2L89A

Solution structure of pdp1 pwwp domain reveals its unique binding sites for methylated h4k20 and dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
b'SADDRLNFGDRILVKAPGYPWWPALLLRRKETKDSLNTNSSFNVLYKVLFFPDFNFAWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKTPPDLKEESSTDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PWWP domain-containing protein 1
publication title Solution structure of Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Protein binding
total genus 18
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l89A00
2LCCA 3L2QA 1SSFA 3OYEA 2PQWA 2GF7A 1RI0A 4E7LA 4BE0A 2EQMA 2JTFA 2BUDA 3BDLA 3FDRA 3OYKA 3OA6A 4E7JA 4BD3A 2K3XA 3META 3QJ6A 4QQ6A 3FC3A 3OYNA 3QIIA 3NTHA 1KHCA 2RHZA 4FL6A 3MEWA 3OB9A 3OYMA 3DB3A 4C5EA 3SD4A 5IAYA 3LYIA 4B9WA 3LX7A 3OYCA 3MEVA 1WJRA 3PFSA 4E7KA 2RI3A 4BE2A 4IUUA 3OQ5A 3C4SA 2WACA 4N4HA 4X34A 3NTKA 3O8VA 2EQUA 2BKDN 2XK0A 3PMIA 2E6NA 3DLMA 2M16A 3LGFA 5FROA 3S3MA 1N27A 3MEAA 5IN1A 2RHXA 4IUVA 4ZTFA 3S3OA 2DIQA 2EKOA 2YRVA 2RI2A 2RJEA 3H6ZA 5C0MA 2XDPA 1XNIA 2MWOA 3L42A 2RHIA 4N4GA 4NS5A 4Q5WA 2D9TA 2M0OA 2RJFA 3MP6A 4UC4A 3S6WA 3OYHA 2CKKA 1OYXA 2F5KA 4IKFA 4GY5A 2X4XA 3H8ZA 3CEYA 5C6SA 2R5AA 2G3RA 3P8DA 2LDMA 3ME9A 4B9XA 2X4YA 3LH0A 5KCHA 3OYLA 3L2RA 4BACA 2FHDA 3LGLA 4QQDA 3F70A 5M9OA 2L3RA 2GFAA 2X4WA 3OYJA 2B8AA 3GOXA 3KUFA 4Z02A 2QQRA 3OYAA 4PLLA 5D6WA 2R58A 3M9QA 3E9GA 4HCZA 4A4FA 4IUQA 1OI1A 2DAQA 5KE2A 2RO0A 3OYBA 2DIGA 3QBYA 3MO8A 3NTIA 5D6XA 4C5IA 5FRNA 2LVMA 4L59A 2LRQA 2RI5A 5D6YA 5KE3A 3OY9A 3OMCA 3L2VA 4E7IA 4ZTJA 2K3YA 3OYDA 2HQEA 2RHYA 3FEOA 5KH6A 4BDZA 4N4IA 3S3NA 2EFIA 2HQXA 3MEUA 1OZ3A 1H3ZA 4C5GA 2MWPA 3OMGA 4II1A 1G5VA 2RHUA 2RJDA 2L89A 5J39A 4OVAA 4IUTA 4A4HA 3PNWC 4QQGA 4IURA 5CIUA 2P0KA 3ZEHA 4CRIA 1MHNA 3OYFA 2GFUA 4BDYA 3ASKA 3UWNA 3UT1A 4EDUA 2BIVA 2IG0A 2R57A 4IUPA 3QKJA 3DB4A 3OS2A 3P8HA 1OZ2A 2O4XB 3EAEA 2R5MA 4PLIA 5FRMA 3L2WA 2VYTA 1WGSA 3FLGA 4LD6A 2JZ2A 2LTOA 3E9FA 3OYGA 3OS1A 3OS0A 5J26A 3Q1JA 4QW2A 2QQSA 2E5QA 2RJCA 2NLUA 2EQKA 3LLRA 4PL6A 3PMTA 1WJQA 1WJSA 4QVZA 4FU6A 3MP1A 3OYIA 4A4EA 2X35A 4A4GA 4BE1A 4E7HA 2O4XA 4RG2A 2EQJA 3MP8A 4C5HA 3L2UA 2L8DA 2M1HA 5KCOA
chains in the Genus database with same CATH superfamily
4M75F 5LJ5j 2KDSA 3SEMA 1NG2A 2KYMA 4DBQA 1QP2A 1VQ9T 2ZPEB 4ZNXA 3FC3A 3O5ZA 1SEMA 1WYXA 4MDWA 3LW5E 4J7FA 2RH2A 2XK0A 3CD6T 3MEAA 1RAIB 5FW9A 3QDRB 1QMCA 1GCPA 1I0CA 1WHKA 1UJYA 1VQPQ 1QVGP 3H9NA 4M7AD 1XJWB 2BZXA 3PVQA 1K8AR 9ATCB 6AT1B 2DF6A 1QKXA 3S6WA 1QKWA 2ROLA 4R55A 4NL2A 4PFOA 3PE0A 4ESRA 1OYXA 4ORZA 4GY5A 3A8OB 4OB1B 3I56A 1PG5B 4KUDK 2HNIA 1WHLA 4D6WA 5I11A 1BIAA 5EC7A 4CC3A 1VQ6Q 1WQ7A 2L3RA 2O2OA 1OULA 1LVKA 4J5YA 1MNDA 2K5FA 2YLBA 1U1TA 4HCBA 1UHFA 1K0SA 1H641 2DTOA 2HL5C 3HSBA 4EMGA 2E10A 1Y71A 3HFNA 1M27C 1B34A 2H3JA 2ZAEA 2CP0A 1JEGA 4A4HA 1N9SA 5CIUA 4J9BA 1RLPC 1U5SA 2DYBA 1M8VA 4PNOA 3G4SA 4ME7A 1UECA 1ZA1B 3GLXA 3OS2A 1PKSA 2R5MA 2RMOA 2XKOC 4BI8B 1H92A 1UHCA 2KGTA 3GP8A 3HPWA 2RPNA 1PCXA 1OOTA 2QA4T 4C92G 2X35A 4KUIA 3RIRA 4XQ3A 2CH4A 2LNVA 4J9IA 1NEBA 2V1RA 2VB6A 1X75C 2PVOB 1FMKA 3H0FA 3UDCA 5LJ5h 2RHZA 1UE9A 2DL7A 2IVWA 1BYMA 3HHTB 3JCMf 3H41A 5IH2A 3EH2A 2E3IA 5GMKl 2P0PA 1GL5A 2OAUA 2D8HA 1YI2T 4ZN1A 2EJ9A 4PJOE 3PIPA 1YJWT 4OGCA 2KMTA 2CGHA 2JXBA 4KT0E 1Q86R 3JAME 2DPPB 2DK3A 1G3TA 2HZYA 2DNUA 4NS5A 1UGRB 5DY9A 1I5OB 4C92D 2C0IA 1VQNQ 1X69A 4PJOF 1JB0E 3RNJA 2LDMA 2YRCA 5DLQE 1YJ9T 2DL3A 2X3WD 3CCMA 1YHQT 3F70A 1X6GA 2FO0A 1Z9ZA 4J9GA 4DOWA 2CP5A 1HD3A 3KUFA 2V1QA 1B34B 4JS5A 1ZSZA 3E1SA 1RI9A 3TU4K 2LRQA 4M77E 3GNGA 4OMPA 3X28B 5KH6A 3S3NA 1K73R 3INZA 2VC8A 4PJNA 2RQRA 2LNHB 4C0FA 2WSFE 2ZZDA 2PVDB 1MHNA 1CSKA 2GFUA 2PUOB 2DJZA 2JOYA 4CI0C 1RAAB 4ZGJB 4M77F 4ELYC 4C0DB 5LJ3d 3OS1A 2L3SA 1I5LA 2J06A 5HK3A 3LLRA 3VS3A 4E7HA 2EAYA 4PJOG 1WLPB 2LP5A 2OAWA 3L2QA 1I07A 1MV0B 4HCCA 1RI0A 4LN2A 4BE0A 1VQ5A 4EIKA 4XU0A 1VQ9Q 3FDRA 4PJJA 1C1AA 2FZKB 2J6KA 2X4JA 1VQMA 4HT9A 1UUEA 2A37A 5GAOp 4FYXB 3C95A 4B9WA 3ZFJA 1YWPA 1OU9A 4OF1A 2PZ1A 3CD6Q 4N4HA 2D1XA 3EGDA 3EG2A 1ZLMA 4M4ZA 3PMIA 3SHWA 1K4US 3VU3C 3J80E 3JCMQ 1W70A 2X51A 4MZTA 1JJ2P 2YRVA 1YJ9A 2OTJA 2EKHA 3CPWP 2RJEA 5C0MA 1YHQA 1OU8A 2Y90A 1M1FA 4NOYA 1VIEA 4OMLA 4IKFA 4M77G 1XQHA 2X4XA 2JN0A 1OX9A 2R5AA 1MGQA 3LH5A 4JJCA 2AHJB 1RAEB 1R77A 3FB9A 3HFOA 3OYLA 1WDXA 4M75A 4QQDA 5L23A 1PSFA 1VOMA 4XTYA 2CREA 2DKGA 4Z02A 3G6EA 3JRZA 1BI0A 2JM9A 4L6V5 3E9GA 4JLIA 1GBQA 1MMNA 1Q86C 3OY9A 1IGUA 1M1KU 2QDYB 2V8JA 2KAFA 5FU6C 3VUBA 1CKBA 4RTTA 2RJDA 5J39A 4E2FB 1GXIE 1WFWA 1AWOA 4RTYA 3CC4A 2ED1A 3JB9I 3P8HA 3EAEA 5LJ3e 4JDSA 2QA4Q 2RJCA 4RCCA 2XMFA 5IT9E 4F17A 1W1FA 4A54A 1ZBXA 3GBQA 3HRTA 1SG5A 3C94A 1VIFA 2LCLA 4QQ6A 1PWTA 1C0MA 2XI9A 3QIIA 1R0CB 3EGDB 4RTZA 1IB8A 1VA7A 2DRKA 2IIMA 2K7AA 2YT6A 2E5KA 4D8DA 3TCJA 1VQ4T 4FW1A 1WJRA 3RMSA 4KGVB 2RI3A 1YJWQ 1KC8C 4JJNK 1KQSA 3QUIA 2EQUA 5GMKe 2E6NA 2M16A 2HEQA 3LGFA 3MHXA 3T9NA 3I55T 2LJ3A 1E6GA 5HKCA 2E65A 1W2BA 2DM1A 1H3HA 4M7DA 3MCAB 2KXCA 2MMPA 4UC4A 4CC7A 1VQLT 4M75B 1MUZA 4OMMA 3HTRA 2EGEA 1KFZA 3EGUA 2LCSA 4J83A 1YJ9Q 2HKNA 2ZPHB 1YHQQ 3LH0A 2LT4A 3D7SB 5CAIA 3OBYA 1N8RU 4WCIA 4JRPA 1NJIC 4J7IA 4C0GA 3FRNA 3E2UA 2QQ9A 2LJ1A 1VQPT 1PRLC 1AWXA 2RI5A 2RF0A 3L2VA 3JV3A 2GCXA 5LJ5g 2EFIA 2HQXA 3A8HB 5LJ3f 3SDZA 4Y28E 4Y91A 4C8QC 5GAMh 3VKIA 2F2VA 3HKSA 4EDUA 1TOVA 1FWZA 1T3LA 5IHNA 5FRMA 1UJ0A 1B07A 2FEIA 3M0RA 3VUZA 5KE2A 4M78C 1SRLA 5GANj 3OYIA 3M0QA 4XTVA 2DE0X 4N0AC 1LPLA 2M1HA 4O5VA 4OMFB 1UTIA 2LCCA 4LDWA 1B7TA 4OGEA 4LDUA 3JCMc 1VQKT 2NUZA 1Y7XA 2K9GA 3JCMP 2YSQA 1GCQC 4A53A 3QYHB 3OB9A 2YUNA 2FZGB 1W2BS 3LX7A 2ZPFB 2XIDA 2X9HA 5CKDA 4MMKA 4C0ZA 4E7KA 1K1ZA 2A08A 4M7DB 2WACA 1BI2A 4JRQA 1V1CA 2VXEA 4LNPA 3CCLT 3WXMB 3CMEA 2MAMA 1BCMA 2RHXA 4ZTFA 3H0IA 2A28A 2DBKA 2ROTA 7AT1B 2OTLT 2FRWA 1M90C 2X3XD 2AT1B 2FZCB 4A4EA 2KROA 1LJOA 1UDLA 1FX7A 3H8ZA 2QXFA 5C6SA 5ECAA 1TG0A 1Y57A 1Q81C 1RAFB 3GIBA 2CSQA 3AHUA 4BY6B 1O75A 2LX7A 3GOXA 3OYAA 3JCMd 1HSQA 5KYUA 4VUBA 1D3BA 2DVJA 1UGVA 2OX7A 5KE3A 3JB9G 4KBMB 3M59A 2HQEA 3G1JA 3NMZC 2KT8A 2O31A 3PIOA 2PVGB 4PJLA 4DBFA 1YCYA 3L2ZA 4PJOB 2KRSA 5IHKA 2DL4A 1PHTA 5GMKi 5CR2A 3I56T 3E9FA 1TUDA 3QG1A 2A3LA 4HA8A 5KYNA 2JMCA 2QQBA 5D7UA 1Q7YC 2L8DA 2DLPA 3WVDB 4AMCA 1OPKA 2GGRA 3X26B 2QTVA 1Z9QA 2KY9A 1NBEB 2JTFA 1R0BG 5I2MA 4BD3A 4GLKA 3META 4M75E 1TWBA 1U1SA 3BY7A 2RK1A 3V7SA 3GF5A 2DFUA 3CCLA 3JB9D 3G71T 2P84A 3DB3A 2DRMA 1VQ4Q 4V2SA 4X1VA 2HQHA 3JCMh 1X43A 1CKAA 4PFPA 1YJNT 2D8JA 3M0PA 4M77B 2DEQA 3G4ST 3QWXX 3RERA 1OX8A 3O8VA 2KRNA 1YBYA 3OYYA 4RTXA 1Q82U 1KD1C 5IN1A 2FVUA 4HXJA 4C8QE 4DEYA 1VQLQ 2MI6A 2RHIA 2ECZA 3P8BB 3SWNA 4EMKC 1M2VB 2IPOB 3QJYA 3HP9A 2MPXC 1D1BA 2NUTB 4M78E 4PK4A 1D3BB 4J9DA 1I4K1 4C8QF 4BI4A 1JXOA 3JCMe 1JQQA 2F5TX 5CKEA 4IUQA 5FLXE 2EVRA 4F7UF 3V8KA 1TUCA 4L59A 4M78F 2KXDA 2LZ6B 2JM8A 2P4TA 4PJMA 3X25B 1OZ3A 3I9QA 4BI3A 3EGXA 2L0AA 2Y4XA 3ASKA 5GAOl 1EX4A 3CCQA 2VXFA 1N9RA 2K79A 4M75G 1ZA2B 3L2WA 2ED0A 3EG9A 4DBHA 2JZ2A 4R56A 3EHRA 2KT1A 3CCMT 3Q1JA 4OP0A 4M7DE 1VQ8T 1VYTA 3G71A 4RG2A 4C5HA 1M5Q1 1O9SA 1VQKQ 1KHIA 5GAN7 1YJNA 5I22A 2RB6A 3OYKA 4X9CA 2BE7D 2QTXA 1IRXA 1KQ1A 4M7DF 2ENMA 4MZMA 1G3SA 1KQSP 3OYCA 3JCMJ 2O01E 2LQNA 2CZ7B 2C0TA 3TVTA 1X27A 1YITA 1IZ6A 4IUUA 3CCLQ 1W2BP 2QK0A 2E12A 5HCKA 1PD0A 1X6OA 2MK5A 2OTLQ 4M75D 3SWNB 3JB9J 2E3HA 2EKOA 4XAXB 4MMLA 4JRIA 1K8AU 4F14A 4XTWA 1SPKA 4ZGDB 2BZ8A 2CZ6B 5FU7C 1A0NB 2QGGA 5CVIA 2G3RA 3VS4A 2DMOA 5A2QE 1VQ5T 3REBB 1VQ7A 3DLLA 3RKXA 1VQMT 4JRKA 2B8AA 2M9UA 1EZZB 4DQ2A 3EGXB 1G83A 1Y07A 1M3CA 2K2VA 4KRTA 2E41A 1SKUB 5D6XA 3FIFA 3M55A 2M0YA 4MDXA 2DX1A 5LJ3j 2GTJA 4M7DG 4FSSA 3CCUA 2D0NA 1M1GA 3VV0A 2OTJT 4OVAA 3EG9B 3ZEHA 4D8KA 1VQ8A 3OYFA 3LWHA 1D0XA 3VRZA 3A8GB 5GJWB 2YWWA 3I56Q 3CBPA 1TS9A 5AYFA 5CKBA 5GAN4 4BDZA 5GJVB 2E5QA 2DD5A 1MMDA 2DBMA 2EBPA 3R6OA 1V76A 3MP1A 2VWFA 3G6ET 4HCKA 4JZ3A 1RACB 3OYDA 2EYYA 1ZBJA 3JCMX 5GMKj 3EG3A 3G71Q 2JTEA 2FRYA 1XOVA 3MJXA 1M3AA 4AFZC 1KC8R 2VVKA 1KHCA 4M7DD 2CS7A 3OYMA 4JLGA 1YJNQ 2JUFA 1YIJA 3G4SQ 4BUGA 1UEBA 2L3PA 2RD1A 3CC4T 5FROA 3DLMA 4E7SA 2QEXA 1ZUYA 4XTZA 2W0ZA 3M0SA 1ZQ1A 2K6DA 1QW1A 2D9TA 2CKKA 1I1JA 1BU1A 1NJIR 2QQAA 2JVVA 1D0ZA 2COZA 1KIKA 2W10A 2GFAA 4BB7A 1F1BB 3CC7A 1RUWA 2MCNA 1KSWA 3VS5A 5GANg 4EPCA 2DIGA 2KBTA 3MO8A 3NTIA 2HDAA 2EGCA 2LQ8A 3CQTA 2CZ1B 3I35A 2AIRB 2LJ0A 4Z89A 3VS6A 2K3YA 3BDUA 2DL5A 4E47A 1K73U 5I2SA 4PJOD 3OMGA 1ZSZB 5LJ3h 3CC2T 3CCVA 1WHJA 5FU6B 4BDYA 1GBRA 5GAOr 2I0NA 1EFNA 4IUPA 5LJ5f 2BTTA 4KH0B 3CCMQ 4LD6A 4CC2A 1AT1B 3QSUA 1QCNA 1VQ8Q 4PL6A 2NLUA 1Y96A 4EMHA 2SRCA 5GAMj 2RQWA 3OS5A 2EQJA 1M4ZA 2RK2A 2VGNA 1HXDA 1NE8A 3TQ7P 4C8QA 4XU1A 2VKNA 2GF7A 2COYA 4JPBW 3A98A 3OYNA 2O9SA 4F7UA 4J9FA 3NTHA 2RN8A 3ZL7C 4M77D 5GMKh 2GNCA 4M78A 4QKUA 2EYXA 2HL3A 2JS2A 4ELZC 4N0AA 3GNFB 2CP6A 1N8RR 3V8JA 1M90R 2FL7A 1YIJQ 4M7AC 5CCAA 5KYWA 1SHGA 1GCQA 2CSIA 1AHJB 4Q5WA 3CMAA 3MP6A 3OYHA 1Q81R 3KFVA 3UA6A 1ZUUA 1TSFA 1VQ5Q 1WHGA 1IREB 1VQMQ 2V8IA 2PUKB 3DKMA 4FSXA 1U3OA 2KYBA 3VS2A 2VUBA 1I8FA 2X4WA 4E6RA 2CH4W 5D6WA 3M9QA 2F2WA 4A4FA 2DO3A 4A63B 1LOJA 4KGXB 4IIOA 3CC2A 5HY6A 3JSCA 2GQIA 2YUPA 3A1PA 3CMET 1OQKA 2CP3A 2OI3A 1E7OA 2OTJQ 4PKCC 8AT1B 3JCMW 1QP3A 1M1KC 3QDFA 2YHTA 2DEUA 1NLOC 4IURA 4QVDA 2NWMA 5FWCA 5CQXA 2QGFB 4LDVA 2V26A 3OSVA 1N6AA 1SHFA 1Q7YR 3OYGA 4C8QB 3CCVQ 1FMVA 1WJSA 3MKDA 3ZBDA 3G6EQ 4QVZA 1K9MU 2CT3A 3V7RA 4HVUA 2EYZA 2RM4A 4F7UB 2CUBA 1OV3A 1ZUKA 4M78B 3CCRT 3UATA 2BUDA 1NM7A 4J9EA 2EJGA 1ABOA 2K5IA 3LYIA 2C06A 2CZ0B 1VQOA 3CCJT 1KD1R 4FT4A 3MEVA 3PFSA 5KYWB 3CC4Q 1ZHIA 3I5RA 2AK5A 2EYQA 4MZPA 1EIFA 1TU0B 2QAZA 4AG2C 3CCST 4C92C 3V8LA 3L42A 2ATCB 3OYBA 4AFSC 4J6WA 1BCOA 4J8OA 2BE9B 2F5KA 4K11A 2LX9A 4BACA 2KNBB 5A0DA 5IXFA 2DXUA 3UA7A 1TTHB 1QVFA 1NYGA 1FYNA 1AOJA 1N8RC 3GPLA 4Z88A 1GFCA 2NUPA 1GFDA 3TSWA 4E7IA 4ZTJA 1QWFA 4EMKA 3G7ZA 1H3ZA 2RHUA 3CC2Q 1WPYA 1DJ7B 3UF4A 3PNWC 2Y4YA 2GBQA 3CCET 4P5NA 4GBQA 1OZ2A 3QZ5B 3RR6A 3CCRA 5IHIA 1Y0MA 5GANd 4J6XA 4FU6A 2O4XA 3NFCA 1BKBA 3CCJA 3RUXA 1M9SA 1AWJA 4M7AF 3ER0A 3OSSC 3M57A 4E7JA 4Z8AA 4KULA 1JXMA 4RTWA 1VQ6A 1WXUA 3MEWA 1U8RA 3CPWA 3AT1B 4FM4B 1I81A 3J81E 4LD9K 3NGPA 2E1HA 1HYOA 3CCSA 2P4RA 2J05A 3CCQT 1UG1A 1RABB 2EJFA 5A0GA 3M58A 1VQOQ 3LWIA 4RTUA 5IXBA 4OMOA 3TEEA 5LJ3g 4JUVA 5GAN6 1JU5C 1XNIA 2DL8A 1YFNA 3QWYA 1QVFS 4WF2A 2DXTA 4PJOC 3CEYA 2K5LA 2EWNA 3CPFA 3TSZA 4KGZB 5DLOA 2FHDA 1YCSB 5M9OA 2NUPB 2EW3A 1WXBA 5GAN2 1G3YA 1JBMA 4EMKB 5CQYA 1JRIA 1FXXA 2E6ZA 2HSEB 1NZ9A 1YITT 3QBYA 2DTHA 3CCEA 2O9VA 4WTOB 3CMEQ 3VS7A 3EH1A 1ZX6A 4N4IA 4F7UE 2KI7A 1SF9A 2XHCA 2RNAA 4OMNA 5KYUB 2BZYA 3M4YA 1ARKA 2ZGWA 1UB4A 2J6FA 3EFOA 2KSSA 2R57A 1HK9A 2AKKA 4M77C 1WNLA 2MOXA 3DB4A 1C6VX 2O4XB 2MYSA 2C0OA 5GANe 2DZCA 1VQ7T 4AFUC 4C92E 1BBZA 4BE1A 1JJ2S 2O88A 1WXTA 3CXCA 3CPWS 5EG2A 5CKFA 2QYZA 3KBGA 3REAB 3CCRQ 2SEMA 1SSFA 1VQNA 3HL8A 2AZVA 1PNJA 3QZ9B 3QJ6A 5GAN3 3CCUT 1M8MA 4C92F 1VUBA 1X2QA 2JMAA 3CCJQ 4C5EA 3WVEB 3SD4A 2YDLA 3CBMA 1P92A 2DXBA 1N5ZA 2J7IA 2LC4A 1RAHB 5AT1B 5LJ5d 4NL3A 1N27A 2RQTA 1XTDA 3CCSQ 2RI2A 4XU2A 2EIFA 4RCBA 4LDXA 1Q82C 4C8QG 2CDTA 2MWOA 1D1CA 1D1AA 1IHWA 5GAOm 3FJ5A 2KK4A 4F7UG 4B9XA 3L2RA 2OJ2A 5KCHA 4M78G 4HT8A 2NYSA 4JJBA 5FU7B 4XTUA 4XK8E 2HKQB 4AG1C 1B3QA 2EGAA 1YIJT 2RQVA 5GAMg 4C5IA 1PRMC 2JW4A 1K9AA 1VQ9A 3C12A 3EFOB 3M0TA 2A36A 1KK7A 1G5VA 1TXQA 5GANf 2QEXT 3CCEQ 2YXYA 3JCMV 1QCOA 3UT1A 4C8QD 3CXCS 4QT7A 2XDDA 3CD6A 2MF2A 4F16A 3SWNC 1WJQA 1AD5A 2DVEA 2G6FX 4M78D 1RL2A 2DZ9A 4PFZA 1YN8A 1OPLA 3CC7T 4DBRA 2QI2A 5KCOA 3OYEA 3TREA 2QG9B 5CKHA 5GMKm 2K3XA 1OEBA 3VYHB 1PSEA 4E7ZA 5DM7R 4DEXA 4LDYA 5HK0A 2F69A 2F1LA 1NPRA 2CUDA 1S72T 5GAN8 3CCVT 3CCQQ 3M5AA 3A8MB 5LJ5e 4LUEA 1VYVA 3X24B 2DJQA 1G2BA 2M02A 1X01A 3S3OA 2DD4A 1W4SA 4O6JA 1ACMB 4FYWB 3HRUA 2ABLA 2LQWA 1K8AC 2V8KA 1QQJA 2JJ9A 4ZN3A 1UFFA 2X4YA 4L5GA 1QVFP 2CT4A 1QVPA 1WHMA 3UPUA 1M2OA 4JZ4A 2QA4A 4M7AA 1Q86U 2QQRA 2K4YA 2KR3A 1YITQ 1NPPA 2CP2A 1OI1A 3M53A 4JJDA 2JTMA 1K76A 4X9DA 2WSEE 1T0JA 1M1KR 2E4HA 3U23A 2L3QA 3M4GA 3BW1A 5FWBA 2RHYA 5KYYA 4Y92A 4RMOA 2MWPA 2DYIA 3EG1A 1BK2A 4FW2A 2KVQG 2L89A 4C0DC 4FYVB 5I21A 3CMAT 3PGGA 1YI2A 1YJWA 2MIOA 2FPEA 5GAOn 2E70A 1VQ7Q 1AEYA 2ZPBB 1BB9A 2JNGA 2AKLA 2B86A 2DA9A 4QW2A 3OW2A 2XG8D 3CBOA 1MMAA 3EHQA 3MP8A 2COWA 3M54A 3JCMg 1BI1A 2PQWA 1S72A 2EQMA 2EYWA 1KG1A 3CCUQ 2YUOA 1PKTA 1KC8U 5IAYA 4IIMA 1UGSB 5CO7A 4GLMA 4RUGA 3IQLA 2FB7A 1YWOA 4OB3B 1UGPB 4LE9A 1LNXA 2E64A 4X34A 3NTKA 3H0HA 2D0QB 2FG0A 1X6BA 2DIQA 3C0CA 1G8XA 3VJPA 1PD1A 2H8HA 3H6ZA 1W6XA 4J9HA 5GAN5 2PNIA 1NYFA 2XDPA 1ZSZC 2M0OA 2RJFA 1PM3A 2PU9B 1QVGA 4M7AB 3KXTA 2F2XA 3P8DA 1TH7A 2ZPIB 4OB2B 4OMQA 1NJIU 1AVZC 2YRDA 3NHNA 2DERA 5KYYB 2CYZB 1VQOT 4C92A 1T3SA 1WQWA 1QWEA 5D6YA 2GQVA 1K9MR 2XD0A 3FEOA 2QEXQ 4RTVA 3N5BB 3OW2S 2KE9A 4ANJA 2A7YA 4CRIA 2HBWA 2KEAA 5LL6S 1K73C 4HVVA 2LQKA 4R0KA 1RLQC 1GRIA 4PLIA 2VYTA 2J6OA 3FLGA 2LTOA 2PTKA 3SFMA 3OS0A 3CXCP 5GAMd 3URGA 1YI2Q 3CC7Q 1SRMA 4HKEA 3QXEB 4FIBA 1JO8A 3VS1A 1V29B 3BDLA 1TUGB 3OA6A 1Y96B 3E19A 1AZGB 1IHVA 1M3BA 3JB9H 2VV5A 4FL6A 1WHHA 2RA2A 2HCKA 1S72Q 2ZPGB 1S1NA 3HRSA 4QVCA 4XTXA 1D0YA 4BE2A 3OQ5A 2ESWA 1QVGS 1FMWA 4CC4B 2HAXA 3BFMA 4M75C 1M90U 4TVRA 2HBPA 3BE3A 4IUVA 4LUDA 3VYGA 1KJWA 1BIBA 3SB2A 3VRYA 1U06A 2D6FA 2HMAA 2XICA 1Q81U 3EFRA 1BI3A 2DILA 1SSHA 3QYGB 4J9CA 2QDLA 1WIEA 4DOVA 2L5QA 4XU3A 4C92B 1IGQA 2KQWA 4FYYB 1X2KA 2GTOA 2YLCA 2FPFA 2M51A 2DETA 3OYJA 1VQ6T 1Q95G 2L2PA 2EPDA 4PLLA 3RMQA 3A5ZB 2XDBA 1YNZA 4LXCA 5KYXA 2RO0A 1YP5A 2K2MA 5FRNA 1UGQB 4PJOA 1HJDA 4RG8A 4J6YA 2EQIA 1MNEA 3MEUA 4C5GA 3V7CA 3MPUB 4IUTA 4QQGA 2FPDA 2P0KA 3CMAQ 1VQ4A 3PT9A 3UWNA 1KQSS 3EFSA 4ATOA 2BIVA 2IG0A 4YTLA 3JB9F 3QKJA 2YUQA 1M30A 1MMGA 3I55A 3L1AA 1WZOA 5GAMe 1Q7YU 2EQKA 1RAGB 1E6HA 2FYKA 1ABQA 4A4GA 1VQLA 2VGMA 1NEGA 3L2UA 4FCYA 4DA4A 1PC0A 4KH1B 3THKA 1K9MC 4E7LA 2DXCA 3VS0A 3EG0A 1NLPC 3PVLA 3J7AF 3RDVA 4M77A 2ZCFB 4HVWA 1QLYA 1G3WA 1R8OB 4M7DC 4RKUE 2Z0WA 4M7AE 1MV3A 3ULRB 4JS4A 3RKYA 3NPFA 3M0UA 1KD1U 1RADB 1WI7A 1VQPA 2P0QA 4A4KA 5J3BA 3C4SA 2BKDN 1Q82R 4AFQC 4F04B 3S3MA 3PTAA 1M2VA 4ZGEB 3I5SA 4OB0B 2QASA 2HSPA 2NUTA 3FJPA 3QPHA 1AWWA 4N4GA 1JJ2A 4BY6C 3JCMb 2XU8A 3ME9A 3A8LB 5L8RE 1VQNT 1T0HA 1WA7A 5KYXB 2DTIA 2AZSA 3RKWA 3LGLA 2I2LA 3RESA 1LCKA 2CP7A 2JT4A 2JS0A 1VYUA 4B6MA 1WX6A 2K3BA 1D09B 3OBWA 2R58A 4HCZA 1IXDA 3R6NA 2DAQA 1QCFA 1H8KA 1ZSGA 1VQKA 2H3EB 2K57A 2LVMA 2A0FB 5CK9A 3OMCA 3QO3A 4FT2A 4II1A 2WSCE 4AT1B 2KRMA 1J3TA 5GAMf 5GANh 2HD0A 1KQ2A 3OW2P 5GAOq 1WGSA 2LMJA 5A0LA 4M7AG 3M56A 1IO6A 5J26A 2QQSA 3RBBB 2OTLA 3X20B 3PMTA 3QHSA 1K0XA 2VASA 3I55Q 8ATCB 2LT1A 2RQUA 1AZEA
chains in the Genus database with same CATH topology
4C8QA 4XU1A 2LCCA 4LDWA 4M75F 4OGEA 3OYEA 4M7AF 2GF7A 5LJ5j 4LDUA 3JCMc 1VQKT 2KDSA 3TREA 3JB9F 5CKHA 5GMKm 1Y7XA 1QP2A 2K3XA 1VQ9T 2ZPEB 3VYHB 3FC3A 3JCMP 4A53A 3OYNA 1PSEA 4F7UA 5DM7R 3NTHA 3QYHB 4M77D 4LDYA 3OB9A 4MDWA 5GMKh 4M78A 1W2BS 5HK0A 3LX7A 2ZPFB 2F69A 2XIDA 3CC4A 1NPRA 5CKDA 5GAN8 3CCVT 4MMKA 1S72T 4C0ZA 4E7KA 3M5AA 4ELZC 4M7DB 2WACA 1BI2A 3GNFB 3LW5E 4J7FA 2RH2A 3A8MB 4N0AA 5LJ5e 4JRQA 2VXEA 3V8JA 2XK0A 3X24B 3WXMB 3CCLT 3CD6T 3CMEA 2MAMA 3MEAA 2RHXA 3QDRB 4ZTFA 2FL7A 1X01A 3S3OA 4M7AC 5CCAA 2OTLT 4M7AD 2DD4A 1M90C 1W4SA 4A4EA 1AHJB 4Q5WA 3S6WA 4O6JA 3MP6A 4R55A 3OYHA 3CMAA 4NL2A 1LJOA 1OYXA 4GY5A 1FX7A 3H8ZA 2QXFA 3HRUA 5C6SA 3A8OB 4OB1B 1K8AC 2V8KA 3I56A 4KUDK 1IREB 4ZN3A 2V8IA 2X4YA 2HNIA 4L5GA 2PUKB 4D6WA 1Q81C 1BIAA 1QVPA 3DKMA 4FSXA 3GIBA 1WQ7A 2L3RA 3UPUA 3AHUA 2VUBA 4BY6B 2QA4A 4M7AA 1I8FA 2X4WA 1O75A 3GOXA 1Q86U 2QQRA 3OYAA 4J5YA 2K4YA 5D6WA 2K5FA 2YLBA 3M9QA 3JCMd 1NPPA 4A4FA 1U1TA 1OI1A 2DO3A 3M53A 1D3BA 1LOJA 4VUBA 4HCBA 2JTMA 4X9DA 3CC2A 2WSEE 5HY6A 3JSCA 5KE3A 1H641 3JB9G 2DTOA 4KBMB 3HSBA 3M59A 2HQEA 3M4GA 3BW1A 3CMET 2RHYA 4EMGA 2E10A 1Y71A 3HFNA 1B34A 2H3JA 4PKCC 4RMOA 2MWPA 3JCMW 1QP3A 2KVQG 2L89A 1M1KC 4C0DC 5I21A 3PIOA 2PVGB 4A4HA 2YHTA 1N9SA 4IURA 5CIUA 4QVDA 5CQXA 1M8VA 4PNOA 1YCYA 3PGGA 3L2ZA 3G4SA 3CMAT 4PJOB 4ME7A 1YI2A 1YJWA 3GLXA 4LDVA 3OS2A 3OSVA 5GMKi 5GAOn 2R5MA 2E70A 1N6AA 5CR2A 3I56T 2XKOC 2ZPBB 3E9FA 4BI8B 3QG1A 2JNGA 3OYGA 2A3LA 4C8QB 3GP8A 4HA8A 3OW2A 4QW2A 3HPWA 2XG8D 1WJSA 2QQBA 3ZBDA 4QVZA 2QA4T 3CBOA 4C92G 1K9MU 2X35A 4KUIA 3V7RA 3RIRA 2RM4A 3MP8A 1Q7YC 4XQ3A 2L8DA 4F7UB 3WVDB 3M54A 3JCMg 1BI1A 2LNVA 2PQWA 3X26B 4M78B 1S72A 3CCRT 2EQMA 2JTFA 2BUDA 2KY9A 1KG1A 4BD3A 5I2MA 1X75C 4GLKA 3META 4M75E 2PVOB 1U1SA 2EJGA 3BY7A 2RK1A 3V7SA 3GF5A 3CCLA 3JB9D 3G71T 5LJ5h 3UDCA 2RHZA 1KC8U 2IVWA 2K5IA 3DB3A 1BYMA 3HHTB 3LYIA 1UGSB 5CO7A 2CZ0B 3JCMf 5IAYA 3CCJT 1VQOA 2C06A 4V2SA 3JCMh 2FB7A 4FT4A 3MEVA 3PFSA 1YJNT 4OB3B 1UGPB 5GMKl 4M77B 2P0PA 1LNXA 2DEQA 2E64A 2OAUA 3G4ST 1ZHIA 1YI2T 4X34A 3NTKA 3O8VA 2EJ9A 4ZN1A 2D0QB 3PIPA 1YJWT 3RERA 1YBYA 3OYYA 4PJOE 4OGCA 2KMTA 2CGHA 1Q82U 1KD1C 2EYQA 4KT0E 4MZPA 5IN1A 3JAME 2DPPB 1EIFA 2DK3A 1G3TA 2DIQA 2FVUA 3VJPA 4C8QE 3H6ZA 2MI6A 5GAN5 2XDPA 3CCST 4C92C 4NS5A 1UGRB 2RHIA 3L42A 3V8LA 3OYBA 2M0OA 5DY9A 2RJFA 4J6WA 4J8OA 2PU9B 3P8BB 4C92D 2F5KA 1QVGA 3SWNA 4M7AB 4EMKC 3QJYA 4PJOF 3HP9A 1JB0E 2LX9A 3P8DA 1TH7A 3KXTA 2LDMA 2ZPIB 4OB2B 5DLQE 4M78E 1YJ9T 1NJIU 4BACA 3CCMA 1D3BB 1YHQT 3F70A 5A0DA 2DXUA 1I4K1 4C8QF 4BI4A 4DOWA 3KUFA 3JCMe 1QVFA 2CYZB 1VQOT 4O5VA 5CKEA 1B34B 2F5TX 4IUQA 5FLXE 4JS5A 4C92A 3E1SA 1N8RC 3GPLA 3TU4K 1WQWA 3V8KA 4F7UF 4L59A 5D6YA 2LRQA 4E7IA 4M77E 4ZTJA 2GQVA 4M78F 4EMKA 3GNGA 3G7ZA 2XD0A 3X28B 5KH6A 3FEOA 2P4TA 3S3NA 3X25B 1OZ3A 3INZA 2VC8A 1NE8A 4BI3A 1H3ZA 2RHUA 3N5BB 1WPYA 1DJ7B 3OW2S 4C0FA 2A7YA 2Y4YA 3PNWC 2WSFE 2ZZDA 4CRIA 2PVDB 1MHNA 2Y4XA 2GFUA 5LL6S 2PUOB 1K73C 3ASKA 3CCET 4P5NA 2DJZA 2JOYA 4CI0C 5GAOl 2LQKA 3CCQA 4ZGJB 2VXFA 1N9RA 1OZ2A 4M75G 4M77F 4PLIA 3QZ5B 4ELYC 4C0DB 2VYTA 3L2WA 4R56A 3FLGA 2JZ2A 2LTOA 3CCRA 5LJ3d 3OS1A 3SFMA 3CCMT 5GANd 3OS0A 3Q1JA 4J6XA 5HK3A 1I5LA 4OP0A 5GAMd 3LLRA 3URGA 4M7DE 1VQ8T 4FU6A 3G71A 4E7HA 2EAYA 2O4XA 3NFCA 4RG2A 4HKEA 4C5HA 1M5Q1 1O9SA 1BKBA 3QXEB 4PJOG 4FIBA 1KHIA 3CCJA 5GAN7 3L2QA 3RUXA 4HCCA 1RI0A 1YJNA 4BE0A 1VQ5A 1M9SA 1V29B 3BDLA 4XU0A 3ER0A 2RB6A 3FDRA 3M57A 3OSSC 4X9CA 3OYKA 3OA6A 1Y96B 2X4JA 2QTXA 4E7JA 3E19A 1VQMA 4OMFB 4HT9A 3JB9H 1KQ1A 5GAOp 2VV5A 4KULA 4M7DF 1VQ6A 4MZMA 4FL6A 3MEWA 2RA2A 1U8RA 3CPWA 1G3SA 3C95A 4FM4B 4B9WA 1I81A 3J81E 4LD9K 3ZFJA 3OYCA 3JCMJ 2O01E 2ZPGB 3HRSA 4QVCA 2CZ7B 4XTXA 2E1HA 4OF1A 1YITA 1IZ6A 4BE2A 3CCSA 4IUUA 3OQ5A 4N4HA 3CCQT 1QVGS 2HAXA 3PMIA 3BFMA 2E12A 4M75C 1M90U 3VU3C 4TVRA 2EJFA 2HBPA 3M58A 4IUVA 5A0GA 1X6OA 3JCMQ 3J80E 4M75D 3SWNB 3LWIA 3JB9J 3VYGA 4MZTA 3TEEA 2EKOA 2YRVA 1YJ9A 1BIBA 3SB2A 5LJ3g 2OTJA 4JUVA 5GAN6 4XAXB 4MMLA 2RJEA 4JRIA 5C0MA 1YHQA 1K8AU 2Y90A 1XNIA 4XTWA 4ZGDB 2D6FA 1M1FA 4NOYA 1VIEA 2XICA 1QVFS 2CZ6B 4WF2A 5FU7C 1Q81U 4M77G 1XQHA 2X4XA 1BI3A 3EFRA 2DXTA 2JN0A 4IKFA 3CEYA 4PJOC 2K5LA 2EWNA 2R5AA 5CVIA 1MGQA 2G3RA 3CPFA 3QYGB 5A2QE 2AHJB 1VQ5T 4DOVA 3FB9A 3HFOA 3OYLA 5DLOA 1VQ7A 3DLLA 3RKXA 2FHDA 2L5QA 4XU3A 2KQWA 4C92B 1VQMT 4M75A 4QQDA 5M9OA 1PSFA 2YLCA 4XTYA 5GAN2 1VQ6T 1G3YA 2DKGA 4JRKA 1JBMA 2B8AA 4EMKB 3OYJA 5CQYA 4Z02A 1JRIA 3JRZA 3G6EA 2M9UA 4PLLA 1BI0A 1FXXA 3RMQA 3A5ZB 4L6V5 3E9GA 2XDBA 4DQ2A 4JLIA 2E6ZA 1NZ9A 1Y07A 2RO0A 1YITT 2K2VA 3QBYA 2E41A 5D6XA 2DTHA 3FIFA 3M55A 5FRNA 3CCEA 1Q86C 3OY9A 1UGQB 4MDXA 1M1KU 4PJOA 2QDYB 2V8JA 2KAFA 5LJ3j 5FU6C 4RG8A 4J6YA 4M7DG 3VUBA 3CCUA 4N4IA 4F7UE 3MEUA 4C5GA 3V7CA 2XHCA 1M1GA 2RJDA 5J39A 3VV0A 2OTJT 4OVAA 4IUTA 4QQGA 3ZEHA 2P0KA 1VQ4A 3M4YA 1GXIE 1VQ8A 2ZGWA 3OYFA 3PT9A 1UB4A 3LWHA 3UWNA 2KSSA 1KQSS 3A8GB 3EFSA 4ATOA 2BIVA 1HK9A 2IG0A 2R57A 4M77C 4YTLA 1WNLA 3CBPA 3DB4A 3QKJA 3JB9I 3P8HA 2O4XB 3EAEA 3I55A 5AYFA 5LJ3e 3L1AA 5GANe 4JDSA 2DZCA 5CKBA 5GAMe 5GAN4 1Q7YU 1VQ7T 4BDZA 2E5QA 2RJCA 4RCCA 2EQKA 2DD5A 4C92E 3R6OA 5IT9E 3MP1A 2FYKA 4A4GA 4BE1A 1JJ2S 1VQLA 2VGMA 3G6ET 4A54A 3CXCA 1ZBXA 3CPWS 3L2UA 5EG2A 4DA4A 3OYDA 5CKFA 3KBGA 1SSFA 3HRTA 1K9MC 4E7LA 2DXCA 1VQNA 3JCMX 5GMKj 3J7AF 3HL8A 3C94A 4M77A 1VIFA 2LCLA 2ZCFB 3QZ9B 3QJ6A 1XOVA 4QQ6A 5GAN3 1G3WA 1R8OB 4M7DC 4RKUE 2XI9A 3CCUT 3QIIA 4C92F 4M7AE 1KHCA 1VUBA 4M7DD 2CS7A 3OYMA 4JLGA 4C5EA 3WVEB 3SD4A 2JUFA 4JS4A 3CBMA 3TCJA 3RKYA 1P92A 1VQ4T 1YIJA 2DXBA 1WJRA 1KD1U 3RMSA 4BUGA 2LC4A 1UEBA 1VQPA 2P0QA 2RI3A 4A4KA 1KC8C 5J3BA 2RD1A 3C4SA 4JJNK 1KQSA 3QUIA 3CC4T 2BKDN 2EQUA 5FROA 5GMKe 2E6NA 3DLMA 2M16A 3LGFA 3MHXA 3T9NA 1N27A 5LJ5d 4NL3A 3PTAA 3I55T 3S3MA 4ZGEB 5HKCA 2E65A 4OB0B 1W2BA 2QEXA 1XTDA 3FJPA 2RI2A 4XU2A 4XTZA 4M7DA 2EIFA 4RCBA 4LDXA 1Q82C 3MCAB 4C8QG 1ZQ1A 2MWOA 3QPHA 4N4GA 2MMPA 1QW1A 4UC4A 1VQLT 2D9TA 4M75B 1JJ2A 2CKKA 5GAOm 4BY6C 4J83A 3JCMb 2XU8A 2QQAA 2JVVA 2KK4A 2ZPHB 3A8LB 3ME9A 5L8RE 4B9XA 4F7UG 1VQNT 3LH0A 5KCHA 3L2RA 2DTIA 3RKWA 3LGLA 4M78G 2I2LA 3RESA 4HT8A 2LT4A 5CAIA 5FU7B 3OBYA 1N8RU 2GFAA 4XTUA 4JRPA 4XK8E 1NJIC 4BB7A 4J7IA 4C0GA 3OBWA 2R58A 3CC7A 4HCZA 3FRNA 1YIJT 2QQ9A 2DAQA 5GANg 4EPCA 2DIGA 5GAMg 3MO8A 3NTIA 4C5IA 2LQ8A 1VQPT 1VQKA 2K57A 2CZ1B 2LVMA 2RI5A 5CK9A 3OMCA 3L2VA 2K3YA 3BDUA 1VQ9A 3C12A 2GCXA 5LJ5g 2EFIA 2HQXA 3QO3A 4E47A 1K73U 5I2SA 4PJOD 3OMGA 4FT2A 3A8HB 4II1A 5LJ3f 1G5VA 2WSCE 5GANf 2QEXT 3SDZA 4Y28E 5LJ3h 4Y91A 5GAMf 5GANh 2HD0A 3CC2T 3JCMV 4C8QC 5GAMh 3CCVA 3VKIA 5FU6B 4BDYA 3CC7T 3UT1A 4C8QD 3HKSA 4EDUA 3CXCS 5GAOr 1KQ2A 1FWZA 4IUPA 5LJ5f 2XDDA 3CD6A 5FRMA 5GAOq 1WGSA 4LD6A 2MF2A 5A0LA 3QSUA 4M7AG 3VUZA 3M56A 5J26A 5KE2A 2QQSA 4PL6A 4M78C 2NLUA 3SWNC 2OTLA 1Y96A 3PMTA 3X20B 1WJQA 4EMHA 2DVEA 3QHSA 5GANj 4M78D 3OYIA 4XTVA 5GAMj 1RL2A 2DZ9A 3OS5A 2EQJA 1M4ZA 2LT1A 2RK2A 2VGNA 4N0AC 1HXDA 2M1HA 2QI2A 5KCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCC A;  3L2Q A;  1SSF A;  3OYE A;  2PQW A;  2GF7 A;  1RI0 A;  4E7L A;  4BE0 A;  2EQM A;  2JTF A;  2BUD A;  3BDL A;  3FDR A;  3OYK A;  3OA6 A;  4E7J A;  4BD3 A;  2K3X A;  3MET A;  3QJ6 A;  4QQ6 A;  3FC3 A;  3OYN A;  3QII A;  3NTH A;  1KHC A;  2RHZ A;  4FL6 A;  3MEW A;  3OB9 A;  3OYM A;  3DB3 A;  4C5E A;  3SD4 A;  5IAY A;  3LYI A;  4B9W A;  3LX7 A;  3OYC A;  3MEV A;  1WJR A;  3PFS A;  4E7K A;  2RI3 A;  4BE2 A;  4IUU A;  3OQ5 A;  3C4S A;  2WAC A;  4N4H A;  4X34 A;  3NTK A;  3O8V A;  2EQU A;  2BKD N;  2XK0 A;  3PMI A;  2E6N A;  3DLM A;  2M16 A;  3LGF A;  5FRO A;  3S3M A;  1N27 A;  3MEA A;  5IN1 A;  2RHX A;  4IUV A;  4ZTF A;  3S3O A;  2DIQ A;  2EKO A;  2YRV A;  2RI2 A;  2RJE A;  3H6Z A;  5C0M A;  2XDP A;  1XNI A;  2MWO A;  3L42 A;  2RHI A;  4N4G A;  4NS5 A;  4Q5W A;  2D9T A;  2M0O A;  2RJF A;  3MP6 A;  4UC4 A;  3S6W A;  3OYH A;  2CKK A;  1OYX A;  2F5K A;  4IKF A;  4GY5 A;  2X4X A;  3H8Z A;  3CEY A;  5C6S A;  2R5A A;  2G3R A;  3P8D A;  2LDM A;  3ME9 A;  4B9X A;  2X4Y A;  3LH0 A;  5KCH A;  3OYL A;  3L2R A;  4BAC A;  2FHD A;  3LGL A;  4QQD A;  3F70 A;  5M9O A;  2L3R A;  2GFA A;  2X4W A;  3OYJ A;  2B8A A;  3GOX A;  3KUF A;  4Z02 A;  2QQR A;  3OYA A;  4PLL A;  5D6W A;  2R58 A;  3M9Q A;  3E9G A;  4HCZ A;  4A4F A;  4IUQ A;  1OI1 A;  2DAQ A;  5KE2 A;  2RO0 A;  3OYB A;  2DIG A;  3QBY A;  3MO8 A;  3NTI A;  5D6X A;  4C5I A;  5FRN A;  2LVM A;  4L59 A;  2LRQ A;  2RI5 A;  5D6Y A;  5KE3 A;  3OY9 A;  3OMC A;  3L2V A;  4E7I A;  4ZTJ A;  2K3Y A;  3OYD A;  2HQE A;  2RHY A;  3FEO A;  5KH6 A;  4BDZ A;  4N4I A;  3S3N A;  2EFI A;  2HQX A;  3MEU A;  1OZ3 A;  1H3Z A;  4C5G A;  2MWP A;  3OMG A;  4II1 A;  1G5V A;  2RHU A;  2RJD A;  2L89 A;  5J39 A;  4OVA A;  4IUT A;  4A4H A;  3PNW C;  4QQG A;  4IUR A;  5CIU A;  2P0K A;  3ZEH A;  4CRI A;  1MHN A;  3OYF A;  2GFU A;  4BDY A;  3ASK A;  3UWN A;  3UT1 A;  4EDU A;  2BIV A;  2IG0 A;  2R57 A;  4IUP A;  3QKJ A;  3DB4 A;  3OS2 A;  3P8H A;  1OZ2 A;  2O4X B;  3EAE A;  2R5M A;  4PLI A;  5FRM A;  3L2W A;  2VYT A;  1WGS A;  3FLG A;  4LD6 A;  2JZ2 A;  2LTO A;  3E9F A;  3OYG A;  3OS1 A;  3OS0 A;  5J26 A;  3Q1J A;  4QW2 A;  2QQS A;  2E5Q A;  2RJC A;  2NLU A;  2EQK A;  3LLR A;  4PL6 A;  3PMT A;  1WJQ A;  1WJS A;  4QVZ A;  4FU6 A;  3MP1 A;  3OYI A;  4A4E A;  2X35 A;  4A4G A;  4BE1 A;  4E7H A;  2O4X A;  4RG2 A;  2EQJ A;  3MP8 A;  4C5H A;  3L2U A;  2L8D A;  2M1H A;  5KCO A; 
#chains in the Genus database with same CATH topology
 4M75 F;  5LJ5 j;  2KDS A;  3SEM A;  1NG2 A;  2KYM A;  4DBQ A;  1QP2 A;  1VQ9 T;  2ZPE B;  4ZNX A;  3FC3 A;  3O5Z A;  1SEM A;  1WYX A;  4MDW A;  3LW5 E;  4J7F A;  2RH2 A;  2XK0 A;  3CD6 T;  3MEA A;  1RAI B;  5FW9 A;  3QDR B;  1QMC A;  1GCP A;  1I0C A;  1WHK A;  1UJY A;  1VQP Q;  1QVG P;  3H9N A;  4M7A D;  1XJW B;  2BZX A;  3PVQ A;  1K8A R;  9ATC B;  6AT1 B;  2DF6 A;  1QKX A;  3S6W A;  1QKW A;  2ROL A;  4R55 A;  4NL2 A;  4PFO A;  3PE0 A;  4ESR A;  1OYX A;  4ORZ A;  4GY5 A;  3A8O B;  4OB1 B;  3I56 A;  1PG5 B;  4KUD K;  2HNI A;  1WHL A;  4D6W A;  5I11 A;  1BIA A;  5EC7 A;  4CC3 A;  1VQ6 Q;  1WQ7 A;  2L3R A;  2O2O A;  1OUL A;  1LVK A;  4J5Y A;  1MND A;  2K5F A;  2YLB A;  1U1T A;  4HCB A;  1UHF A;  1K0S A;  1H64 1;  2DTO A;  2HL5 C;  3HSB A;  4EMG A;  2E10 A;  1Y71 A;  3HFN A;  1M27 C;  1B34 A;  2H3J A;  2ZAE A;  2CP0 A;  1JEG A;  4A4H A;  1N9S A;  5CIU A;  4J9B A;  1RLP C;  1U5S A;  2DYB A;  1M8V A;  4PNO A;  3G4S A;  4ME7 A;  1UEC A;  1ZA1 B;  3GLX A;  3OS2 A;  1PKS A;  2R5M A;  2RMO A;  2XKO C;  4BI8 B;  1H92 A;  1UHC A;  2KGT A;  3GP8 A;  3HPW A;  2RPN A;  1PCX A;  1OOT A;  2QA4 T;  4C92 G;  2X35 A;  4KUI A;  3RIR A;  4XQ3 A;  2CH4 A;  2LNV A;  4J9I A;  1NEB A;  2V1R A;  2VB6 A;  1X75 C;  2PVO B;  1FMK A;  3H0F A;  3UDC A;  5LJ5 h;  2RHZ A;  1UE9 A;  2DL7 A;  2IVW A;  1BYM A;  3HHT B;  3JCM f;  3H41 A;  5IH2 A;  3EH2 A;  2E3I A;  5GMK l;  2P0P A;  1GL5 A;  2OAU A;  2D8H A;  1YI2 T;  4ZN1 A;  2EJ9 A;  4PJO E;  3PIP A;  1YJW T;  4OGC A;  2KMT A;  2CGH A;  2JXB A;  4KT0 E;  1Q86 R;  3JAM E;  2DPP B;  2DK3 A;  1G3T A;  2HZY A;  2DNU A;  4NS5 A;  1UGR B;  5DY9 A;  1I5O B;  4C92 D;  2C0I A;  1VQN Q;  1X69 A;  4PJO F;  1JB0 E;  3RNJ A;  2LDM A;  2YRC A;  5DLQ E;  1YJ9 T;  2DL3 A;  2X3W D;  3CCM A;  1YHQ T;  3F70 A;  1X6G A;  2FO0 A;  1Z9Z A;  4J9G A;  4DOW A;  2CP5 A;  1HD3 A;  3KUF A;  2V1Q A;  1B34 B;  4JS5 A;  1ZSZ A;  3E1S A;  1RI9 A;  3TU4 K;  2LRQ A;  4M77 E;  3GNG A;  4OMP A;  3X28 B;  5KH6 A;  3S3N A;  1K73 R;  3INZ A;  2VC8 A;  4PJN A;  2RQR A;  2LNH B;  4C0F A;  2WSF E;  2ZZD A;  2PVD B;  1MHN A;  1CSK A;  2GFU A;  2PUO B;  2DJZ A;  2JOY A;  4CI0 C;  1RAA B;  4ZGJ B;  4M77 F;  4ELY C;  4C0D B;  5LJ3 d;  3OS1 A;  2L3S A;  1I5L A;  2J06 A;  5HK3 A;  3LLR A;  3VS3 A;  4E7H A;  2EAY A;  4PJO G;  1WLP B;  2LP5 A;  2OAW A;  3L2Q A;  1I07 A;  1MV0 B;  4HCC A;  1RI0 A;  4LN2 A;  4BE0 A;  1VQ5 A;  4EIK A;  4XU0 A;  1VQ9 Q;  3FDR A;  4PJJ A;  1C1A A;  2FZK B;  2J6K A;  2X4J A;  1VQM A;  4HT9 A;  1UUE A;  2A37 A;  5GAO p;  4FYX B;  3C95 A;  4B9W A;  3ZFJ A;  1YWP A;  1OU9 A;  4OF1 A;  2PZ1 A;  3CD6 Q;  4N4H A;  2D1X A;  3EGD A;  3EG2 A;  1ZLM A;  4M4Z A;  3PMI A;  3SHW A;  1K4U S;  3VU3 C;  3J80 E;  3JCM Q;  1W70 A;  2X51 A;  4MZT A;  1JJ2 P;  2YRV A;  1YJ9 A;  2OTJ A;  2EKH A;  3CPW P;  2RJE A;  5C0M A;  1YHQ A;  1OU8 A;  2Y90 A;  1M1F A;  4NOY A;  1VIE A;  4OML A;  4IKF A;  4M77 G;  1XQH A;  2X4X A;  2JN0 A;  1OX9 A;  2R5A A;  1MGQ A;  3LH5 A;  4JJC A;  2AHJ B;  1RAE B;  1R77 A;  3FB9 A;  3HFO A;  3OYL A;  1WDX A;  4M75 A;  4QQD A;  5L23 A;  1PSF A;  1VOM A;  4XTY A;  2CRE A;  2DKG A;  4Z02 A;  3G6E A;  3JRZ A;  1BI0 A;  2JM9 A;  4L6V 5;  3E9G A;  4JLI A;  1GBQ A;  1MMN A;  1Q86 C;  3OY9 A;  1IGU A;  1M1K U;  2QDY B;  2V8J A;  2KAF A;  5FU6 C;  3VUB A;  1CKB A;  4RTT A;  2RJD A;  5J39 A;  4E2F B;  1GXI E;  1WFW A;  1AWO A;  4RTY A;  3CC4 A;  2ED1 A;  3JB9 I;  3P8H A;  3EAE A;  5LJ3 e;  4JDS A;  2QA4 Q;  2RJC A;  4RCC A;  2XMF A;  5IT9 E;  4F17 A;  1W1F A;  4A54 A;  1ZBX A;  3GBQ A;  3HRT A;  1SG5 A;  3C94 A;  1VIF A;  2LCL A;  4QQ6 A;  1PWT A;  1C0M A;  2XI9 A;  3QII A;  1R0C B;  3EGD B;  4RTZ A;  1IB8 A;  1VA7 A;  2DRK A;  2IIM A;  2K7A A;  2YT6 A;  2E5K A;  4D8D A;  3TCJ A;  1VQ4 T;  4FW1 A;  1WJR A;  3RMS A;  4KGV B;  2RI3 A;  1YJW Q;  1KC8 C;  4JJN K;  1KQS A;  3QUI A;  2EQU A;  5GMK e;  2E6N A;  2M16 A;  2HEQ A;  3LGF A;  3MHX A;  3T9N A;  3I55 T;  2LJ3 A;  1E6G A;  5HKC A;  2E65 A;  1W2B A;  2DM1 A;  1H3H A;  4M7D A;  3MCA B;  2KXC A;  2MMP A;  4UC4 A;  4CC7 A;  1VQL T;  4M75 B;  1MUZ A;  4OMM A;  3HTR A;  2EGE A;  1KFZ A;  3EGU A;  2LCS A;  4J83 A;  1YJ9 Q;  2HKN A;  2ZPH B;  1YHQ Q;  3LH0 A;  2LT4 A;  3D7S B;  5CAI A;  3OBY A;  1N8R U;  4WCI A;  4JRP A;  1NJI C;  4J7I A;  4C0G A;  3FRN A;  3E2U A;  2QQ9 A;  2LJ1 A;  1VQP T;  1PRL C;  1AWX A;  2RI5 A;  2RF0 A;  3L2V A;  3JV3 A;  2GCX A;  5LJ5 g;  2EFI A;  2HQX A;  3A8H B;  5LJ3 f;  3SDZ A;  4Y28 E;  4Y91 A;  4C8Q C;  5GAM h;  3VKI A;  2F2V A;  3HKS A;  4EDU A;  1TOV A;  1FWZ A;  1T3L A;  5IHN A;  5FRM A;  1UJ0 A;  1B07 A;  2FEI A;  3M0R A;  3VUZ A;  5KE2 A;  4M78 C;  1SRL A;  5GAN j;  3OYI A;  3M0Q A;  4XTV A;  2DE0 X;  4N0A C;  1LPL A;  2M1H A;  4O5V A;  4OMF B;  1UTI A;  2LCC A;  4LDW A;  1B7T A;  4OGE A;  4LDU A;  3JCM c;  1VQK T;  2NUZ A;  1Y7X A;  2K9G A;  3JCM P;  2YSQ A;  1GCQ C;  4A53 A;  3QYH B;  3OB9 A;  2YUN A;  2FZG B;  1W2B S;  3LX7 A;  2ZPF B;  2XID A;  2X9H A;  5CKD A;  4MMK A;  4C0Z A;  4E7K A;  1K1Z A;  2A08 A;  4M7D B;  2WAC A;  1BI2 A;  4JRQ A;  1V1C A;  2VXE A;  4LNP A;  3CCL T;  3WXM B;  3CME A;  2MAM A;  1BCM A;  2RHX A;  4ZTF A;  3H0I A;  2A28 A;  2DBK A;  2ROT A;  7AT1 B;  2OTL T;  2FRW A;  1M90 C;  2X3X D;  2AT1 B;  2FZC B;  4A4E A;  2KRO A;  1LJO A;  1UDL A;  1FX7 A;  3H8Z A;  2QXF A;  5C6S A;  5ECA A;  1TG0 A;  1Y57 A;  1Q81 C;  1RAF B;  3GIB A;  2CSQ A;  3AHU A;  4BY6 B;  1O75 A;  2LX7 A;  3GOX A;  3OYA A;  3JCM d;  1HSQ A;  5KYU A;  4VUB A;  1D3B A;  2DVJ A;  1UGV A;  2OX7 A;  5KE3 A;  3JB9 G;  4KBM B;  3M59 A;  2HQE A;  3G1J A;  3NMZ C;  2KT8 A;  2O31 A;  3PIO A;  2PVG B;  4PJL A;  4DBF A;  1YCY A;  3L2Z A;  4PJO B;  2KRS A;  5IHK A;  2DL4 A;  1PHT A;  5GMK i;  5CR2 A;  3I56 T;  3E9F A;  1TUD A;  3QG1 A;  2A3L A;  4HA8 A;  5KYN A;  2JMC A;  2QQB A;  5D7U A;  1Q7Y C;  2L8D A;  2DLP A;  3WVD B;  4AMC A;  1OPK A;  2GGR A;  3X26 B;  2QTV A;  1Z9Q A;  2KY9 A;  1NBE B;  2JTF A;  1R0B G;  5I2M A;  4BD3 A;  4GLK A;  3MET A;  4M75 E;  1TWB A;  1U1S A;  3BY7 A;  2RK1 A;  3V7S A;  3GF5 A;  2DFU A;  3CCL A;  3JB9 D;  3G71 T;  2P84 A;  3DB3 A;  2DRM A;  1VQ4 Q;  4V2S A;  4X1V A;  2HQH A;  3JCM h;  1X43 A;  1CKA A;  4PFP A;  1YJN T;  2D8J A;  3M0P A;  4M77 B;  2DEQ A;  3G4S T;  3QWX X;  3RER A;  1OX8 A;  3O8V A;  2KRN A;  1YBY A;  3OYY A;  4RTX A;  1Q82 U;  1KD1 C;  5IN1 A;  2FVU A;  4HXJ A;  4C8Q E;  4DEY A;  1VQL Q;  2MI6 A;  2RHI A;  2ECZ A;  3P8B B;  3SWN A;  4EMK C;  1M2V B;  2IPO B;  3QJY A;  3HP9 A;  2MPX C;  1D1B A;  2NUT B;  4M78 E;  4PK4 A;  1D3B B;  4J9D A;  1I4K 1;  4C8Q F;  4BI4 A;  1JXO A;  3JCM e;  1JQQ A;  2F5T X;  5CKE A;  4IUQ A;  5FLX E;  2EVR A;  4F7U F;  3V8K A;  1TUC A;  4L59 A;  4M78 F;  2KXD A;  2LZ6 B;  2JM8 A;  2P4T A;  4PJM A;  3X25 B;  1OZ3 A;  3I9Q A;  4BI3 A;  3EGX A;  2L0A A;  2Y4X A;  3ASK A;  5GAO l;  1EX4 A;  3CCQ A;  2VXF A;  1N9R A;  2K79 A;  4M75 G;  1ZA2 B;  3L2W A;  2ED0 A;  3EG9 A;  4DBH A;  2JZ2 A;  4R56 A;  3EHR A;  2KT1 A;  3CCM T;  3Q1J A;  4OP0 A;  4M7D E;  1VQ8 T;  1VYT A;  3G71 A;  4RG2 A;  4C5H A;  1M5Q 1;  1O9S A;  1VQK Q;  1KHI A;  5GAN 7;  1YJN A;  5I22 A;  2RB6 A;  3OYK A;  4X9C A;  2BE7 D;  2QTX A;  1IRX A;  1KQ1 A;  4M7D F;  2ENM A;  4MZM A;  1G3S A;  1KQS P;  3OYC A;  3JCM J;  2O01 E;  2LQN A;  2CZ7 B;  2C0T A;  3TVT A;  1X27 A;  1YIT A;  1IZ6 A;  4IUU A;  3CCL Q;  1W2B P;  2QK0 A;  2E12 A;  5HCK A;  1PD0 A;  1X6O A;  2MK5 A;  2OTL Q;  4M75 D;  3SWN B;  3JB9 J;  2E3H A;  2EKO A;  4XAX B;  4MML A;  4JRI A;  1K8A U;  4F14 A;  4XTW A;  1SPK A;  4ZGD B;  2BZ8 A;  2CZ6 B;  5FU7 C;  1A0N B;  2QGG A;  5CVI A;  2G3R A;  3VS4 A;  2DMO A;  5A2Q E;  1VQ5 T;  3REB B;  1VQ7 A;  3DLL A;  3RKX A;  1VQM T;  4JRK A;  2B8A A;  2M9U A;  1EZZ B;  4DQ2 A;  3EGX B;  1G83 A;  1Y07 A;  1M3C A;  2K2V A;  4KRT A;  2E41 A;  1SKU B;  5D6X A;  3FIF A;  3M55 A;  2M0Y A;  4MDX A;  2DX1 A;  5LJ3 j;  2GTJ A;  4M7D G;  4FSS A;  3CCU A;  2D0N A;  1M1G A;  3VV0 A;  2OTJ T;  4OVA A;  3EG9 B;  3ZEH A;  4D8K A;  1VQ8 A;  3OYF A;  3LWH A;  1D0X A;  3VRZ A;  3A8G B;  5GJW B;  2YWW A;  3I56 Q;  3CBP A;  1TS9 A;  5AYF A;  5CKB A;  5GAN 4;  4BDZ A;  5GJV B;  2E5Q A;  2DD5 A;  1MMD A;  2DBM A;  2EBP A;  3R6O A;  1V76 A;  3MP1 A;  2VWF A;  3G6E T;  4HCK A;  4JZ3 A;  1RAC B;  3OYD A;  2EYY A;  1ZBJ A;  3JCM X;  5GMK j;  3EG3 A;  3G71 Q;  2JTE A;  2FRY A;  1XOV A;  3MJX A;  1M3A A;  4AFZ C;  1KC8 R;  2VVK A;  1KHC A;  4M7D D;  2CS7 A;  3OYM A;  4JLG A;  1YJN Q;  2JUF A;  1YIJ A;  3G4S Q;  4BUG A;  1UEB A;  2L3P A;  2RD1 A;  3CC4 T;  5FRO A;  3DLM A;  4E7S A;  2QEX A;  1ZUY A;  4XTZ A;  2W0Z A;  3M0S A;  1ZQ1 A;  2K6D A;  1QW1 A;  2D9T A;  2CKK A;  1I1J A;  1BU1 A;  1NJI R;  2QQA A;  2JVV A;  1D0Z A;  2COZ A;  1KIK A;  2W10 A;  2GFA A;  4BB7 A;  1F1B B;  3CC7 A;  1RUW A;  2MCN A;  1KSW A;  3VS5 A;  5GAN g;  4EPC A;  2DIG A;  2KBT A;  3MO8 A;  3NTI A;  2HDA A;  2EGC A;  2LQ8 A;  3CQT A;  2CZ1 B;  3I35 A;  2AIR B;  2LJ0 A;  4Z89 A;  3VS6 A;  2K3Y A;  3BDU A;  2DL5 A;  4E47 A;  1K73 U;  5I2S A;  4PJO D;  3OMG A;  1ZSZ B;  5LJ3 h;  3CC2 T;  3CCV A;  1WHJ A;  5FU6 B;  4BDY A;  1GBR A;  5GAO r;  2I0N A;  1EFN A;  4IUP A;  5LJ5 f;  2BTT A;  4KH0 B;  3CCM Q;  4LD6 A;  4CC2 A;  1AT1 B;  3QSU A;  1QCN A;  1VQ8 Q;  4PL6 A;  2NLU A;  1Y96 A;  4EMH A;  2SRC A;  5GAM j;  2RQW A;  3OS5 A;  2EQJ A;  1M4Z A;  2RK2 A;  2VGN A;  1HXD A;  1NE8 A;  3TQ7 P;  4C8Q A;  4XU1 A;  2VKN A;  2GF7 A;  2COY A;  4JPB W;  3A98 A;  3OYN A;  2O9S A;  4F7U A;  4J9F A;  3NTH A;  2RN8 A;  3ZL7 C;  4M77 D;  5GMK h;  2GNC A;  4M78 A;  4QKU A;  2EYX A;  2HL3 A;  2JS2 A;  4ELZ C;  4N0A A;  3GNF B;  2CP6 A;  1N8R R;  3V8J A;  1M90 R;  2FL7 A;  1YIJ Q;  4M7A C;  5CCA A;  5KYW A;  1SHG A;  1GCQ A;  2CSI A;  1AHJ B;  4Q5W A;  3CMA A;  3MP6 A;  3OYH A;  1Q81 R;  3KFV A;  3UA6 A;  1ZUU A;  1TSF A;  1VQ5 Q;  1WHG A;  1IRE B;  1VQM Q;  2V8I A;  2PUK B;  3DKM A;  4FSX A;  1U3O A;  2KYB A;  3VS2 A;  2VUB A;  1I8F A;  2X4W A;  4E6R A;  2CH4 W;  5D6W A;  3M9Q A;  2F2W A;  4A4F A;  2DO3 A;  4A63 B;  1LOJ A;  4KGX B;  4IIO A;  3CC2 A;  5HY6 A;  3JSC A;  2GQI A;  2YUP A;  3A1P A;  3CME T;  1OQK A;  2CP3 A;  2OI3 A;  1E7O A;  2OTJ Q;  4PKC C;  8AT1 B;  3JCM W;  1QP3 A;  1M1K C;  3QDF A;  2YHT A;  2DEU A;  1NLO C;  4IUR A;  4QVD A;  2NWM A;  5FWC A;  5CQX A;  2QGF B;  4LDV A;  2V26 A;  3OSV A;  1N6A A;  1SHF A;  1Q7Y R;  3OYG A;  4C8Q B;  3CCV Q;  1FMV A;  1WJS A;  3MKD A;  3ZBD A;  3G6E Q;  4QVZ A;  1K9M U;  2CT3 A;  3V7R A;  4HVU A;  2EYZ A;  2RM4 A;  4F7U B;  2CUB A;  1OV3 A;  1ZUK A;  4M78 B;  3CCR T;  3UAT A;  2BUD A;  1NM7 A;  4J9E A;  2EJG A;  1ABO A;  2K5I A;  3LYI A;  2C06 A;  2CZ0 B;  1VQO A;  3CCJ T;  1KD1 R;  4FT4 A;  3MEV A;  3PFS A;  5KYW B;  3CC4 Q;  1ZHI A;  3I5R A;  2AK5 A;  2EYQ A;  4MZP A;  1EIF A;  1TU0 B;  2QAZ A;  4AG2 C;  3CCS T;  4C92 C;  3V8L A;  3L42 A;  2ATC B;  3OYB A;  4AFS C;  4J6W A;  1BCO A;  4J8O A;  2BE9 B;  2F5K A;  4K11 A;  2LX9 A;  4BAC A;  2KNB B;  5A0D A;  5IXF A;  2DXU A;  3UA7 A;  1TTH B;  1QVF A;  1NYG A;  1FYN A;  1AOJ A;  1N8R C;  3GPL A;  4Z88 A;  1GFC A;  2NUP A;  1GFD A;  3TSW A;  4E7I A;  4ZTJ A;  1QWF A;  4EMK A;  3G7Z A;  1H3Z A;  2RHU A;  3CC2 Q;  1WPY A;  1DJ7 B;  3UF4 A;  3PNW C;  2Y4Y A;  2GBQ A;  3CCE T;  4P5N A;  4GBQ A;  1OZ2 A;  3QZ5 B;  3RR6 A;  3CCR A;  5IHI A;  1Y0M A;  5GAN d;  4J6X A;  4FU6 A;  2O4X A;  3NFC A;  1BKB A;  3CCJ A;  3RUX A;  1M9S A;  1AWJ A;  4M7A F;  3ER0 A;  3OSS C;  3M57 A;  4E7J A;  4Z8A A;  4KUL A;  1JXM A;  4RTW A;  1VQ6 A;  1WXU A;  3MEW A;  1U8R A;  3CPW A;  3AT1 B;  4FM4 B;  1I81 A;  3J81 E;  4LD9 K;  3NGP A;  2E1H A;  1HYO A;  3CCS A;  2P4R A;  2J05 A;  3CCQ T;  1UG1 A;  1RAB B;  2EJF A;  5A0G A;  3M58 A;  1VQO Q;  3LWI A;  4RTU A;  5IXB A;  4OMO A;  3TEE A;  5LJ3 g;  4JUV A;  5GAN 6;  1JU5 C;  1XNI A;  2DL8 A;  1YFN A;  3QWY A;  1QVF S;  4WF2 A;  2DXT A;  4PJO C;  3CEY A;  2K5L A;  2EWN A;  3CPF A;  3TSZ A;  4KGZ B;  5DLO A;  2FHD A;  1YCS B;  5M9O A;  2NUP B;  2EW3 A;  1WXB A;  5GAN 2;  1G3Y A;  1JBM A;  4EMK B;  5CQY A;  1JRI A;  1FXX A;  2E6Z A;  2HSE B;  1NZ9 A;  1YIT T;  3QBY A;  2DTH A;  3CCE A;  2O9V A;  4WTO B;  3CME Q;  3VS7 A;  3EH1 A;  1ZX6 A;  4N4I A;  4F7U E;  2KI7 A;  1SF9 A;  2XHC A;  2RNA A;  4OMN A;  5KYU B;  2BZY A;  3M4Y A;  1ARK A;  2ZGW A;  1UB4 A;  2J6F A;  3EFO A;  2KSS A;  2R57 A;  1HK9 A;  2AKK A;  4M77 C;  1WNL A;  2MOX A;  3DB4 A;  1C6V X;  2O4X B;  2MYS A;  2C0O A;  5GAN e;  2DZC A;  1VQ7 T;  4AFU C;  4C92 E;  1BBZ A;  4BE1 A;  1JJ2 S;  2O88 A;  1WXT A;  3CXC A;  3CPW S;  5EG2 A;  5CKF A;  2QYZ A;  3KBG A;  3REA B;  3CCR Q;  2SEM A;  1SSF A;  1VQN A;  3HL8 A;  2AZV A;  1PNJ A;  3QZ9 B;  3QJ6 A;  5GAN 3;  3CCU T;  1M8M A;  4C92 F;  1VUB A;  1X2Q A;  2JMA A;  3CCJ Q;  4C5E A;  3WVE B;  3SD4 A;  2YDL A;  3CBM A;  1P92 A;  2DXB A;  1N5Z A;  2J7I A;  2LC4 A;  1RAH B;  5AT1 B;  5LJ5 d;  4NL3 A;  1N27 A;  2RQT A;  1XTD A;  3CCS Q;  2RI2 A;  4XU2 A;  2EIF A;  4RCB A;  4LDX A;  1Q82 C;  4C8Q G;  2CDT A;  2MWO A;  1D1C A;  1D1A A;  1IHW A;  5GAO m;  3FJ5 A;  2KK4 A;  4F7U G;  4B9X A;  3L2R A;  2OJ2 A;  5KCH A;  4M78 G;  4HT8 A;  2NYS A;  4JJB A;  5FU7 B;  4XTU A;  4XK8 E;  2HKQ B;  4AG1 C;  1B3Q A;  2EGA A;  1YIJ T;  2RQV A;  5GAM g;  4C5I A;  1PRM C;  2JW4 A;  1K9A A;  1VQ9 A;  3C12 A;  3EFO B;  3M0T A;  2A36 A;  1KK7 A;  1G5V A;  1TXQ A;  5GAN f;  2QEX T;  3CCE Q;  2YXY A;  3JCM V;  1QCO A;  3UT1 A;  4C8Q D;  3CXC S;  4QT7 A;  2XDD A;  3CD6 A;  2MF2 A;  4F16 A;  3SWN C;  1WJQ A;  1AD5 A;  2DVE A;  2G6F X;  4M78 D;  1RL2 A;  2DZ9 A;  4PFZ A;  1YN8 A;  1OPL A;  3CC7 T;  4DBR A;  2QI2 A;  5KCO A;  3OYE A;  3TRE A;  2QG9 B;  5CKH A;  5GMK m;  2K3X A;  1OEB A;  3VYH B;  1PSE A;  4E7Z A;  5DM7 R;  4DEX A;  4LDY A;  5HK0 A;  2F69 A;  2F1L A;  1NPR A;  2CUD A;  1S72 T;  5GAN 8;  3CCV T;  3CCQ Q;  3M5A A;  3A8M B;  5LJ5 e;  4LUE A;  1VYV A;  3X24 B;  2DJQ A;  1G2B A;  2M02 A;  1X01 A;  3S3O A;  2DD4 A;  1W4S A;  4O6J A;  1ACM B;  4FYW B;  3HRU A;  2ABL A;  2LQW A;  1K8A C;  2V8K A;  1QQJ A;  2JJ9 A;  4ZN3 A;  1UFF A;  2X4Y A;  4L5G A;  1QVF P;  2CT4 A;  1QVP A;  1WHM A;  3UPU A;  1M2O A;  4JZ4 A;  2QA4 A;  4M7A A;  1Q86 U;  2QQR A;  2K4Y A;  2KR3 A;  1YIT Q;  1NPP A;  2CP2 A;  1OI1 A;  3M53 A;  4JJD A;  2JTM A;  1K76 A;  4X9D A;  2WSE E;  1T0J A;  1M1K R;  2E4H A;  3U23 A;  2L3Q A;  3M4G A;  3BW1 A;  5FWB A;  2RHY A;  5KYY A;  4Y92 A;  4RMO A;  2MWP A;  2DYI A;  3EG1 A;  1BK2 A;  4FW2 A;  2KVQ G;  2L89 A;  4C0D C;  4FYV B;  5I21 A;  3CMA T;  3PGG A;  1YI2 A;  1YJW A;  2MIO A;  2FPE A;  5GAO n;  2E70 A;  1VQ7 Q;  1AEY A;  2ZPB B;  1BB9 A;  2JNG A;  2AKL A;  2B86 A;  2DA9 A;  4QW2 A;  3OW2 A;  2XG8 D;  3CBO A;  1MMA A;  3EHQ A;  3MP8 A;  2COW A;  3M54 A;  3JCM g;  1BI1 A;  2PQW A;  1S72 A;  2EQM A;  2EYW A;  1KG1 A;  3CCU Q;  2YUO A;  1PKT A;  1KC8 U;  5IAY A;  4IIM A;  1UGS B;  5CO7 A;  4GLM A;  4RUG A;  3IQL A;  2FB7 A;  1YWO A;  4OB3 B;  1UGP B;  4LE9 A;  1LNX A;  2E64 A;  4X34 A;  3NTK A;  3H0H A;  2D0Q B;  2FG0 A;  1X6B A;  2DIQ A;  3C0C A;  1G8X A;  3VJP A;  1PD1 A;  2H8H A;  3H6Z A;  1W6X A;  4J9H A;  5GAN 5;  2PNI A;  1NYF A;  2XDP A;  1ZSZ C;  2M0O A;  2RJF A;  1PM3 A;  2PU9 B;  1QVG A;  4M7A B;  3KXT A;  2F2X A;  3P8D A;  1TH7 A;  2ZPI B;  4OB2 B;  4OMQ A;  1NJI U;  1AVZ C;  2YRD A;  3NHN A;  2DER A;  5KYY B;  2CYZ B;  1VQO T;  4C92 A;  1T3S A;  1WQW A;  1QWE A;  5D6Y A;  2GQV A;  1K9M R;  2XD0 A;  3FEO A;  2QEX Q;  4RTV A;  3N5B B;  3OW2 S;  2KE9 A;  4ANJ A;  2A7Y A;  4CRI A;  2HBW A;  2KEA A;  5LL6 S;  1K73 C;  4HVV A;  2LQK A;  4R0K A;  1RLQ C;  1GRI A;  4PLI A;  2VYT A;  2J6O A;  3FLG A;  2LTO A;  2PTK A;  3SFM A;  3OS0 A;  3CXC P;  5GAM d;  3URG A;  1YI2 Q;  3CC7 Q;  1SRM A;  4HKE A;  3QXE B;  4FIB A;  1JO8 A;  3VS1 A;  1V29 B;  3BDL A;  1TUG B;  3OA6 A;  1Y96 B;  3E19 A;  1AZG B;  1IHV A;  1M3B A;  3JB9 H;  2VV5 A;  4FL6 A;  1WHH A;  2RA2 A;  2HCK A;  1S72 Q;  2ZPG B;  1S1N A;  3HRS A;  4QVC A;  4XTX A;  1D0Y A;  4BE2 A;  3OQ5 A;  2ESW A;  1QVG S;  1FMW A;  4CC4 B;  2HAX A;  3BFM A;  4M75 C;  1M90 U;  4TVR A;  2HBP A;  3BE3 A;  4IUV A;  4LUD A;  3VYG A;  1KJW A;  1BIB A;  3SB2 A;  3VRY A;  1U06 A;  2D6F A;  2HMA A;  2XIC A;  1Q81 U;  3EFR A;  1BI3 A;  2DIL A;  1SSH A;  3QYG B;  4J9C A;  2QDL A;  1WIE A;  4DOV A;  2L5Q A;  4XU3 A;  4C92 B;  1IGQ A;  2KQW A;  4FYY B;  1X2K A;  2GTO A;  2YLC A;  2FPF A;  2M51 A;  2DET A;  3OYJ A;  1VQ6 T;  1Q95 G;  2L2P A;  2EPD A;  4PLL A;  3RMQ A;  3A5Z B;  2XDB A;  1YNZ A;  4LXC A;  5KYX A;  2RO0 A;  1YP5 A;  2K2M A;  5FRN A;  1UGQ B;  4PJO A;  1HJD A;  4RG8 A;  4J6Y A;  2EQI A;  1MNE A;  3MEU A;  4C5G A;  3V7C A;  3MPU B;  4IUT A;  4QQG A;  2FPD A;  2P0K A;  3CMA Q;  1VQ4 A;  3PT9 A;  3UWN A;  1KQS S;  3EFS A;  4ATO A;  2BIV A;  2IG0 A;  4YTL A;  3JB9 F;  3QKJ A;  2YUQ A;  1M30 A;  1MMG A;  3I55 A;  3L1A A;  1WZO A;  5GAM e;  1Q7Y U;  2EQK A;  1RAG B;  1E6H A;  2FYK A;  1ABQ A;  4A4G A;  1VQL A;  2VGM A;  1NEG A;  3L2U A;  4FCY A;  4DA4 A;  1PC0 A;  4KH1 B;  3THK A;  1K9M C;  4E7L A;  2DXC A;  3VS0 A;  3EG0 A;  1NLP C;  3PVL A;  3J7A F;  3RDV A;  4M77 A;  2ZCF B;  4HVW A;  1QLY A;  1G3W A;  1R8O B;  4M7D C;  4RKU E;  2Z0W A;  4M7A E;  1MV3 A;  3ULR B;  4JS4 A;  3RKY A;  3NPF A;  3M0U A;  1KD1 U;  1RAD B;  1WI7 A;  1VQP A;  2P0Q A;  4A4K A;  5J3B A;  3C4S A;  2BKD N;  1Q82 R;  4AFQ C;  4F04 B;  3S3M A;  3PTA A;  1M2V A;  4ZGE B;  3I5S A;  4OB0 B;  2QAS A;  2HSP A;  2NUT A;  3FJP A;  3QPH A;  1AWW A;  4N4G A;  1JJ2 A;  4BY6 C;  3JCM b;  2XU8 A;  3ME9 A;  3A8L B;  5L8R E;  1VQN T;  1T0H A;  1WA7 A;  5KYX B;  2DTI A;  2AZS A;  3RKW A;  3LGL A;  2I2L A;  3RES A;  1LCK A;  2CP7 A;  2JT4 A;  2JS0 A;  1VYU A;  4B6M A;  1WX6 A;  2K3B A;  1D09 B;  3OBW A;  2R58 A;  4HCZ A;  1IXD A;  3R6N A;  2DAQ A;  1QCF A;  1H8K A;  1ZSG A;  1VQK A;  2H3E B;  2K57 A;  2LVM A;  2A0F B;  5CK9 A;  3OMC A;  3QO3 A;  4FT2 A;  4II1 A;  2WSC E;  4AT1 B;  2KRM A;  1J3T A;  5GAM f;  5GAN h;  2HD0 A;  1KQ2 A;  3OW2 P;  5GAO q;  1WGS A;  2LMJ A;  5A0L A;  4M7A G;  3M56 A;  1IO6 A;  5J26 A;  2QQS A;  3RBB B;  2OTL A;  3X20 B;  3PMT A;  3QHS A;  1K0X A;  2VAS A;  3I55 Q;  8ATC B;  2LT1 A;  2RQU A;  1AZE A; 
#chains in the Genus database with same CATH homology
 4C8Q A;  4XU1 A;  2LCC A;  4LDW A;  4M75 F;  4OGE A;  3OYE A;  4M7A F;  2GF7 A;  5LJ5 j;  4LDU A;  3JCM c;  1VQK T;  2KDS A;  3TRE A;  3JB9 F;  5CKH A;  5GMK m;  1Y7X A;  1QP2 A;  2K3X A;  1VQ9 T;  2ZPE B;  3VYH B;  3FC3 A;  3JCM P;  4A53 A;  3OYN A;  1PSE A;  4F7U A;  5DM7 R;  3NTH A;  3QYH B;  4M77 D;  4LDY A;  3OB9 A;  4MDW A;  5GMK h;  4M78 A;  1W2B S;  5HK0 A;  3LX7 A;  2ZPF B;  2F69 A;  2XID A;  3CC4 A;  1NPR A;  5CKD A;  5GAN 8;  3CCV T;  4MMK A;  1S72 T;  4C0Z A;  4E7K A;  3M5A A;  4ELZ C;  4M7D B;  2WAC A;  1BI2 A;  3GNF B;  3LW5 E;  4J7F A;  2RH2 A;  3A8M B;  4N0A A;  5LJ5 e;  4JRQ A;  2VXE A;  3V8J A;  2XK0 A;  3X24 B;  3WXM B;  3CCL T;  3CD6 T;  3CME A;  2MAM A;  3MEA A;  2RHX A;  3QDR B;  4ZTF A;  2FL7 A;  1X01 A;  3S3O A;  4M7A C;  5CCA A;  2OTL T;  4M7A D;  2DD4 A;  1M90 C;  1W4S A;  4A4E A;  1AHJ B;  4Q5W A;  3S6W A;  4O6J A;  3MP6 A;  4R55 A;  3OYH A;  3CMA A;  4NL2 A;  1LJO A;  1OYX A;  4GY5 A;  1FX7 A;  3H8Z A;  2QXF A;  3HRU A;  5C6S A;  3A8O B;  4OB1 B;  1K8A C;  2V8K A;  3I56 A;  4KUD K;  1IRE B;  4ZN3 A;  2V8I A;  2X4Y A;  2HNI A;  4L5G A;  2PUK B;  4D6W A;  1Q81 C;  1BIA A;  1QVP A;  3DKM A;  4FSX A;  3GIB A;  1WQ7 A;  2L3R A;  3UPU A;  3AHU A;  2VUB A;  4BY6 B;  2QA4 A;  4M7A A;  1I8F A;  2X4W A;  1O75 A;  3GOX A;  1Q86 U;  2QQR A;  3OYA A;  4J5Y A;  2K4Y A;  5D6W A;  2K5F A;  2YLB A;  3M9Q A;  3JCM d;  1NPP A;  4A4F A;  1U1T A;  1OI1 A;  2DO3 A;  3M53 A;  1D3B A;  1LOJ A;  4VUB A;  4HCB A;  2JTM A;  4X9D A;  3CC2 A;  2WSE E;  5HY6 A;  3JSC A;  5KE3 A;  1H64 1;  3JB9 G;  2DTO A;  4KBM B;  3HSB A;  3M59 A;  2HQE A;  3M4G A;  3BW1 A;  3CME T;  2RHY A;  4EMG A;  2E10 A;  1Y71 A;  3HFN A;  1B34 A;  2H3J A;  4PKC C;  4RMO A;  2MWP A;  3JCM W;  1QP3 A;  2KVQ G;  2L89 A;  1M1K C;  4C0D C;  5I21 A;  3PIO A;  2PVG B;  4A4H A;  2YHT A;  1N9S A;  4IUR A;  5CIU A;  4QVD A;  5CQX A;  1M8V A;  4PNO A;  1YCY A;  3PGG A;  3L2Z A;  3G4S A;  3CMA T;  4PJO B;  4ME7 A;  1YI2 A;  1YJW A;  3GLX A;  4LDV A;  3OS2 A;  3OSV A;  5GMK i;  5GAO n;  2R5M A;  2E70 A;  1N6A A;  5CR2 A;  3I56 T;  2XKO C;  2ZPB B;  3E9F A;  4BI8 B;  3QG1 A;  2JNG A;  3OYG A;  2A3L A;  4C8Q B;  3GP8 A;  4HA8 A;  3OW2 A;  4QW2 A;  3HPW A;  2XG8 D;  1WJS A;  2QQB A;  3ZBD A;  4QVZ A;  2QA4 T;  3CBO A;  4C92 G;  1K9M U;  2X35 A;  4KUI A;  3V7R A;  3RIR A;  2RM4 A;  3MP8 A;  1Q7Y C;  4XQ3 A;  2L8D A;  4F7U B;  3WVD B;  3M54 A;  3JCM g;  1BI1 A;  2LNV A;  2PQW A;  3X26 B;  4M78 B;  1S72 A;  3CCR T;  2EQM A;  2JTF A;  2BUD A;  2KY9 A;  1KG1 A;  4BD3 A;  5I2M A;  1X75 C;  4GLK A;  3MET A;  4M75 E;  2PVO B;  1U1S A;  2EJG A;  3BY7 A;  2RK1 A;  3V7S A;  3GF5 A;  3CCL A;  3JB9 D;  3G71 T;  5LJ5 h;  3UDC A;  2RHZ A;  1KC8 U;  2IVW A;  2K5I A;  3DB3 A;  1BYM A;  3HHT B;  3LYI A;  1UGS B;  5CO7 A;  2CZ0 B;  3JCM f;  5IAY A;  3CCJ T;  1VQO A;  2C06 A;  4V2S A;  3JCM h;  2FB7 A;  4FT4 A;  3MEV A;  3PFS A;  1YJN T;  4OB3 B;  1UGP B;  5GMK l;  4M77 B;  2P0P A;  1LNX A;  2DEQ A;  2E64 A;  2OAU A;  3G4S T;  1ZHI A;  1YI2 T;  4X34 A;  3NTK A;  3O8V A;  2EJ9 A;  4ZN1 A;  2D0Q B;  3PIP A;  1YJW T;  3RER A;  1YBY A;  3OYY A;  4PJO E;  4OGC A;  2KMT A;  2CGH A;  1Q82 U;  1KD1 C;  2EYQ A;  4KT0 E;  4MZP A;  5IN1 A;  3JAM E;  2DPP B;  1EIF A;  2DK3 A;  1G3T A;  2DIQ A;  2FVU A;  3VJP A;  4C8Q E;  3H6Z A;  2MI6 A;  5GAN 5;  2XDP A;  3CCS T;  4C92 C;  4NS5 A;  1UGR B;  2RHI A;  3L42 A;  3V8L A;  3OYB A;  2M0O A;  5DY9 A;  2RJF A;  4J6W A;  4J8O A;  2PU9 B;  3P8B B;  4C92 D;  2F5K A;  1QVG A;  3SWN A;  4M7A B;  4EMK C;  3QJY A;  4PJO F;  3HP9 A;  1JB0 E;  2LX9 A;  3P8D A;  1TH7 A;  3KXT A;  2LDM A;  2ZPI B;  4OB2 B;  5DLQ E;  4M78 E;  1YJ9 T;  1NJI U;  4BAC A;  3CCM A;  1D3B B;  1YHQ T;  3F70 A;  5A0D A;  2DXU A;  1I4K 1;  4C8Q F;  4BI4 A;  4DOW A;  3KUF A;  3JCM e;  1QVF A;  2CYZ B;  1VQO T;  4O5V A;  5CKE A;  1B34 B;  2F5T X;  4IUQ A;  5FLX E;  4JS5 A;  4C92 A;  3E1S A;  1N8R C;  3GPL A;  3TU4 K;  1WQW A;  3V8K A;  4F7U F;  4L59 A;  5D6Y A;  2LRQ A;  4E7I A;  4M77 E;  4ZTJ A;  2GQV A;  4M78 F;  4EMK A;  3GNG A;  3G7Z A;  2XD0 A;  3X28 B;  5KH6 A;  3FEO A;  2P4T A;  3S3N A;  3X25 B;  1OZ3 A;  3INZ A;  2VC8 A;  1NE8 A;  4BI3 A;  1H3Z A;  2RHU A;  3N5B B;  1WPY A;  1DJ7 B;  3OW2 S;  4C0F A;  2A7Y A;  2Y4Y A;  3PNW C;  2WSF E;  2ZZD A;  4CRI A;  2PVD B;  1MHN A;  2Y4X A;  2GFU A;  5LL6 S;  2PUO B;  1K73 C;  3ASK A;  3CCE T;  4P5N A;  2DJZ A;  2JOY A;  4CI0 C;  5GAO l;  2LQK A;  3CCQ A;  4ZGJ B;  2VXF A;  1N9R A;  1OZ2 A;  4M75 G;  4M77 F;  4PLI A;  3QZ5 B;  4ELY C;  4C0D B;  2VYT A;  3L2W A;  4R56 A;  3FLG A;  2JZ2 A;  2LTO A;  3CCR A;  5LJ3 d;  3OS1 A;  3SFM A;  3CCM T;  5GAN d;  3OS0 A;  3Q1J A;  4J6X A;  5HK3 A;  1I5L A;  4OP0 A;  5GAM d;  3LLR A;  3URG A;  4M7D E;  1VQ8 T;  4FU6 A;  3G71 A;  4E7H A;  2EAY A;  2O4X A;  3NFC A;  4RG2 A;  4HKE A;  4C5H A;  1M5Q 1;  1O9S A;  1BKB A;  3QXE B;  4PJO G;  4FIB A;  1KHI A;  3CCJ A;  5GAN 7;  3L2Q A;  3RUX A;  4HCC A;  1RI0 A;  1YJN A;  4BE0 A;  1VQ5 A;  1M9S A;  1V29 B;  3BDL A;  4XU0 A;  3ER0 A;  2RB6 A;  3FDR A;  3M57 A;  3OSS C;  4X9C A;  3OYK A;  3OA6 A;  1Y96 B;  2X4J A;  2QTX A;  4E7J A;  3E19 A;  1VQM A;  4OMF B;  4HT9 A;  3JB9 H;  1KQ1 A;  5GAO p;  2VV5 A;  4KUL A;  4M7D F;  1VQ6 A;  4MZM A;  4FL6 A;  3MEW A;  2RA2 A;  1U8R A;  3CPW A;  1G3S A;  3C95 A;  4FM4 B;  4B9W A;  1I81 A;  3J81 E;  4LD9 K;  3ZFJ A;  3OYC A;  3JCM J;  2O01 E;  2ZPG B;  3HRS A;  4QVC A;  2CZ7 B;  4XTX A;  2E1H A;  4OF1 A;  1YIT A;  1IZ6 A;  4BE2 A;  3CCS A;  4IUU A;  3OQ5 A;  4N4H A;  3CCQ T;  1QVG S;  2HAX A;  3PMI A;  3BFM A;  2E12 A;  4M75 C;  1M90 U;  3VU3 C;  4TVR A;  2EJF A;  2HBP A;  3M58 A;  4IUV A;  5A0G A;  1X6O A;  3JCM Q;  3J80 E;  4M75 D;  3SWN B;  3LWI A;  3JB9 J;  3VYG A;  4MZT A;  3TEE A;  2EKO A;  2YRV A;  1YJ9 A;  1BIB A;  3SB2 A;  5LJ3 g;  2OTJ A;  4JUV A;  5GAN 6;  4XAX B;  4MML A;  2RJE A;  4JRI A;  5C0M A;  1YHQ A;  1K8A U;  2Y90 A;  1XNI A;  4XTW A;  4ZGD B;  2D6F A;  1M1F A;  4NOY A;  1VIE A;  2XIC A;  1QVF S;  2CZ6 B;  4WF2 A;  5FU7 C;  1Q81 U;  4M77 G;  1XQH A;  2X4X A;  1BI3 A;  3EFR A;  2DXT A;  2JN0 A;  4IKF A;  3CEY A;  4PJO C;  2K5L A;  2EWN A;  2R5A A;  5CVI A;  1MGQ A;  2G3R A;  3CPF A;  3QYG B;  5A2Q E;  2AHJ B;  1VQ5 T;  4DOV A;  3FB9 A;  3HFO A;  3OYL A;  5DLO A;  1VQ7 A;  3DLL A;  3RKX A;  2FHD A;  2L5Q A;  4XU3 A;  2KQW A;  4C92 B;  1VQM T;  4M75 A;  4QQD A;  5M9O A;  1PSF A;  2YLC A;  4XTY A;  5GAN 2;  1VQ6 T;  1G3Y A;  2DKG A;  4JRK A;  1JBM A;  2B8A A;  4EMK B;  3OYJ A;  5CQY A;  4Z02 A;  1JRI A;  3JRZ A;  3G6E A;  2M9U A;  4PLL A;  1BI0 A;  1FXX A;  3RMQ A;  3A5Z B;  4L6V 5;  3E9G A;  2XDB A;  4DQ2 A;  4JLI A;  2E6Z A;  1NZ9 A;  1Y07 A;  2RO0 A;  1YIT T;  2K2V A;  3QBY A;  2E41 A;  5D6X A;  2DTH A;  3FIF A;  3M55 A;  5FRN A;  3CCE A;  1Q86 C;  3OY9 A;  1UGQ B;  4MDX A;  1M1K U;  4PJO A;  2QDY B;  2V8J A;  2KAF A;  5LJ3 j;  5FU6 C;  4RG8 A;  4J6Y A;  4M7D G;  3VUB A;  3CCU A;  4N4I A;  4F7U E;  3MEU A;  4C5G A;  3V7C A;  2XHC A;  1M1G A;  2RJD A;  5J39 A;  3VV0 A;  2OTJ T;  4OVA A;  4IUT A;  4QQG A;  3ZEH A;  2P0K A;  1VQ4 A;  3M4Y A;  1GXI E;  1VQ8 A;  2ZGW A;  3OYF A;  3PT9 A;  1UB4 A;  3LWH A;  3UWN A;  2KSS A;  1KQS S;  3A8G B;  3EFS A;  4ATO A;  2BIV A;  1HK9 A;  2IG0 A;  2R57 A;  4M77 C;  4YTL A;  1WNL A;  3CBP A;  3DB4 A;  3QKJ A;  3JB9 I;  3P8H A;  2O4X B;  3EAE A;  3I55 A;  5AYF A;  5LJ3 e;  3L1A A;  5GAN e;  4JDS A;  2DZC A;  5CKB A;  5GAM e;  5GAN 4;  1Q7Y U;  1VQ7 T;  4BDZ A;  2E5Q A;  2RJC A;  4RCC A;  2EQK A;  2DD5 A;  4C92 E;  3R6O A;  5IT9 E;  3MP1 A;  2FYK A;  4A4G A;  4BE1 A;  1JJ2 S;  1VQL A;  2VGM A;  3G6E T;  4A54 A;  3CXC A;  1ZBX A;  3CPW S;  3L2U A;  5EG2 A;  4DA4 A;  3OYD A;  5CKF A;  3KBG A;  1SSF A;  3HRT A;  1K9M C;  4E7L A;  2DXC A;  1VQN A;  3JCM X;  5GMK j;  3J7A F;  3HL8 A;  3C94 A;  4M77 A;  1VIF A;  2LCL A;  2ZCF B;  3QZ9 B;  3QJ6 A;  1XOV A;  4QQ6 A;  5GAN 3;  1G3W A;  1R8O B;  4M7D C;  4RKU E;  2XI9 A;  3CCU T;  3QII A;  4C92 F;  4M7A E;  1KHC A;  1VUB A;  4M7D D;  2CS7 A;  3OYM A;  4JLG A;  4C5E A;  3WVE B;  3SD4 A;  2JUF A;  4JS4 A;  3CBM A;  3TCJ A;  3RKY A;  1P92 A;  1VQ4 T;  1YIJ A;  2DXB A;  1WJR A;  1KD1 U;  3RMS A;  4BUG A;  2LC4 A;  1UEB A;  1VQP A;  2P0Q A;  2RI3 A;  4A4K A;  1KC8 C;  5J3B A;  2RD1 A;  3C4S A;  4JJN K;  1KQS A;  3QUI A;  3CC4 T;  2BKD N;  2EQU A;  5FRO A;  5GMK e;  2E6N A;  3DLM A;  2M16 A;  3LGF A;  3MHX A;  3T9N A;  1N27 A;  5LJ5 d;  4NL3 A;  3PTA A;  3I55 T;  3S3M A;  4ZGE B;  5HKC A;  2E65 A;  4OB0 B;  1W2B A;  2QEX A;  1XTD A;  3FJP A;  2RI2 A;  4XU2 A;  4XTZ A;  4M7D A;  2EIF A;  4RCB A;  4LDX A;  1Q82 C;  3MCA B;  4C8Q G;  1ZQ1 A;  2MWO A;  3QPH A;  4N4G A;  2MMP A;  1QW1 A;  4UC4 A;  1VQL T;  2D9T A;  4M75 B;  1JJ2 A;  2CKK A;  5GAO m;  4BY6 C;  4J83 A;  3JCM b;  2XU8 A;  2QQA A;  2JVV A;  2KK4 A;  2ZPH B;  3A8L B;  3ME9 A;  5L8R E;  4B9X A;  4F7U G;  1VQN T;  3LH0 A;  5KCH A;  3L2R A;  2DTI A;  3RKW A;  3LGL A;  4M78 G;  2I2L A;  3RES A;  4HT8 A;  2LT4 A;  5CAI A;  5FU7 B;  3OBY A;  1N8R U;  2GFA A;  4XTU A;  4JRP A;  4XK8 E;  1NJI C;  4BB7 A;  4J7I A;  4C0G A;  3OBW A;  2R58 A;  3CC7 A;  4HCZ A;  3FRN A;  1YIJ T;  2QQ9 A;  2DAQ A;  5GAN g;  4EPC A;  2DIG A;  5GAM g;  3MO8 A;  3NTI A;  4C5I A;  2LQ8 A;  1VQP T;  1VQK A;  2K57 A;  2CZ1 B;  2LVM A;  2RI5 A;  5CK9 A;  3OMC A;  3L2V A;  2K3Y A;  3BDU A;  1VQ9 A;  3C12 A;  2GCX A;  5LJ5 g;  2EFI A;  2HQX A;  3QO3 A;  4E47 A;  1K73 U;  5I2S A;  4PJO D;  3OMG A;  4FT2 A;  3A8H B;  4II1 A;  5LJ3 f;  1G5V A;  2WSC E;  5GAN f;  2QEX T;  3SDZ A;  4Y28 E;  5LJ3 h;  4Y91 A;  5GAM f;  5GAN h;  2HD0 A;  3CC2 T;  3JCM V;  4C8Q C;  5GAM h;  3CCV A;  3VKI A;  5FU6 B;  4BDY A;  3CC7 T;  3UT1 A;  4C8Q D;  3HKS A;  4EDU A;  3CXC S;  5GAO r;  1KQ2 A;  1FWZ A;  4IUP A;  5LJ5 f;  2XDD A;  3CD6 A;  5FRM A;  5GAO q;  1WGS A;  4LD6 A;  2MF2 A;  5A0L A;  3QSU A;  4M7A G;  3VUZ A;  3M56 A;  5J26 A;  5KE2 A;  2QQS A;  4PL6 A;  4M78 C;  2NLU A;  3SWN C;  2OTL A;  1Y96 A;  3PMT A;  3X20 B;  1WJQ A;  4EMH A;  2DVE A;  3QHS A;  5GAN j;  4M78 D;  3OYI A;  4XTV A;  5GAM j;  1RL2 A;  2DZ9 A;  3OS5 A;  2EQJ A;  1M4Z A;  2LT1 A;  2RK2 A;  2VGN A;  4N0A C;  1HXD A;  2M1H A;  2QI2 A;  5KCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...