2L9BA

Heterodimer between rna14p monkeytail domain and rna15p hinge domain of the yeast cf ia complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
ANFLSQKFPELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQEWTRAHPEDAASLLELCPQLSFVTAELLLTNGICKVDDLIPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Locked Tether Formation by Cooperative Folding of Rna14p Monkeytail and Rna15p Hinge Domains in the Yeast CF IA Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords mRNA 3'-end-processing protein RNA15
total genus 30
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.630 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l9bA00
4EBAG 2L9BA
chains in the Genus database with same CATH superfamily
2KC7A 1OUVA 1YCSB 5JJ6A 5FQ4A 4RSYA 2FI7A 3CKBA 3FTYA 2AW6A 2WM9A 3FTXA 1KPSB 4G25A 4OAVB 2XCCA 2IY0C 5E76A 3SHFA 3QAQA 1X5BA 3ZYQA 4AVXA 1D9SA 4G8LA 3B7RL 1TYQG 5EKQD 4JHRA 3UKUG 5JJ7A 3R9MA 4NURA 3S7FA 5B1AE 4DPRA 4F6RD 2F37A 2PZIA 1SZ9A 4KXKB 1OWOA 3FUMA 2P9SG 3PNTB 1QQEA 4GZ3A 3AAAC 3FH8A 3CVUA 1H0AA 1IQUA 3EJNA 1HX8A 3V30A 3C3QA 4GYYA 3ONLA 4DX5D 1D8EA 2L0IA 1N4SA 3ULEG 2J4BA 1H6KA 2WXGA 4I1MA 3OAWA 3TG5A 1IXVA 3C3RA 3AU4A 5AQ7A 4GZ5A 1LTXA 3UQ3A 3FUJA 3B95A 4JD2G 2LUHA 4XE0A 4LSZE 4J6IA 4L2YA 4U8YD 4GZCA 4HS2A 1N95A 3LCAA 4DLQA 3ZIMA 2VTBA 3CVLA 4A3TA 2XEEA 3D9KA 3IKOB 4HOTA 2P2CP 2LNIA 3I4GA 1BD8A 4HI9A 3E4BA 4H7XA 2Q7FA 1MX4A 3OTNA 4KYOB 2GRMA 2DZOA 5EILA 1UW4B 4EHMA 3E32A 3LJNA 3MV3B 2CFZA 4A3VA 3GYZA 3N71A 4HOQA 2YQ8A 4APFA 3HIZA 3Q4AB 2A5UA 1FT1A 5CRUA 4ANWA 3DSUA 4I2WA 3QJZA 4BSZB 4CEMA 4HLLA 2LO6A 4AM9A 3ML8A 3SY2A 5ENRD 5ENTD 2J09A 3ZW3A 3MJWA 3HXFA 3GZ2A 2OEWA 4IRUA 4YVQC 1U2VG 2QY7A 4L2LA 5AN8A 1NA0A 3EUVA 1H19A 3PZDA 3SQVA 4NACA 2F8XK 3LJ3A 3CSTA 1KT1A 2KZTA 2J9QA 2UY1A 5FZRA 3ZXPA 1AP7A 3V31A 4Q69A 4GCOA 3RAUA 4DI3A 4CDRA 2XZDG 3EHMA 2AVPA 1HE8A 4ABNA 5CMWA 3L22A 3CIAA 5AQ9A 3V79K 2AJAA 3RJVA 3DPDA 5ANRA 3EHNA 2RKKA 3L16A 3PUKA 3R9AB 4K5BA 5KCMA 3IEGA 2IONA 5AJDA 1N4RA 4LNUD 3CHMA 2OOEA 2WVIA 3CR3A 3SO8A 2BKKB 5AJLA 5KWDA 4QQIA 4RQIA 4B89A 2OCCE 4TXQA 4WAFA 3ZYKA 2VGXB 1WG0A 2LSUA 4LUNU 3CLJA 1S0PA 2J07A 2QC9A 3JCKC 4W9RA 3FTWA 3ZU7B 4AV7A 4EZLA 4GMLA 3AU5A 3ZXSA 3CHSA 2KATA 4N5CA 3E37A 1LD7A 3RIBA 2NSZA 3QOUA 3NF1A 1A5EA 5FJYA 1OXJA 4DX6D 5G05J 2R03A 3PH0C 5FZQA 4PS7A 4XX5A 2AXZA 4HQDA 5T4YA 4XEIG 3ZNGA 5T3RA 3HXCA 4N3BA 3ULYA 2WQ7A 3LS8A 4NQ0A 3AG1E 2ILRA 1V55E 4MKTA 5ENOD 4KZCA 4DUIA 4U95D 4CT4A 1H2UA 4HRMB 2OEVA 4G8KA 3JQ0A 3CK8A 3KEZA 1KZOA 3FUIA 2VSYA 2E2EA 2XGOA 3D9PA 4CT0A 5FZSA 3SBTB 4GTSA 1TJCA 3LKUA 3NZUA 3LY8A 3FU6A 2ZISA 3RRMB 3FTSA 1JCRA 4I17A 3D9MA 4JVSA 4FC8A 3CVXA 3UUXA 4AP2A 4HOSA 5D2MC 1FVFA 1EPUA 4M7CA 4CRWA 3VLEA 3VLDA 3V2XA 4LG6A 3MKQA 3DSVA 1KZPA 3TWQA 3ESKA 5KJMA 4GTVA 5FQ6A 1BPOA 1BI7B 3ONKA 1OWNA 4B94A 1NL4A 1JWFA 2ZXWE 3IBEA 4Y6WA 2BTDA 4ANUA 3UM0A 1OT8A 2X6JA 2BUGA 1TNZA 3PNLB 4J8FA 1G3NB 1HS6A 4EBAA 2FULA 4CGVA 4KBQA 3VTYA 3Q73A 3CEQA 3JXIA 4OAUC 3UPVA 3MX3A 2UWJG 3AG4E 4XIFA 3FH5A 5FQ7A 4F53A 5B1BE 3ZGQA 1HG5A 3DXKG 4WNDA 2XGSA 4UQZA 1UJJA 1MJ0A 1B89A 4GCNA 3PZ4A 1H6PA 3QARA 2WXLA 1ELKA 5ENNA 1ZU2A 3W9FA 3LY9A 3TXMA 3I3NA 3OXGA 3ZPJA 3CKCA 3DWLG 1JCSA 3WXXA 2IQCA 1UN8A 4J8SA 2P9NG 2J4DA 3TWTA 5EDSA 1O1TA 2EIME 3TWXA 4MBGA 1MYOA 3UI2A 5C1DA 4FHKA 4ACKA 1IHGA 1OWPA 3WG7E 1KT0A 3PE3A 2WXKA 5BV1A 4N3AA 5KNGA 2WPVA 3CVQA 4GTTA 5HRYA 3Q5MA 4GTPA 3U64A 2V8SE 2YINA 2PNNA 3E33A 2P9KG 2NYJA 3FUHA 5T8IA 3D9NA 1WY6A 2B0OE 2LAIA 3HRAA 3UX4A 1DCQA 4LCTA 3HHMA 2GRLA 5JJTA 2P9LG 4G23A 1N94A 2CG2A 1EYHA 3PS6A 3AG2E 4Q94A 3TWRA 4FA6A 1HU3A 2UY1B 2V5FA 4I6JA 3QWWA 5BT1A 3NBNB 2ZGDA 3T8KA 4EBAG 3R7QA 4GU5A 3JXJA 3EIQC 4K0RA 1HO8A 2F8YA 4PS8A 3B7SA 2I6HA 3CHRA 4XZ4A 3L82A 4CGWA 2XS1A 3HG0D 5JA4D 3JUEA 3L9TA 4C0MA 1SVXA 3BG1B 1BU9A 2YHCA 2HR2A 2C2LA 2V4LA 3Q47B 3UT8A 1RW2A 2Y1LE 4BX9A 5B3SE 3Q79A 2WMOA 4NRHB 3D9HA 3ASDA 2NC9A 3BU8A 2V4HC 2L9BA 1N0RA 5LCWJ 2WXNA 3LYAA 5G04C 3PZ3A 1Z3YA 3Q7AA 4I6EA 4O6FA 3CVVA 3MCXA 1N54A 4GTRA 4JXTA 1OCOE 2Y4TA 2QZAA 5CMYA 2GW1A 2WQHA 4JL0A 2DIWA 5ARFA 5KNHD 3UM2A 1PC2A 3HVEA 3L6AA 1TNYA 2WXRA 5BPPA 2XCBA 3RO3A 3JQ1A 2WMNA 3DEPA 3SI5A 2EIKE 2XPYA 4L1BA 3ZVVA 5BV0A 2DZNA 3U66A 3QB2A 2IEJA 3E30A 3G2WA 5CEDB 4CDMA 4IN3B 1V54E 5AIJA 2R02A 2HYZA 3TWUA 4X8QA 2XPIA 4L23A 3IV0A 4ILGA 3IHVA 3LDZA 3SZ7A 2XS8A 1ELRA 3MA5A 5ENQD 2EILE 5FTPA 4JHJA 1O1SA 1HH8A 5D0OD 2P9IG 3S7DA 4XKBA 1DVPA 3P1UA 1TN8A 4HNAD 1SW6A 4OVUA 3CHPA 4XI0A 4G2VA 5M72A 4FADA 3ASOE 2EIJE 4XI9A 4J7WA 2LAHA 2KBXA 1DCEA 3EIJA 4TV3A 5CCMA 3ZKJA 4HI8A 1MX2A 3ZFWA 4U04A 4HVBA 1BI8B 4EPZA 1U3DA 4PH4B 4TUUA 3FU0A 3T9KA 2MOWA 1QNFA 1NA3A 1PY1A 4TRQA 1FT2A 5LFAA 3G2VA 5KJNA 3CGHA 1WM5A 3B7TA 3MZLB 4UQYA 3PZ1A 1QBQA 5H7PA 5BXUA 3S7BA 3UM1A 4ANXA 3TAXA 3L54A 3HYMB 4I1OB 2XRYA 3T5VA 3NOGD 4N2QA 1W3BA 1NP7A 2X6KA 2R59A 3G2SA 1OCZE 4L7TA 4N2SA 1FCHA 4GYOA 4H7YA 2P58C 3VTXA 1E8WA 4R7LA 2VJ8A 3IHYA 4CZ2D 4G24A 1MQSA 4GMRA 4Q96A 4LNBA 2VYIA 5CBNA 3LVQE 4A63B 3U4TA 4URKA 3HXDA 4KT6B 2LXLA 3LVRE 2R17C 3DSTA 3I4RB 3UKRG 3ZEFA 4UWLA 1O1RA 3ZN3A 2DCPA 3FFLA 4V3IA 4FJYA 1H2VC 3T8MA 1K1AA 1DNPA 4HRLA 4NIKA 3FULA 3UTMA 2E0IA 3RU0A 3TG4A 3EHQA 4IYPA 3S7JA 2J49A 3RK6A 2GRNB 3D9IA 3C72A 5G05C 3CSFA 1N4PA 1NI1A 1TR4A 5G55A 3ASFA 4JA9A 1EDUA 1IHBA 2Y4UA 2IU1A 4YNDA 5JMND 2VSXE 4O60A 4GYWA 4GTMA 3KS2A 2LSVA 1TJFA 1TN6A 2HE0A 4FP7A 3CVPA 4KVOA 4GA0A 4ZHBA 1HFAA 4UI9J 2IOSA 4BFRA 1JPLA 4L9PA 1X81A 3DXMG 1FVHA 3URZA 4N3CA 2DBAA 1EF1C 4BESA 2Y3AA 3DBSA 5ENPD 3TWVA 2FO1E 1QZ2A 4GZ6A 4UWKA 4RG9A 1E7UA 4AY6A 4UWGA 5KJLA 4BWRA 1HXIA 3ULQA 1ELWA 4DLOA 5CEAA 2CHXA 4PS3A 1IKND 5KJKA 5JHBA 4JC8A 1K3ZD 3QKYA 2WXPA 1MZCA 2M63A 3EU9A 2F0YA 5EYLA 4EZJA 4FHJA 1D8DA 3SF4A 1S70B 4DRXE 3MGBA 1DC2A 4WNFA 3NAWA 3GZ1A 4HXIA 3ZYMA 3UMVA 2C0MA 2KCVA 3F6QA 4APOA 3NZSA 4G26A 2YHEA 4QFVA 4UWFA 1HG2A 4WNGA 4DJAA 4B93B 4A1GA 3CV0A 4ILIA 4I1AA 3KAEA 3NOCD 3OXFA 3ENEA 3SFYA 1OCRE 4RG6A 2MYOA 5D0QD 5FWQA 1TNUA 2V5QC 3PZ2A 4N5QA 4FU3A 4ATZD 1OCCE 3KSLA 3QWPA 4GMJA 4LEUA 4FLHA 1JWGA 4C9BB 1O5MA 2PQRA 3ABKE 4JEHA 2WXIA 4E6HA 3AJIA 2EQXA 5BW8C 3CHQA 2VGEA 3Q9UC 3UINC 3FTZA 5AQBA 2KM4A 4I9CA 4EZKA 4DI4A 5JHAA 4YDEA 1TNBA 3CQGB 5FQ8A 2R5SA 2GRPB 2QYJA 4AXHA 4U0SA 2H6HA 2P9UG 5A23A 1E8YA 4ATGA 4BTBA 2DYRE 1XNFA 4HFGA 5EYPF 5J90A 3FUEA 5IY5E 3APFA 3FUNA 3VLFA 1E96B 3Q15A 4JPSA 4AIFA 2XQ0A 4F1SA 2L0TB 4TXRA 3J5PA 3FEYA 1IYGA 2H6FA 4BETA 4B8CB 2H6IA 1H2TC 3MKRA 1Z5SC 4HOUA 4J8DA 4ZFHA 2WXOA 2AXVA 1E7VA 2RFMA 2XZTG 2KXPC 3ZHEB 1INZA 2PQNA 2R05A 1TNOA 3C98A 4RVBA 4D10C 3TL5A 1AWCB 4UWHA 2XEHA 4LERA 4DX2A 3PEVB 2A4ZA 3J5QB 3QDNA 2XEVA 4WNEA 2V0PA 2QYUA 3LPZA 2QFCA 2WXQA 4JW1A 4GPKA 1L5JA 1UOHA 3ISMC 2J8SD 4G1TA 2DYSE 4ILHB 4I9EA 3FEXA 1UG3A 5AAOA 2FEZA 5EN5D 3DSXA 2ZU6B 3Q9NC 2IJGX 3CVWA 2IOLA 4FULA 2GRQB 4YDWA 3CHOA 3FHEA 3I5PA 3T5XA 4Z68A 2VGXA 2AWIA 4G11A 1LF8A 2RG8A 3RKVA 3X2QE 5G04J 3U3WA 3CK7A 3NQPA 4XKCA 5EIDA 3P2BA 4ACLA 3PDNA 4MLPA 3GW4A 4WWOA 5EX0A 4AJWA 2I1JA 4P29A 2WB2A 5HQ8A 4F1PA 2JEKA 1LD8A 3EDTB 3C5RA 3L13A 3SFXA 3HXBA 4I2ZA 1ZBPA 3SFZA 4KVMA 3PEUB 5BNWA 1N9AA 3SD5A 5AARA 3FP3A 3NB2A 4B8AA 2C0LA 5AENA 3D3MA 1H6OA 4U7EB 4BEPA 2BF0X 3ZRHA 1K8KG 4MS6A 3LY7A 3AS8A 1PAQA 3PRZA 4AY5A 3FU3A 3UIPC 4CCAA 4U8HA 1Z3XA 2BKGA 4BTAA 3QNKA 2PL2A 5FIOA 2MRIA 1NFIE 4GZDA 3K9IA 2OV8A 3L17A 4KZ0A 3G2UA 3LEWA 4TUMA 3AS4A 2ZIRA 3JUIA 2BEDA 3MKQB 3SGHA 3PUJA 2XHEA 3SNXA 4F7AA 4JHKA 2X6FA 3JYSA 3MEKA 3BQOA 3B7BA 4E85A 5CERB 2R2LA 3RRUA 1BLXB 1JUQA 4KMOA 3FY4A 2L6BA 3C3OA 2EINE 2HO1A 4GB9A 3B7UX 3DSWA 4HORA 1MHQA 3MYVA 4A55A 1Y8MA 5HS0A 5LP0A 4YDOA 3EU5A 3UT4A 5D66A 2RD0A 4O1OA 2WXHA 1HF8A 3UM3A 1N4QA 4GA2A 4IULA 5C2YA 4HB5A 2ONDA 3DEOA 1QYMA 4I43A 4MRUA 2XRZA 3BUAA 3APCA 4U0UA 1OWMA 3HVEB 1KLXA 3D9JA 3OXLA 3FU5A 3R7RA 4FLBA 4OVVA 3W9GA 3EHRA 4EECA 3RRNB 2Y69E 3FDHA 4GTQA 4CDNA 4BT8A 5CECB 4HLEA 3Q49B 3V2OA 1K1BA 4JZYA 2DWZA 4DK5A 1YA0A 1RZ4A 5BXOA 4JA7A 2L6JA 2OVBA 3AG3E 4YVOA 1YYHA 5CBOA 4J8YA 2KZTB 1E90A 5ITZF 1HZ4A 4OYSA 3RO2A 2ETCA 2VSNA 2H6GA 2FO7A 3G2TA 5HI7A 4AOFA 2Y0BG 3ZUVB 1WAO1 1SQMA 4M3OA 4DX1A 1E8XA 3ASGA 2CG3A 4A1SA 4GPMA 2VGYA 2IF4A 3QC1A 1S64A 3LXUX 3DPYA 3Q75A 5J08A 3SBSA 1MX6A 1E8ZA 4UQXA 1SA4A 4U63A 3TJPA 3UXGA 3RSEG 2X6HA 1JCQA 2A5EA 3QWVA 2WXMA 2DVWA 4I6GA 4GA1A 3FUFA 3TGOA 4JB8P 4RLYA 3FH7A 1TEZA 3D9OA 4WWPA 4LRZA 1SZAA 5DIZA 5EIBE 3DRAA 4J0UA 4WUYA 1P5QA 5A6CA 5CRVA 2GROB 2IO3C 2ETBA 5EX3A 4K03A 3UT7A 2IO2C 2KCLA 3PE4A 2AXUA 4GTOA 5BUZA 2VQ2A 5DBKA 2JLBA 3HDXA 4TXPA 4B0ZA 4YDYA 3Q78A 2RFAA 1YMPA 3U9WA 2VSOE 1FPPA 3APDA 1N0QA 2I9CA 3TXNA 3KD7A 4Y6CA 2X3MA 2X6IA 4LNGA 3CVNA 3ZHEA 4C0EA 4GAAA 3E34A 3FTUA 2CHWA 1TN7A 5CHEE 5AQAA 1GW6A 3QK0A 5ENSD 2I2OA 1IQRA 2X38A 3FWVA 3KEAA 4F3VA 4HBDA 3Q7FA 4U07A 2XPZA 4AEZC 3FUKA 1XGWA 4O1PA 3O4ZA 1UJKA 5KBAA 3GZSA 1SA5A 2ETAA 4K5AB 1ZB1A 1OWLA 1Q2ZA 3FTVA 2IFUA 4U0ZA 3KSQA 2HM8A 4ANVA 2YNQA 2OVFA 1UN9A 3ABLE 4HRNA 5FINA 4FJZA 5LX8A 1WDYA 3ESLA 3PVLA 2GRRB 2ZGGA 2I1KA 2NXPA 2P9PG 2B6CA 4UI9K 1S63A 4WWNA 4BY6A 3D9LA 4BSXA 4DX7D 3O48A 4BX8A 4J8EA 1N11A 1A17A 3MV2B 3ZYLA 2CFUA 4PUCA 4CYMD 3IXEA 2XENA 2LXMA 2VTBB 5LCWC 5E75A 2FBNA 3HXEA 3AS5A 1NZNA 3FUDA 1N52A 5G2NA 1OY3D 5HKPA 3UIOC 5FT9A 2WQ6A 3B13A 5CCLA 3PREA 3BEEA 2CHZA 2GGFA 3CQCB 4EQFA 5A7DB 4UI9C 3ASHA 5AYWD 3CK9A 5LOZA 4JEUA 2JABA 2XGMA 3BG0B 4K5CA 3CVYA 4BERA 4N39A 3ML9A 4ME2A 4U96D 5ARGA 2FF4A 1VDYA 3L08A 3TWSA 1Z6TA 2WXJA 2MHKA 4UUCA 1Y6IA 3ABME 4BT9A 1U3CA 5ANLA 4C48B 3DSSA 3S2AA 3TWWA 3ASNE 2KCKA 2J08A 2WXFA 2PM7A 2PM6A 4PDXA 4U8VD
chains in the Genus database with same CATH topology
2KC7A 3UT4A 1OUVA 5JJ6A 5FQ4A 4RSYA 1FVHA 1ELKA 3URZA 3LY9A 3TXMA 3I3NA 3OXGA 4N3CA 2FI7A 3ZPJA 3CKCA 2DBAA 1EF1C 3CKBA 2Y3AA 2RD0A 3FTYA 2AW6A 3DBSA 2WM9A 3FTXA 2WXHA 1HF8A 4G25A 3WXXA 1QZ2A 2IQCA 4GA2A 1UN8A 2XCCA 4GZ6A 4IULA 5C2YA 4J8SA 2J4DA 4UWKA 5E76A 2ONDA 3SHFA 5EDSA 4RG9A 1E7UA 4AY6A 3QAQA 4UWGA 5KJLA 4BWRA 1X5BA 3ZYQA 4AVXA 5C1DA 4FHKA 3B7RL 1HXIA 5EKQD 4JHRA 4ACKA 4I43A 5JJ7A 3ULQA 1ELWA 4MRUA 4DLOA 1IHGA 1OWPA 2XRZA 4NURA 1KT0A 3PE3A 3APCA 3S7FA 4DPRA 2CHXA 2WXKA 2PZIA 1SZ9A 4U0UA 4KXKB 4N3AA 4PS3A 1OWOA 3FUMA 5BV1A 3PNTB 5KJKA 2WPVA 1OWMA 5JHBA 3CVQA 3HVEB 1KLXA 3D9JA 3OXLA 1QQEA 4GZ3A 3FH8A 4JC8A 3FU5A 3Q5MA 3QKYA 3CVUA 1H0AA 2WXPA 1IQUA 3EJNA 1HX8A 2M63A 3U64A 2V8SE 2YINA 3R7RA 4GYYA 4EZJA 4FHJA 4FLBA 3ONLA 3SF4A 3FUHA 5ENNA 5T8IA 3D9NA 1WY6A 4OVVA 3MGBA 2LAIA 4WNFA 4EECA 2L0IA 3GZ1A 3UX4A 3RRNB 4HXIA 3ZYMA 3FDHA 3UMVA 2J4BA 1H6KA 2WXGA 4I1MA 3OAWA 3TG5A 4CDNA 2C0MA 2KCVA 4LCTA 4BT8A 4HLEA 3HHMA 2GRLA 3AU4A 5JJTA 4GZ5A 3Q49B 4APOA 4G23A 3UQ3A 3FUJA 3NZSA 4JZYA 4G26A 2CG2A 4DK5A 1YA0A 2YHEA 4QFVA 1EYHA 1HG2A 4UWFA 4WNGA 4XE0A 4JA7A 3PS6A 4J6IA 4L2YA 4DJAA 4GZCA 2L6JA 4A1GA 3CV0A 4HS2A 4Q94A 2OVBA 4ILIA 4I1AA 3KAEA 1HU3A 4FA6A 3LCAA 4YVOA 4DLQA 2UY1B 2V5FA 3ZIMA 3OXFA 4I6JA 3QWWA 5BT1A 2KZTB 3ENEA 2VTBA 3CVLA 1E90A 4RG6A 4A3TA 3D9KA 3IKOB 4EBAG 5D0QD 1HZ4A 3R7QA 5FWQA 2LNIA 4GU5A 4HOTA 4OYSA 3RO2A 3I4GA 3EIQC 4K0RA 1HO8A 4FU3A 2VSNA 3G2TA 2FO7A 4PS8A 3E4BA 4H7XA 2Q7FA 3QWPA 5HI7A 4AOFA 3B7SA 2I6HA 3CHRA 4XZ4A 3OTNA 4KYOB 2GRMA 4GMJA 4LEUA 4FLHA 4CGWA 1JWGA 1WAO1 4C9BB 2PQRA 1UW4B 1SQMA 2WXIA 4JEHA 4M3OA 4C0MA 4E6HA 2EQXA 3MV3B 2CFZA 4A3VA 1E8XA 3GYZA 5BW8C 3CHQA 3BG1B 3N71A 2YHCA 3ASGA 2CG3A 4HOQA 2YQ8A 4A1SA 4APFA 2HR2A 2VGYA 3FTZA 2C2LA 2IF4A 2V4LA 2KM4A 3HIZA 3Q47B 3Q4AB 3QC1A 4I9CA 3UT8A 2A5UA 3LXUX 4BX9A 4EZKA 5J08A 4ANWA 2WMOA 3SBSA 4DI4A 4I2WA 5JHAA 4NRHB 3CQGB 1E8ZA 3ASDA 3QJZA 5FQ8A 2R5SA 4UQXA 3TJPA 4U63A 2NC9A 4AXHA 4CEMA 2X6HA 4U0SA 3QWVA 2LO6A 2WXMA 4AM9A 3ML8A 5A23A 4I6GA 1E8YA 4GA1A 4ATGA 2J09A 3ZW3A 4BTBA 3MJWA 3FUFA 3GZ2A 3TGOA 4IRUA 2L9BA 4YVQC 5LCWJ 3FH7A 1TEZA 1XNFA 3D9OA 4WWPA 2WXNA 2QY7A 3LYAA 4HFGA 4L2LA 5G04C 4LRZA 1SZAA 5J90A 1Z3YA 3FUEA 4I6EA 4O6FA 5DIZA 1NA0A 3CVVA 4J0UA 4WUYA 1P5QA 5A6CA 3MCXA 1N54A 3APFA 3FUNA 1H19A 4JXTA 3PZDA 3VLFA 4NACA 1E96B 2Y4TA 3Q15A 4JPSA 4AIFA 5CMYA 2GW1A 5EX3A 3LJ3A 2WQHA 4JL0A 2DIWA 2XQ0A 3CSTA 4K03A 1KT1A 2KZTA 5ARFA 3UT7A 2J9QA 4F1SA 1PC2A 3HVEA 3L6AA 2UY1A 2L0TB 5FZRA 3FEYA 2WXRA 5BPPA 2KCLA 4Q69A 3PE4A 4GCOA 2XCBA 4DI3A 4CDRA 1IYGA 3EHMA 2AVPA 4B8CB 3RO3A 1HE8A 3JQ1A 4ABNA 5CMWA 1H2TC 2AXUA 3L22A 2WMNA 3CIAA 5BUZA 3MKRA 2VQ2A 5DBKA 3SI5A 2XPYA 4L1BA 3ZVVA 2JLBA 3RJVA 5BV0A 3DPDA 3U66A 4HOUA 4J8DA 5ANRA 3EHNA 3HDXA 3QB2A 3L16A 3PUKA 2WXOA 3G2WA 2AXVA 1E7VA 3R9AB 4CDMA 4IN3B 4B0ZA 5KCMA 3ZHEB 1INZA 3IEGA 2PQNA 5AIJA 3C98A 2IONA 4RVBA 4D10C 5AJDA 3TL5A 3U9WA 4UWHA 2VSOE 2HYZA 3APDA 3CHMA 2OOEA 4LERA 3TXNA 2I9CA 3PEVB 3KD7A 4Y6CA 2WVIA 3CR3A 2A4ZA 2X3MA 2XPIA 2X6IA 3IV0A 4L23A 4ILGA 3QDNA 3CVNA 2XEVA 4WNEA 3ZHEA 4C0EA 3IHVA 4GAAA 2V0PA 3FTUA 2CHWA 3LPZA 5CHEE 5AJLA 2QFCA 2WXQA 3LDZA 3SZ7A 1GW6A 1ELRA 3QK0A 4JW1A 4B89A 3MA5A 2I2OA 4GPKA 1L5JA 1IQRA 2X38A 3FWVA 4G1TA 4ILHB 4WAFA 5FTPA 4I9EA 4F3VA 3FEXA 3ZYKA 1UG3A 4JHJA 2FEZA 2VGXB 2LSUA 1HH8A 4U07A 2XPZA 2ZU6B 3CLJA 1S0PA 4LUNU 5D0OD 2IJGX 2J07A 3JCKC 4AEZC 4W9RA 3CVWA 3FTWA 2IOLA 4FULA 3S7DA 4XKBA 3FUKA 1XGWA 4AV7A 4EZLA 4GMLA 3CHOA 1DVPA 3AU5A 3O4ZA 3ZXSA 3CHSA 3FHEA 3I5PA 3P1UA 2KATA 3T5XA 4N5CA 1UJKA 4OVUA 3CHPA 4XI0A 2VGXA 4G2VA 2AWIA 4G11A 5M72A 3GZSA 4FADA 1LF8A 4XI9A 3RIBA 2NSZA 2LAHA 3QOUA 2RG8A 3NF1A 3EIJA 1OWLA 4TV3A 5CCMA 3RKVA 3FTVA 5G04J 5FJYA 3CK7A 3U3WA 3NQPA 2IFUA 4U04A 4XKCA 3ZFWA 4U0ZA 4HVBA 2HM8A 1U3DA 5G05J 3P2BA 4EPZA 4PH4B 3PH0C 4TUUA 4ACLA 3PDNA 4MLPA 4ANVA 3GW4A 4WWOA 3FU0A 2YNQA 5FZQA 4PS7A 5EX0A 2MOWA 4XX5A 4AJWA 2AXZA 2OVFA 1QNFA 2I1JA 4P29A 5T4YA 1UN9A 2WB2A 5T3RA 5HQ8A 4N3BA 1NA3A 2WQ7A 3LS8A 4NQ0A 1PY1A 2JEKA 4TRQA 4FJZA 5LX8A 2ILRA 4MKTA 3ESLA 5LFAA 3EDTB 3G2VA 5KJNA 4KZCA 3CGHA 1WM5A 3B7TA 3MZLB 4UQYA 3PVLA 3L13A 4CT4A 1H2UA 4I2ZA 1ZBPA 3SFZA 3JQ0A 2I1KA 4KVMA 3PEUB 3S7BA 5BNWA 3CK8A 3KEZA 3FUIA 3SD5A 2NXPA 4ANXA 2VSYA 3TAXA 3L54A 2E2EA 2XGOA 3D9PA 4UI9K 3HYMB 4I1OB 2XRYA 3T5VA 4CT0A 5FZSA 3SBTB 3FP3A 4N2QA 1W3BA 1TJCA 1NP7A 2X6KA 4WWNA 3LKUA 2C0LA 4B8AA 3D3MA 5AENA 4BY6A 3D9LA 2R59A 3NZUA 3LY8A 2BF0X 3G2SA 3FU6A 3ZRHA 4BSXA 4L7TA 3O48A 4BX8A 1FCHA 4GYOA 4N2SA 3RRMB 4J8EA 3FTSA 4H7YA 4MS6A 2P58C 3LY7A 3AS8A 1PAQA 4I17A 1A17A 3MV2B 3D9MA 3VTXA 1E8WA 4R7LA 3PRZA 4FC8A 4JVSA 2VJ8A 3CVXA 4AY5A 3FU3A 3UUXA 3ZYLA 4AP2A 4CCAA 4U8HA 1Z3XA 2CFUA 4PUCA 4BTAA 4HOSA 3IHYA 3QNKA 1FVFA 2PL2A 1EPUA 2VTBB 5LCWC 5E75A 4G24A 1MQSA 2MRIA 4Q96A 4CRWA 3VLEA 3VLDA 2VYIA 2FBNA 3LVQE 3MKQA 4GZDA 3U4TA 3K9IA 4URKA 5KJMA 3ESKA 4KT6B 2OV8A 3LVRE 2R17C 1BPOA 3L17A 5FQ6A 3AS5A 3ONKA 1NZNA 1OWNA 3FUDA 4B94A 1N52A 3I4RB 4KZ0A 3G2UA 5G2NA 3ZEFA 3LEWA 4UWLA 1JWFA 3ZN3A 3IBEA 4Y6WA 3AS4A 2BTDA 3JUIA 2DCPA 3FFLA 4ANUA 4V3IA 5FT9A 3MKQB 4FJYA 2WQ6A 3SGHA 1H2VC 3B13A 2X6JA 3T8MA 5CCLA 3PREA 2BUGA 1DNPA 3BEEA 3PUJA 2CHZA 2GGFA 3CQCB 3FULA 3PNLB 4J8FA 3SNXA 2E0IA 3RU0A 1HS6A 4EBAA 4EQFA 4F7AA 4JHKA 5A7DB 4UI9C 3TG4A 2FULA 4CGVA 4IYPA 3ASHA 4KBQA 3VTYA 5AYWD 3CK9A 3S7JA 2J49A 5LOZA 3RK6A 4JEUA 2XGMA 2X6FA 3BG0B 3CEQA 3D9IA 3JYSA 3CVYA 5G05C 4N39A 3ML9A 3CSFA 4ME2A 3MEKA 3UPVA 3MX3A 5ARGA 2FF4A 2UWJG 1VDYA 3L08A 1Z6TA 4E85A 2WXJA 5G55A 4XIFA 3FH5A 2MHKA 5FQ7A 3ASFA 1Y6IA 4JA9A 3RRUA 1JUQA 4F53A 1EDUA 2Y4UA 4BT9A 2IU1A 1U3CA 4YNDA 4KMOA 3ZGQA 1HG5A 2VSXE 3FY4A 4GYWA 4WNDA 2HO1A 5ANLA 3KS2A 3B7UX 4GB9A 2XGSA 4UQZA 1UJJA 2LSVA 4HORA 3S2AA 1TJFA 1MHQA 2KCKA 4FP7A 3MYVA 1B89A 4A55A 2J08A 4GCNA 2WXFA 3CVPA 2PM7A 1Y8MA 4GA0A 4KVOA 1HFAA 2PM6A 5LP0A 4UI9J 2IOSA 3QARA 4BFRA 2WXLA 4PDXA 2XHEA 1JPLA 1ZU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBA G;  2L9B A; 
#chains in the Genus database with same CATH topology
 2KC7 A;  1OUV A;  1YCS B;  5JJ6 A;  5FQ4 A;  4RSY A;  2FI7 A;  3CKB A;  3FTY A;  2AW6 A;  2WM9 A;  3FTX A;  1KPS B;  4G25 A;  4OAV B;  2XCC A;  2IY0 C;  5E76 A;  3SHF A;  3QAQ A;  1X5B A;  3ZYQ A;  4AVX A;  1D9S A;  4G8L A;  3B7R L;  1TYQ G;  5EKQ D;  4JHR A;  3UKU G;  5JJ7 A;  3R9M A;  4NUR A;  3S7F A;  5B1A E;  4DPR A;  4F6R D;  2F37 A;  2PZI A;  1SZ9 A;  4KXK B;  1OWO A;  3FUM A;  2P9S G;  3PNT B;  1QQE A;  4GZ3 A;  3AAA C;  3FH8 A;  3CVU A;  1H0A A;  1IQU A;  3EJN A;  1HX8 A;  3V30 A;  3C3Q A;  4GYY A;  3ONL A;  4DX5 D;  1D8E A;  2L0I A;  1N4S A;  3ULE G;  2J4B A;  1H6K A;  2WXG A;  4I1M A;  3OAW A;  3TG5 A;  1IXV A;  3C3R A;  3AU4 A;  5AQ7 A;  4GZ5 A;  1LTX A;  3UQ3 A;  3FUJ A;  3B95 A;  4JD2 G;  2LUH A;  4XE0 A;  4LSZ E;  4J6I A;  4L2Y A;  4U8Y D;  4GZC A;  4HS2 A;  1N95 A;  3LCA A;  4DLQ A;  3ZIM A;  2VTB A;  3CVL A;  4A3T A;  2XEE A;  3D9K A;  3IKO B;  4HOT A;  2P2C P;  2LNI A;  3I4G A;  1BD8 A;  4HI9 A;  3E4B A;  4H7X A;  2Q7F A;  1MX4 A;  3OTN A;  4KYO B;  2GRM A;  2DZO A;  5EIL A;  1UW4 B;  4EHM A;  3E32 A;  3LJN A;  3MV3 B;  2CFZ A;  4A3V A;  3GYZ A;  3N71 A;  4HOQ A;  2YQ8 A;  4APF A;  3HIZ A;  3Q4A B;  2A5U A;  1FT1 A;  5CRU A;  4ANW A;  3DSU A;  4I2W A;  3QJZ A;  4BSZ B;  4CEM A;  4HLL A;  2LO6 A;  4AM9 A;  3ML8 A;  3SY2 A;  5ENR D;  5ENT D;  2J09 A;  3ZW3 A;  3MJW A;  3HXF A;  3GZ2 A;  2OEW A;  4IRU A;  4YVQ C;  1U2V G;  2QY7 A;  4L2L A;  5AN8 A;  1NA0 A;  3EUV A;  1H19 A;  3PZD A;  3SQV A;  4NAC A;  2F8X K;  3LJ3 A;  3CST A;  1KT1 A;  2KZT A;  2J9Q A;  2UY1 A;  5FZR A;  3ZXP A;  1AP7 A;  3V31 A;  4Q69 A;  4GCO A;  3RAU A;  4DI3 A;  4CDR A;  2XZD G;  3EHM A;  2AVP A;  1HE8 A;  4ABN A;  5CMW A;  3L22 A;  3CIA A;  5AQ9 A;  3V79 K;  2AJA A;  3RJV A;  3DPD A;  5ANR A;  3EHN A;  2RKK A;  3L16 A;  3PUK A;  3R9A B;  4K5B A;  5KCM A;  3IEG A;  2ION A;  5AJD A;  1N4R A;  4LNU D;  3CHM A;  2OOE A;  2WVI A;  3CR3 A;  3SO8 A;  2BKK B;  5AJL A;  5KWD A;  4QQI A;  4RQI A;  4B89 A;  2OCC E;  4TXQ A;  4WAF A;  3ZYK A;  2VGX B;  1WG0 A;  2LSU A;  4LUN U;  3CLJ A;  1S0P A;  2J07 A;  2QC9 A;  3JCK C;  4W9R A;  3FTW A;  3ZU7 B;  4AV7 A;  4EZL A;  4GML A;  3AU5 A;  3ZXS A;  3CHS A;  2KAT A;  4N5C A;  3E37 A;  1LD7 A;  3RIB A;  2NSZ A;  3QOU A;  3NF1 A;  1A5E A;  5FJY A;  1OXJ A;  4DX6 D;  5G05 J;  2R03 A;  3PH0 C;  5FZQ A;  4PS7 A;  4XX5 A;  2AXZ A;  4HQD A;  5T4Y A;  4XEI G;  3ZNG A;  5T3R A;  3HXC A;  4N3B A;  3ULY A;  2WQ7 A;  3LS8 A;  4NQ0 A;  3AG1 E;  2ILR A;  1V55 E;  4MKT A;  5ENO D;  4KZC A;  4DUI A;  4U95 D;  4CT4 A;  1H2U A;  4HRM B;  2OEV A;  4G8K A;  3JQ0 A;  3CK8 A;  3KEZ A;  1KZO A;  3FUI A;  2VSY A;  2E2E A;  2XGO A;  3D9P A;  4CT0 A;  5FZS A;  3SBT B;  4GTS A;  1TJC A;  3LKU A;  3NZU A;  3LY8 A;  3FU6 A;  2ZIS A;  3RRM B;  3FTS A;  1JCR A;  4I17 A;  3D9M A;  4JVS A;  4FC8 A;  3CVX A;  3UUX A;  4AP2 A;  4HOS A;  5D2M C;  1FVF A;  1EPU A;  4M7C A;  4CRW A;  3VLE A;  3VLD A;  3V2X A;  4LG6 A;  3MKQ A;  3DSV A;  1KZP A;  3TWQ A;  3ESK A;  5KJM A;  4GTV A;  5FQ6 A;  1BPO A;  1BI7 B;  3ONK A;  1OWN A;  4B94 A;  1NL4 A;  1JWF A;  2ZXW E;  3IBE A;  4Y6W A;  2BTD A;  4ANU A;  3UM0 A;  1OT8 A;  2X6J A;  2BUG A;  1TNZ A;  3PNL B;  4J8F A;  1G3N B;  1HS6 A;  4EBA A;  2FUL A;  4CGV A;  4KBQ A;  3VTY A;  3Q73 A;  3CEQ A;  3JXI A;  4OAU C;  3UPV A;  3MX3 A;  2UWJ G;  3AG4 E;  4XIF A;  3FH5 A;  5FQ7 A;  4F53 A;  5B1B E;  3ZGQ A;  1HG5 A;  3DXK G;  4WND A;  2XGS A;  4UQZ A;  1UJJ A;  1MJ0 A;  1B89 A;  4GCN A;  3PZ4 A;  1H6P A;  3QAR A;  2WXL A;  1ELK A;  5ENN A;  1ZU2 A;  3W9F A;  3LY9 A;  3TXM A;  3I3N A;  3OXG A;  3ZPJ A;  3CKC A;  3DWL G;  1JCS A;  3WXX A;  2IQC A;  1UN8 A;  4J8S A;  2P9N G;  2J4D A;  3TWT A;  5EDS A;  1O1T A;  2EIM E;  3TWX A;  4MBG A;  1MYO A;  3UI2 A;  5C1D A;  4FHK A;  4ACK A;  1IHG A;  1OWP A;  3WG7 E;  1KT0 A;  3PE3 A;  2WXK A;  5BV1 A;  4N3A A;  5KNG A;  2WPV A;  3CVQ A;  4GTT A;  5HRY A;  3Q5M A;  4GTP A;  3U64 A;  2V8S E;  2YIN A;  2PNN A;  3E33 A;  2P9K G;  2NYJ A;  3FUH A;  5T8I A;  3D9N A;  1WY6 A;  2B0O E;  2LAI A;  3HRA A;  3UX4 A;  1DCQ A;  4LCT A;  3HHM A;  2GRL A;  5JJT A;  2P9L G;  4G23 A;  1N94 A;  2CG2 A;  1EYH A;  3PS6 A;  3AG2 E;  4Q94 A;  3TWR A;  4FA6 A;  1HU3 A;  2UY1 B;  2V5F A;  4I6J A;  3QWW A;  5BT1 A;  3NBN B;  2ZGD A;  3T8K A;  4EBA G;  3R7Q A;  4GU5 A;  3JXJ A;  3EIQ C;  4K0R A;  1HO8 A;  2F8Y A;  4PS8 A;  3B7S A;  2I6H A;  3CHR A;  4XZ4 A;  3L82 A;  4CGW A;  2XS1 A;  3HG0 D;  5JA4 D;  3JUE A;  3L9T A;  4C0M A;  1SVX A;  3BG1 B;  1BU9 A;  2YHC A;  2HR2 A;  2C2L A;  2V4L A;  3Q47 B;  3UT8 A;  1RW2 A;  2Y1L E;  4BX9 A;  5B3S E;  3Q79 A;  2WMO A;  4NRH B;  3D9H A;  3ASD A;  2NC9 A;  3BU8 A;  2V4H C;  2L9B A;  1N0R A;  5LCW J;  2WXN A;  3LYA A;  5G04 C;  3PZ3 A;  1Z3Y A;  3Q7A A;  4I6E A;  4O6F A;  3CVV A;  3MCX A;  1N54 A;  4GTR A;  4JXT A;  1OCO E;  2Y4T A;  2QZA A;  5CMY A;  2GW1 A;  2WQH A;  4JL0 A;  2DIW A;  5ARF A;  5KNH D;  3UM2 A;  1PC2 A;  3HVE A;  3L6A A;  1TNY A;  2WXR A;  5BPP A;  2XCB A;  3RO3 A;  3JQ1 A;  2WMN A;  3DEP A;  3SI5 A;  2EIK E;  2XPY A;  4L1B A;  3ZVV A;  5BV0 A;  2DZN A;  3U66 A;  3QB2 A;  2IEJ A;  3E30 A;  3G2W A;  5CED B;  4CDM A;  4IN3 B;  1V54 E;  5AIJ A;  2R02 A;  2HYZ A;  3TWU A;  4X8Q A;  2XPI A;  4L23 A;  3IV0 A;  4ILG A;  3IHV A;  3LDZ A;  3SZ7 A;  2XS8 A;  1ELR A;  3MA5 A;  5ENQ D;  2EIL E;  5FTP A;  4JHJ A;  1O1S A;  1HH8 A;  5D0O D;  2P9I G;  3S7D A;  4XKB A;  1DVP A;  3P1U A;  1TN8 A;  4HNA D;  1SW6 A;  4OVU A;  3CHP A;  4XI0 A;  4G2V A;  5M72 A;  4FAD A;  3ASO E;  2EIJ E;  4XI9 A;  4J7W A;  2LAH A;  2KBX A;  1DCE A;  3EIJ A;  4TV3 A;  5CCM A;  3ZKJ A;  4HI8 A;  1MX2 A;  3ZFW A;  4U04 A;  4HVB A;  1BI8 B;  4EPZ A;  1U3D A;  4PH4 B;  4TUU A;  3FU0 A;  3T9K A;  2MOW A;  1QNF A;  1NA3 A;  1PY1 A;  4TRQ A;  1FT2 A;  5LFA A;  3G2V A;  5KJN A;  3CGH A;  1WM5 A;  3B7T A;  3MZL B;  4UQY A;  3PZ1 A;  1QBQ A;  5H7P A;  5BXU A;  3S7B A;  3UM1 A;  4ANX A;  3TAX A;  3L54 A;  3HYM B;  4I1O B;  2XRY A;  3T5V A;  3NOG D;  4N2Q A;  1W3B A;  1NP7 A;  2X6K A;  2R59 A;  3G2S A;  1OCZ E;  4L7T A;  4N2S A;  1FCH A;  4GYO A;  4H7Y A;  2P58 C;  3VTX A;  1E8W A;  4R7L A;  2VJ8 A;  3IHY A;  4CZ2 D;  4G24 A;  1MQS A;  4GMR A;  4Q96 A;  4LNB A;  2VYI A;  5CBN A;  3LVQ E;  4A63 B;  3U4T A;  4URK A;  3HXD A;  4KT6 B;  2LXL A;  3LVR E;  2R17 C;  3DST A;  3I4R B;  3UKR G;  3ZEF A;  4UWL A;  1O1R A;  3ZN3 A;  2DCP A;  3FFL A;  4V3I A;  4FJY A;  1H2V C;  3T8M A;  1K1A A;  1DNP A;  4HRL A;  4NIK A;  3FUL A;  3UTM A;  2E0I A;  3RU0 A;  3TG4 A;  3EHQ A;  4IYP A;  3S7J A;  2J49 A;  3RK6 A;  2GRN B;  3D9I A;  3C72 A;  5G05 C;  3CSF A;  1N4P A;  1NI1 A;  1TR4 A;  5G55 A;  3ASF A;  4JA9 A;  1EDU A;  1IHB A;  2Y4U A;  2IU1 A;  4YND A;  5JMN D;  2VSX E;  4O60 A;  4GYW A;  4GTM A;  3KS2 A;  2LSV A;  1TJF A;  1TN6 A;  2HE0 A;  4FP7 A;  3CVP A;  4KVO A;  4GA0 A;  4ZHB A;  1HFA A;  4UI9 J;  2IOS A;  4BFR A;  1JPL A;  4L9P A;  1X81 A;  3DXM G;  1FVH A;  3URZ A;  4N3C A;  2DBA A;  1EF1 C;  4BES A;  2Y3A A;  3DBS A;  5ENP D;  3TWV A;  2FO1 E;  1QZ2 A;  4GZ6 A;  4UWK A;  4RG9 A;  1E7U A;  4AY6 A;  4UWG A;  5KJL A;  4BWR A;  1HXI A;  3ULQ A;  1ELW A;  4DLO A;  5CEA A;  2CHX A;  4PS3 A;  1IKN D;  5KJK A;  5JHB A;  4JC8 A;  1K3Z D;  3QKY A;  2WXP A;  1MZC A;  2M63 A;  3EU9 A;  2F0Y A;  5EYL A;  4EZJ A;  4FHJ A;  1D8D A;  3SF4 A;  1S70 B;  4DRX E;  3MGB A;  1DC2 A;  4WNF A;  3NAW A;  3GZ1 A;  4HXI A;  3ZYM A;  3UMV A;  2C0M A;  2KCV A;  3F6Q A;  4APO A;  3NZS A;  4G26 A;  2YHE A;  4QFV A;  4UWF A;  1HG2 A;  4WNG A;  4DJA A;  4B93 B;  4A1G A;  3CV0 A;  4ILI A;  4I1A A;  3KAE A;  3NOC D;  3OXF A;  3ENE A;  3SFY A;  1OCR E;  4RG6 A;  2MYO A;  5D0Q D;  5FWQ A;  1TNU A;  2V5Q C;  3PZ2 A;  4N5Q A;  4FU3 A;  4ATZ D;  1OCC E;  3KSL A;  3QWP A;  4GMJ A;  4LEU A;  4FLH A;  1JWG A;  4C9B B;  1O5M A;  2PQR A;  3ABK E;  4JEH A;  2WXI A;  4E6H A;  3AJI A;  2EQX A;  5BW8 C;  3CHQ A;  2VGE A;  3Q9U C;  3UIN C;  3FTZ A;  5AQB A;  2KM4 A;  4I9C A;  4EZK A;  4DI4 A;  5JHA A;  4YDE A;  1TNB A;  3CQG B;  5FQ8 A;  2R5S A;  2GRP B;  2QYJ A;  4AXH A;  4U0S A;  2H6H A;  2P9U G;  5A23 A;  1E8Y A;  4ATG A;  4BTB A;  2DYR E;  1XNF A;  4HFG A;  5EYP F;  5J90 A;  3FUE A;  5IY5 E;  3APF A;  3FUN A;  3VLF A;  1E96 B;  3Q15 A;  4JPS A;  4AIF A;  2XQ0 A;  4F1S A;  2L0T B;  4TXR A;  3J5P A;  3FEY A;  1IYG A;  2H6F A;  4BET A;  4B8C B;  2H6I A;  1H2T C;  3MKR A;  1Z5S C;  4HOU A;  4J8D A;  4ZFH A;  2WXO A;  2AXV A;  1E7V A;  2RFM A;  2XZT G;  2KXP C;  3ZHE B;  1INZ A;  2PQN A;  2R05 A;  1TNO A;  3C98 A;  4RVB A;  4D10 C;  3TL5 A;  1AWC B;  4UWH A;  2XEH A;  4LER A;  4DX2 A;  3PEV B;  2A4Z A;  3J5Q B;  3QDN A;  2XEV A;  4WNE A;  2V0P A;  2QYU A;  3LPZ A;  2QFC A;  2WXQ A;  4JW1 A;  4GPK A;  1L5J A;  1UOH A;  3ISM C;  2J8S D;  4G1T A;  2DYS E;  4ILH B;  4I9E A;  3FEX A;  1UG3 A;  5AAO A;  2FEZ A;  5EN5 D;  3DSX A;  2ZU6 B;  3Q9N C;  2IJG X;  3CVW A;  2IOL A;  4FUL A;  2GRQ B;  4YDW A;  3CHO A;  3FHE A;  3I5P A;  3T5X A;  4Z68 A;  2VGX A;  2AWI A;  4G11 A;  1LF8 A;  2RG8 A;  3RKV A;  3X2Q E;  5G04 J;  3U3W A;  3CK7 A;  3NQP A;  4XKC A;  5EID A;  3P2B A;  4ACL A;  3PDN A;  4MLP A;  3GW4 A;  4WWO A;  5EX0 A;  4AJW A;  2I1J A;  4P29 A;  2WB2 A;  5HQ8 A;  4F1P A;  2JEK A;  1LD8 A;  3EDT B;  3C5R A;  3L13 A;  3SFX A;  3HXB A;  4I2Z A;  1ZBP A;  3SFZ A;  4KVM A;  3PEU B;  5BNW A;  1N9A A;  3SD5 A;  5AAR A;  3FP3 A;  3NB2 A;  4B8A A;  2C0L A;  5AEN A;  3D3M A;  1H6O A;  4U7E B;  4BEP A;  2BF0 X;  3ZRH A;  1K8K G;  4MS6 A;  3LY7 A;  3AS8 A;  1PAQ A;  3PRZ A;  4AY5 A;  3FU3 A;  3UIP C;  4CCA A;  4U8H A;  1Z3X A;  2BKG A;  4BTA A;  3QNK A;  2PL2 A;  5FIO A;  2MRI A;  1NFI E;  4GZD A;  3K9I A;  2OV8 A;  3L17 A;  4KZ0 A;  3G2U A;  3LEW A;  4TUM A;  3AS4 A;  2ZIR A;  3JUI A;  2BED A;  3MKQ B;  3SGH A;  3PUJ A;  2XHE A;  3SNX A;  4F7A A;  4JHK A;  2X6F A;  3JYS A;  3MEK A;  3BQO A;  3B7B A;  4E85 A;  5CER B;  2R2L A;  3RRU A;  1BLX B;  1JUQ A;  4KMO A;  3FY4 A;  2L6B A;  3C3O A;  2EIN E;  2HO1 A;  4GB9 A;  3B7U X;  3DSW A;  4HOR A;  1MHQ A;  3MYV A;  4A55 A;  1Y8M A;  5HS0 A;  5LP0 A;  4YDO A;  3EU5 A;  3UT4 A;  5D66 A;  2RD0 A;  4O1O A;  2WXH A;  1HF8 A;  3UM3 A;  1N4Q A;  4GA2 A;  4IUL A;  5C2Y A;  4HB5 A;  2OND A;  3DEO A;  1QYM A;  4I43 A;  4MRU A;  2XRZ A;  3BUA A;  3APC A;  4U0U A;  1OWM A;  3HVE B;  1KLX A;  3D9J A;  3OXL A;  3FU5 A;  3R7R A;  4FLB A;  4OVV A;  3W9G A;  3EHR A;  4EEC A;  3RRN B;  2Y69 E;  3FDH A;  4GTQ A;  4CDN A;  4BT8 A;  5CEC B;  4HLE A;  3Q49 B;  3V2O A;  1K1B A;  4JZY A;  2DWZ A;  4DK5 A;  1YA0 A;  1RZ4 A;  5BXO A;  4JA7 A;  2L6J A;  2OVB A;  3AG3 E;  4YVO A;  1YYH A;  5CBO A;  4J8Y A;  2KZT B;  1E90 A;  5ITZ F;  1HZ4 A;  4OYS A;  3RO2 A;  2ETC A;  2VSN A;  2H6G A;  2FO7 A;  3G2T A;  5HI7 A;  4AOF A;  2Y0B G;  3ZUV B;  1WAO 1;  1SQM A;  4M3O A;  4DX1 A;  1E8X A;  3ASG A;  2CG3 A;  4A1S A;  4GPM A;  2VGY A;  2IF4 A;  3QC1 A;  1S64 A;  3LXU X;  3DPY A;  3Q75 A;  5J08 A;  3SBS A;  1MX6 A;  1E8Z A;  4UQX A;  1SA4 A;  4U63 A;  3TJP A;  3UXG A;  3RSE G;  2X6H A;  1JCQ A;  2A5E A;  3QWV A;  2WXM A;  2DVW A;  4I6G A;  4GA1 A;  3FUF A;  3TGO A;  4JB8 P;  4RLY A;  3FH7 A;  1TEZ A;  3D9O A;  4WWP A;  4LRZ A;  1SZA A;  5DIZ A;  5EIB E;  3DRA A;  4J0U A;  4WUY A;  1P5Q A;  5A6C A;  5CRV A;  2GRO B;  2IO3 C;  2ETB A;  5EX3 A;  4K03 A;  3UT7 A;  2IO2 C;  2KCL A;  3PE4 A;  2AXU A;  4GTO A;  5BUZ A;  2VQ2 A;  5DBK A;  2JLB A;  3HDX A;  4TXP A;  4B0Z A;  4YDY A;  3Q78 A;  2RFA A;  1YMP A;  3U9W A;  2VSO E;  1FPP A;  3APD A;  1N0Q A;  2I9C A;  3TXN A;  3KD7 A;  4Y6C A;  2X3M A;  2X6I A;  4LNG A;  3CVN A;  3ZHE A;  4C0E A;  4GAA A;  3E34 A;  3FTU A;  2CHW A;  1TN7 A;  5CHE E;  5AQA A;  1GW6 A;  3QK0 A;  5ENS D;  2I2O A;  1IQR A;  2X38 A;  3FWV A;  3KEA A;  4F3V A;  4HBD A;  3Q7F A;  4U07 A;  2XPZ A;  4AEZ C;  3FUK A;  1XGW A;  4O1P A;  3O4Z A;  1UJK A;  5KBA A;  3GZS A;  1SA5 A;  2ETA A;  4K5A B;  1ZB1 A;  1OWL A;  1Q2Z A;  3FTV A;  2IFU A;  4U0Z A;  3KSQ A;  2HM8 A;  4ANV A;  2YNQ A;  2OVF A;  1UN9 A;  3ABL E;  4HRN A;  5FIN A;  4FJZ A;  5LX8 A;  1WDY A;  3ESL A;  3PVL A;  2GRR B;  2ZGG A;  2I1K A;  2NXP A;  2P9P G;  2B6C A;  4UI9 K;  1S63 A;  4WWN A;  4BY6 A;  3D9L A;  4BSX A;  4DX7 D;  3O48 A;  4BX8 A;  4J8E A;  1N11 A;  1A17 A;  3MV2 B;  3ZYL A;  2CFU A;  4PUC A;  4CYM D;  3IXE A;  2XEN A;  2LXM A;  2VTB B;  5LCW C;  5E75 A;  2FBN A;  3HXE A;  3AS5 A;  1NZN A;  3FUD A;  1N52 A;  5G2N A;  1OY3 D;  5HKP A;  3UIO C;  5FT9 A;  2WQ6 A;  3B13 A;  5CCL A;  3PRE A;  3BEE A;  2CHZ A;  2GGF A;  3CQC B;  4EQF A;  5A7D B;  4UI9 C;  3ASH A;  5AYW D;  3CK9 A;  5LOZ A;  4JEU A;  2JAB A;  2XGM A;  3BG0 B;  4K5C A;  3CVY A;  4BER A;  4N39 A;  3ML9 A;  4ME2 A;  4U96 D;  5ARG A;  2FF4 A;  1VDY A;  3L08 A;  3TWS A;  1Z6T A;  2WXJ A;  2MHK A;  4UUC A;  1Y6I A;  3ABM E;  4BT9 A;  1U3C A;  5ANL A;  4C48 B;  3DSS A;  3S2A A;  3TWW A;  3ASN E;  2KCK A;  2J08 A;  2WXF A;  2PM7 A;  2PM6 A;  4PDX A;  4U8V D; 
#chains in the Genus database with same CATH homology
 2KC7 A;  3UT4 A;  1OUV A;  5JJ6 A;  5FQ4 A;  4RSY A;  1FVH A;  1ELK A;  3URZ A;  3LY9 A;  3TXM A;  3I3N A;  3OXG A;  4N3C A;  2FI7 A;  3ZPJ A;  3CKC A;  2DBA A;  1EF1 C;  3CKB A;  2Y3A A;  2RD0 A;  3FTY A;  2AW6 A;  3DBS A;  2WM9 A;  3FTX A;  2WXH A;  1HF8 A;  4G25 A;  3WXX A;  1QZ2 A;  2IQC A;  4GA2 A;  1UN8 A;  2XCC A;  4GZ6 A;  4IUL A;  5C2Y A;  4J8S A;  2J4D A;  4UWK A;  5E76 A;  2OND A;  3SHF A;  5EDS A;  4RG9 A;  1E7U A;  4AY6 A;  3QAQ A;  4UWG A;  5KJL A;  4BWR A;  1X5B A;  3ZYQ A;  4AVX A;  5C1D A;  4FHK A;  3B7R L;  1HXI A;  5EKQ D;  4JHR A;  4ACK A;  4I43 A;  5JJ7 A;  3ULQ A;  1ELW A;  4MRU A;  4DLO A;  1IHG A;  1OWP A;  2XRZ A;  4NUR A;  1KT0 A;  3PE3 A;  3APC A;  3S7F A;  4DPR A;  2CHX A;  2WXK A;  2PZI A;  1SZ9 A;  4U0U A;  4KXK B;  4N3A A;  4PS3 A;  1OWO A;  3FUM A;  5BV1 A;  3PNT B;  5KJK A;  2WPV A;  1OWM A;  5JHB A;  3CVQ A;  3HVE B;  1KLX A;  3D9J A;  3OXL A;  1QQE A;  4GZ3 A;  3FH8 A;  4JC8 A;  3FU5 A;  3Q5M A;  3QKY A;  3CVU A;  1H0A A;  2WXP A;  1IQU A;  3EJN A;  1HX8 A;  2M63 A;  3U64 A;  2V8S E;  2YIN A;  3R7R A;  4GYY A;  4EZJ A;  4FHJ A;  4FLB A;  3ONL A;  3SF4 A;  3FUH A;  5ENN A;  5T8I A;  3D9N A;  1WY6 A;  4OVV A;  3MGB A;  2LAI A;  4WNF A;  4EEC A;  2L0I A;  3GZ1 A;  3UX4 A;  3RRN B;  4HXI A;  3ZYM A;  3FDH A;  3UMV A;  2J4B A;  1H6K A;  2WXG A;  4I1M A;  3OAW A;  3TG5 A;  4CDN A;  2C0M A;  2KCV A;  4LCT A;  4BT8 A;  4HLE A;  3HHM A;  2GRL A;  3AU4 A;  5JJT A;  4GZ5 A;  3Q49 B;  4APO A;  4G23 A;  3UQ3 A;  3FUJ A;  3NZS A;  4JZY A;  4G26 A;  2CG2 A;  4DK5 A;  1YA0 A;  2YHE A;  4QFV A;  1EYH A;  1HG2 A;  4UWF A;  4WNG A;  4XE0 A;  4JA7 A;  3PS6 A;  4J6I A;  4L2Y A;  4DJA A;  4GZC A;  2L6J A;  4A1G A;  3CV0 A;  4HS2 A;  4Q94 A;  2OVB A;  4ILI A;  4I1A A;  3KAE A;  1HU3 A;  4FA6 A;  3LCA A;  4YVO A;  4DLQ A;  2UY1 B;  2V5F A;  3ZIM A;  3OXF A;  4I6J A;  3QWW A;  5BT1 A;  2KZT B;  3ENE A;  2VTB A;  3CVL A;  1E90 A;  4RG6 A;  4A3T A;  3D9K A;  3IKO B;  4EBA G;  5D0Q D;  1HZ4 A;  3R7Q A;  5FWQ A;  2LNI A;  4GU5 A;  4HOT A;  4OYS A;  3RO2 A;  3I4G A;  3EIQ C;  4K0R A;  1HO8 A;  4FU3 A;  2VSN A;  3G2T A;  2FO7 A;  4PS8 A;  3E4B A;  4H7X A;  2Q7F A;  3QWP A;  5HI7 A;  4AOF A;  3B7S A;  2I6H A;  3CHR A;  4XZ4 A;  3OTN A;  4KYO B;  2GRM A;  4GMJ A;  4LEU A;  4FLH A;  4CGW A;  1JWG A;  1WAO 1;  4C9B B;  2PQR A;  1UW4 B;  1SQM A;  2WXI A;  4JEH A;  4M3O A;  4C0M A;  4E6H A;  2EQX A;  3MV3 B;  2CFZ A;  4A3V A;  1E8X A;  3GYZ A;  5BW8 C;  3CHQ A;  3BG1 B;  3N71 A;  2YHC A;  3ASG A;  2CG3 A;  4HOQ A;  2YQ8 A;  4A1S A;  4APF A;  2HR2 A;  2VGY A;  3FTZ A;  2C2L A;  2IF4 A;  2V4L A;  2KM4 A;  3HIZ A;  3Q47 B;  3Q4A B;  3QC1 A;  4I9C A;  3UT8 A;  2A5U A;  3LXU X;  4BX9 A;  4EZK A;  5J08 A;  4ANW A;  2WMO A;  3SBS A;  4DI4 A;  4I2W A;  5JHA A;  4NRH B;  3CQG B;  1E8Z A;  3ASD A;  3QJZ A;  5FQ8 A;  2R5S A;  4UQX A;  3TJP A;  4U63 A;  2NC9 A;  4AXH A;  4CEM A;  2X6H A;  4U0S A;  3QWV A;  2LO6 A;  2WXM A;  4AM9 A;  3ML8 A;  5A23 A;  4I6G A;  1E8Y A;  4GA1 A;  4ATG A;  2J09 A;  3ZW3 A;  4BTB A;  3MJW A;  3FUF A;  3GZ2 A;  3TGO A;  4IRU A;  2L9B A;  4YVQ C;  5LCW J;  3FH7 A;  1TEZ A;  1XNF A;  3D9O A;  4WWP A;  2WXN A;  2QY7 A;  3LYA A;  4HFG A;  4L2L A;  5G04 C;  4LRZ A;  1SZA A;  5J90 A;  1Z3Y A;  3FUE A;  4I6E A;  4O6F A;  5DIZ A;  1NA0 A;  3CVV A;  4J0U A;  4WUY A;  1P5Q A;  5A6C A;  3MCX A;  1N54 A;  3APF A;  3FUN A;  1H19 A;  4JXT A;  3PZD A;  3VLF A;  4NAC A;  1E96 B;  2Y4T A;  3Q15 A;  4JPS A;  4AIF A;  5CMY A;  2GW1 A;  5EX3 A;  3LJ3 A;  2WQH A;  4JL0 A;  2DIW A;  2XQ0 A;  3CST A;  4K03 A;  1KT1 A;  2KZT A;  5ARF A;  3UT7 A;  2J9Q A;  4F1S A;  1PC2 A;  3HVE A;  3L6A A;  2UY1 A;  2L0T B;  5FZR A;  3FEY A;  2WXR A;  5BPP A;  2KCL A;  4Q69 A;  3PE4 A;  4GCO A;  2XCB A;  4DI3 A;  4CDR A;  1IYG A;  3EHM A;  2AVP A;  4B8C B;  3RO3 A;  1HE8 A;  3JQ1 A;  4ABN A;  5CMW A;  1H2T C;  2AXU A;  3L22 A;  2WMN A;  3CIA A;  5BUZ A;  3MKR A;  2VQ2 A;  5DBK A;  3SI5 A;  2XPY A;  4L1B A;  3ZVV A;  2JLB A;  3RJV A;  5BV0 A;  3DPD A;  3U66 A;  4HOU A;  4J8D A;  5ANR A;  3EHN A;  3HDX A;  3QB2 A;  3L16 A;  3PUK A;  2WXO A;  3G2W A;  2AXV A;  1E7V A;  3R9A B;  4CDM A;  4IN3 B;  4B0Z A;  5KCM A;  3ZHE B;  1INZ A;  3IEG A;  2PQN A;  5AIJ A;  3C98 A;  2ION A;  4RVB A;  4D10 C;  5AJD A;  3TL5 A;  3U9W A;  4UWH A;  2VSO E;  2HYZ A;  3APD A;  3CHM A;  2OOE A;  4LER A;  3TXN A;  2I9C A;  3PEV B;  3KD7 A;  4Y6C A;  2WVI A;  3CR3 A;  2A4Z A;  2X3M A;  2XPI A;  2X6I A;  3IV0 A;  4L23 A;  4ILG A;  3QDN A;  3CVN A;  2XEV A;  4WNE A;  3ZHE A;  4C0E A;  3IHV A;  4GAA A;  2V0P A;  3FTU A;  2CHW A;  3LPZ A;  5CHE E;  5AJL A;  2QFC A;  2WXQ A;  3LDZ A;  3SZ7 A;  1GW6 A;  1ELR A;  3QK0 A;  4JW1 A;  4B89 A;  3MA5 A;  2I2O A;  4GPK A;  1L5J A;  1IQR A;  2X38 A;  3FWV A;  4G1T A;  4ILH B;  4WAF A;  5FTP A;  4I9E A;  4F3V A;  3FEX A;  3ZYK A;  1UG3 A;  4JHJ A;  2FEZ A;  2VGX B;  2LSU A;  1HH8 A;  4U07 A;  2XPZ A;  2ZU6 B;  3CLJ A;  1S0P A;  4LUN U;  5D0O D;  2IJG X;  2J07 A;  3JCK C;  4AEZ C;  4W9R A;  3CVW A;  3FTW A;  2IOL A;  4FUL A;  3S7D A;  4XKB A;  3FUK A;  1XGW A;  4AV7 A;  4EZL A;  4GML A;  3CHO A;  1DVP A;  3AU5 A;  3O4Z A;  3ZXS A;  3CHS A;  3FHE A;  3I5P A;  3P1U A;  2KAT A;  3T5X A;  4N5C A;  1UJK A;  4OVU A;  3CHP A;  4XI0 A;  2VGX A;  4G2V A;  2AWI A;  4G11 A;  5M72 A;  3GZS A;  4FAD A;  1LF8 A;  4XI9 A;  3RIB A;  2NSZ A;  2LAH A;  3QOU A;  2RG8 A;  3NF1 A;  3EIJ A;  1OWL A;  4TV3 A;  5CCM A;  3RKV A;  3FTV A;  5G04 J;  5FJY A;  3CK7 A;  3U3W A;  3NQP A;  2IFU A;  4U04 A;  4XKC A;  3ZFW A;  4U0Z A;  4HVB A;  2HM8 A;  1U3D A;  5G05 J;  3P2B A;  4EPZ A;  4PH4 B;  3PH0 C;  4TUU A;  4ACL A;  3PDN A;  4MLP A;  4ANV A;  3GW4 A;  4WWO A;  3FU0 A;  2YNQ A;  5FZQ A;  4PS7 A;  5EX0 A;  2MOW A;  4XX5 A;  4AJW A;  2AXZ A;  2OVF A;  1QNF A;  2I1J A;  4P29 A;  5T4Y A;  1UN9 A;  2WB2 A;  5T3R A;  5HQ8 A;  4N3B A;  1NA3 A;  2WQ7 A;  3LS8 A;  4NQ0 A;  1PY1 A;  2JEK A;  4TRQ A;  4FJZ A;  5LX8 A;  2ILR A;  4MKT A;  3ESL A;  5LFA A;  3EDT B;  3G2V A;  5KJN A;  4KZC A;  3CGH A;  1WM5 A;  3B7T A;  3MZL B;  4UQY A;  3PVL A;  3L13 A;  4CT4 A;  1H2U A;  4I2Z A;  1ZBP A;  3SFZ A;  3JQ0 A;  2I1K A;  4KVM A;  3PEU B;  3S7B A;  5BNW A;  3CK8 A;  3KEZ A;  3FUI A;  3SD5 A;  2NXP A;  4ANX A;  2VSY A;  3TAX A;  3L54 A;  2E2E A;  2XGO A;  3D9P A;  4UI9 K;  3HYM B;  4I1O B;  2XRY A;  3T5V A;  4CT0 A;  5FZS A;  3SBT B;  3FP3 A;  4N2Q A;  1W3B A;  1TJC A;  1NP7 A;  2X6K A;  4WWN A;  3LKU A;  2C0L A;  4B8A A;  3D3M A;  5AEN A;  4BY6 A;  3D9L A;  2R59 A;  3NZU A;  3LY8 A;  2BF0 X;  3G2S A;  3FU6 A;  3ZRH A;  4BSX A;  4L7T A;  3O48 A;  4BX8 A;  1FCH A;  4GYO A;  4N2S A;  3RRM B;  4J8E A;  3FTS A;  4H7Y A;  4MS6 A;  2P58 C;  3LY7 A;  3AS8 A;  1PAQ A;  4I17 A;  1A17 A;  3MV2 B;  3D9M A;  3VTX A;  1E8W A;  4R7L A;  3PRZ A;  4FC8 A;  4JVS A;  2VJ8 A;  3CVX A;  4AY5 A;  3FU3 A;  3UUX A;  3ZYL A;  4AP2 A;  4CCA A;  4U8H A;  1Z3X A;  2CFU A;  4PUC A;  4BTA A;  4HOS A;  3IHY A;  3QNK A;  1FVF A;  2PL2 A;  1EPU A;  2VTB B;  5LCW C;  5E75 A;  4G24 A;  1MQS A;  2MRI A;  4Q96 A;  4CRW A;  3VLE A;  3VLD A;  2VYI A;  2FBN A;  3LVQ E;  3MKQ A;  4GZD A;  3U4T A;  3K9I A;  4URK A;  5KJM A;  3ESK A;  4KT6 B;  2OV8 A;  3LVR E;  2R17 C;  1BPO A;  3L17 A;  5FQ6 A;  3AS5 A;  3ONK A;  1NZN A;  1OWN A;  3FUD A;  4B94 A;  1N52 A;  3I4R B;  4KZ0 A;  3G2U A;  5G2N A;  3ZEF A;  3LEW A;  4UWL A;  1JWF A;  3ZN3 A;  3IBE A;  4Y6W A;  3AS4 A;  2BTD A;  3JUI A;  2DCP A;  3FFL A;  4ANU A;  4V3I A;  5FT9 A;  3MKQ B;  4FJY A;  2WQ6 A;  3SGH A;  1H2V C;  3B13 A;  2X6J A;  3T8M A;  5CCL A;  3PRE A;  2BUG A;  1DNP A;  3BEE A;  3PUJ A;  2CHZ A;  2GGF A;  3CQC B;  3FUL A;  3PNL B;  4J8F A;  3SNX A;  2E0I A;  3RU0 A;  1HS6 A;  4EBA A;  4EQF A;  4F7A A;  4JHK A;  5A7D B;  4UI9 C;  3TG4 A;  2FUL A;  4CGV A;  4IYP A;  3ASH A;  4KBQ A;  3VTY A;  5AYW D;  3CK9 A;  3S7J A;  2J49 A;  5LOZ A;  3RK6 A;  4JEU A;  2XGM A;  2X6F A;  3BG0 B;  3CEQ A;  3D9I A;  3JYS A;  3CVY A;  5G05 C;  4N39 A;  3ML9 A;  3CSF A;  4ME2 A;  3MEK A;  3UPV A;  3MX3 A;  5ARG A;  2FF4 A;  2UWJ G;  1VDY A;  3L08 A;  1Z6T A;  4E85 A;  2WXJ A;  5G55 A;  4XIF A;  3FH5 A;  2MHK A;  5FQ7 A;  3ASF A;  1Y6I A;  4JA9 A;  3RRU A;  1JUQ A;  4F53 A;  1EDU A;  2Y4U A;  4BT9 A;  2IU1 A;  1U3C A;  4YND A;  4KMO A;  3ZGQ A;  1HG5 A;  2VSX E;  3FY4 A;  4GYW A;  4WND A;  2HO1 A;  5ANL A;  3KS2 A;  3B7U X;  4GB9 A;  2XGS A;  4UQZ A;  1UJJ A;  2LSV A;  4HOR A;  3S2A A;  1TJF A;  1MHQ A;  2KCK A;  4FP7 A;  3MYV A;  1B89 A;  4A55 A;  2J08 A;  4GCN A;  2WXF A;  3CVP A;  2PM7 A;  1Y8M A;  4GA0 A;  4KVO A;  1HFA A;  2PM6 A;  5LP0 A;  4UI9 J;  2IOS A;  3QAR A;  4BFR A;  2WXL A;  4PDX A;  2XHE A;  1JPL A;  1ZU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...