2L8NA

Nmr structure of the cytidine repressor dna binding domain in presence of operator half-site dna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
AATMKDVALKAKVSTATVSRALMNPDKVSQATRNRVEKAAREVGYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple Conformations of the Cytidine Repressor DNA-Binding Domain Coalesce to One upon Recognition of a Specific DNA Surface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Transcriptional repressor CytR
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2l8nA00
2LYQA 1R69A 1L1MA 2JCGA 4IA8A 3ZHMA 1ZZBA 4Z5CA 1ZUGA 2ICTA 3KZ3A 1UXDA 2WIUB 2XI8A 3BD1A 3B7HA 1RZRD 2AWIA 3FYAA 3F6WA 3IVPA 3R1FA 3CLCA 3GN5B 3F51A 4I8TA 2IUOA 3FMYA 2AXZA 3GBFA 1UTXA 1ZZ6A 2LYJA 1OSLA 2IVGA 1ZZ9A 2KZ8A 2FJRA 2HINA 2GRMA 2BJCA 1PRUA 2IVQA 2XSDC 1BDIA 2LYPA 2XIUA 1QQBA 4JCXA 3LISA 3GN5A 3L1PA 4Z59A 1ZZCA 4X4EA 2LYSA 1LLIA 2BNOA 4PU4C 1CJGA 4FN3A 2CSFA 2LYLA 1HF0A 1Y7YA 4YG1A 3OQMA 3G7DA 4X4FA 3KXAA 1ADRA 2EBYA 4Y42A 4X4DA 5A7LA 2XJ3A 1POUA 1PRVA 4I6RA 2JVLA 3FYMA 1ZPQA 3EUSA 4J1XA 4X4CA 1OCTC 4JQDA 1QP0A 2BNNA 4GHJA 1LMB3 4F8DA 2HSGA 3SCFA 1PNRA 1RPEL 1Y9QA 4OB4A 1PERL 2IV1A 2AXUA 2WUSR 3SCHA 1NEQA 3MLFA 1ZZ7A 3QQ6A 3H5TA 1ZVVA 2PE5A 3OMTA 4X4BA 2AUWA 2BNMA 1ZZ8A 2ICPA 1WH8A 2XCJA 2B5AA 1RIOA 1WH6A 3ZKCA 2LYRA 1GT0C 1JH9A 1BDHA 1QP4A 1ZS4A 3CECA 2L8NA 1E3OC 1IC8A 2PPXA 1DW9A 3QF3A 2PUGA 3HZIB 2R63A 2A6CA 2GRLA 1AU7A 4X4GA 4X4HA 3BDNA 1NERA 2R1JL 1JFSA 2KPJA 3LFPA 3ZHIA 4Z5DA 2PUFA 3JXDL 4O8BA 2PUDA 1R63A 1WIZA 3BS3A 2AXVA 4MCTA 2IU7A 2PUEA 2KEJA 4IWRA 3G5GA 3VK0A 4YARA 3JXBC 4PU8A 2OFYA 1YSEA 2PIJA 3TRBA 1JFTA 4J1WA 3PXPA 1QQAA 1RZRA 4YG4A 2MQKA 3O9XA 2CROA 3OQNA 3OQOA 2O49A 2LYKA 3OP9A 2EWTA 3SCGA 1EFAA 3KJXA 4YG7B 1PRAA 3U3WA 1SQ8A 3JXCL 1S7EA 2AW6A 1O4XA 2KEIA 2O38A 2O4AA 2IVBA 3CROL 1LQCA 2OR1L 4PU7A 2L49A 1CQTA 4YBAA 2KEKA 2H8RA 1QPZA 3F52A 3QWGA 4IVZA 3QYXA 1DWKA 1XWRA 2GZUA 1X57A 3RZZA 1LCDA 2LCVA 1VPWA 4I6TA 1X2LA 3S8QA 1JWLA 2EF8A 1RZSA 4GQMA 3UFDA 4NDWA 5K98B 4MCXA 3D1NI 2D5VA 1UXCA 1B0NA 3DNVB 1QP7A 2PUAA 4FBIA 4I6UA 2PUCA 1ZAYA 4PU3C 4JCYA 2PUBA 1LCCA 2MEZA 4Z58A 4Z5HA 1WETA 4X4IA
chains in the Genus database with same CATH superfamily
1R69A 1L1MA 2PXLA 3A9YA 2PXUA 1ZUGA 1UXDA 3B7HA 1RZRD 3F6WA 2ODRD 2IUOA 1ZZ9A 2HINA 3NROA 1BDIA 3GUUA 4EZIA 2LLVA 2LYSA 3QFIA 2CSFA 1HF0A 4ER6A 2XJ3A 1PRVA 3QOWA 4I6RA 4EK9A 4JQDA 1ZPQA 3EUSA 3GZDA 3NZLA 3SCFA 1RPEL 3M9LA 3KL4A 3SCHA 1QZXA 1NEQA 2JQEA 1ZVVA 2XCJA 2VEOA 1JH9A 1BDHA 1QP4A 1DW9A 2R63A 5DRYA 4X4HA 3TFLA 2KPJA 3ZHIA 4Z5DA 2PUFA 2PXDA 3VK0A 4PU8A 4J1WA 3A9XA 4YG4A 3OQNA 2O49A 3OP9A 3KJXA 1PRAA 3U3WA 1SQ8A 2AW6A 3CROL 1CQTA 2KEKA 3S8QA 4NDWA 2D5VA 2PUCA 4PU3C 4JCYA 2PUBA 2PXPA 3ZPXA 2V3CC 4Z5CA 2XXPA 1DULA 3IVPA 2L1PA 1ZZ6A 2LYJA 2BJCA 2IVQA 2XSDC 2LYPA 2XIUA 3LISA 4EKGA 1CJGA 2LLWA 3A9ZA 3SX0A 3G7DA 4ER7A 4X4DA 5A7LA 2HCNA 2JVLA 3FYMA 1OCTC 2BNNA 4GHJA 4OB4A 2PXQA 1ZZ7A 3OWQA 3QQ6A 4OBMA 1ZZ8A 1WH6A 2PXVA 5GAGi 1ZS4A 3CECA 4DE8A 2L8NA 1E3OC 2PPXA 3QF3A 5DTMA 1AU7A 4X4GA 1NERA 3LFPA 3UWPA 2AXVA 4MCTA 4IWRA 4YARA 1YSEA 2PIJA 3TRBA 3O9XA 4YG7B 3JXCL 1S7EA 2KEIA 2IVBA 1LQCA 3F52A 3QWGA 4IVZA 1DWKA 2GZUA 1VPWA 1JWLA 1X2LA 2EF8A 3UFDA 3D1NI 1UXCA 4FBIA 1ZAYA 1LCCA 2YBDA 2MEZA 4Z5HA 1WETA 3ZHMA 3NDBB 2ICTA 2WIUB 2XI8A 2AWIA 3CLCA 3GN5B 3F51A 2MXDA 3FMYA 2AXZA 3GBFA 1UTXA 5JUWA 3MEJA 2KZ8A 3PE5A 1QQBA 3VWSA 4JCXA 2M4HA 3L1PA 1ZZCA 5DT2A 4X4EA 4FN3A 1Y7YA 3OQMA 2PXFA 3KXAA 1ADRA 2EBYA 4Y42A 5GAHi 1QB2A 4J1XA 5DTRA 3DM5A 2HSGA 1PERL 2AXUA 2WUSR 1U2ZA 4X4BA 2AUWA 1RIOA 2ICPA 1WH8A 5DRTA 2B5AA 2LYRA 2PUGA 3HZIB 2GRLA 3BDNA 3JXDL 2PUDA 1R63A 3BS3A 2IU7A 3G5GA 2FFHA 3JXBC 1JFTA 3PXPA 1NW3A 1QQAA 3R09A 2J7UA 2LYKA 3QOXA 2EWTA 3SCGA 1EFAA 4ER5A 3TELA 2O4AA 2OR1L 4ER3A 3LQXA 1X57A 1LCDA 2LCVA 4WVLA 4I6TA 1RZSA 4GQMA 4DE9A 4MCXA 2PUAA 2XXAA 2LYQA 2JCGA 4IA8A 1ZZBA 3KZ3A 4Q2JA 2PXTA 3BD1A 3FYAA 3R1FA 2HCSA 4EQZA 2LNMA 4I8TA 1OSLA 2IVGA 2FJRA 2GRMA 1PRUA 3GN5A 4Z59A 1LLIA 2BNOA 4PU4C 2LYLA 4YG1A 4X4FA 3GZDC 1POUA 4X4CA 1QP0A 1LMB3 4F8DA 1PNRA 1Y9QA 2IV1A 5DSXA 3MLFA 2PXBA 3H5TA 3NXHA 2PE5A 3OMTA 2BNMA 5DTQA 3ZKCA 1GT0C 2J7WA 1IC8A 1HQ1A 3GZCA 1MFQC 2A6CA 3TEPA 2R1JL 1JFSA 4O8BA 1WIZA 2PUEA 2KEJA 2OFYA 1RZRA 2MQKA 3OQOA 2CROA 2HFZA 3ME5A 1O4XA 2O38A 4ER0A 3SR4A 3G0TA 4PU7A 2L49A 2PXEA 4YBAA 2H8RA 1QPZA 2XXQA 3QYXA 1XWRA 3RZZA 3OKZA 5K98B 1B0NA 3DNVB 1QP7A 4I6UA 4Z58A 2PXKA 4EKIA 4HRAA 4X4IA
chains in the Genus database with same CATH topology
2LYQA 1R69A 1L1MA 2JCGA 4IA8A 3ZHMA 1ZZBA 4Z5CA 1ZUGA 2ICTA 3KZ3A 1UXDA 2WIUB 2XI8A 3BD1A 3B7HA 1RZRD 2AWIA 3FYAA 3F6WA 3IVPA 3R1FA 3CLCA 3GN5B 3F51A 4I8TA 2IUOA 3FMYA 2AXZA 3GBFA 1UTXA 1ZZ6A 2LYJA 1OSLA 2IVGA 1ZZ9A 2KZ8A 2FJRA 2HINA 2GRMA 2BJCA 1PRUA 2IVQA 2XSDC 1BDIA 2LYPA 2XIUA 1QQBA 4JCXA 3LISA 3GN5A 3L1PA 4Z59A 1ZZCA 4X4EA 2LYSA 1LLIA 2BNOA 4PU4C 1CJGA 4FN3A 2CSFA 2LYLA 1HF0A 1Y7YA 4YG1A 3OQMA 3G7DA 4X4FA 3KXAA 1ADRA 2EBYA 4Y42A 4X4DA 5A7LA 2XJ3A 1POUA 1PRVA 4I6RA 2JVLA 3FYMA 1ZPQA 3EUSA 4J1XA 4X4CA 1OCTC 4JQDA 1QP0A 2BNNA 4GHJA 1LMB3 4F8DA 2HSGA 3SCFA 1PNRA 1RPEL 1Y9QA 4OB4A 1PERL 2IV1A 2AXUA 2WUSR 3SCHA 1NEQA 3MLFA 1ZZ7A 3QQ6A 3H5TA 1ZVVA 2PE5A 3OMTA 4X4BA 2AUWA 2BNMA 1ZZ8A 2ICPA 1WH8A 2XCJA 2B5AA 1RIOA 1WH6A 3ZKCA 2LYRA 1GT0C 1JH9A 1BDHA 1QP4A 1ZS4A 3CECA 2L8NA 1E3OC 1IC8A 2PPXA 1DW9A 3QF3A 2PUGA 3HZIB 2R63A 2A6CA 2GRLA 1AU7A 4X4GA 4X4HA 3BDNA 1NERA 2R1JL 1JFSA 2KPJA 3LFPA 3ZHIA 4Z5DA 2PUFA 3JXDL 4O8BA 2PUDA 1R63A 1WIZA 3BS3A 2AXVA 4MCTA 2IU7A 2PUEA 2KEJA 4IWRA 3G5GA 3VK0A 4YARA 3JXBC 4PU8A 2OFYA 1YSEA 2PIJA 3TRBA 1JFTA 4J1WA 3PXPA 1QQAA 1RZRA 4YG4A 2MQKA 3O9XA 2CROA 3OQNA 3OQOA 2O49A 2LYKA 3OP9A 2EWTA 3SCGA 1EFAA 3KJXA 4YG7B 1PRAA 3U3WA 1SQ8A 3JXCL 1S7EA 2AW6A 1O4XA 2KEIA 2O38A 2O4AA 2IVBA 3CROL 1LQCA 2OR1L 4PU7A 2L49A 1CQTA 4YBAA 2KEKA 2H8RA 1QPZA 3F52A 3QWGA 4IVZA 3QYXA 1DWKA 1XWRA 2GZUA 1X57A 3RZZA 1LCDA 2LCVA 1VPWA 4I6TA 1X2LA 3S8QA 1JWLA 2EF8A 1RZSA 4GQMA 3UFDA 4NDWA 5K98B 4MCXA 3D1NI 2D5VA 1UXCA 1B0NA 3DNVB 1QP7A 2PUAA 4FBIA 4I6UA 2PUCA 1ZAYA 4PU3C 4JCYA 2PUBA 1LCCA 2MEZA 4Z58A 4Z5HA 1WETA 4X4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYQ A;  1R69 A;  1L1M A;  2JCG A;  4IA8 A;  3ZHM A;  1ZZB A;  4Z5C A;  1ZUG A;  2ICT A;  3KZ3 A;  1UXD A;  2WIU B;  2XI8 A;  3BD1 A;  3B7H A;  1RZR D;  2AWI A;  3FYA A;  3F6W A;  3IVP A;  3R1F A;  3CLC A;  3GN5 B;  3F51 A;  4I8T A;  2IUO A;  3FMY A;  2AXZ A;  3GBF A;  1UTX A;  1ZZ6 A;  2LYJ A;  1OSL A;  2IVG A;  1ZZ9 A;  2KZ8 A;  2FJR A;  2HIN A;  2GRM A;  2BJC A;  1PRU A;  2IVQ A;  2XSD C;  1BDI A;  2LYP A;  2XIU A;  1QQB A;  4JCX A;  3LIS A;  3GN5 A;  3L1P A;  4Z59 A;  1ZZC A;  4X4E A;  2LYS A;  1LLI A;  2BNO A;  4PU4 C;  1CJG A;  4FN3 A;  2CSF A;  2LYL A;  1HF0 A;  1Y7Y A;  4YG1 A;  3OQM A;  3G7D A;  4X4F A;  3KXA A;  1ADR A;  2EBY A;  4Y42 A;  4X4D A;  5A7L A;  2XJ3 A;  1POU A;  1PRV A;  4I6R A;  2JVL A;  3FYM A;  1ZPQ A;  3EUS A;  4J1X A;  4X4C A;  1OCT C;  4JQD A;  1QP0 A;  2BNN A;  4GHJ A;  1LMB 3;  4F8D A;  2HSG A;  3SCF A;  1PNR A;  1RPE L;  1Y9Q A;  4OB4 A;  1PER L;  2IV1 A;  2AXU A;  2WUS R;  3SCH A;  1NEQ A;  3MLF A;  1ZZ7 A;  3QQ6 A;  3H5T A;  1ZVV A;  2PE5 A;  3OMT A;  4X4B A;  2AUW A;  2BNM A;  1ZZ8 A;  2ICP A;  1WH8 A;  2XCJ A;  2B5A A;  1RIO A;  1WH6 A;  3ZKC A;  2LYR A;  1GT0 C;  1JH9 A;  1BDH A;  1QP4 A;  1ZS4 A;  3CEC A;  2L8N A;  1E3O C;  1IC8 A;  2PPX A;  1DW9 A;  3QF3 A;  2PUG A;  3HZI B;  2R63 A;  2A6C A;  2GRL A;  1AU7 A;  4X4G A;  4X4H A;  3BDN A;  1NER A;  2R1J L;  1JFS A;  2KPJ A;  3LFP A;  3ZHI A;  4Z5D A;  2PUF A;  3JXD L;  4O8B A;  2PUD A;  1R63 A;  1WIZ A;  3BS3 A;  2AXV A;  4MCT A;  2IU7 A;  2PUE A;  2KEJ A;  4IWR A;  3G5G A;  3VK0 A;  4YAR A;  3JXB C;  4PU8 A;  2OFY A;  1YSE A;  2PIJ A;  3TRB A;  1JFT A;  4J1W A;  3PXP A;  1QQA A;  1RZR A;  4YG4 A;  2MQK A;  3O9X A;  2CRO A;  3OQN A;  3OQO A;  2O49 A;  2LYK A;  3OP9 A;  2EWT A;  3SCG A;  1EFA A;  3KJX A;  4YG7 B;  1PRA A;  3U3W A;  1SQ8 A;  3JXC L;  1S7E A;  2AW6 A;  1O4X A;  2KEI A;  2O38 A;  2O4A A;  2IVB A;  3CRO L;  1LQC A;  2OR1 L;  4PU7 A;  2L49 A;  1CQT A;  4YBA A;  2KEK A;  2H8R A;  1QPZ A;  3F52 A;  3QWG A;  4IVZ A;  3QYX A;  1DWK A;  1XWR A;  2GZU A;  1X57 A;  3RZZ A;  1LCD A;  2LCV A;  1VPW A;  4I6T A;  1X2L A;  3S8Q A;  1JWL A;  2EF8 A;  1RZS A;  4GQM A;  3UFD A;  4NDW A;  5K98 B;  4MCX A;  3D1N I;  2D5V A;  1UXC A;  1B0N A;  3DNV B;  1QP7 A;  2PUA A;  4FBI A;  4I6U A;  2PUC A;  1ZAY A;  4PU3 C;  4JCY A;  2PUB A;  1LCC A;  2MEZ A;  4Z58 A;  4Z5H A;  1WET A;  4X4I A; 
#chains in the Genus database with same CATH topology
 1R69 A;  1L1M A;  2PXL A;  3A9Y A;  2PXU A;  1ZUG A;  1UXD A;  3B7H A;  1RZR D;  3F6W A;  2ODR D;  2IUO A;  1ZZ9 A;  2HIN A;  3NRO A;  1BDI A;  3GUU A;  4EZI A;  2LLV A;  2LYS A;  3QFI A;  2CSF A;  1HF0 A;  4ER6 A;  2XJ3 A;  1PRV A;  3QOW A;  4I6R A;  4EK9 A;  4JQD A;  1ZPQ A;  3EUS A;  3GZD A;  3NZL A;  3SCF A;  1RPE L;  3M9L A;  3KL4 A;  3SCH A;  1QZX A;  1NEQ A;  2JQE A;  1ZVV A;  2XCJ A;  2VEO A;  1JH9 A;  1BDH A;  1QP4 A;  1DW9 A;  2R63 A;  5DRY A;  4X4H A;  3TFL A;  2KPJ A;  3ZHI A;  4Z5D A;  2PUF A;  2PXD A;  3VK0 A;  4PU8 A;  4J1W A;  3A9X A;  4YG4 A;  3OQN A;  2O49 A;  3OP9 A;  3KJX A;  1PRA A;  3U3W A;  1SQ8 A;  2AW6 A;  3CRO L;  1CQT A;  2KEK A;  3S8Q A;  4NDW A;  2D5V A;  2PUC A;  4PU3 C;  4JCY A;  2PUB A;  2PXP A;  3ZPX A;  2V3C C;  4Z5C A;  2XXP A;  1DUL A;  3IVP A;  2L1P A;  1ZZ6 A;  2LYJ A;  2BJC A;  2IVQ A;  2XSD C;  2LYP A;  2XIU A;  3LIS A;  4EKG A;  1CJG A;  2LLW A;  3A9Z A;  3SX0 A;  3G7D A;  4ER7 A;  4X4D A;  5A7L A;  2HCN A;  2JVL A;  3FYM A;  1OCT C;  2BNN A;  4GHJ A;  4OB4 A;  2PXQ A;  1ZZ7 A;  3OWQ A;  3QQ6 A;  4OBM A;  1ZZ8 A;  1WH6 A;  2PXV A;  5GAG i;  1ZS4 A;  3CEC A;  4DE8 A;  2L8N A;  1E3O C;  2PPX A;  3QF3 A;  5DTM A;  1AU7 A;  4X4G A;  1NER A;  3LFP A;  3UWP A;  2AXV A;  4MCT A;  4IWR A;  4YAR A;  1YSE A;  2PIJ A;  3TRB A;  3O9X A;  4YG7 B;  3JXC L;  1S7E A;  2KEI A;  2IVB A;  1LQC A;  3F52 A;  3QWG A;  4IVZ A;  1DWK A;  2GZU A;  1VPW A;  1JWL A;  1X2L A;  2EF8 A;  3UFD A;  3D1N I;  1UXC A;  4FBI A;  1ZAY A;  1LCC A;  2YBD A;  2MEZ A;  4Z5H A;  1WET A;  3ZHM A;  3NDB B;  2ICT A;  2WIU B;  2XI8 A;  2AWI A;  3CLC A;  3GN5 B;  3F51 A;  2MXD A;  3FMY A;  2AXZ A;  3GBF A;  1UTX A;  5JUW A;  3MEJ A;  2KZ8 A;  3PE5 A;  1QQB A;  3VWS A;  4JCX A;  2M4H A;  3L1P A;  1ZZC A;  5DT2 A;  4X4E A;  4FN3 A;  1Y7Y A;  3OQM A;  2PXF A;  3KXA A;  1ADR A;  2EBY A;  4Y42 A;  5GAH i;  1QB2 A;  4J1X A;  5DTR A;  3DM5 A;  2HSG A;  1PER L;  2AXU A;  2WUS R;  1U2Z A;  4X4B A;  2AUW A;  1RIO A;  2ICP A;  1WH8 A;  5DRT A;  2B5A A;  2LYR A;  2PUG A;  3HZI B;  2GRL A;  3BDN A;  3JXD L;  2PUD A;  1R63 A;  3BS3 A;  2IU7 A;  3G5G A;  2FFH A;  3JXB C;  1JFT A;  3PXP A;  1NW3 A;  1QQA A;  3R09 A;  2J7U A;  2LYK A;  3QOX A;  2EWT A;  3SCG A;  1EFA A;  4ER5 A;  3TEL A;  2O4A A;  2OR1 L;  4ER3 A;  3LQX A;  1X57 A;  1LCD A;  2LCV A;  4WVL A;  4I6T A;  1RZS A;  4GQM A;  4DE9 A;  4MCX A;  2PUA A;  2XXA A;  2LYQ A;  2JCG A;  4IA8 A;  1ZZB A;  3KZ3 A;  4Q2J A;  2PXT A;  3BD1 A;  3FYA A;  3R1F A;  2HCS A;  4EQZ A;  2LNM A;  4I8T A;  1OSL A;  2IVG A;  2FJR A;  2GRM A;  1PRU A;  3GN5 A;  4Z59 A;  1LLI A;  2BNO A;  4PU4 C;  2LYL A;  4YG1 A;  4X4F A;  3GZD C;  1POU A;  4X4C A;  1QP0 A;  1LMB 3;  4F8D A;  1PNR A;  1Y9Q A;  2IV1 A;  5DSX A;  3MLF A;  2PXB A;  3H5T A;  3NXH A;  2PE5 A;  3OMT A;  2BNM A;  5DTQ A;  3ZKC A;  1GT0 C;  2J7W A;  1IC8 A;  1HQ1 A;  3GZC A;  1MFQ C;  2A6C A;  3TEP A;  2R1J L;  1JFS A;  4O8B A;  1WIZ A;  2PUE A;  2KEJ A;  2OFY A;  1RZR A;  2MQK A;  3OQO A;  2CRO A;  2HFZ A;  3ME5 A;  1O4X A;  2O38 A;  4ER0 A;  3SR4 A;  3G0T A;  4PU7 A;  2L49 A;  2PXE A;  4YBA A;  2H8R A;  1QPZ A;  2XXQ A;  3QYX A;  1XWR A;  3RZZ A;  3OKZ A;  5K98 B;  1B0N A;  3DNV B;  1QP7 A;  4I6U A;  4Z58 A;  2PXK A;  4EKI A;  4HRA A;  4X4I A; 
#chains in the Genus database with same CATH homology
 2LYQ A;  1R69 A;  1L1M A;  2JCG A;  4IA8 A;  3ZHM A;  1ZZB A;  4Z5C A;  1ZUG A;  2ICT A;  3KZ3 A;  1UXD A;  2WIU B;  2XI8 A;  3BD1 A;  3B7H A;  1RZR D;  2AWI A;  3FYA A;  3F6W A;  3IVP A;  3R1F A;  3CLC A;  3GN5 B;  3F51 A;  4I8T A;  2IUO A;  3FMY A;  2AXZ A;  3GBF A;  1UTX A;  1ZZ6 A;  2LYJ A;  1OSL A;  2IVG A;  1ZZ9 A;  2KZ8 A;  2FJR A;  2HIN A;  2GRM A;  2BJC A;  1PRU A;  2IVQ A;  2XSD C;  1BDI A;  2LYP A;  2XIU A;  1QQB A;  4JCX A;  3LIS A;  3GN5 A;  3L1P A;  4Z59 A;  1ZZC A;  4X4E A;  2LYS A;  1LLI A;  2BNO A;  4PU4 C;  1CJG A;  4FN3 A;  2CSF A;  2LYL A;  1HF0 A;  1Y7Y A;  4YG1 A;  3OQM A;  3G7D A;  4X4F A;  3KXA A;  1ADR A;  2EBY A;  4Y42 A;  4X4D A;  5A7L A;  2XJ3 A;  1POU A;  1PRV A;  4I6R A;  2JVL A;  3FYM A;  1ZPQ A;  3EUS A;  4J1X A;  4X4C A;  1OCT C;  4JQD A;  1QP0 A;  2BNN A;  4GHJ A;  1LMB 3;  4F8D A;  2HSG A;  3SCF A;  1PNR A;  1RPE L;  1Y9Q A;  4OB4 A;  1PER L;  2IV1 A;  2AXU A;  2WUS R;  3SCH A;  1NEQ A;  3MLF A;  1ZZ7 A;  3QQ6 A;  3H5T A;  1ZVV A;  2PE5 A;  3OMT A;  4X4B A;  2AUW A;  2BNM A;  1ZZ8 A;  2ICP A;  1WH8 A;  2XCJ A;  2B5A A;  1RIO A;  1WH6 A;  3ZKC A;  2LYR A;  1GT0 C;  1JH9 A;  1BDH A;  1QP4 A;  1ZS4 A;  3CEC A;  2L8N A;  1E3O C;  1IC8 A;  2PPX A;  1DW9 A;  3QF3 A;  2PUG A;  3HZI B;  2R63 A;  2A6C A;  2GRL A;  1AU7 A;  4X4G A;  4X4H A;  3BDN A;  1NER A;  2R1J L;  1JFS A;  2KPJ A;  3LFP A;  3ZHI A;  4Z5D A;  2PUF A;  3JXD L;  4O8B A;  2PUD A;  1R63 A;  1WIZ A;  3BS3 A;  2AXV A;  4MCT A;  2IU7 A;  2PUE A;  2KEJ A;  4IWR A;  3G5G A;  3VK0 A;  4YAR A;  3JXB C;  4PU8 A;  2OFY A;  1YSE A;  2PIJ A;  3TRB A;  1JFT A;  4J1W A;  3PXP A;  1QQA A;  1RZR A;  4YG4 A;  2MQK A;  3O9X A;  2CRO A;  3OQN A;  3OQO A;  2O49 A;  2LYK A;  3OP9 A;  2EWT A;  3SCG A;  1EFA A;  3KJX A;  4YG7 B;  1PRA A;  3U3W A;  1SQ8 A;  3JXC L;  1S7E A;  2AW6 A;  1O4X A;  2KEI A;  2O38 A;  2O4A A;  2IVB A;  3CRO L;  1LQC A;  2OR1 L;  4PU7 A;  2L49 A;  1CQT A;  4YBA A;  2KEK A;  2H8R A;  1QPZ A;  3F52 A;  3QWG A;  4IVZ A;  3QYX A;  1DWK A;  1XWR A;  2GZU A;  1X57 A;  3RZZ A;  1LCD A;  2LCV A;  1VPW A;  4I6T A;  1X2L A;  3S8Q A;  1JWL A;  2EF8 A;  1RZS A;  4GQM A;  3UFD A;  4NDW A;  5K98 B;  4MCX A;  3D1N I;  2D5V A;  1UXC A;  1B0N A;  3DNV B;  1QP7 A;  2PUA A;  4FBI A;  4I6U A;  2PUC A;  1ZAY A;  4PU3 C;  4JCY A;  2PUB A;  1LCC A;  2MEZ A;  4Z58 A;  4Z5H A;  1WET A;  4X4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...