2L8NA

Nmr structure of the cytidine repressor dna binding domain in presence of operator half-site dna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
AATMKDVALKAKVSTATVSRALMNPDKVSQATRNRVEKAAREVGYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple Conformations of the Cytidine Repressor DNA-Binding Domain Coalesce to One upon Recognition of a Specific DNA Surface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Transcriptional repressor CytR
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2l8nA00
2B5AA 3EUSA 3LISA 4O8BA 2GZUA 4J1XA 2MEZA 4YG4A 4I6RA 2KEKA 4PU8A 2HSGA 2A6CA 2H8RA 2EF8A 1BDHA 3CROL 3IVPA 3GBFA 4I6TA 2BNMA 3KZ3A 4Z5CA 2IUOA 2LCVA 3U3WA 4MCTA 1RZSA 1UXDA 3OQNA 1JFTA 1DW9A 2HINA 3SCGA 2BNOA 1WH8A 4PU3C 2D5VA 3OMTA 2FJRA 2JCGA 1R63A 2R63A 1Y7YA 3F51A 4Z59A 1QP4A 2WUSR 3CECA 3LFPA 2O38A 1HF0A 2PUCA 1AU7A 3ZKCA 1OSLA 2LYPA 2L8NA 3L1PA 4PU7A 2JVLA 2LYJA 4I6UA 1ZS4A 2EBYA 1ZUGA 2L49A 2XCJA 4JQDA 1PNRA 3G7DA 3QYXA 2IVQA 3SCFA 2PUDA 3MLFA 1XWRA 2AXVA 3BS3A 1CQTA 1JH9A 4I8TA 4YARA 5A7LA 1CJGA 2LYLA 3GN5B 2KEIA 3KJXA 1RPEL 1DWKA 4IA8A 1RZRA 2CSFA 3UFDA 2AWIA 3BD1A 4X4CA 4X4EA 3S8QA 1LLIA 2PE5A 3KXAA 4PU4C 2PUFA 2BNNA 1LQCA 3VK0A 3H5TA 4YG7B 1BDIA 3QWGA 2OR1L 3O9XA 2IV1A 3D1NI 4FN3A 1POUA 1PERL 4F8DA 2IVGA 2XSDC 4X4DA 2KPJA 4NDWA 4X4BA 2KZ8A 1R69A 5K98B 3DNVB 1X57A 3GN5A 1UTXA 3JXBC 2R1JL 3F52A 1LMB3 4YG1A 1Y9QA 1WIZA 3JXCL 2MQKA 1OCTC 2O49A 1JFSA 2AUWA 1ZZ7A 2LYRA 3RZZA 1WETA 3SCHA 2PUGA 3QQ6A 4IVZA 4Z5DA 3BDNA 4OB4A 2PUAA 3G5GA 1YSEA 1LCCA 4X4IA 1RIOA 1ZZ6A 1PRAA 1NEQA 1ZPQA 2AXZA 1QP7A 1VPWA 1ZAYA 1QQAA 1B0NA 2O4AA 4X4FA 1ZZ9A 4Y42A 2EWTA 2OFYA 4J1WA 1O4XA 1NERA 1ZVVA 1UXCA 3B7HA 4GQMA 4JCXA 2PUEA 3ZHIA 4X4HA 3ZHMA 4IWRA 1WH6A 2PPXA 3FYAA 2AW6A 2XJ3A 4X4GA 1ZZBA 2ICTA 1RZRD 4JCYA 3R1FA 2ICPA 4Z58A 2GRMA 3PXPA 1ZZCA 1QQBA 2PUBA 2KEJA 2AXUA 2PIJA 3HZIB 2CROA 3OQOA 1QPZA 2XI8A 3OP9A 3CLCA 1X2LA 3TRBA 3FYMA 2WIUB 3OQMA 1PRUA 2LYSA 2LYQA 3JXDL 2IU7A 3FMYA 2IVBA 2GRLA 1PRVA 2BJCA 1GT0C 3QF3A 4YBAA 1QP0A 4GHJA 1ADRA 4MCXA 1L1MA 1EFAA 2LYKA 2XIUA 1S7EA 1IC8A 1LCDA 1SQ8A 3F6WA 1E3OC 4FBIA 4Z5HA 1JWLA 1ZZ8A
chains in the Genus database with same CATH superfamily
2B5AA 4YG4A 2KEKA 2H8RA 3CROL 4I6TA 3TEPA 2BNMA 1UXDA 2HINA 4ER5A 2BNOA 1QP4A 3CECA 2LLWA 3LFPA 2PUCA 4PU7A 4I6UA 2EBYA 4JQDA 1PNRA 3G7DA 3QYXA 2AXVA 5DT2A 2LYLA 3NDBB 1RPEL 1RZRA 2AWIA 3GZDC 2PE5A 3KXAA 4PU4C 4OBMA 4YG7B 3QWGA 2ODRD 3SX0A 1PERL 4F8DA 3QOXA 2XSDC 4X4DA 2R1JL 5K98B 3JXBC 1UTXA 4YG1A 2AUWA 3RZZA 4OB4A 1ZZ6A 1NEQA 2PXVA 1QQAA 1B0NA 2EWTA 4ER3A 1UXCA 3B7HA 2FFHA 4EZIA 3ZHIA 3ZHMA 3FYAA 2PXTA 4Z58A 2GRMA 1QQBA 1PRUA 2LYSA 2GRLA 1ADRA 1L1MA 3DM5A 4EK9A 3EUSA 3LISA 2HSGA 3IVPA 3GBFA 3KZ3A 2IUOA 2HCSA 3OWQA 3U3WA 1RZSA 1DW9A 3GUUA 4Q2JA 2R63A 1QZXA 3NROA 1OSLA 2L8NA 2MXDA 2JVLA 2LYJA 1ZUGA 2L49A 3UWPA 3SCFA 3QFIA 3BS3A 1CQTA 4I8TA 1CJGA 3KJXA 3NXHA 2PXEA 1DWKA 2CSFA 3UFDA 3BD1A 3R09A 2PUFA 3TELA 3VK0A 3H5TA 2IV1A 3D1NI 4WVLA 1POUA 3MEJA 2KZ8A 3GN5A 1LMB3 3ME5A 2MQKA 1ZZ7A 4ER0A 3BDNA 3G5GA 1YSEA 5DRYA 1RIOA 1PRAA 1ZPQA 1ZZ9A 2OFYA 4X4HA 4IWRA 2PPXA 1ZZBA 2ICTA 4JCYA 4DE9A 2ICPA 2J7WA 2L1PA 1ZZCA 3PXPA 3VWSA 2PXLA 1X2LA 3FYMA 2M4HA 3FMYA 1QP0A 4GHJA 1EFAA 1S7EA 1NW3A 1LCDA 1SQ8A 4FBIA 4Z5HA 1HQ1A 4O8BA 2MEZA 2A6CA 2EF8A 2LCVA 4MCTA 1JFTA 2PXUA 4PU3C 3OMTA 2JCGA 4Z59A 1HF0A 1AU7A 2LYPA 3L1PA 5DRTA 3KL4A 2XCJA 2PXPA 1MFQC 3MLFA 1XWRA 2PXDA 1JH9A 5A7LA 3GN5B 2YBDA 2XXPA 4X4CA 4X4EA 3S8QA 2PXQA 2BNNA 1LQCA 1BDIA 2OR1L 3O9XA 3GZDA 1R69A 1X57A 1QB2A 1WIZA 2O49A 2LYRA 3A9YA 1WETA 3SCHA 3QQ6A 4Z5DA 2PXFA 2PUAA 1LCCA 2AXZA 1VPWA 1QP7A 1ZAYA 2O4AA 4Y42A 4J1WA 1O4XA 1NERA 1ZVVA 3A9ZA 2LNMA 2PUEA 1WH6A 3LQXA 1RZRD 3TFLA 5GAHi 3R1FA 2PIJA 4EQZA 2CROA 3A9XA 4DE8A 3OQOA 1QPZA 3OP9A 3CLCA 3TRBA 3G0TA 1U2ZA 3ZPXA 2IU7A 2IVBA 2BJCA 1GT0C 4YBAA 2HCNA 4MCXA 2LYKA 2VEOA 1IC8A 1BDHA 1ZZ8A 2GZUA 4J1XA 4I6RA 3M9LA 4PU8A 2PXBA 2V3CC 4Z5CA 3OQNA 3SCGA 1WH8A 2D5VA 2FJRA 3F51A 1R63A 1Y7YA 2WUSR 5GAGi 2O38A 3ZKCA 3NZLA 1ZS4A 2IVQA 2PUDA 3OKZA 2J7UA 4YARA 2KEIA 4IA8A 1LLIA 4ER7A 5DTRA 3SR4A 4FN3A 5DSXA 5DTMA 2IVGA 2KPJA 4NDWA 4X4BA 3DNVB 2HFZA 3F52A 2LLVA 1Y9QA 3JXCL 1OCTC 2PXKA 1JFSA 2PUGA 4IVZA 2XXAA 4X4IA 4X4FA 4JCXA 4GQMA 5JUWA 2AW6A 2XJ3A 4X4GA 2PUBA 2KEJA 2AXUA 2JQEA 3HZIB 4HRAA 4EKGA 3GZCA 3PE5A 5DTQA 2WIUB 3OQMA 2LYQA 3JXDL 3QOWA 1PRVA 1DULA 3QF3A 2XXQA 4ER6A 2XIUA 3F6WA 1E3OC 1JWLA 2XI8A 4EKIA
chains in the Genus database with same CATH topology
2B5AA 3EUSA 3LISA 4O8BA 2GZUA 4J1XA 2MEZA 4YG4A 4I6RA 2KEKA 4PU8A 2HSGA 2A6CA 2H8RA 2EF8A 1BDHA 3CROL 3IVPA 3GBFA 4I6TA 2BNMA 3KZ3A 4Z5CA 2IUOA 2LCVA 3U3WA 4MCTA 1RZSA 1UXDA 3OQNA 1JFTA 1DW9A 2HINA 3SCGA 2BNOA 1WH8A 4PU3C 2D5VA 3OMTA 2FJRA 2JCGA 1R63A 2R63A 1Y7YA 3F51A 4Z59A 1QP4A 2WUSR 3CECA 3LFPA 2O38A 1HF0A 2PUCA 1AU7A 3ZKCA 1OSLA 2LYPA 2L8NA 3L1PA 4PU7A 2JVLA 2LYJA 4I6UA 1ZS4A 2EBYA 1ZUGA 2L49A 2XCJA 4JQDA 1PNRA 3G7DA 3QYXA 2IVQA 3SCFA 2PUDA 3MLFA 1XWRA 2AXVA 3BS3A 1CQTA 1JH9A 4I8TA 4YARA 5A7LA 1CJGA 2LYLA 3GN5B 2KEIA 3KJXA 1RPEL 1DWKA 4IA8A 1RZRA 2CSFA 3UFDA 2AWIA 3BD1A 4X4CA 4X4EA 3S8QA 1LLIA 2PE5A 3KXAA 4PU4C 2PUFA 2BNNA 1LQCA 3VK0A 3H5TA 4YG7B 1BDIA 3QWGA 2OR1L 3O9XA 2IV1A 3D1NI 4FN3A 1POUA 1PERL 4F8DA 2IVGA 2XSDC 4X4DA 2KPJA 4NDWA 4X4BA 2KZ8A 1R69A 5K98B 3DNVB 1X57A 3GN5A 1UTXA 3JXBC 2R1JL 3F52A 1LMB3 4YG1A 1Y9QA 1WIZA 3JXCL 2MQKA 1OCTC 2O49A 1JFSA 2AUWA 1ZZ7A 2LYRA 3RZZA 1WETA 3SCHA 2PUGA 3QQ6A 4IVZA 4Z5DA 3BDNA 4OB4A 2PUAA 3G5GA 1YSEA 1LCCA 4X4IA 1RIOA 1ZZ6A 1PRAA 1NEQA 1ZPQA 2AXZA 1QP7A 1VPWA 1ZAYA 1QQAA 1B0NA 2O4AA 4X4FA 1ZZ9A 4Y42A 2EWTA 2OFYA 4J1WA 1O4XA 1NERA 1ZVVA 1UXCA 3B7HA 4GQMA 4JCXA 2PUEA 3ZHIA 4X4HA 3ZHMA 4IWRA 1WH6A 2PPXA 3FYAA 2AW6A 2XJ3A 4X4GA 1ZZBA 2ICTA 1RZRD 4JCYA 3R1FA 2ICPA 4Z58A 2GRMA 3PXPA 1ZZCA 1QQBA 2PUBA 2KEJA 2AXUA 2PIJA 3HZIB 2CROA 3OQOA 1QPZA 2XI8A 3OP9A 3CLCA 1X2LA 3TRBA 3FYMA 2WIUB 3OQMA 1PRUA 2LYSA 2LYQA 3JXDL 2IU7A 3FMYA 2IVBA 2GRLA 1PRVA 2BJCA 1GT0C 3QF3A 4YBAA 1QP0A 4GHJA 1ADRA 4MCXA 1L1MA 1EFAA 2LYKA 2XIUA 1S7EA 1IC8A 1LCDA 1SQ8A 3F6WA 1E3OC 4FBIA 4Z5HA 1JWLA 1ZZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5A A;  3EUS A;  3LIS A;  4O8B A;  2GZU A;  4J1X A;  2MEZ A;  4YG4 A;  4I6R A;  2KEK A;  4PU8 A;  2HSG A;  2A6C A;  2H8R A;  2EF8 A;  1BDH A;  3CRO L;  3IVP A;  3GBF A;  4I6T A;  2BNM A;  3KZ3 A;  4Z5C A;  2IUO A;  2LCV A;  3U3W A;  4MCT A;  1RZS A;  1UXD A;  3OQN A;  1JFT A;  1DW9 A;  2HIN A;  3SCG A;  2BNO A;  1WH8 A;  4PU3 C;  2D5V A;  3OMT A;  2FJR A;  2JCG A;  1R63 A;  2R63 A;  1Y7Y A;  3F51 A;  4Z59 A;  1QP4 A;  2WUS R;  3CEC A;  3LFP A;  2O38 A;  1HF0 A;  2PUC A;  1AU7 A;  3ZKC A;  1OSL A;  2LYP A;  2L8N A;  3L1P A;  4PU7 A;  2JVL A;  2LYJ A;  4I6U A;  1ZS4 A;  2EBY A;  1ZUG A;  2L49 A;  2XCJ A;  4JQD A;  1PNR A;  3G7D A;  3QYX A;  2IVQ A;  3SCF A;  2PUD A;  3MLF A;  1XWR A;  2AXV A;  3BS3 A;  1CQT A;  1JH9 A;  4I8T A;  4YAR A;  5A7L A;  1CJG A;  2LYL A;  3GN5 B;  2KEI A;  3KJX A;  1RPE L;  1DWK A;  4IA8 A;  1RZR A;  2CSF A;  3UFD A;  2AWI A;  3BD1 A;  4X4C A;  4X4E A;  3S8Q A;  1LLI A;  2PE5 A;  3KXA A;  4PU4 C;  2PUF A;  2BNN A;  1LQC A;  3VK0 A;  3H5T A;  4YG7 B;  1BDI A;  3QWG A;  2OR1 L;  3O9X A;  2IV1 A;  3D1N I;  4FN3 A;  1POU A;  1PER L;  4F8D A;  2IVG A;  2XSD C;  4X4D A;  2KPJ A;  4NDW A;  4X4B A;  2KZ8 A;  1R69 A;  5K98 B;  3DNV B;  1X57 A;  3GN5 A;  1UTX A;  3JXB C;  2R1J L;  3F52 A;  1LMB 3;  4YG1 A;  1Y9Q A;  1WIZ A;  3JXC L;  2MQK A;  1OCT C;  2O49 A;  1JFS A;  2AUW A;  1ZZ7 A;  2LYR A;  3RZZ A;  1WET A;  3SCH A;  2PUG A;  3QQ6 A;  4IVZ A;  4Z5D A;  3BDN A;  4OB4 A;  2PUA A;  3G5G A;  1YSE A;  1LCC A;  4X4I A;  1RIO A;  1ZZ6 A;  1PRA A;  1NEQ A;  1ZPQ A;  2AXZ A;  1QP7 A;  1VPW A;  1ZAY A;  1QQA A;  1B0N A;  2O4A A;  4X4F A;  1ZZ9 A;  4Y42 A;  2EWT A;  2OFY A;  4J1W A;  1O4X A;  1NER A;  1ZVV A;  1UXC A;  3B7H A;  4GQM A;  4JCX A;  2PUE A;  3ZHI A;  4X4H A;  3ZHM A;  4IWR A;  1WH6 A;  2PPX A;  3FYA A;  2AW6 A;  2XJ3 A;  4X4G A;  1ZZB A;  2ICT A;  1RZR D;  4JCY A;  3R1F A;  2ICP A;  4Z58 A;  2GRM A;  3PXP A;  1ZZC A;  1QQB A;  2PUB A;  2KEJ A;  2AXU A;  2PIJ A;  3HZI B;  2CRO A;  3OQO A;  1QPZ A;  2XI8 A;  3OP9 A;  3CLC A;  1X2L A;  3TRB A;  3FYM A;  2WIU B;  3OQM A;  1PRU A;  2LYS A;  2LYQ A;  3JXD L;  2IU7 A;  3FMY A;  2IVB A;  2GRL A;  1PRV A;  2BJC A;  1GT0 C;  3QF3 A;  4YBA A;  1QP0 A;  4GHJ A;  1ADR A;  4MCX A;  1L1M A;  1EFA A;  2LYK A;  2XIU A;  1S7E A;  1IC8 A;  1LCD A;  1SQ8 A;  3F6W A;  1E3O C;  4FBI A;  4Z5H A;  1JWL A;  1ZZ8 A; 
#chains in the Genus database with same CATH topology
 2B5A A;  4YG4 A;  2KEK A;  2H8R A;  3CRO L;  4I6T A;  3TEP A;  2BNM A;  1UXD A;  2HIN A;  4ER5 A;  2BNO A;  1QP4 A;  3CEC A;  2LLW A;  3LFP A;  2PUC A;  4PU7 A;  4I6U A;  2EBY A;  4JQD A;  1PNR A;  3G7D A;  3QYX A;  2AXV A;  5DT2 A;  2LYL A;  3NDB B;  1RPE L;  1RZR A;  2AWI A;  3GZD C;  2PE5 A;  3KXA A;  4PU4 C;  4OBM A;  4YG7 B;  3QWG A;  2ODR D;  3SX0 A;  1PER L;  4F8D A;  3QOX A;  2XSD C;  4X4D A;  2R1J L;  5K98 B;  3JXB C;  1UTX A;  4YG1 A;  2AUW A;  3RZZ A;  4OB4 A;  1ZZ6 A;  1NEQ A;  2PXV A;  1QQA A;  1B0N A;  2EWT A;  4ER3 A;  1UXC A;  3B7H A;  2FFH A;  4EZI A;  3ZHI A;  3ZHM A;  3FYA A;  2PXT A;  4Z58 A;  2GRM A;  1QQB A;  1PRU A;  2LYS A;  2GRL A;  1ADR A;  1L1M A;  3DM5 A;  4EK9 A;  3EUS A;  3LIS A;  2HSG A;  3IVP A;  3GBF A;  3KZ3 A;  2IUO A;  2HCS A;  3OWQ A;  3U3W A;  1RZS A;  1DW9 A;  3GUU A;  4Q2J A;  2R63 A;  1QZX A;  3NRO A;  1OSL A;  2L8N A;  2MXD A;  2JVL A;  2LYJ A;  1ZUG A;  2L49 A;  3UWP A;  3SCF A;  3QFI A;  3BS3 A;  1CQT A;  4I8T A;  1CJG A;  3KJX A;  3NXH A;  2PXE A;  1DWK A;  2CSF A;  3UFD A;  3BD1 A;  3R09 A;  2PUF A;  3TEL A;  3VK0 A;  3H5T A;  2IV1 A;  3D1N I;  4WVL A;  1POU A;  3MEJ A;  2KZ8 A;  3GN5 A;  1LMB 3;  3ME5 A;  2MQK A;  1ZZ7 A;  4ER0 A;  3BDN A;  3G5G A;  1YSE A;  5DRY A;  1RIO A;  1PRA A;  1ZPQ A;  1ZZ9 A;  2OFY A;  4X4H A;  4IWR A;  2PPX A;  1ZZB A;  2ICT A;  4JCY A;  4DE9 A;  2ICP A;  2J7W A;  2L1P A;  1ZZC A;  3PXP A;  3VWS A;  2PXL A;  1X2L A;  3FYM A;  2M4H A;  3FMY A;  1QP0 A;  4GHJ A;  1EFA A;  1S7E A;  1NW3 A;  1LCD A;  1SQ8 A;  4FBI A;  4Z5H A;  1HQ1 A;  4O8B A;  2MEZ A;  2A6C A;  2EF8 A;  2LCV A;  4MCT A;  1JFT A;  2PXU A;  4PU3 C;  3OMT A;  2JCG A;  4Z59 A;  1HF0 A;  1AU7 A;  2LYP A;  3L1P A;  5DRT A;  3KL4 A;  2XCJ A;  2PXP A;  1MFQ C;  3MLF A;  1XWR A;  2PXD A;  1JH9 A;  5A7L A;  3GN5 B;  2YBD A;  2XXP A;  4X4C A;  4X4E A;  3S8Q A;  2PXQ A;  2BNN A;  1LQC A;  1BDI A;  2OR1 L;  3O9X A;  3GZD A;  1R69 A;  1X57 A;  1QB2 A;  1WIZ A;  2O49 A;  2LYR A;  3A9Y A;  1WET A;  3SCH A;  3QQ6 A;  4Z5D A;  2PXF A;  2PUA A;  1LCC A;  2AXZ A;  1VPW A;  1QP7 A;  1ZAY A;  2O4A A;  4Y42 A;  4J1W A;  1O4X A;  1NER A;  1ZVV A;  3A9Z A;  2LNM A;  2PUE A;  1WH6 A;  3LQX A;  1RZR D;  3TFL A;  5GAH i;  3R1F A;  2PIJ A;  4EQZ A;  2CRO A;  3A9X A;  4DE8 A;  3OQO A;  1QPZ A;  3OP9 A;  3CLC A;  3TRB A;  3G0T A;  1U2Z A;  3ZPX A;  2IU7 A;  2IVB A;  2BJC A;  1GT0 C;  4YBA A;  2HCN A;  4MCX A;  2LYK A;  2VEO A;  1IC8 A;  1BDH A;  1ZZ8 A;  2GZU A;  4J1X A;  4I6R A;  3M9L A;  4PU8 A;  2PXB A;  2V3C C;  4Z5C A;  3OQN A;  3SCG A;  1WH8 A;  2D5V A;  2FJR A;  3F51 A;  1R63 A;  1Y7Y A;  2WUS R;  5GAG i;  2O38 A;  3ZKC A;  3NZL A;  1ZS4 A;  2IVQ A;  2PUD A;  3OKZ A;  2J7U A;  4YAR A;  2KEI A;  4IA8 A;  1LLI A;  4ER7 A;  5DTR A;  3SR4 A;  4FN3 A;  5DSX A;  5DTM A;  2IVG A;  2KPJ A;  4NDW A;  4X4B A;  3DNV B;  2HFZ A;  3F52 A;  2LLV A;  1Y9Q A;  3JXC L;  1OCT C;  2PXK A;  1JFS A;  2PUG A;  4IVZ A;  2XXA A;  4X4I A;  4X4F A;  4JCX A;  4GQM A;  5JUW A;  2AW6 A;  2XJ3 A;  4X4G A;  2PUB A;  2KEJ A;  2AXU A;  2JQE A;  3HZI B;  4HRA A;  4EKG A;  3GZC A;  3PE5 A;  5DTQ A;  2WIU B;  3OQM A;  2LYQ A;  3JXD L;  3QOW A;  1PRV A;  1DUL A;  3QF3 A;  2XXQ A;  4ER6 A;  2XIU A;  3F6W A;  1E3O C;  1JWL A;  2XI8 A;  4EKI A; 
#chains in the Genus database with same CATH homology
 2B5A A;  3EUS A;  3LIS A;  4O8B A;  2GZU A;  4J1X A;  2MEZ A;  4YG4 A;  4I6R A;  2KEK A;  4PU8 A;  2HSG A;  2A6C A;  2H8R A;  2EF8 A;  1BDH A;  3CRO L;  3IVP A;  3GBF A;  4I6T A;  2BNM A;  3KZ3 A;  4Z5C A;  2IUO A;  2LCV A;  3U3W A;  4MCT A;  1RZS A;  1UXD A;  3OQN A;  1JFT A;  1DW9 A;  2HIN A;  3SCG A;  2BNO A;  1WH8 A;  4PU3 C;  2D5V A;  3OMT A;  2FJR A;  2JCG A;  1R63 A;  2R63 A;  1Y7Y A;  3F51 A;  4Z59 A;  1QP4 A;  2WUS R;  3CEC A;  3LFP A;  2O38 A;  1HF0 A;  2PUC A;  1AU7 A;  3ZKC A;  1OSL A;  2LYP A;  2L8N A;  3L1P A;  4PU7 A;  2JVL A;  2LYJ A;  4I6U A;  1ZS4 A;  2EBY A;  1ZUG A;  2L49 A;  2XCJ A;  4JQD A;  1PNR A;  3G7D A;  3QYX A;  2IVQ A;  3SCF A;  2PUD A;  3MLF A;  1XWR A;  2AXV A;  3BS3 A;  1CQT A;  1JH9 A;  4I8T A;  4YAR A;  5A7L A;  1CJG A;  2LYL A;  3GN5 B;  2KEI A;  3KJX A;  1RPE L;  1DWK A;  4IA8 A;  1RZR A;  2CSF A;  3UFD A;  2AWI A;  3BD1 A;  4X4C A;  4X4E A;  3S8Q A;  1LLI A;  2PE5 A;  3KXA A;  4PU4 C;  2PUF A;  2BNN A;  1LQC A;  3VK0 A;  3H5T A;  4YG7 B;  1BDI A;  3QWG A;  2OR1 L;  3O9X A;  2IV1 A;  3D1N I;  4FN3 A;  1POU A;  1PER L;  4F8D A;  2IVG A;  2XSD C;  4X4D A;  2KPJ A;  4NDW A;  4X4B A;  2KZ8 A;  1R69 A;  5K98 B;  3DNV B;  1X57 A;  3GN5 A;  1UTX A;  3JXB C;  2R1J L;  3F52 A;  1LMB 3;  4YG1 A;  1Y9Q A;  1WIZ A;  3JXC L;  2MQK A;  1OCT C;  2O49 A;  1JFS A;  2AUW A;  1ZZ7 A;  2LYR A;  3RZZ A;  1WET A;  3SCH A;  2PUG A;  3QQ6 A;  4IVZ A;  4Z5D A;  3BDN A;  4OB4 A;  2PUA A;  3G5G A;  1YSE A;  1LCC A;  4X4I A;  1RIO A;  1ZZ6 A;  1PRA A;  1NEQ A;  1ZPQ A;  2AXZ A;  1QP7 A;  1VPW A;  1ZAY A;  1QQA A;  1B0N A;  2O4A A;  4X4F A;  1ZZ9 A;  4Y42 A;  2EWT A;  2OFY A;  4J1W A;  1O4X A;  1NER A;  1ZVV A;  1UXC A;  3B7H A;  4GQM A;  4JCX A;  2PUE A;  3ZHI A;  4X4H A;  3ZHM A;  4IWR A;  1WH6 A;  2PPX A;  3FYA A;  2AW6 A;  2XJ3 A;  4X4G A;  1ZZB A;  2ICT A;  1RZR D;  4JCY A;  3R1F A;  2ICP A;  4Z58 A;  2GRM A;  3PXP A;  1ZZC A;  1QQB A;  2PUB A;  2KEJ A;  2AXU A;  2PIJ A;  3HZI B;  2CRO A;  3OQO A;  1QPZ A;  2XI8 A;  3OP9 A;  3CLC A;  1X2L A;  3TRB A;  3FYM A;  2WIU B;  3OQM A;  1PRU A;  2LYS A;  2LYQ A;  3JXD L;  2IU7 A;  3FMY A;  2IVB A;  2GRL A;  1PRV A;  2BJC A;  1GT0 C;  3QF3 A;  4YBA A;  1QP0 A;  4GHJ A;  1ADR A;  4MCX A;  1L1M A;  1EFA A;  2LYK A;  2XIU A;  1S7E A;  1IC8 A;  1LCD A;  1SQ8 A;  3F6W A;  1E3O C;  4FBI A;  4Z5H A;  1JWL A;  1ZZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...