DG 3T9NA 2RJDA 3QJ6A 4NS5A 3M4YA 1M5Q1 2RJCA 3INZA 3VYHB 5J39A 3VKIA 2RHYA 4IUUA 4OGCA 5LJ5g 3OYMA 3OYHA 3FC3A 1VQ4T 4PJOE 4HCCA 3MP8A 2E10A 3BDLA 1KC8C 2KMTA 3BDUA 1NE8A 1Y07A 2K2VA 2MF2A 2RI5A 2R58A 4E7HA 1LJOA 2F5KA 3QG1A 2JN0A 4FT4A 1Q86C 3PMTA 1O75A 4EDUA 4IUQA 1B34B 5GMKm 2QA4T 2E12A 2ZPHB 4F7UA 3JAME 2XU8A 3L2WA 2E5QA 2DXTA 3QO3A 4MZTA 1LNXA 4BDYA 1KD1U 2XIDA 5GANf 5GANh 2F69A 2EWNA 4B9XA 3VJPA 1QP2A 1BYMA 2DXBA 4TVRA 3A8MB 2LC4A 4MMKA 1N8RU 3FLGA 3WVDB 2DXCA 3CC7T 3S3OA 4PJOB 4FIBA 3CBMA 3CCMT 1WGSA 4J7FA 2LX9A 4IKFA 4N4HA 2DIGA 4PJOG 1WJQA 2D0QB 3TEEA 4X9DA 5IN1A 1UGSB 1Q7YC 5LJ5d 1X01A 3FDRA 3OYAA 1AHJB 5I21A 2R5AA 4Y28E 1W2BS 2K57A 4C5GA 3M56A 4OB1B 4JRQA 3ME9A 3LH0A 3QXEB 1Y7XA 2CZ6B 3CPFA 1K8AU 2RM4A 3QYGB 1JB0E 4IURA 4C92F 5GAN6 4R55A 3CMEA 4L6V5 3QZ5B 2AHJB 3CCLA 5D6YA 2O4XB 2OAUA 2F5TX 4EMKA 4P5NA 1V29B 1BIAA 1S72T 3A5ZB 2YHTA 5FU6B 5FRMA 4QQ6A 3C4SA 4XK8E 1DJ7B 5GAOm 5CKDA 3L2UA 1NJIU 4O5VA 3CCUT 4ATOA 4XTVA 1XNIA 3G4SA 1GXIE 3GF5A 2IVWA 3ER0A 5LJ3d 3CEYA 2XG8D 4M7DB 3HRSA 4M77D 3HRTA 3QIIA 2GQVA 5GAN8 2HQEA 3JCMd 4M77F 2CS7A 4N4GA 2X35A 1VIFA 5LJ3e 2RK2A 5GANe 1N27A 5GAMe 2MMPA 3CMAT 4BI8B 1VQKT 3L1AA 3A8LB 2XD0A 3JCMJ 4LDYA 3OA6A 3GLXA 3CCLT 4IUTA 3CC7A 1VQKA 3CCQT 4J7IA 4KBMB 1ZHIA 4NL3A 4FT2A 5DM7R 2VYTA 4CRIA 4RMOA 3OYEA 5GAMf 2BIVA 1WQWA 5AYFA 3HSBA 4JUVA 3VUBA 5HKCA 2X4XA 1OZ3A 3KUFA 2V8JA 4JRIA 4PJOF 1QVFA 5A0GA 2P0PA 2LRQA 3CCRA 3MP1A 1KHIA 5CR2A 5HK0A 4M7AG 3M5AA 3HP9A 4JLGA 3JCMf 3P8DA 3TREA 3ZBDA 3QJYA 3I56A 2C06A 5FRNA 4EMGA 5GMKi 1VQMT 5GAOl 4XU3A 3G71T 1VQ8A 2G3RA 2R5MA 2R57A 2EQKA 2RHUA 1U1SA 5LJ3g 5GAN2 4E7JA 4M7AC 4QVZA 5D6WA 2RHZA 3HKSA 1KQ2A 2PQWA 1VQLT 2EKOA 4PNOA 2RA2A 2PVGB 2JVVA 4RCBA 1K9MU 4J6YA 3FEOA 1SSFA 1X6OA 2E64A 4J83A 4XTXA 3OYDA 3JB9F 2DVEA 1G3SA 4V2SA 4C8QB 2XI9A 3L2ZA 4J8OA 4ZGDB 3OQ5A 2ZPBB 2M9UA 3M53A 3WXMB 5KH6A 2ZGWA 5CKHA 5CIUA 5A0DA 2PUOB 3LWHA 2E41A 2K5IA 4JRPA 5C6SA 3CXCA 1KQSA 3L2QA 3CBPA 2DXUA 3CBOA 4N0AA 1VUBA 3L2VA 1OZ2A 3DLLA 2ZPFB 3JCMV 2O4XA 4EMKB 4M78G 4C92C 3CCEA 2XKOC 4CI0C 4DA4A 1YBYA 1VQ9T 3H6ZA 2L8DA 3DLMA 3OYBA 3MEUA 3I56T 2CZ7B 2E6NA 2GCXA 4LDUA 3CCST 2XK0A 2RHXA 4OGEA 4E7KA 3CC4A 1ZQ1A 5CKFA 3BW1A 3VV0A 1VQ6T 2K3YA 4BB7A 1UB4A 2RB6A 1KQ1A 4QVCA 1NZ9A 2DO3A 3PNWC 4UC4A 3AHUA 4GLKA 3QDRB 4FL6A 2FHDA 2M0OA 2DAQA 2ZPEB 3OYIA 4D6WA 3LX7A 4M77B 3JSCA 1K73C 2K4YA 1UGPB 3X26B 1HXDA 5FU7B 1MGQA 4LDXA 5LJ5f 4YTLA 5GMKj 1YHQT 3OYJA 3OYCA 2RH2A 3OS5A 3UT1A 4DOVA 3RESA 2YRVA 2RJEA 4PJOC 1G3WA 1PSFA 3JCMW 3CCVT 1KD1C 3L2RA 3JB9D 3UDCA 3J7AF 3OB9A 1Y96A 3OMCA 3OY9A 5EG2A 4C92A 2L89A 1IREB 5CAIA 1VQ7A 4IUPA 4NOYA 5L8RE 2E65A 3M58A 1D3BB 4L5GA 3SWNA 1YJWT 2DTHA 4XTWA 1VIEA 2QQ9A 1WQ7A 3P8HA 1VQ5A 4M75C 4BACA 3LGFA 2GFAA 2FB7A 4JRKA 2DIQA 1Q82U 2PVOB 2QQAA 1QP3A 2L5QA 2DEQA 3DB4A 3PFSA 3SFMA 2CZ0B 3V7RA 1I81A 4C5HA 4PJOD 1YJNT 1N9RA 1QVPA 3CCET 5LL6S 3QHSA 4X34A 2HNIA 5GAOn 4M7DF 3ASKA 2K5FA 3M4GA 4C0DB 2KY9A 4RKUE 1M1FA 1YITA 2DZ9A 2QQBA 5CKBA 5GAOq 3HHTB 2JUFA 3UWNA 5GAN3 2D9TA 4L59A 4M77E 4HA8A 4QW2A 5LJ5j 1ZBXA 3OBYA 5IT9E 1S72A 5DLQE 1MHNA 2QI2A 3NTHA 4QQGA 3EFRA 1Y71A 5GAN7 3QBYA 3QKJA 3URGA 3SWNB 4M75F 2PVDB 4XTZA 2KVQG 4Z02A 1D3BA 3C94A 4R56A 1M9SA 3DKMA 3MEAA 2ZZDA 1VQNA 3V8LA 3S3NA 2EQJA 3BY7A 2KSSA 1BI0A 3MEVA 5GMKl 5CCAA 3PIOA 3OW2A 3MO8A 2XDDA 1NPPA 2P4TA 1OI1A 3PGGA 2HQXA 3RKWA 3CPWS 1JJ2S 3NTKA 1BI1A 2E1HA 4MDWA 1VQOA 1G5VA 4M78E 1VQ7T 2GFUA 3MHXA 4ZN3A 2WSEE 3RMSA 1UGQB 2LVMA 1BIBA 3HL8A 5D6XA 5GANg 5GAOp 3OYKA 4M7AA 4C92D 2BKDN 2VGMA 4EMKC 4C92B 1M4ZA 4FM4B 3CCQA 5M9OA 4ZTFA 1YJWA 2K3XA 1JRIA 4C0ZA 3ZEHA 2V8KA 3PIPA 3FB9A 1K8AC 3UPUA 5LJ3j 3WVEB 5GAMj 4M77A 5FROA 2WSFE 1VQPA 4JS5A 3BFMA 3E1SA 2DPPB 3NFCA 5CKEA 4BUGA 4HCZA 5FLXE 4ZGEB 3V8JA 4J5YA 1OYXA 3OMGA 1YIJT 1HK9A 1WNLA 5KE3A 3S6WA 3OYYA 4KUDK 1NPRA 1QW1A 3OYLA 3CC2T 3O8VA 4ZN1A 3LGLA 2QTXA 2EIFA 1QVGA 1RL2A 2A3LA 4PJOA 4LD9K 2KDSA 4ELYC 4M77C 1M1GA 2Y4XA 5C0MA 3MEWA 4II1A 2JNGA 5FU7C 4JJNK 4PL6A 1VQ4A 1Y96B 5I2SA 1UEBA 4Y91A 5GANd 1KC8U 1YI2A 4M7AE 3G6ET 2MI6A 4M75G 2QXFA 5J3BA 4A54A 4J6WA 4BY6B 4F7UB 1KG1A 3JCMc 1YI2T 4A4EA 2OTJT 1G3TA 3QZ9B 3HPWA 2RHIA 3FJPA 4ME7A 2XDPA 4MZMA 1K73U 4B9WA 5I2MA 4M7DC 3TCJA 2DD4A 2A7YA 4C8QA 3OYFA 3MP6A 3JB9H 1W2BA 2EAYA 2X4YA 3KXTA 1U8RA 3HRUA 4FSXA 4M75D 4A4HA 3I55A 4C8QG 1YIJA 2DD5A 4C8QE 3GP8A 5DLOA 3GIBA 5HY6A 1U1TA 3F70A 5HK3A 2EJGA 2BUDA 2LNVA 1I4K1 4BY6C 3OS0A 1XOVA 1K9MC 2JZ2A 5GAOr 3SD4A 4BE1A 4PLLA 1Q81U 1G3YA 5LJ3h 2E6ZA 4N0AC 3HFNA 4MZPA 3FIFA 5LJ3f 3V7CA 5A0LA 5GMKh 4M7DD 2OTLA 3RUXA 3RIRA 2B8AA 3PT9A 1Q82C 4C5EA 1VQMA 2MAMA 2DJZA 3E19A 2FYKA 2EQUA 4OF1A 2V8IA 5GAN5 2CGHA 2DK3A 3GNGA 1FWZA 4M7AB 5CO7A 2DTIA 4MMLA 2RK1A 3V7SA 3OS2A 3CCRT 4OB2B 3S3MA 1WPYA 1Q86U 2Y90A 3SWNC 2JTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GF7 A;  3OA6 A;  3ASK A;  2X4W A;  4Q5W A;  2WAC A;  4IUT A;  3OYE A;  4A4F A;  5J26 A;  2VYT A;  4CRI A;  3UWN A;  1H3Z A;  2BIV A;  2D9T A;  4L59 A;  4QW2 A;  4BD3 A;  5KCH A;  2X4X A;  1OZ3 A;  3KUF A;  4N4I A;  1MHN A;  3NTH A;  2LRQ A;  4QQG A;  3MP1 A;  4GY5 A;  3QBY A;  3QKJ A;  3P8D A;  5FRN A;  4RG2 A;  4Z02 A;  2G3R A;  2R5M A;  2R57 A;  2EQK A;  2RHU A;  3MEA A;  4IUV A;  4E7J A;  3S3N A;  2EQJ A;  3H8Z A;  3MEV A;  2MWO A;  2QQS A;  4QVZ A;  2P0K A;  3MO8 A;  5D6W A;  4BDZ A;  2RHZ A;  4ZTJ A;  1OI1 A;  4BE0 A;  2HQX A;  2PQW A;  3OYN A;  2EKO A;  3NTK A;  3EAE A;  1G5V A;  2GFU A;  2LVM A;  3M9Q A;  1KHC A;  3FEO A;  5D6X A;  1SSF A;  3OYK A;  3OYD A;  2BKD N;  4ZTF A;  5M9O A;  2RI2 A;  4FU6 A;  2K3X A;  3ZEH A;  5IAY A;  2CKK A;  3OQ5 A;  3PMI A;  2NLU A;  5FRO A;  2RJD A;  3QJ6 A;  4NS5 A;  2MWP A;  5KH6 A;  4HCZ A;  5J39 A;  2RJC A;  5CIU A;  3OYM A;  3OYH A;  2RHY A;  4IUU A;  3FC3 A;  4BE2 A;  1OYX A;  5C6S A;  3OMG A;  3L2Q A;  3L2V A;  5KE3 A;  4E7L A;  1OZ2 A;  3MP8 A;  3S6W A;  2O4X A;  4QQD A;  2LDM A;  3BDL A;  3E9G A;  3OYL A;  3H6Z A;  2L8D A;  2RI5 A;  3O8V A;  2RO0 A;  3LGL A;  5KE2 A;  3DLM A;  2R58 A;  3OYB A;  3MEU A;  2F5K A;  4E7H A;  2E6N A;  3LLR A;  3PMT A;  3NTI A;  4IUQ A;  4EDU A;  2XK0 A;  2RHX A;  3E9F A;  5C0M A;  4E7K A;  3MEW A;  4II1 A;  4PL6 A;  3L2W A;  2E5Q A;  4C5I A;  4BDY A;  2K3Y A;  2L3R A;  4B9X A;  4E7I A;  3PNW C;  4UC4 A;  4PLI A;  3FLG A;  2FHD A;  2M0O A;  4FL6 A;  2DAQ A;  4A4E A;  3S3O A;  3OYI A;  1WGS A;  2RHI A;  2IG0 A;  4N4H A;  4IKF A;  2DIG A;  2XDP A;  1WJQ A;  3LX7 A;  4OVA A;  5IN1 A;  4B9W A;  3FDR A;  3OYA A;  1RI0 A;  3OYF A;  2R5A A;  2LCC A;  4LD6 A;  2RI3 A;  4C5G A;  3OYJ A;  3LYI A;  3MP6 A;  3OYC A;  3UT1 A;  2X4Y A;  3ME9 A;  3OS1 A;  2JTF A;  2YRV A;  2RJF A;  2RJE A;  3LH0 A;  4A4H A;  4IUR A;  3L2R A;  2EQM A;  3OB9 A;  5KCO A;  1WJS A;  3OMC A;  5D6Y A;  2O4X B;  3MET A;  3F70 A;  2M1H A;  3OY9 A;  2L89 A;  2BUD A;  5FRM A;  3DB3 A;  3OS0 A;  4IUP A;  2EFI A;  4QQ6 A;  3C4S A;  2M16 A;  2JZ2 A;  3SD4 A;  4BE1 A;  2QQR A;  4PLL A;  3L2U A;  2LTO A;  3Q1J A;  1XNI A;  1WJR A;  3P8H A;  3CEY A;  3GOX A;  2B8A A;  4BAC A;  3LGF A;  2GFA A;  4C5E A;  3QII A;  2HQE A;  3OYG A;  2DIQ A;  2EQU A;  4N4G A;  2X35 A;  3DB4 A;  1N27 A;  3PFS A;  4C5H A;  3OS2 A;  3S3M A;  4A4G A;  4X34 A;  3L42 A; 
#chains in the Genus database with same CATH topology
 3LWI A;  1XTD A;  1H3Z A;  2VUB A;  1FXX A;  1IGQ A;  4AG2 C;  4ZGJ B;  5LJ5 h;  1UE9 A;  4HT9 A;  1GBQ A;  2KXC A;  1VOM A;  2RQV A;  2I2L A;  1BCM A;  4AT1 B;  3THK A;  3C95 A;  2Y4Y A;  3CD6 A;  2HSE B;  3FRN A;  5IHI A;  2YLB A;  2CSI A;  1YHQ Q;  2K9G A;  2NUP B;  3G71 A;  4JDS A;  4LDW A;  5IHK A;  3MPU B;  1H8K A;  1QVF S;  2CKK A;  2NLU A;  3EFO A;  3GPL A;  1GCQ C;  2BE7 D;  4M7D A;  4FSS A;  1BKB A;  2RQR A;  2K5L A;  1YHQ A;  1ACM B;  2RO0 A;  4A53 A;  5IHN A;  3TSZ A;  2KEA A;  1OPK A;  2L3R A;  1ZUY A;  1K4U S;  4E7I A;  1MND A;  4KH1 B;  1QCO A;  2EJF A;  3LH5 A;  4AFS C;  3EG0 A;  4E47 A;  2VXE A;  1M3A A;  4OVA A;  1R8O B;  2PUK B;  3I55 T;  1OX9 A;  3A1P A;  2LCC A;  4XTU A;  2RD1 A;  3LYI A;  3MJX A;  3OS1 A;  2JTF A;  2XDB A;  1PNJ A;  1YCY A;  2KAF A;  3RBB B;  1JXM A;  1TH7 A;  2NUP A;  5KYY A;  3JCM X;  2EFI A;  2ZPG B;  1PRL C;  4OMF B;  1RI9 A;  1Y0M A;  1Q81 C;  1RAH B;  4DEX A;  4PKC C;  1IZ6 A;  1WJR A;  1YIT T;  2CP0 A;  1RAE B;  2DKG A;  1H92 A;  2IPO B;  4KT0 E;  3X28 B;  2HAX A;  3VUZ A;  2H8H A;  5CK9 A;  1X75 C;  3RMQ A;  4LE9 A;  2HD0 A;  1M1K U;  4DQ2 A;  3CCJ A;  1YJ9 A;  3L42 A;  2O31 A;  2DF6 A;  4A4F A;  1CSK A;  2PNI A;  1TOV A;  4Z88 A;  1Q7Y U;  4C92 E;  4JJC A;  3M59 A;  3G1J A;  1EX4 A;  2VXF A;  4C8Q F;  2COY A;  2ENM A;  2XIC A;  4M78 A;  1YJ9 Q;  1WFW A;  2KK4 A;  3V8K A;  4M78 B;  1VQO T;  4QT7 A;  4C8Q D;  1NLO C;  5L23 A;  1PHT A;  4OMP A;  4HXJ A;  4XAX B;  1A0N B;  5GMK e;  2RJD A;  1VQ8 Q;  1YFN A;  3INZ A;  4KH0 B;  1W2B P;  3OYM A;  2QAZ A;  2RHY A;  3VKI A;  1QLY A;  1X2Q A;  1AWO A;  4OMQ A;  1KC8 C;  4AG1 C;  1NE8 A;  2RI5 A;  2R58 A;  4E7H A;  2JN0 A;  1WZO A;  4F04 B;  3PMT A;  1B34 B;  2QG9 B;  2J6F A;  3M0P A;  4F7U A;  2XU8 A;  1LNX A;  4BDY A;  4J9D A;  1YIJ Q;  1MUZ A;  3VJP A;  1QP2 A;  3CC7 T;  4PJO B;  2DEU A;  4JJB A;  1TSF A;  2DXC A;  2FRW A;  4FIB A;  1WGS A;  4IKF A;  4N4H A;  1T3S A;  1YWO A;  2LJ1 A;  3FDR A;  1W2B S;  4OB1 B;  1Y7X A;  3VS2 A;  3CME A;  4R55 A;  3NPF A;  3QZ5 B;  2AHJ B;  4JPB W;  1BIA A;  1S72 T;  3A5Z B;  5FU6 B;  5GAO m;  4ATO A;  4O5V A;  2RPN A;  3G4S A;  2IVW A;  3ER0 A;  2XG8 D;  2CH4 W;  4M77 F;  2CS7 A;  4N4G A;  1VIF A;  5GAM e;  2MMP A;  2C0O A;  4KGX B;  1E7O A;  3CMA T;  4BI8 B;  4OMN A;  3L1A A;  4DBQ A;  3A8L B;  2DNU A;  3JCM J;  3OA6 A;  3EGD B;  3I9Q A;  3CCL T;  4IUT A;  4RUG A;  3OYE A;  4RMO A;  1V1C A;  1KFZ A;  4RTY A;  2OX7 A;  1NJI R;  2X4X A;  3CMA Q;  2KXD A;  4KGV B;  3HP9 A;  4JLG A;  3JCM f;  3TSW A;  3ZBD A;  1AWW A;  5GMK i;  3G71 T;  4AFQ C;  2G3R A;  5GAN 2;  2EQK A;  3C0C A;  2NWM A;  4M7A C;  2LX7 A;  1KQ2 A;  2RA2 A;  1QWE A;  4J6Y A;  3JB9 F;  1PKS A;  1G3S A;  1RAF B;  4V2S A;  4ZGD B;  1G8X A;  2QGG A;  3IQL A;  2ZGW A;  3VS4 A;  2E41 A;  4HVV A;  2K5I A;  5C6S A;  3CBP A;  1IXD A;  2DXU A;  1OZ2 A;  4DA4 A;  4RTW A;  4M78 G;  4C92 C;  3CCE A;  2XKO C;  3H6Z A;  2L8D A;  3NGP A;  4LDU A;  4J9G A;  3VV0 A;  1VQ6 T;  1Y57 A;  1UB4 A;  2D0N A;  3MKD A;  3PNW C;  3CCE Q;  2GBQ A;  3LX7 A;  3JSC A;  2K4Y A;  1HXD A;  4LDX A;  3OYJ A;  2RQT A;  2CP7 A;  1FMV A;  2VWF A;  1G3W A;  2EPD A;  2M02 A;  3H0I A;  1JEG A;  2L3Q A;  4IUP A;  1VQK Q;  1D3B B;  3SWN A;  2EW3 A;  1WQ7 A;  1VQ5 A;  4M75 C;  3REB B;  2GFA A;  2FB7 A;  1N5Z A;  1Q82 U;  2GTJ A;  2QQA A;  2YDL A;  2RMO A;  4C5H A;  4PJO D;  1N9R A;  4M7D F;  5KYX B;  3M4G A;  2K6D A;  5CKB A;  3HHT B;  5GAN 3;  4M77 E;  2D8H A;  4EIK A;  5LJ5 j;  1ZBX A;  1S72 A;  3G71 Q;  4QQG A;  1W6X A;  2E3H A;  4M75 F;  1UGV A;  1PM3 A;  1D3B A;  2DRM A;  3C94 A;  1M9S A;  4R56 A;  1NEB A;  2L0A A;  4KRT A;  3MEV A;  3PIO A;  2KSS A;  5CCA A;  4F17 A;  2XDD A;  4JZ4 A;  3CC7 Q;  1OI1 A;  1FMW A;  2GFU A;  5GAO p;  2E3I A;  2BKD N;  1JRI A;  3ZEH A;  4M77 A;  2X51 A;  1VQP A;  4JS5 A;  1SRM A;  5FLX E;  1M30 A;  4ESR A;  5I22 A;  2F1L A;  4D8K A;  1MMG A;  1YNZ A;  1WNL A;  1Z9Q A;  4KUD K;  1NPR A;  3O8V A;  2QTX A;  2EIF A;  1M2V B;  3M0U A;  1I07 A;  1U06 A;  2A3L A;  1NG2 A;  4LD9 K;  2KDS A;  3MEW A;  3EGX A;  2BZX A;  4PL6 A;  2FPF A;  1MV0 B;  3RDV A;  5GAN d;  1WX6 A;  2E5K A;  2ABL A;  2MI6 A;  4BY6 B;  3CCL Q;  1QQJ A;  2A08 A;  1HSQ A;  3HPW A;  2V1Q A;  2XDP A;  4MZM A;  1K73 U;  5I2M A;  3G4S Q;  2A7Y A;  3OYF A;  2OTL Q;  4E7S A;  2MYS A;  3MP6 A;  3KXT A;  1U8R A;  4J9B A;  4PJJ A;  2DD5 A;  2K7A A;  5GJV B;  8ATC B;  2E4H A;  5HY6 A;  2QAS A;  1NEG A;  1XOV A;  1K0X A;  5LJ3 h;  3V7C A;  5A0L A;  1Q82 C;  2V26 A;  2MAM A;  2DJZ A;  5GAN 5;  1QVF P;  2EQU A;  3ULR B;  4FCY A;  1FWZ A;  2BTT A;  4M7A B;  3OS2 A;  4OB2 B;  4K11 A;  2Y90 A;  2CUB A;  3EGD A;  2X4W A;  4XTY A;  1JBM A;  2DRK A;  1M90 C;  5CQX A;  1FX7 A;  2JOY A;  3JB9 J;  4XU2 A;  2FVU A;  4X9C A;  1AZG B;  1UFF A;  4GY5 A;  4WCI A;  4C0F A;  3UAT A;  3OSV A;  3G7Z A;  9ATC B;  1U3O A;  3VS0 A;  4MDX A;  2YUO A;  3CCU A;  3QSU A;  4A4K A;  4C0G A;  2HKQ B;  1T0J A;  4QVD A;  1KIK A;  1B7T A;  3A8G B;  1VQ5 T;  1W4S A;  4PJN A;  3RKY A;  2ATC B;  1EIF A;  1YN8 A;  2EJ9 A;  5GJW B;  4JJD A;  2G6F X;  5GAN 4;  4F7U F;  3CCQ Q;  1IHV A;  2H3J A;  2KQW A;  1KQS S;  5GAM h;  4DBF A;  2ZCF B;  5GAN j;  1XQH A;  3A8O B;  2VAS A;  3A8H B;  4PLI A;  3JCM P;  2D6F A;  4J9F A;  4XU1 A;  2E70 A;  2WSC E;  3CCS A;  1M2O A;  2A0F B;  1WHH A;  1X43 A;  2JM9 A;  4LD6 A;  3CPW A;  3KBG A;  5DY9 A;  5KYN A;  2AK5 A;  1LOJ A;  2LT1 A;  2RJF A;  3M0T A;  2A36 A;  1PRM C;  1D1C A;  1O9S A;  4FYV B;  1D1B A;  5KCO A;  1WJS A;  3RER A;  1H64 1;  3QUI A;  2QQR A;  4RTV A;  2QA4 Q;  4F7U E;  4QKU A;  3GBQ A;  1P92 A;  3JCM b;  4DOW A;  2CYZ B;  2VVK A;  1K0S A;  4F16 A;  4HT8 A;  4A4G A;  2GGR A;  3M55 A;  2YUN A;  3QDF A;  2WAC A;  1JJ2 P;  5J26 A;  4GBQ A;  4WF2 A;  2JJ9 A;  5KCH A;  3M57 A;  4HCK A;  2D1X A;  3G4S T;  1M8V A;  4XU0 A;  4RCC A;  2YXY A;  5KYY B;  3X20 B;  4M75 E;  2P0Q A;  2DLP A;  2DVJ A;  3EAE A;  3CC2 A;  2AKL A;  1NJI C;  2LQ8 A;  2LT4 A;  2VKN A;  3CD6 T;  1WLP B;  5CQY A;  5IAY A;  4M7D G;  3T9N A;  2RJC A;  3OYH A;  1H3H A;  2RQU A;  4PJO E;  1GL5 A;  1N8R R;  3MP8 A;  3BDL A;  1ZBJ A;  2K2V A;  2RF0 A;  1GCQ A;  2QYZ A;  1O75 A;  5GMK m;  2E12 A;  2KT1 A;  3QO3 A;  2XID A;  5GAN f;  4PJM A;  4B9X A;  4TVR A;  4MMK A;  2HCK A;  3WVD B;  3S3O A;  4J7F A;  2QK0 A;  2DIG A;  1WJQ A;  4ANJ A;  1WHM A;  2YRC A;  2CZ6 B;  1JB0 E;  3H0F A;  1X2K A;  1KSW A;  2F5T X;  4P5N A;  2YHT A;  2HMA A;  4QQ6 A;  3C4S A;  4XK8 E;  1DJ7 B;  3L2U A;  4HVU A;  4XTV A;  5I11 A;  3GF5 A;  1RAD B;  3UA7 A;  3HRT A;  2GQV A;  2X35 A;  2BE9 B;  1AWJ A;  1VQK T;  1HJD A;  2AIR B;  3CC7 A;  1VQ7 Q;  3CCQ T;  4J7I A;  5DM7 R;  5GAM f;  1WQW A;  4JUV A;  4PJO F;  5KYX A;  4JRI A;  5A0G A;  1Q82 R;  3MP1 A;  1KHI A;  2EGA A;  2C06 A;  3I56 A;  3P8D A;  3QJY A;  2V1R A;  1YP5 A;  1VQ8 A;  2R57 A;  2OAW A;  3CCV Q;  3HKS A;  2KT8 A;  1M27 C;  4PNO A;  1VQL T;  2ECZ A;  1G83 A;  1SSF A;  1VQ6 Q;  1OPL A;  4J9H A;  2DVE A;  1X69 A;  2COZ A;  4C8Q B;  1HYO A;  3L2Z A;  3OQ5 A;  4FYY B;  2B86 A;  1SKU B;  3JV3 A;  3WXM B;  1KC8 R;  5A0D A;  2M51 A;  4PJL A;  4JRP A;  3SEM A;  1KQS A;  3L2V A;  1VUB A;  1VQO Q;  3DLL A;  3JCM V;  4CI0 C;  1YBY A;  2EQI A;  3OYB A;  3MEU A;  1AVZ C;  2GCX A;  2RHX A;  1ZQ1 A;  1ZUU A;  4BB7 A;  1KQ1 A;  4QVC A;  1GRI A;  2FHD A;  2DAQ A;  3X26 B;  2SEM A;  4YTL A;  3CXC P;  2RH2 A;  3OS5 A;  3UT1 A;  2J6K A;  3M0S A;  3RES A;  1T0H A;  1YJN Q;  4PJO C;  3JCM W;  3CCV T;  1RAG B;  3EG2 A;  1UEC A;  1QCF A;  3OMC A;  1IRE B;  1AT1 B;  5L8R E;  1D1A A;  2FPD A;  2FPE A;  4NOY A;  4L5G A;  2DTH A;  1IB8 A;  1VIE A;  1KK7 A;  1AEY A;  2RN8 A;  1RUW A;  2PVO B;  3EGU A;  2DBK A;  2L5Q A;  3VS6 A;  1SPK A;  2DEQ A;  3SFM A;  2CZ0 B;  1PKT A;  1OEB A;  3EFO B;  3QHS A;  2NYS A;  2JM8 A;  2LMJ A;  1M1F A;  1YIT A;  2DZ9 A;  2C0I A;  5GAO q;  2JUF A;  3UWN A;  2BZY A;  4L59 A;  3OBY A;  2QI2 A;  3EFR A;  3VS3 A;  1Y71 A;  5GAN 7;  3URG A;  2PVD B;  4XTZ A;  1Q81 R;  1NYF A;  2EQJ A;  1BI0 A;  3PGG A;  3CPW S;  1OV3 A;  3NTK A;  4MDW A;  1TTH B;  3RMS A;  1BIB A;  5D6X A;  2EGE A;  5GAN g;  3OYK A;  4C92 D;  2IIM A;  1YJW A;  2V8K A;  3UPU A;  2DFU A;  4CC7 A;  4GLM A;  5CKE A;  3E1S A;  1RLP C;  4OML A;  3V8J A;  1SF9 A;  2HBW A;  2JXB A;  5KYU B;  3CCU Q;  1HK9 A;  1WHK A;  2JT4 A;  2DL5 A;  2MIO A;  2CP3 A;  4ELY C;  4M77 C;  4JJN K;  5FU7 C;  1Y96 B;  2YUQ A;  5I2S A;  1UEB A;  4J9I A;  1KC8 U;  1YI2 A;  3JCM c;  1YI2 T;  4FYX B;  2RHI A;  3FJP A;  1GBR A;  1VYU A;  2EKH A;  4M7D C;  2FG0 A;  3EG9 B;  2DD4 A;  1X6B A;  3TQ7 P;  1W2B A;  1WXB A;  1JQQ A;  2YT6 A;  4J9C A;  2PZ1 A;  3HRU A;  4M75 D;  4A4H A;  1NYG A;  4C8Q G;  5HK3 A;  2BUD A;  4BY6 C;  4DBR A;  5FWC A;  1W1F A;  1VQL Q;  4BE1 A;  4PLL A;  2E6Z A;  4N0A C;  2L2P A;  1S72 Q;  2B8A A;  3HTR A;  2DL8 A;  4C5E A;  2KE9 A;  4OF1 A;  3E19 A;  2FYK A;  2JW4 A;  3EH2 A;  2HZY A;  3S3M A;  3SWN C;  3VS1 A;  4AFU C;  2CRE A;  4Q5W A;  3M54 A;  3P8B B;  4BI3 A;  2QA4 A;  2AZS A;  4M75 B;  4OB0 B;  5FU6 C;  1UTI A;  3EFS A;  2LP5 A;  2EYQ A;  4AMC A;  4M78 F;  2LNH B;  3OBW A;  1U5S A;  3ZFJ A;  4EMH A;  1VQP Q;  2DTO A;  1QVG S;  4LDV A;  3R6O A;  2YWW A;  2QEX T;  3J80 E;  1B07 A;  2CDT A;  3RR6 A;  2QEX A;  4O6J A;  2DZC A;  2RI2 A;  3CME T;  2Z0W A;  2XHC A;  2KYM A;  2DJQ A;  1Q86 R;  3JCM g;  3HFO A;  4J6X A;  4BE2 A;  4NL2 A;  3C12 A;  1N8R C;  4QQD A;  2LDM A;  3JCM h;  1UDL A;  4WTO B;  2EGC A;  3E9G A;  3OSS C;  1WDX A;  1X6G A;  5KE2 A;  4PK4 A;  3AT1 B;  1ZX6 A;  4ZNX A;  1R0B G;  4JLI A;  1GCP A;  2COW A;  1WXT A;  2IG0 A;  4B6M A;  2VV5 A;  4LUD A;  3CC4 T;  1M90 U;  3QYH B;  1LPL A;  2ROT A;  4RG8 A;  1K9A A;  1ZLM A;  3VYG A;  4AFZ C;  3CCJ T;  2KBT A;  3EG3 A;  1CKA A;  2EQM A;  2HBP A;  2M1H A;  2KI7 A;  1B34 A;  4JZ3 A;  3DB3 A;  1TUG B;  2FRY A;  2M16 A;  4DEY A;  2FZK B;  2LTO A;  1BI2 A;  2NUT B;  5EC7 A;  3PTA A;  3I55 Q;  3VRY A;  1G2B A;  1MMN A;  3H9N A;  2LQW A;  2GF7 A;  2FZG B;  1OX8 A;  3UF4 A;  2JTE A;  1VQ6 A;  3OW2 S;  3SDZ A;  1MNE A;  4LN2 A;  5A2Q E;  1PD1 A;  2QDY B;  3RKX A;  1UUE A;  3QPH A;  2X3X D;  4C8Q C;  3H8Z A;  4M4Z A;  2QQS A;  2YSQ A;  3JCM Q;  3G6E A;  3X25 B;  4BE0 A;  3JB9 I;  3CCR Q;  1IHW A;  4EPC A;  2LQK A;  3PMI A;  1TUC A;  1I5L A;  3QJ6 A;  4NS5 A;  1M5Q 1;  3VYH B;  1VQ4 T;  4IUU A;  5LJ5 g;  3G6E Q;  4HCC A;  1SHG A;  2E10 A;  2NUT A;  1NM7 A;  2KMT A;  3BDU A;  1Y07 A;  2MF2 A;  1Q86 C;  3QG1 A;  2F5K A;  4PFZ A;  2QA4 T;  1RAB B;  1OU9 A;  2O9S A;  2E5Q A;  2RQW A;  1E6H A;  1KD1 U;  4CC3 A;  2F69 A;  2EWN A;  3I5S A;  2CP6 A;  2LC4 A;  2CUD A;  3CBM A;  2DL3 A;  3CCM T;  2LX9 A;  3VRZ A;  1T3L A;  2D0Q B;  4X9D A;  1Q7Y C;  5LJ5 d;  1X01 A;  1AHJ B;  1AWX A;  3EH1 A;  3A98 A;  4C5G A;  3M56 A;  3ME9 A;  3LH0 A;  4RTX A;  1XJW B;  3CPF A;  1UJ0 A;  2RM4 A;  5FWB A;  5GAN 6;  4L6V 5;  3CCL A;  5D6Y A;  4EMK A;  1IGU A;  2AKK A;  1V29 B;  1ARK A;  3CCU T;  1XNI A;  1GXI E;  1ZA1 B;  1AOJ A;  4M7D B;  3HRS A;  4M77 D;  2EYW A;  5GAN 8;  3JCM d;  5LJ3 e;  2RK2 A;  5GAN e;  1N27 A;  2XD0 A;  3OW2 P;  3CD6 Q;  4LDY A;  2XMF A;  2OTJ Q;  2HQH A;  4KBM B;  3R6N A;  2VYT A;  2LQN A;  3HSB A;  1WA7 A;  3VUB A;  5HKC A;  1LCK A;  3KUF A;  1QVF A;  1YWP A;  1MMA A;  2LRQ A;  1KQS P;  5CR2 A;  4M7A G;  5FRN A;  4EMG A;  4XU3 A;  1FYN A;  5LJ3 g;  2R5M A;  4E7J A;  1K8A R;  4D8D A;  2M0Y A;  4QVZ A;  2RHZ A;  2D8J A;  2PQW A;  1K9M U;  2L3S A;  3FEO A;  4XTX A;  2E64 A;  4J83 A;  2P84 A;  2XI9 A;  1RAC B;  1VQ4 Q;  2ZPB B;  2M9U A;  1SSH A;  3M53 A;  4LXC A;  5CKH A;  5CIU A;  3EG1 A;  2PUO B;  3VS5 A;  3CXC A;  3L2Q A;  1NLP C;  1E6G A;  1K1Z A;  2DX1 A;  4EMK B;  2KRN A;  1M3C A;  2CZ7 B;  3CC4 A;  4OGE A;  4E7K A;  5CKF A;  3BW1 A;  1I5O B;  2F2V A;  2DA9 A;  2DO3 A;  4HVW A;  3AHU A;  3QDR B;  2M0O A;  3CQT A;  2ZPE B;  4D6W A;  3SHW A;  3PVL A;  4M77 B;  2MPX C;  5FU7 B;  1MGQ A;  5LJ5 f;  2RJE A;  1KD1 R;  1KD1 C;  3L2R A;  2J7I A;  3J7A F;  1Y96 A;  1VQ9 Q;  5CAI A;  1VQ7 A;  2E65 A;  3M58 A;  1OUL A;  1QWF A;  1YJW T;  4XTW A;  4BAC A;  1TUD A;  2MCN A;  4R0K A;  1PD0 A;  4FW2 A;  1I81 A;  4IIM A;  2DE0 X;  1OQK A;  3CCE T;  1QVP A;  5LL6 S;  2HNI A;  4C0D B;  2KY9 A;  4RKU E;  2QQB A;  4LUE A;  5AT1 B;  2D9T A;  4HA8 A;  5IT9 E;  1MHN A;  1VQM Q;  1JU5 C;  3SWN B;  2KVQ G;  3DKM A;  3V8L A;  2J6O A;  3BY7 A;  3TVT A;  4CC2 A;  3MO8 A;  1NPP A;  1VQO A;  1ABQ A;  2E1H A;  1G5V A;  4M78 E;  1SG5 A;  2F2W A;  3KFV A;  4ZN3 A;  2LVM A;  3HL8 A;  4M7A A;  4EMK C;  1M4Z A;  4FM4 B;  1F1B B;  4C0Z A;  3PIP A;  4ORZ A;  1BK2 A;  1PCX A;  5GAM j;  4FW1 A;  2LZ6 B;  2WSF E;  2X9H A;  3BFM A;  1J3T A;  2DPP B;  4BUG A;  4ZGE B;  5D7U A;  2HEQ A;  1OYX A;  4Z89 A;  3E2U A;  2PTK A;  3OYY A;  3CC2 T;  1QVG A;  1RL2 A;  1JXO A;  5C0M A;  2Y4X A;  4II1 A;  2DER A;  2GTO A;  3U23 A;  3G6E T;  4M7A E;  4M75 G;  2QXF A;  4J6W A;  1ZA2 B;  1D0Y A;  2OTJ T;  1G3T A;  1SHF A;  3QZ9 B;  4OMO A;  1AD5 A;  4B9W A;  1K9M R;  3TCJ A;  1QKW A;  1ZSZ A;  4FYW B;  5KYW A;  3JB9 H;  2BZ8 A;  4FSX A;  3I55 A;  3I5R A;  2O9V A;  4C8Q E;  3CCJ Q;  3M0Q A;  5DLO A;  3M0R A;  1IO6 A;  1RAA B;  2EJG A;  2LNV A;  1I4K 1;  2DL7 A;  1K9M C;  2JZ2 A;  5GAO r;  3SD4 A;  1I0C A;  1Q81 U;  1G3Y A;  5LJ3 f;  3HFN A;  4MZP A;  5GMK h;  2CH4 A;  2FZC B;  3RUX A;  3PT9 A;  4A63 B;  2FEI A;  2DK3 A;  3GNG A;  5CO7 A;  2DTI A;  4MML A;  1Q86 U;  1VQN Q;  1WPY A;  2OI3 A;  1WHL A;  2ROL A;  2FL7 A;  1WHJ A;  3GNF B;  2OTL T;  3LW5 E;  4F7U G;  3JCM e;  4BD3 A;  2OJ2 A;  3H41 A;  4N4I A;  1VQN T;  2DYB A;  2F2X A;  4C0D C;  4IUV A;  4M75 A;  2C0T A;  2MWO A;  1BBZ A;  4BI4 A;  1C1A A;  1Q95 G;  2P0K A;  4ZTJ A;  3OYN A;  2QTV A;  5CVI A;  1KJW A;  5GAM g;  1KHC A;  4HKE A;  4Z8A A;  4FU6 A;  3CC4 Q;  3I56 Q;  1GFC A;  4M78 C;  4C92 G;  3EHQ A;  1Q7Y R;  2HKN A;  2MWP A;  4X1V A;  2FO0 A;  2LJ0 A;  2HL3 A;  3CXC S;  1X27 A;  2PU9 B;  3CCV A;  2YRD A;  2A28 A;  1V76 A;  5LJ5 e;  4XQ3 A;  3CCS Q;  2W0Z A;  3UA6 A;  2O01 E;  3LLR A;  3NTI A;  3E9F A;  3N5B B;  2KRS A;  7AT1 B;  4C5I A;  3CCM A;  2ED0 A;  3MCA B;  1YJ9 T;  1TWB A;  3TU4 K;  5IH2 A;  4E7Z A;  4M77 G;  4J9E A;  1VQ9 A;  1VYT A;  2ZPI B;  1BI3 A;  3VU3 C;  1UGR B;  1VQL A;  1EFN A;  4RTU A;  2LCL A;  4HCB A;  1RI0 A;  4M7A F;  1JJ2 A;  2RI3 A;  1VQ8 T;  2X4J A;  2AT1 B;  2VC8 A;  3CCM Q;  1I8F A;  2A37 A;  3X24 B;  3ZL7 C;  3PE0 A;  4PFO A;  1QMC A;  3NMZ C;  4M7A D;  3MET A;  1VQP T;  4JS4 A;  1RAI B;  4KUL A;  5KYU A;  2J06 A;  2YLC A;  1ABO A;  3Q1J A;  2CP2 A;  3CMA A;  3GOX A;  3J81 E;  2KRM A;  2VGN A;  3OYG A;  1YJN A;  1N6A A;  3JB9 G;  3CME Q;  2CZ1 B;  4VUB A;  2NUZ A;  2ED1 A;  3CPW P;  1M1K C;  3CC2 Q;  2AZV A;  4LNP A;  2QGF B;  4M7D E;  1BU1 A;  1SEM A;  4ELZ C;  4M78 D;  3SB2 A;  4DBH A;  1N9S A;  4KUI A;  4RG2 A;  5FW9 A;  2OTJ A;  3VS7 A;  4BDZ A;  3JRZ A;  2QDL A;  1CKB A;  1PSE A;  3M9Q A;  5GAM d;  1VA7 A;  2MK5 A;  4OP0 A;  2W10 A;  4OB3 B;  4KGZ B;  1ZUK A;  2X3W D;  3M4Y A;  5J39 A;  4OGC A;  3FC3 A;  3PVQ A;  1ZSZ B;  1C0M A;  2GQI A;  2QEX Q;  5IXF A;  1LJO A;  4FT4 A;  2I0N A;  2JMA A;  2OTL A;  4EDU A;  4IUQ A;  2ZPH B;  3JAM E;  3L2W A;  2DXT A;  3RNJ A;  4MZT A;  5GAN h;  5HCK A;  3EGX B;  3FJ5 A;  1BYM A;  1SRL A;  2P4R A;  2DXB A;  3A8M B;  1YCS B;  1N8R U;  3FLG A;  1M2V A;  1UJY A;  4PJO G;  3TEE A;  2CT3 A;  5IN1 A;  1UGS B;  2CSQ A;  3OYA A;  5I21 A;  2R5A A;  3I35 A;  1UHF A;  4Y28 E;  2K57 A;  4F14 A;  4JRQ A;  3QXE B;  4OMM A;  1MMD A;  1K8A U;  3QYG B;  2YUP A;  4IUR A;  4C92 F;  1OOT A;  2O4X B;  2K3B A;  2OAU A;  2DMO A;  3QWY A;  1R0C B;  5FRM A;  4E2F B;  5CKD A;  1NJI U;  2KR3 A;  5LJ3 d;  3CEY A;  3QII A;  1QKX A;  2HQE A;  2KGT A;  1FMK A;  4E6R A;  2LJ3 A;  3GLX A;  1VQK A;  1QCN A;  1PWT A;  4NL3 A;  1ZHI A;  1TXQ A;  4FT2 A;  4CRI A;  2BIV A;  2O2O A;  5AYF A;  1OZ3 A;  2V8J A;  1ZSG A;  2P0P A;  1D0X A;  1EZZ B;  3CCR A;  5HK0 A;  2RNA A;  2ZAE A;  3M5A A;  3TRE A;  2EYX A;  1VQM T;  5GAO l;  5IXB A;  1M8M A;  2RHU A;  1U1S A;  5D6W A;  1UHC A;  2EKO A;  1UG1 A;  2CP5 A;  2PVG B;  2JVV A;  4RCB A;  1X6O A;  3OYD A;  2EYZ A;  3NHN A;  2VB6 A;  2JS0 A;  4J8O A;  3BE3 A;  5KH6 A;  3LWH A;  3CBO A;  3EG9 A;  4E7L A;  2ZPF B;  2O4X A;  2HDA A;  1VQ9 T;  3DLM A;  3I56 T;  1WXU A;  8AT1 B;  2E6N A;  1I1J A;  2XK0 A;  3CCS T;  2H3E B;  1D0Z A;  2K3Y A;  1ZSZ C;  2RB6 A;  1PC0 A;  1NZ9 A;  4UC4 A;  4GLK A;  4FL6 A;  3OYI A;  2DET A;  1K73 R;  1K73 C;  1UGP B;  4RTZ A;  1YHQ T;  5GMK j;  2DL4 A;  3OYC A;  4DOV A;  2YRV A;  3H0H A;  5ECA A;  1PSF A;  3JB9 D;  1PG5 B;  3UDC A;  3OB9 A;  3OY9 A;  1WI7 A;  5EG2 A;  4C92 A;  2L89 A;  1YIT Q;  2EYY A;  1W70 A;  3REA B;  2GNC A;  1QVG P;  3P8H A;  2QQ9 A;  3LGF A;  4JRK A;  2DIQ A;  1S1N A;  1QP3 A;  3DB4 A;  3V7R A;  3PFS A;  1M1K R;  1YJN T;  4X34 A;  5GAO n;  3ASK A;  2K5F A;  3O5Z A;  2KRO A;  1GFD A;  2ESW A;  3QWX X;  2EBP A;  4QW2 A;  1IRX A;  2KYB A;  5DLQ E;  2JS2 A;  3NTH A;  4IIO A;  2O88 A;  3QBY A;  3QKJ A;  1TS9 A;  4Z02 A;  3MEA A;  1VQN A;  2ZZD A;  3S3N A;  5GMK l;  3OW2 A;  2P4T A;  3RKW A;  1JJ2 S;  2HQX A;  1BI1 A;  1VQ7 T;  3MHX A;  2WSE E;  1UGQ B;  1TG0 A;  1M90 R;  1M3B A;  2VGM A;  5KYW B;  4C92 B;  1BCO A;  3CCQ A;  4ZTF A;  5M9O A;  2K2M A;  2K3X A;  2MOX A;  1LVK A;  3FB9 A;  1D09 B;  4RTT A;  5LJ3 j;  1K8A C;  3D7S B;  3WVE B;  5FRO A;  3NFC A;  1WIE A;  1YI2 Q;  2K79 A;  4HCZ A;  2EVR A;  6AT1 B;  2HL5 C;  4J5Y A;  2HSP A;  3OMG A;  1YIJ T;  1Z9Z A;  1R77 A;  2CT4 A;  5KE3 A;  3S6W A;  2JMC A;  1QW1 A;  3OYL A;  4ZN1 A;  3LGL A;  2DIL A;  1YJW Q;  4PJO A;  1OU8 A;  1M1G A;  2JNG A;  1B3Q A;  1VQ4 A;  4PFP A;  1AZE A;  4Y91 A;  1WYX A;  1JO8 A;  1TU0 B;  2L3P A;  4F7U B;  5J3B A;  4A54 A;  1KG1 A;  1MV3 A;  2KNB B;  4A4E A;  4ME7 A;  4C8Q A;  1VQ5 Q;  1C6V X;  2EAY A;  2X4Y A;  1WHG A;  2DBM A;  1RLQ C;  1YIJ A;  2DM1 A;  2DYI A;  1BB9 A;  3GP8 A;  3GIB A;  1U1T A;  3F70 A;  3OS0 A;  2SRC A;  1VYV A;  1K76 A;  1NBE B;  3FIF A;  4M7D D;  3RIR A;  1VQM A;  4CC4 B;  2V8I A;  2J05 A;  4Y92 A;  3EHR A;  2CGH A;  1HD3 A;  3V7S A;  3CCR T;  2RK1 A;  2LCS A;  4N0A A;  2JTM A; 
#chains in the Genus database with same CATH homology
 3LWI A;  2X4W A;  4Q5W A;  1JBM A;  1XTD A;  2FL7 A;  3M54 A;  3P8B B;  4XTY A;  3GNF B;  2QA4 A;  2OTL T;  4BI3 A;  1H3Z A;  2VUB A;  1FXX A;  3LW5 E;  4M75 B;  5CQX A;  4F7U G;  4OB0 B;  1FX7 A;  4ZGJ B;  5LJ5 h;  2JOY A;  5FU6 C;  4BD3 A;  3JCM e;  4HT9 A;  3JB9 J;  4XU2 A;  3EFS A;  4N4I A;  1VQN T;  2EYQ A;  4E7L A;  4M78 F;  2FVU A;  4X9C A;  2I2L A;  4GY5 A;  3OBW A;  3ZFJ A;  4C0F A;  4EMH A;  3OSV A;  3G7Z A;  4C0D C;  4IUV A;  2DTO A;  3C95 A;  4M75 A;  1QVG S;  4LDV A;  2Y4Y A;  3CD6 A;  4MDX A;  2MWO A;  3R6O A;  4BI4 A;  2P0K A;  4ZTJ A;  3CCU A;  3OYN A;  3FRN A;  2QEX T;  2YLB A;  3J80 E;  5CVI A;  3QSU A;  4A4K A;  5GAM g;  1KHC A;  4C0G A;  4HKE A;  2QEX A;  4QVD A;  4O6J A;  2DZC A;  2RI2 A;  4FU6 A;  4JDS A;  4LDW A;  3G71 A;  3CME T;  2XHC A;  1QVF S;  2CKK A;  4M78 C;  4C92 G;  2NLU A;  3JCM g;  3A8G B;  3HFO A;  1W4S A;  2MWP A;  3GPL A;  1VQ5 T;  3RKY A;  4J6X A;  4BE2 A;  4NL2 A;  3CXC S;  1EIF A;  3C12 A;  1M90 C;  2PU9 B;  3CCV A;  1N8R C;  4M7D A;  2EJ9 A;  1BKB A;  4QQD A;  2LDM A;  5LJ5 e;  3JCM h;  3E9G A;  4XQ3 A;  2K5L A;  1YHQ A;  3OSS C;  5GAN 4;  2RO0 A;  5KE2 A;  4F7U F;  4A53 A;  2O01 E;  3LLR A;  3NTI A;  2H3J A;  2KQW A;  3E9F A;  3N5B B;  1KQS S;  5GAM h;  4C5I A;  3CCM A;  3MCA B;  1YJ9 T;  2ZCF B;  2L3R A;  5GAN j;  1XQH A;  3TU4 K;  3A8O B;  3A8H B;  4E7I A;  4M77 G;  2EJF A;  4PLI A;  3JCM P;  1VQ9 A;  4JLI A;  2ZPI B;  2D6F A;  1BI3 A;  3VU3 C;  1UGR B;  4XU1 A;  2IG0 A;  2E70 A;  4E47 A;  2VV5 A;  2VXE A;  1VQL A;  2WSC E;  3CC4 T;  4OVA A;  3CCS A;  1R8O B;  2PUK B;  3QYH B;  2LCL A;  3I55 T;  1M90 U;  4HCB A;  1RI0 A;  4M7A F;  2LCC A;  4LD6 A;  3CPW A;  3KBG A;  2RI3 A;  4XTU A;  5DY9 A;  2RD1 A;  1JJ2 A;  1VQ8 T;  2X4J A;  3LYI A;  2VC8 A;  4RG8 A;  1LOJ A;  2LT1 A;  3VYG A;  2JTF A;  3OS1 A;  1I8F A;  2RJF A;  3X24 B;  3CCJ T;  2XDB A;  1YCY A;  1O9S A;  2EQM A;  2HBP A;  2KAF A;  5KCO A;  1WJS A;  4M7A D;  1TH7 A;  3MET A;  2M1H A;  3RER A;  1H64 1;  1VQP T;  1B34 A;  4JS4 A;  3DB3 A;  4KUL A;  3JCM X;  2EFI A;  2ZPG B;  3QUI A;  2M16 A;  4OMF B;  2YLC A;  1Q81 C;  2QQR A;  2LTO A;  4F7U E;  3Q1J A;  4PKC C;  1IZ6 A;  1BI2 A;  1WJR A;  1YIT T;  1P92 A;  2DKG A;  3CMA A;  3GOX A;  4KT0 E;  3X28 B;  3JCM b;  4DOW A;  3VUZ A;  3J81 E;  2VGN A;  3OYG A;  3PTA A;  2HAX A;  5CK9 A;  1YJN A;  2CYZ B;  1X75 C;  3RMQ A;  1N6A A;  3JB9 G;  2HD0 A;  1M1K U;  4DQ2 A;  3CCJ A;  2CZ1 B;  4VUB A;  4A4G A;  1YJ9 A;  4HT8 A;  3M55 A;  3L42 A;  2GF7 A;  2WAC A;  4A4F A;  5J26 A;  1M1K C;  1Q7Y U;  4WF2 A;  4C92 E;  5KCH A;  3M59 A;  1VQ6 A;  3OW2 S;  3SDZ A;  4M7D E;  2VXF A;  4C8Q F;  5A2Q E;  2QDY B;  4ELZ C;  3RKX A;  2XIC A;  3M57 A;  4M78 D;  3SB2 A;  3QPH A;  1N9S A;  4M78 A;  3G4S T;  4KUI A;  4RG2 A;  1M8V A;  4XU0 A;  2KK4 A;  4RCC A;  4C8Q C;  3V8K A;  3H8Z A;  4M78 B;  1VQO T;  2OTJ A;  2QQS A;  3X20 B;  4C8Q D;  3JCM Q;  3G6E A;  4BDZ A;  3X25 B;  4BE0 A;  4M75 E;  2P0Q A;  3EAE A;  3CC2 A;  3JB9 I;  1NJI C;  3JRZ A;  2LQ8 A;  2LT4 A;  5GAM d;  1PSE A;  3M9Q A;  3CD6 T;  4OP0 A;  4XAX B;  5CQY A;  5GMK e;  4EPC A;  5IAY A;  2LQK A;  4OB3 B;  3PMI A;  1I5L A;  4M7D G;  3T9N A;  2RJD A;  3QJ6 A;  4NS5 A;  3M4Y A;  1M5Q 1;  2RJC A;  3INZ A;  3VYH B;  5J39 A;  3VKI A;  2RHY A;  4IUU A;  4OGC A;  5LJ5 g;  3OYM A;  3OYH A;  3FC3 A;  1VQ4 T;  4PJO E;  4HCC A;  3MP8 A;  2E10 A;  3BDL A;  1KC8 C;  2KMT A;  3BDU A;  1NE8 A;  1Y07 A;  2K2V A;  2MF2 A;  2RI5 A;  2R58 A;  4E7H A;  1LJO A;  2F5K A;  3QG1 A;  2JN0 A;  4FT4 A;  1Q86 C;  3PMT A;  1O75 A;  4EDU A;  4IUQ A;  1B34 B;  5GMK m;  2QA4 T;  2E12 A;  2ZPH B;  4F7U A;  3JAM E;  2XU8 A;  3L2W A;  2E5Q A;  2DXT A;  3QO3 A;  4MZT A;  1LNX A;  4BDY A;  1KD1 U;  2XID A;  5GAN f;  5GAN h;  2F69 A;  2EWN A;  4B9X A;  3VJP A;  1QP2 A;  1BYM A;  2DXB A;  4TVR A;  3A8M B;  2LC4 A;  4MMK A;  1N8R U;  3FLG A;  3WVD B;  2DXC A;  3CC7 T;  3S3O A;  4PJO B;  4FIB A;  3CBM A;  3CCM T;  1WGS A;  4J7F A;  2LX9 A;  4IKF A;  4N4H A;  2DIG A;  4PJO G;  1WJQ A;  2D0Q B;  3TEE A;  4X9D A;  5IN1 A;  1UGS B;  1Q7Y C;  5LJ5 d;  1X01 A;  3FDR A;  3OYA A;  1AHJ B;  5I21 A;  2R5A A;  4Y28 E;  1W2B S;  2K57 A;  4C5G A;  3M56 A;  4OB1 B;  4JRQ A;  3ME9 A;  3LH0 A;  3QXE B;  1Y7X A;  2CZ6 B;  3CPF A;  1K8A U;  2RM4 A;  3QYG B;  1JB0 E;  4IUR A;  4C92 F;  5GAN 6;  4R55 A;  3CME A;  4L6V 5;  3QZ5 B;  2AHJ B;  3CCL A;  5D6Y A;  2O4X B;  2OAU A;  2F5T X;  4EMK A;  4P5N A;  1V29 B;  1BIA A;  1S72 T;  3A5Z B;  2YHT A;  5FU6 B;  5FRM A;  4QQ6 A;  3C4S A;  4XK8 E;  1DJ7 B;  5GAO m;  5CKD A;  3L2U A;  1NJI U;  4O5V A;  3CCU T;  4ATO A;  4XTV A;  1XNI A;  3G4S A;  1GXI E;  3GF5 A;  2IVW A;  3ER0 A;  5LJ3 d;  3CEY A;  2XG8 D;  4M7D B;  3HRS A;  4M77 D;  3HRT A;  3QII A;  2GQV A;  5GAN 8;  2HQE A;  3JCM d;  4M77 F;  2CS7 A;  4N4G A;  2X35 A;  1VIF A;  5LJ3 e;  2RK2 A;  5GAN e;  1N27 A;  5GAM e;  2MMP A;  3CMA T;  4BI8 B;  1VQK T;  3L1A A;  3A8L B;  2XD0 A;  3JCM J;  4LDY A;  3OA6 A;  3GLX A;  3CCL T;  4IUT A;  3CC7 A;  1VQK A;  3CCQ T;  4J7I A;  4KBM B;  1ZHI A;  4NL3 A;  4FT2 A;  5DM7 R;  2VYT A;  4CRI A;  4RMO A;  3OYE A;  5GAM f;  2BIV A;  1WQW A;  5AYF A;  3HSB A;  4JUV A;  3VUB A;  5HKC A;  2X4X A;  1OZ3 A;  3KUF A;  2V8J A;  4JRI A;  4PJO F;  1QVF A;  5A0G A;  2P0P A;  2LRQ A;  3CCR A;  3MP1 A;  1KHI A;  5CR2 A;  5HK0 A;  4M7A G;  3M5A A;  3HP9 A;  4JLG A;  3JCM f;  3P8D A;  3TRE A;  3ZBD A;  3QJY A;  3I56 A;  2C06 A;  5FRN A;  4EMG A;  5GMK i;  1VQM T;  5GAO l;  4XU3 A;  3G71 T;  1VQ8 A;  2G3R A;  2R5M A;  2R57 A;  2EQK A;  2RHU A;  1U1S A;  5LJ3 g;  5GAN 2;  4E7J A;  4M7A C;  4QVZ A;  5D6W A;  2RHZ A;  3HKS A;  1KQ2 A;  2PQW A;  1VQL T;  2EKO A;  4PNO A;  2RA2 A;  2PVG B;  2JVV A;  4RCB A;  1K9M U;  4J6Y A;  3FEO A;  1SSF A;  1X6O A;  2E64 A;  4J83 A;  4XTX A;  3OYD A;  3JB9 F;  2DVE A;  1G3S A;  4V2S A;  4C8Q B;  2XI9 A;  3L2Z A;  4J8O A;  4ZGD B;  3OQ5 A;  2ZPB B;  2M9U A;  3M53 A;  3WXM B;  5KH6 A;  2ZGW A;  5CKH A;  5CIU A;  5A0D A;  2PUO B;  3LWH A;  2E41 A;  2K5I A;  4JRP A;  5C6S A;  3CXC A;  1KQS A;  3L2Q A;  3CBP A;  2DXU A;  3CBO A;  4N0A A;  1VUB A;  3L2V A;  1OZ2 A;  3DLL A;  2ZPF B;  3JCM V;  2O4X A;  4EMK B;  4M78 G;  4C92 C;  3CCE A;  2XKO C;  4CI0 C;  4DA4 A;  1YBY A;  1VQ9 T;  3H6Z A;  2L8D A;  3DLM A;  3OYB A;  3MEU A;  3I56 T;  2CZ7 B;  2E6N A;  2GCX A;  4LDU A;  3CCS T;  2XK0 A;  2RHX A;  4OGE A;  4E7K A;  3CC4 A;  1ZQ1 A;  5CKF A;  3BW1 A;  3VV0 A;  1VQ6 T;  2K3Y A;  4BB7 A;  1UB4 A;  2RB6 A;  1KQ1 A;  4QVC A;  1NZ9 A;  2DO3 A;  3PNW C;  4UC4 A;  3AHU A;  4GLK A;  3QDR B;  4FL6 A;  2FHD A;  2M0O A;  2DAQ A;  2ZPE B;  3OYI A;  4D6W A;  3LX7 A;  4M77 B;  3JSC A;  1K73 C;  2K4Y A;  1UGP B;  3X26 B;  1HXD A;  5FU7 B;  1MGQ A;  4LDX A;  5LJ5 f;  4YTL A;  5GMK j;  1YHQ T;  3OYJ A;  3OYC A;  2RH2 A;  3OS5 A;  3UT1 A;  4DOV A;  3RES A;  2YRV A;  2RJE A;  4PJO C;  1G3W A;  1PSF A;  3JCM W;  3CCV T;  1KD1 C;  3L2R A;  3JB9 D;  3UDC A;  3J7A F;  3OB9 A;  1Y96 A;  3OMC A;  3OY9 A;  5EG2 A;  4C92 A;  2L89 A;  1IRE B;  5CAI A;  1VQ7 A;  4IUP A;  4NOY A;  5L8R E;  2E65 A;  3M58 A;  1D3B B;  4L5G A;  3SWN A;  1YJW T;  2DTH A;  4XTW A;  1VIE A;  2QQ9 A;  1WQ7 A;  3P8H A;  1VQ5 A;  4M75 C;  4BAC A;  3LGF A;  2GFA A;  2FB7 A;  4JRK A;  2DIQ A;  1Q82 U;  2PVO B;  2QQA A;  1QP3 A;  2L5Q A;  2DEQ A;  3DB4 A;  3PFS A;  3SFM A;  2CZ0 B;  3V7R A;  1I81 A;  4C5H A;  4PJO D;  1YJN T;  1N9R A;  1QVP A;  3CCE T;  5LL6 S;  3QHS A;  4X34 A;  2HNI A;  5GAO n;  4M7D F;  3ASK A;  2K5F A;  3M4G A;  4C0D B;  2KY9 A;  4RKU E;  1M1F A;  1YIT A;  2DZ9 A;  2QQB A;  5CKB A;  5GAO q;  3HHT B;  2JUF A;  3UWN A;  5GAN 3;  2D9T A;  4L59 A;  4M77 E;  4HA8 A;  4QW2 A;  5LJ5 j;  1ZBX A;  3OBY A;  5IT9 E;  1S72 A;  5DLQ E;  1MHN A;  2QI2 A;  3NTH A;  4QQG A;  3EFR A;  1Y71 A;  5GAN 7;  3QBY A;  3QKJ A;  3URG A;  3SWN B;  4M75 F;  2PVD B;  4XTZ A;  2KVQ G;  4Z02 A;  1D3B A;  3C94 A;  4R56 A;  1M9S A;  3DKM A;  3MEA A;  2ZZD A;  1VQN A;  3V8L A;  3S3N A;  2EQJ A;  3BY7 A;  2KSS A;  1BI0 A;  3MEV A;  5GMK l;  5CCA A;  3PIO A;  3OW2 A;  3MO8 A;  2XDD A;  1NPP A;  2P4T A;  1OI1 A;  3PGG A;  2HQX A;  3RKW A;  3CPW S;  1JJ2 S;  3NTK A;  1BI1 A;  2E1H A;  4MDW A;  1VQO A;  1G5V A;  4M78 E;  1VQ7 T;  2GFU A;  3MHX A;  4ZN3 A;  2WSE E;  3RMS A;  1UGQ B;  2LVM A;  1BIB A;  3HL8 A;  5D6X A;  5GAN g;  5GAO p;  3OYK A;  4M7A A;  4C92 D;  2BKD N;  2VGM A;  4EMK C;  4C92 B;  1M4Z A;  4FM4 B;  3CCQ A;  5M9O A;  4ZTF A;  1YJW A;  2K3X A;  1JRI A;  4C0Z A;  3ZEH A;  2V8K A;  3PIP A;  3FB9 A;  1K8A C;  3UPU A;  5LJ3 j;  3WVE B;  5GAM j;  4M77 A;  5FRO A;  2WSF E;  1VQP A;  4JS5 A;  3BFM A;  3E1S A;  2DPP B;  3NFC A;  5CKE A;  4BUG A;  4HCZ A;  5FLX E;  4ZGE B;  3V8J A;  4J5Y A;  1OYX A;  3OMG A;  1YIJ T;  1HK9 A;  1WNL A;  5KE3 A;  3S6W A;  3OYY A;  4KUD K;  1NPR A;  1QW1 A;  3OYL A;  3CC2 T;  3O8V A;  4ZN1 A;  3LGL A;  2QTX A;  2EIF A;  1QVG A;  1RL2 A;  2A3L A;  4PJO A;  4LD9 K;  2KDS A;  4ELY C;  4M77 C;  1M1G A;  2Y4X A;  5C0M A;  3MEW A;  4II1 A;  2JNG A;  5FU7 C;  4JJN K;  4PL6 A;  1VQ4 A;  1Y96 B;  5I2S A;  1UEB A;  4Y91 A;  5GAN d;  1KC8 U;  1YI2 A;  4M7A E;  3G6E T;  2MI6 A;  4M75 G;  2QXF A;  5J3B A;  4A54 A;  4J6W A;  4BY6 B;  4F7U B;  1KG1 A;  3JCM c;  1YI2 T;  4A4E A;  2OTJ T;  1G3T A;  3QZ9 B;  3HPW A;  2RHI A;  3FJP A;  4ME7 A;  2XDP A;  4MZM A;  1K73 U;  4B9W A;  5I2M A;  4M7D C;  3TCJ A;  2DD4 A;  2A7Y A;  4C8Q A;  3OYF A;  3MP6 A;  3JB9 H;  1W2B A;  2EAY A;  2X4Y A;  3KXT A;  1U8R A;  3HRU A;  4FSX A;  4M75 D;  4A4H A;  3I55 A;  4C8Q G;  1YIJ A;  2DD5 A;  4C8Q E;  3GP8 A;  5DLO A;  3GIB A;  5HY6 A;  1U1T A;  3F70 A;  5HK3 A;  2EJG A;  2BUD A;  2LNV A;  1I4K 1;  4BY6 C;  3OS0 A;  1XOV A;  1K9M C;  2JZ2 A;  5GAO r;  3SD4 A;  4BE1 A;  4PLL A;  1Q81 U;  1G3Y A;  5LJ3 h;  2E6Z A;  4N0A C;  3HFN A;  4MZP A;  3FIF A;  5LJ3 f;  3V7C A;  5A0L A;  5GMK h;  4M7D D;  2OTL A;  3RUX A;  3RIR A;  2B8A A;  3PT9 A;  1Q82 C;  4C5E A;  1VQM A;  2MAM A;  2DJZ A;  3E19 A;  2FYK A;  2EQU A;  4OF1 A;  2V8I A;  5GAN 5;  2CGH A;  2DK3 A;  3GNG A;  1FWZ A;  4M7A B;  5CO7 A;  2DTI A;  4MML A;  2RK1 A;  3V7S A;  3OS2 A;  3CCR T;  4OB2 B;  3S3M A;  1WPY A;  1Q86 U;  2Y90 A;  3SWN C;  2JTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...