2L9BA

Heterodimer between rna14p monkeytail domain and rna15p hinge domain of the yeast cf ia complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
ANFLSQKFPELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQEWTRAHPEDAASLLELCPQLSFVTAELLLTNGICKVDDLIPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Locked Tether Formation by Cooperative Folding of Rna14p Monkeytail and Rna15p Hinge Domains in the Yeast CF IA Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords mRNA 3'-end-processing protein RNA15
total genus 30
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.630 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l9bA00
2L9BA 4EBAG
chains in the Genus database with same CATH superfamily
3V31A 2Y4TA 4CGWA 4BSXA 4H7YA 2VSOE 3UX4A 2OV8A 4FADA 4WNEA 3E4BA 3UMVA 3PS6A 4FHKA 1HXIA 1RW2A 2VGYA 5AQ7A 1NFIE 1OXJA 4G2VA 4UUCA 5FQ6A 2J08A 3LCAA 5EDSA 1KT0A 5D66A 4EZJA 3IHVA 3CHSA 1N54A 3OXFA 4GTMA 3FU0A 5AQ9A 3RRNB 5BW8C 2H6FA 3Q5MA 2IONA 3RK6A 4Y6CA 2E0IA 3FULA 3G2SA 4NQ0A 3ZXSA 4AVXA 1TNOA 2DZOA 2L9BA 1OCCE 4C0MA 2A4ZA 5LCWC 4B93B 4O1PA 2XCCA 3PEUB 2GGFA 3ASOE 5JJ6A 5AAOA 3UM3A 3AG4E 4EBAA 3EHRA 1Y8MA 2LNIA 3JCKC 3KAEA 4L2YA 3TWSA 3APDA 5G05C 3B7UX 2FO1E 3C3RA 5ENPD 3U9WA 1S64A 4BEPA 3E32A 5B1BE 3FTZA 2LUHA 4XI9A 4I1AA 3NOCD 3MKQB 1JCQA 4DX6D 4GA1A 1OWNA 4DJAA 3UI2A 3NAWA 3ZFWA 2OVFA 4F7AA 2NYJA 3U3WA 2BTDA 4HBDA 4CDMA 1FVFA 3ZW3A 1UJJA 3CSTA 1Z5SC 5G04J 2IJGX 5BT1A 5DIZA 2L6BA 3Q7AA 3L17A 4HRNA 1TEZA 3UIOC 2I2OA 1LTXA 1G3NB 5HRYA 3BQOA 1H6PA 4CEMA 4X8QA 2JABA 4F53A 1DNPA 2VSXE 3FUNA 1BI8B 1K8KG 3ASHA 3R9AB 1MYOA 2IOSA 2IO2C 4GZ6A 3FU3A 2NC9A 4I17A 2WXLA 3UPVA 2Y3AA 4U95D 2X6HA 4TUUA 4FP7A 2KCKA 3RO3A 3UXGA 3VTYA 3ZIMA 4ME2A 5HI7A 1OWPA 2I9CA 1S0PA 4I43A 4N3BA 2KZTA 2X6JA 2F0YA 5JMND 4BETA 3CSFA 3PZDA 3DPDA 2GRPB 4GTQA 5FQ7A 2V4LA 1Q2ZA 4Q94A 4APFA 5JJ7A 3DPYA 4GMJA 3DSSA 1E90A 3ZHEA 2X38A 4DX7D 3CKBA 2LSVA 3QAQA 2XGMA 3KEAA 4AEZC 5BXOA 3T9KA 4KXKB 4GYOA 1TJFA 4KYOB 2ETCA 4GTPA 1OWLA 4ACKA 2JEKA 3Q7FA 3SGHA 4AP2A 2EIJE 2PQNA 2R59A 3D9NA 3S7JA 3OAWA 2ETAA 1WG0A 2KXPC 2WXMA 3PRZA 1N4PA 3FUDA 1S63A 2X3MA 3DSVA 5AARA 3HXFA 3QDNA 4A55A 1H19A 3PUJA 4TUMA 2P9SG 5KNGA 4U8YD 3PNLB 4W9RA 2WVIA 2A5UA 2QYJA 2HO1A 3RO2A 2XEHA 4AXHA 3ASGA 2V5QC 4OAVB 2CHWA 4BT9A 5CEAA 2QYUA 4BX8A 1H6OA 4JEUA 4U07A 2J4BA 1AP7A 1XGWA 4F3VA 2KM4A 4YNDA 3EHNA 1FT1A 4KZCA 2BUGA 4AV7A 4DX1A 5B1AE 3V79K 4FJYA 5FIOA 2XZTG 1OWOA 3D9MA 4G11A 4U0ZA 2BEDA 2C0LA 4AY6A 4ATZD 3SI5A 4HFGA 4I6JA 2IU1A 4LSZE 4FHJA 3AU5A 1H2VC 1WY6A 2UY1A 4JVSA 3UT7A 4ILHB 4TXQA 2ETBA 2YINA 4ACLA 3ESLA 1TNBA 5EILA 1YMPA 5EX0A 3FU6A 3FTVA 1N4SA 3BU8A 1PAQA 3DSTA 4G26A 4URKA 2WXJA 1V55E 2VYIA 4HVBA 4K5AB 3S7DA 2GRRB 2X6IA 3MJWA 4GZDA 4AY5A 2P9PG 2FBNA 4UQZA 2FF4A 5C1DA 3ASDA 4B94A 3Q49B 1U3DA 5CMYA 4CCAA 4RG6A 1YYHA 3VLEA 3BG0B 2ILRA 4ZFHA 3Q9UC 4U63A 4U96D 1OCRE 3RKVA 4D10C 5LFAA 4WWOA 3ULEG 5KBAA 4AOFA 3QWWA 3SY2A 5AYWD 5T8IA 5LOZA 4N3CA 4AIFA 3SFYA 4C48B 4J6IA 5DBKA 4EHMA 1HE8A 2AVPA 3UM1A 3ASFA 3FEXA 1W3BA 1ZU2A 4PUCA 1IHGA 3SD5A 1AWCB 1IXVA 3R7RA 3VLFA 1BD8A 1TN8A 3IXEA 3SO8A 4DX2A 4UQYA 3L16A 2XQ0A 2J07A 4WWNA 3UKRG 2HE0A 3MZLB 4ATGA 2WQ6A 2R03A 4NACA 2XEEA 3EUVA 3FUMA 4GZCA 3FUFA 3JYSA 4LRZA 2WPVA 3QKYA 2PQRA 3T5XA 4I2WA 2RFMA 4E85A 3TG5A 2DYSE 5J90A 1KT1A 3DXMG 1JWFA 3TWUA 2MOWA 3P1UA 3ZKJA 5FQ4A 1U2VG 3L82A 3X2QE 5CRUA 1YA0A 4I6EA 5BNWA 5G55A 1DCEA 5FWQA 4ABNA 1LD8A 3CVVA 3ABME 4HXIA 1HO8A 3RRUA 3SBTB 3EIJA 1H2UA 3W9FA 3PE3A 3DSUA 5T3RA 3DEOA 3T8KA 2ZXWE 2KBXA 4G23A 1WDYA 2WXQA 3MV2B 3TWXA 1TNYA 2WXIA 4MS6A 4L2LA 1A5EA 1DC2A 1JWGA 1MJ0A 4BERA 1MX2A 1UN9A 2XHEA 4J8SA 4MRUA 5KNHD 1HZ4A 2GRMA 5BV1A 2XRYA 5E75A 4IYPA 4GAAA 3NF1A 4PS7A 4K03A 4UQXA 4KT6B 3SFXA 4CDRA 3HIZA 4B8CB 3PVLA 2FI7A 3CVWA 2UY1B 2IY0C 1HX8A 1N94A 5ENNA 3I5PA 4CRWA 1YCSB 4HOUA 4RQIA 3SHFA 3B95A 3MCXA 2A5EA 2J9QA 3SFZA 4B0ZA 2WM9A 5D0QD 2J49A 3ULYA 1H6KA 1DVPA 5CCMA 3CQCB 3Q15A 3UT8A 4E6HA 2KATA 4DK5A 4GYYA 3W9GA 3P2BA 2YNQA 4KZ0A 2L0IA 1TN7A 3K9IA 5CHEE 1O5MA 5T4YA 2WXPA 1N0QA 3LVQE 4GMLA 4J8EA 2I6HA 1K1BA 3B7BA 1EF1C 1O1SA 1D8EA 5J08A 3LKUA 3LY7A 1E96B 3QNKA 1KLXA 2OEWA 2DBAA 5M72A 4LEUA 3O4ZA 5CEDB 3JXIA 3FHEA 1OT8A 1IKND 2J8SD 3DSXA 3MX3A 4LNGA 3EDTB 1BI7B 2JLBA 1TN6A 4JHJA 5AN8A 2NSZA 3UKUG 3QB2A 3ZXPA 2PM7A 4XKCA 1PY1A 2H6HA 5ENSD 2DYRE 3FWVA 4HNAD 4N5QA 2L0TB 3AU4A 1SVXA 3C3OA 4U0UA 4LERA 2C2LA 1RZ4A 1JPLA 4O1OA 3D9LA 1EPUA 3UQ3A 1NA3A 5CBOA 3NZSA 2CG3A 3MV3B 4YDYA 4XZ4A 3MKQA 3FFLA 5E76A 1TNZA 2R17C 2WXKA 2GW1A 3D9KA 3FH5A 4HLLA 4YDWA 2QFCA 2X6FA 4P29A 3MA5A 3C72A 4JPSA 3B7RL 3L9TA 4LNBA 3AJIA 1UJKA 3N71A 5G04C 3BEEA 4GYWA 2GRQB 2VSYA 4LUNU 3PH0C 3KS2A 1HG5A 3PZ4A 4PS3A 3ZPJA 2J4DA 2VQ2A 4PH4B 3B7SA 4UWGA 2MRIA 4RSYA 4K0RA 3C98A 4GTVA 3L54A 1JCSA 3U4TA 3LDZA 2H6IA 3G2WA 3SBSA 4M7CA 1N4QA 1OY3D 2XPYA 2PM6A 3OTNA 1MQSA 3AG2E 5JHBA 4F6RD 3G2UA 2VTBA 2LAIA 4N3AA 4GA0A 4UI9K 2WXHA 1HFAA 2C0MA 4FLHA 4DLQA 3AS4A 3VLDA 4RLYA 4HRMB 3CHOA 3KSLA 2RD0A 2DVWA 4GZ5A 3ISMC 4B89A 4BTAA 3U66A 3IEGA 3RRMB 5ARGA 4XI0A 3EHMA 1E7VA 3J5PA 2P9KG 3RAUA 2VSNA 1PC2A 3ZYLA 3ENEA 3B13A 3CK8A 5ANRA 5KJLA 3EU9A 4RVBA 4A1SA 4GCOA 4FULA 1E8YA 1MZCA 4TXPA 2MYOA 3DXKG 4UI9C 1HU3A 1NP7A 2Y69E 4U8HA 3VTXA 4BTBA 5FT9A 4A1GA 2P9IG 1ZBPA 2DWZA 3D9OA 3UUXA 1SZ9A 1INZA 2YHEA 4I9CA 2P9LG 3CK7A 4OVUA 3HHMA 4RG9A 4ILIA 5G2NA 4BX9A 3UM0A 2KC7A 2IO3C 3FTXA 3UINC 5CCLA 3NQPA 4FLBA 3QWVA 4HOSA 3PUKA 2HM8A 2RFAA 2NXPA 1X5BA 2R2LA 2WMOA 2DIWA 3GZ2A 5LX8A 4GTTA 5AJDA 1KZOA 4JB8P 3ZYQA 3QWPA 2ZGGA 3RSEG 4PS8A 4GTSA 5KCMA 2F37A 4JD2G 2QY7A 4MBGA 3SF4A 1NZNA 4IULA 4DI3A 3ONKA 1LD7A 4N2QA 3D9JA 4FA6A 3WG7E 4N5CA 5AENA 3V2OA 4OAUC 2E2EA 3S7BA 2DCPA 2LXMA 4KMOA 4HS2A 2ZIRA 1X81A 3LYAA 4J8FA 1E7UA 2LO6A 2VJ8A 3R7QA 3BUAA 4L9PA 1IHBA 3EHQA 1TNUA 5KJNA 4WNDA 3AAAC 3Q79A 3EJNA 3KD7A 1OUVA 4WNGA 2FO7A 2QC9A 2I1JA 3CVYA 4N39A 4BWRA 5AQBA 5BUZA 1FPPA 1BLXB 4CYMD 3IV0A 3PREA 4HOTA 4M3OA 4ANWA 1VDYA 2PNNA 2XS8A 4GU5A 2XPZA 4WNFA 3HXBA 4J8DA 3Q73A 2GROB 1UOHA 4ILGA 4IN3B 1SZAA 2BKKB 2WXGA 1QNFA 3HRAA 3EIQC 2BKGA 1Z3YA 4EPZA 3NB2A 2XENA 1EYHA 3FTWA 1JCRA 3LY8A 1N4RA 1K3ZD 5B3SE 1OCZE 1NL4A 3RJVA 3UTMA 3FH8A 1K1AA 1KZPA 5JJTA 2P58C 3CVXA 4U7EB 1E8XA 4YVQC 2IOLA 3HXEA 3ZYKA 3FUJA 3PNTB 4ZHBA 3I4RB 1IYGA 4NIKA 2FULA 2B6CA 2EILE 3AG1E 3CGHA 2YQ8A 4CDNA 4EBAG 3CLJA 1HH8A 1ELRA 3CHRA 4CZ2D 3MEKA 4CT0A 4BT8A 3FUEA 3GZ1A 4J8YA 5C2YA 3TWVA 3IBEA 2EINE 3D9IA 1SQMA 4JHRA 3RU0A 5EKQD 4K5BA 2DZNA 1HG2A 1E8ZA 3ZGQA 3CVPA 1QQEA 4LCTA 1ELKA 3JXJA 3JQ1A 3D9PA 5EIBE 4AM9A 5CERB 4YVOA 4G24A 3LY9A 4OVVA 1V54E 4J7WA 3FU5A 2OEVA 2CG2A 5CRVA 3JQ0A 3LJ3A 4EECA 1D9SA 2V8SE 3FDHA 5HS0A 3CQGB 2HYZA 2PZIA 3GW4A 2EIKE 4GA2A 4LG6A 4HRLA 4GCNA 4UI9J 1WM5A 4AJWA 2P9NG 1HS6A 5D2MC 2YHCA 4U04A 3FTSA 1O1RA 1OCOE 4QFVA 1UG3A 2GRNB 3QJZA 4YDEA 3V2XA 3AG3E 5FZSA 3HVEB 5EIDA 3ZN3A 4GB9A 4TV3A 3NZUA 4ANXA 3ZYMA 4CT4A 4HLEA 4L23A 1N52A 3L6AA 3ZEFA 3U64A 2OCCE 3HYMB 3QC1A 4DRXE 4DPRA 4DUIA 2WXRA 4WUYA 3T5VA 1NA0A 2OVBA 1LF8A 2AXVA 3C5RA 5EYLA 2WMNA 2AXUA 4JXTA 3SNXA 3AS5A 4F1PA 3GZSA 5A6CA 3S2AA 4BSZB 4KVMA 4MLPA 3V30A 4TRQA 3TAXA 5FJYA 3Q9NC 2XGSA 1UW4B 3E30A 4GPMA 2PL2A 3PZ3A 5EN5D 3FY4A 4PDXA 4I2ZA 3BG1B 5AQAA 5CBNA 2V4HC 3ASNE 2F8XK 3CV0A 5AJLA 4ANUA 1UN8A 2VGXB 3L22A 3E37A 3TGOA 3MYVA 1S70B 4QQIA 4OYSA 2WXFA 2EIME 4HI9A 3O48A 1MX6A 4L1BA 4O60A 3TXMA 2VGXA 4J0UA 2I1KA 5FZRA 2L6JA 1N0RA 4ANVA 3ML8A 2HR2A 4NRHB 4EZLA 4JA7A 1GW6A 1TYQG 4NURA 3S7FA 3CK9A 3AS8A 4FC8A 2CFUA 4L7TA 5FTPA 1N11A 4XX5A 3FP3A 3MKRA 3ZNGA 5KJMA 4JEHA 4C0EA 4A63B 2AJAA 2Y0BG 1H2TC 3ABKE 2WXOA 4K5CA 3JUIA 2ZU6B 1ELWA 5ENRD 4N2SA 4I1MA 2KCLA 3QARA 1TJCA 4EZKA 3ML9A 3FUKA 4F1SA 4DI4A 4JA9A 3CHQA 3CVNA 3L08A 3TXNA 1JUQA 1BPOA 5D0OD 2M63A 4GMRA 1B89A 3DRAA 3MGBA 1FT2A 4R7LA 3APCA 3CR3A 3CVUA 3QOUA 4XE0A 1FVHA 4HORA 4LNUD 2MHKA 4UWFA 2XRZA 2XS1A 3PDNA 2Y4UA 3PEVB 3TWWA 3HDXA 2ONDA 3PZ1A 5LP0A 5KJKA 4TXRA 3UM2A 5FZQA 3J5QB 3TG4A 1D8DA 2ZGDA 2IFUA 3DBSA 5BV0A 4CGVA 1SA4A 2IQCA 2QZAA 5CECB 4BFRA 4KVOA 3KEZA 3ZVVA 4UWLA 3L13A 5LCWJ 4BESA 3KSQA 2V5FA 2BF0X 2P9UG 4GTRA 4I9EA 4APOA 2LSUA 1Z6TA 1EDUA 5EX3A 2R02A 3F6QA 2RKKA 3G2VA 3WXXA 2F8YA 1L5JA 2Q7FA 3FUIA 3ZHEB 4KBQA 1H0AA 3APFA 2XCBA 3FEYA 5ENTD 3T8MA 2R05A 3B7TA 2XPIA 3LXUX 5ENOD 1IQRA 4V3IA 3RIBA 3ESKA 3JUEA 4G8LA 2KCVA 3LS8A 4XKBA 3E34A 3ULQA 3NOGD 3D9HA 1HF8A 5H7PA 2UWJG 4XEIG 1WAO1 4UWKA 3SZ7A 3SQVA 5A7DB 3Q78A 3Q47B 3E33A 4UWHA 4A3TA 3TL5A 5KWDA 4GTOA 3ZRHA 1N95A 4JZYA 3PE4A 4G25A 3TJPA 5JA4D 2X6KA 3TWQA 2J09A 3FUHA 1OWMA 4HOQA 1QBQA 2ZISA 1IQUA 3LJNA 1Y6IA 4Y6WA 1MX4A 4HB5A 5FINA 1A17A 1TR4A 4FU3A 4DX5D 2XEVA 3CHMA 4IRUA 2RG8A 3HG0D 1P5QA 4EQFA 3LPZA 5EYPF 3D3MA 4YDOA 4Q96A 5ITZF 4G8KA 1KPSB 2AWIA 3G2TA 5AIJA 2WQHA 2P2CP 4FJZA 4I1OB 2CFZA 3QK0A 2VTBB 4I6GA 1N9AA 2EQXA 2B0OE 3IKOB 3CKCA 1SW6A 4WAFA 1ZB1A 3ONLA 4U0SA 2LXLA 3FTYA 5A23A 4MKTA 3FH7A 3I4GA 4GPKA 4Q69A 3URZA 3ZUVB 3NBNB 3CVQA 3ABLE 3DEPA 2XGOA 4HI8A 4JC8A 3PZ2A 3Q4AB 3HXCA 3HVEA 2VGEA 5BPPA 3IHYA 3DSWA 4GZ3A 4HQDA 5CMWA 2WXNA 4O6FA 3Q75A 3GYZA 3OXLA 5ENQD 1MHQA 2OOEA 3C3QA 2CHXA 1SA5A 4A3VA 1Z3XA 2WB2A 2LAHA 4Z68A 2V0PA 2Y1LE 1NI1A 5IY5E 1DCQA 3I3NA 4WWPA 3CIAA 5HQ8A 1U3CA 4BY6A 3EU5A 5G05J 3FTUA 3HXDA 3TWTA 4H7XA 3UIPC 3ZU7B 2GRLA 2WQ7A 2IF4A 1XNFA 3R9MA 5ANLA 4JL0A 5ARFA 5HKPA 4JHKA 1FCHA 2XZDG 1BU9A 2AW6A 4XIFA 2KZTB 1O1TA 3UT4A 4JW1A 4DLOA 2H6GA 5FQ8A 5JHAA 2CHZA 2IEJA 5BXUA 3CEQA 3OXGA 1E8WA 3DWLG 4G1TA 4B8AA 3LEWA 2AXZA 3LVRE 3CHPA 4C9BB 3TWRA 4U8VD 2FEZA 1QYMA 3CVLA 1QZ2A 2R5SA
chains in the Genus database with same CATH topology
1E8YA 2Y4TA 4L1BA 4CGWA 3TXMA 4WWOA 2VGXA 4BSXA 4J0UA 4UI9C 4AOFA 1HU3A 3QWWA 4H7YA 4D10C 2I1KA 5FZRA 2L6JA 2VSOE 5AYWD 5T8IA 1NP7A 3UX4A 5LOZA 4U8HA 3VTXA 4ANVA 4N3CA 4BTBA 2OV8A 3ML8A 4FADA 4WNEA 5FT9A 4AIFA 4A1GA 1ZBPA 3E4BA 2HR2A 3D9OA 4NRHB 3UMVA 3UUXA 4EZLA 1SZ9A 4JA7A 1INZA 1GW6A 2YHEA 3PS6A 4FHKA 4I9CA 4J6IA 4NURA 3S7FA 3CK7A 5DBKA 1HXIA 4OVUA 2VGYA 3CK9A 3HHMA 4G2VA 4ILIA 3AS8A 4FC8A 2CFUA 4RG9A 2J08A 5FQ6A 3LCAA 5G2NA 5EDSA 1HE8A 1KT0A 2AVPA 4L7TA 5FTPA 4EZJA 3IHVA 4BX9A 2KC7A 3ASFA 1N54A 3CHSA 3OXFA 4XX5A 3FEXA 3FTXA 3FP3A 1W3BA 1ZU2A 4PUCA 1IHGA 3FU0A 3SD5A 3RRNB 3MKRA 5KJMA 5BW8C 5CCLA 3NQPA 3R7RA 3VLFA 4JEHA 3Q5MA 2IONA 3QWVA 4FLBA 3RK6A 4Y6CA 2E0IA 3FULA 3G2SA 4NQ0A 4C0EA 4UQYA 4HOSA 3ZXSA 3PUKA 4AVXA 2HM8A 1H2TC 2NXPA 1X5BA 2L9BA 2WXOA 2WMOA 3L16A 3JUIA 2XQ0A 4C0MA 2DIWA 2J07A 2ZU6B 1ELWA 2A4ZA 3GZ2A 4WWNA 4N2SA 5LCWC 5LX8A 2XCCA 2KCLA 3MZLB 4I1MA 5AJDA 4ATGA 4DI3A 2WQ6A 3ZYQA 3QARA 3PEUB 3QWPA 4NACA 2GGFA 4GZCA 1TJCA 3FUMA 4EZKA 3ML9A 3FUFA 3JYSA 4PS8A 3FUKA 4F1SA 4DI4A 4LRZA 5KCMA 4JA9A 5JJ6A 2WPVA 2QY7A 3CHQA 4EBAA 3SF4A 3QKYA 1Y8MA 2PQRA 2LNIA 1NZNA 3CVNA 3JCKC 3KAEA 3ONKA 3L08A 4IULA 4I2WA 4L2YA 3APDA 5G05C 1JUQA 1BPOA 3TXNA 3B7UX 5D0OD 4E85A 4N2QA 2M63A 1B89A 3D9JA 3MGBA 4R7LA 4FA6A 3APCA 3TG5A 3U9WA 3CR3A 4N5CA 5AENA 3QOUA 3CVUA 4XE0A 1FVHA 5J90A 1KT1A 4HORA 1JWFA 2E2EA 2MOWA 3S7BA 3FTZA 2MHKA 4UWFA 3P1UA 2XRZA 2DCPA 4XI9A 4I1AA 5FQ4A 4KMOA 3T5XA 4HS2A 3PDNA 2Y4UA 3MKQB 3PEVB 1YA0A 4I6EA 3LYAA 4J8FA 5BNWA 5G55A 4GA1A 3HDXA 1OWNA 2ONDA 5FWQA 4ABNA 1E7UA 4DJAA 3CVVA 4HXIA 1HO8A 3RRUA 2LO6A 3SBTB 2VJ8A 3EIJA 3R7QA 1H2UA 5LP0A 3PE3A 5KJKA 3ZFWA 4F7AA 2OVFA 5FZQA 5T3RA 3U3WA 2BTDA 4CDMA 5KJNA 1FVFA 3ZW3A 1UJJA 3CSTA 3TG4A 5G04J 4G23A 2IJGX 4WNDA 5BT1A 5DIZA 2IFUA 3DBSA 5BV0A 3L17A 2WXQA 1TEZA 3MV2B 4CGVA 3EJNA 2IQCA 2WXIA 4MS6A 4BFRA 4L2LA 3KD7A 1OUVA 2I2OA 3KEZA 4KVOA 4WNGA 3ZVVA 2FO7A 1JWGA 4UWLA 2I1JA 3L13A 5LCWJ 3CVYA 4N39A 4BWRA 4CEMA 2V5FA 1UN9A 2XHEA 4J8SA 4MRUA 2BF0X 5BUZA 1HZ4A 2GRMA 4I9EA 4APOA 5BV1A 2LSUA 2XRYA 5E75A 3IV0A 3PREA 4HOTA 4M3OA 4F53A 1Z6TA 1DNPA 4ANWA 1EDUA 2VSXE 5EX3A 1VDYA 3FUNA 4IYPA 4GAAA 3ASHA 3R9AB 4GU5A 3G2VA 3WXXA 2XPZA 3NF1A 4PS7A 4WNFA 2IOSA 4GZ6A 4K03A 4J8DA 1L5JA 4UQXA 2Q7FA 4ILGA 4KT6B 3FUIA 4IN3B 1SZAA 3ZHEB 4KBQA 1H0AA 3APFA 2XCBA 3FEYA 3FU3A 4CDRA 3T8MA 2NC9A 2WXGA 3HIZA 4I17A 4B8CB 3B7TA 2WXLA 3UPVA 3PVLA 1QNFA 2Y3AA 2FI7A 3CVWA 2UY1B 2X6HA 1HX8A 2XPIA 3EIQC 4TUUA 1Z3YA 3LXUX 4FP7A 1IQRA 5ENNA 3I5PA 4V3IA 4EPZA 4CRWA 2KCKA 3RIBA 3RO3A 3VTYA 3ZIMA 3ESKA 4ME2A 4HOUA 5HI7A 1EYHA 1OWPA 2KCVA 2I9CA 3LS8A 3SHFA 3MCXA 1S0PA 4XKBA 3FTWA 4I43A 4N3BA 2KZTA 2X6JA 3LY8A 3ULQA 2J9QA 1HF8A 3SFZA 3CSFA 3PZDA 3RJVA 3DPDA 4B0ZA 2WM9A 3FH8A 2UWJG 2J49A 5D0QD 5FQ7A 1H6KA 2V4LA 1DVPA 5CCMA 3CQCB 3Q15A 5JJTA 3UT8A 4E6HA 2KATA 2P58C 4DK5A 4GYYA 3CVXA 1E8XA 1WAO1 3P2BA 2YNQA 4YVQC 4UWKA 2IOLA 3SZ7A 3ZYKA 3FUJA 4Q94A 5A7DB 3PNTB 3I4RB 4KZ0A 4APFA 5JJ7A 2L0IA 3Q47B 3K9IA 5CHEE 1IYGA 5T4YA 2WXPA 4GMJA 2FULA 4UWHA 4A3TA 3LVQE 4GMLA 4J8EA 3TL5A 3CGHA 2I6HA 2YQ8A 4CDNA 1EF1C 3ZRHA 1E90A 4EBAG 4JZYA 3PE4A 4G25A 3ZHEA 5J08A 3LKUA 3LY7A 3TJPA 1E96B 2X6KA 1KLXA 3CLJA 3QNKA 2X38A 1HH8A 1ELRA 2DBAA 2J09A 3CHRA 3CKBA 5M72A 3FUHA 4LEUA 2LSVA 3QAQA 2XGMA 3MEKA 3O4ZA 4CT0A 3FHEA 4BT8A 3FUEA 3GZ1A 1OWMA 4HOQA 1IQUA 5C2YA 1Y6IA 3IBEA 4Y6WA 3MX3A 4AEZC 3D9IA 4KXKB 1SQMA 4GYOA 4JHRA 1TJFA 3EDTB 4KYOB 3RU0A 5EKQD 1A17A 4FU3A 2JLBA 2XEVA 3CHMA 4IRUA 4JHJA 1OWLA 2RG8A 2JEKA 4ACKA 3SGHA 4AP2A 1P5QA 4EQFA 3LPZA 1HG2A 3D3MA 2PQNA 4Q96A 2NSZA 1E8ZA 3QB2A 3ZGQA 2PM7A 4XKCA 3CVPA 2R59A 1PY1A 1QQEA 3D9NA 2AWIA 1ELKA 3G2TA 3OAWA 4LCTA 3S7JA 5AIJA 3JQ1A 2WQHA 3D9PA 4FJZA 4I1OB 3FWVA 2CFZA 3QK0A 2WXMA 2L0TB 3AU4A 4AM9A 4U0UA 4LERA 2C2LA 2VTBB 4I6GA 3PRZA 3FUDA 1JPLA 4YVOA 3D9LA 1EPUA 4G24A 3LY9A 4OVVA 3FU5A 2X3MA 3UQ3A 2EQXA 1NA3A 2CG2A 3IKOB 3QDNA 3JQ0A 4A55A 3CKCA 3NZSA 4WAFA 1H19A 3LJ3A 4EECA 3ONLA 2CG3A 3PUJA 4U0SA 3MV3B 2V8SE 3FDHA 4XZ4A 3FTYA 5A23A 3CQGB 4MKTA 2HYZA 2PZIA 3FH7A 3GW4A 3MKQA 3I4GA 3FFLA 4GPKA 4Q69A 5E76A 3URZA 4GA2A 2R17C 2WXKA 4GCNA 3CVQA 3PNLB 2XGOA 2GW1A 3D9KA 2WVIA 4UI9J 3FH5A 4W9RA 1WM5A 2A5UA 4JC8A 4AJWA 1HS6A 2HO1A 2QFCA 2X6FA 2YHCA 4P29A 3RO2A 4AXHA 4U04A 3Q4AB 3ASGA 3MA5A 3FTSA 3HVEA 4QFVA 1UG3A 4JPSA 3B7RL 5BPPA 3IHYA 3QJZA 4GZ3A 1UJKA 2CHWA 3N71A 5G04C 5CMWA 2WXNA 4BT9A 4O6FA 5FZSA 3HVEB 3BEEA 3GYZA 4GYWA 4BX8A 3ZN3A 3OXLA 2VSYA 4GB9A 1MHQA 4JEUA 2OOEA 4LUNU 4U07A 2CHXA 3PH0C 4TV3A 3KS2A 1HG5A 2J4BA 1XGWA 4PS3A 3ZPJA 2J4DA 3NZUA 4A3VA 2VQ2A 4ANXA 1Z3XA 4PH4B 3B7SA 4UWGA 3ZYMA 4F3VA 2KM4A 4YNDA 2MRIA 3EHNA 4CT4A 4RSYA 4HLEA 2WB2A 4K0RA 3C98A 4L23A 2LAHA 1N52A 3L6AA 3L54A 3ZEFA 2V0PA 3U64A 3U4TA 3LDZA 4KZCA 2BUGA 3HYMB 4AV7A 3QC1A 4DPRA 3G2WA 2WXRA 4FJYA 4WUYA 3T5VA 1NA0A 2OVBA 3SBSA 1OWOA 3D9MA 3I3NA 4G11A 1LF8A 2AXVA 4U0ZA 4WWPA 3CIAA 5HQ8A 4AY6A 2C0LA 1U3CA 2XPYA 2PM6A 3OTNA 4BY6A 1MQSA 3SI5A 5G05J 3FTUA 4HFGA 5JHBA 4I6JA 2IU1A 3G2UA 4H7XA 2VTBA 2LAIA 4FHJA 2WMNA 2AXUA 4N3AA 4GA0A 4UI9K 3AU5A 1H2VC 4JXTA 2GRLA 1HFAA 2WXHA 1WY6A 2C0MA 3AS5A 3SNXA 2UY1A 4FLHA 4JVSA 2WQ7A 3UT7A 4ILHB 3GZSA 2YINA 4DLQA 3AS4A 4ACLA 2IF4A 3ESLA 1XNFA 5A6CA 3VLDA 3S2AA 5ANLA 4JL0A 4KVMA 5ARFA 4MLPA 5EX0A 3FU6A 3FTVA 4JHKA 4TRQA 1FCHA 3TAXA 5FJYA 4G26A 1PAQA 2XGSA 3CHOA 1UW4B 2WXJA 4URKA 2AW6A 4XIFA 2KZTB 2PL2A 3UT4A 3FY4A 2VYIA 4JW1A 4HVBA 4DLOA 3S7DA 2RD0A 2X6IA 4I2ZA 3BG1B 4PDXA 5FQ8A 3MJWA 4GZ5A 4B89A 4BTAA 5JHAA 2CHZA 3U66A 4GZDA 3IEGA 4AY5A 3CEQA 3CV0A 3OXGA 1E8WA 5AJLA 3RRMB 2FBNA 4UQZA 2FF4A 5C1DA 3ASDA 5ARGA 4B94A 4XI0A 4ANUA 3Q49B 1U3DA 1UN8A 3EHMA 4G1TA 2VGXB 3L22A 1E7VA 3LEWA 5CMYA 4B8AA 4CCAA 4RG6A 3VLEA 3TGOA 2AXZA 3BG0B 3LVRE 3MYVA 2VSNA 2ILRA 1PC2A 3CHPA 3ZYLA 3ENEA 4C9BB 3B13A 3CK8A 4OYSA 5ANRA 5KJLA 2FEZA 4RVBA 4U63A 4A1SA 2WXFA 4GCOA 3RKVA 4FULA 3CVLA 1QZ2A 3O48A 2R5SA 5LFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9B A;  4EBA G; 
#chains in the Genus database with same CATH topology
 3V31 A;  2Y4T A;  4CGW A;  4BSX A;  4H7Y A;  2VSO E;  3UX4 A;  2OV8 A;  4FAD A;  4WNE A;  3E4B A;  3UMV A;  3PS6 A;  4FHK A;  1HXI A;  1RW2 A;  2VGY A;  5AQ7 A;  1NFI E;  1OXJ A;  4G2V A;  4UUC A;  5FQ6 A;  2J08 A;  3LCA A;  5EDS A;  1KT0 A;  5D66 A;  4EZJ A;  3IHV A;  3CHS A;  1N54 A;  3OXF A;  4GTM A;  3FU0 A;  5AQ9 A;  3RRN B;  5BW8 C;  2H6F A;  3Q5M A;  2ION A;  3RK6 A;  4Y6C A;  2E0I A;  3FUL A;  3G2S A;  4NQ0 A;  3ZXS A;  4AVX A;  1TNO A;  2DZO A;  2L9B A;  1OCC E;  4C0M A;  2A4Z A;  5LCW C;  4B93 B;  4O1P A;  2XCC A;  3PEU B;  2GGF A;  3ASO E;  5JJ6 A;  5AAO A;  3UM3 A;  3AG4 E;  4EBA A;  3EHR A;  1Y8M A;  2LNI A;  3JCK C;  3KAE A;  4L2Y A;  3TWS A;  3APD A;  5G05 C;  3B7U X;  2FO1 E;  3C3R A;  5ENP D;  3U9W A;  1S64 A;  4BEP A;  3E32 A;  5B1B E;  3FTZ A;  2LUH A;  4XI9 A;  4I1A A;  3NOC D;  3MKQ B;  1JCQ A;  4DX6 D;  4GA1 A;  1OWN A;  4DJA A;  3UI2 A;  3NAW A;  3ZFW A;  2OVF A;  4F7A A;  2NYJ A;  3U3W A;  2BTD A;  4HBD A;  4CDM A;  1FVF A;  3ZW3 A;  1UJJ A;  3CST A;  1Z5S C;  5G04 J;  2IJG X;  5BT1 A;  5DIZ A;  2L6B A;  3Q7A A;  3L17 A;  4HRN A;  1TEZ A;  3UIO C;  2I2O A;  1LTX A;  1G3N B;  5HRY A;  3BQO A;  1H6P A;  4CEM A;  4X8Q A;  2JAB A;  4F53 A;  1DNP A;  2VSX E;  3FUN A;  1BI8 B;  1K8K G;  3ASH A;  3R9A B;  1MYO A;  2IOS A;  2IO2 C;  4GZ6 A;  3FU3 A;  2NC9 A;  4I17 A;  2WXL A;  3UPV A;  2Y3A A;  4U95 D;  2X6H A;  4TUU A;  4FP7 A;  2KCK A;  3RO3 A;  3UXG A;  3VTY A;  3ZIM A;  4ME2 A;  5HI7 A;  1OWP A;  2I9C A;  1S0P A;  4I43 A;  4N3B A;  2KZT A;  2X6J A;  2F0Y A;  5JMN D;  4BET A;  3CSF A;  3PZD A;  3DPD A;  2GRP B;  4GTQ A;  5FQ7 A;  2V4L A;  1Q2Z A;  4Q94 A;  4APF A;  5JJ7 A;  3DPY A;  4GMJ A;  3DSS A;  1E90 A;  3ZHE A;  2X38 A;  4DX7 D;  3CKB A;  2LSV A;  3QAQ A;  2XGM A;  3KEA A;  4AEZ C;  5BXO A;  3T9K A;  4KXK B;  4GYO A;  1TJF A;  4KYO B;  2ETC A;  4GTP A;  1OWL A;  4ACK A;  2JEK A;  3Q7F A;  3SGH A;  4AP2 A;  2EIJ E;  2PQN A;  2R59 A;  3D9N A;  3S7J A;  3OAW A;  2ETA A;  1WG0 A;  2KXP C;  2WXM A;  3PRZ A;  1N4P A;  3FUD A;  1S63 A;  2X3M A;  3DSV A;  5AAR A;  3HXF A;  3QDN A;  4A55 A;  1H19 A;  3PUJ A;  4TUM A;  2P9S G;  5KNG A;  4U8Y D;  3PNL B;  4W9R A;  2WVI A;  2A5U A;  2QYJ A;  2HO1 A;  3RO2 A;  2XEH A;  4AXH A;  3ASG A;  2V5Q C;  4OAV B;  2CHW A;  4BT9 A;  5CEA A;  2QYU A;  4BX8 A;  1H6O A;  4JEU A;  4U07 A;  2J4B A;  1AP7 A;  1XGW A;  4F3V A;  2KM4 A;  4YND A;  3EHN A;  1FT1 A;  4KZC A;  2BUG A;  4AV7 A;  4DX1 A;  5B1A E;  3V79 K;  4FJY A;  5FIO A;  2XZT G;  1OWO A;  3D9M A;  4G11 A;  4U0Z A;  2BED A;  2C0L A;  4AY6 A;  4ATZ D;  3SI5 A;  4HFG A;  4I6J A;  2IU1 A;  4LSZ E;  4FHJ A;  3AU5 A;  1H2V C;  1WY6 A;  2UY1 A;  4JVS A;  3UT7 A;  4ILH B;  4TXQ A;  2ETB A;  2YIN A;  4ACL A;  3ESL A;  1TNB A;  5EIL A;  1YMP A;  5EX0 A;  3FU6 A;  3FTV A;  1N4S A;  3BU8 A;  1PAQ A;  3DST A;  4G26 A;  4URK A;  2WXJ A;  1V55 E;  2VYI A;  4HVB A;  4K5A B;  3S7D A;  2GRR B;  2X6I A;  3MJW A;  4GZD A;  4AY5 A;  2P9P G;  2FBN A;  4UQZ A;  2FF4 A;  5C1D A;  3ASD A;  4B94 A;  3Q49 B;  1U3D A;  5CMY A;  4CCA A;  4RG6 A;  1YYH A;  3VLE A;  3BG0 B;  2ILR A;  4ZFH A;  3Q9U C;  4U63 A;  4U96 D;  1OCR E;  3RKV A;  4D10 C;  5LFA A;  4WWO A;  3ULE G;  5KBA A;  4AOF A;  3QWW A;  3SY2 A;  5AYW D;  5T8I A;  5LOZ A;  4N3C A;  4AIF A;  3SFY A;  4C48 B;  4J6I A;  5DBK A;  4EHM A;  1HE8 A;  2AVP A;  3UM1 A;  3ASF A;  3FEX A;  1W3B A;  1ZU2 A;  4PUC A;  1IHG A;  3SD5 A;  1AWC B;  1IXV A;  3R7R A;  3VLF A;  1BD8 A;  1TN8 A;  3IXE A;  3SO8 A;  4DX2 A;  4UQY A;  3L16 A;  2XQ0 A;  2J07 A;  4WWN A;  3UKR G;  2HE0 A;  3MZL B;  4ATG A;  2WQ6 A;  2R03 A;  4NAC A;  2XEE A;  3EUV A;  3FUM A;  4GZC A;  3FUF A;  3JYS A;  4LRZ A;  2WPV A;  3QKY A;  2PQR A;  3T5X A;  4I2W A;  2RFM A;  4E85 A;  3TG5 A;  2DYS E;  5J90 A;  1KT1 A;  3DXM G;  1JWF A;  3TWU A;  2MOW A;  3P1U A;  3ZKJ A;  5FQ4 A;  1U2V G;  3L82 A;  3X2Q E;  5CRU A;  1YA0 A;  4I6E A;  5BNW A;  5G55 A;  1DCE A;  5FWQ A;  4ABN A;  1LD8 A;  3CVV A;  3ABM E;  4HXI A;  1HO8 A;  3RRU A;  3SBT B;  3EIJ A;  1H2U A;  3W9F A;  3PE3 A;  3DSU A;  5T3R A;  3DEO A;  3T8K A;  2ZXW E;  2KBX A;  4G23 A;  1WDY A;  2WXQ A;  3MV2 B;  3TWX A;  1TNY A;  2WXI A;  4MS6 A;  4L2L A;  1A5E A;  1DC2 A;  1JWG A;  1MJ0 A;  4BER A;  1MX2 A;  1UN9 A;  2XHE A;  4J8S A;  4MRU A;  5KNH D;  1HZ4 A;  2GRM A;  5BV1 A;  2XRY A;  5E75 A;  4IYP A;  4GAA A;  3NF1 A;  4PS7 A;  4K03 A;  4UQX A;  4KT6 B;  3SFX A;  4CDR A;  3HIZ A;  4B8C B;  3PVL A;  2FI7 A;  3CVW A;  2UY1 B;  2IY0 C;  1HX8 A;  1N94 A;  5ENN A;  3I5P A;  4CRW A;  1YCS B;  4HOU A;  4RQI A;  3SHF A;  3B95 A;  3MCX A;  2A5E A;  2J9Q A;  3SFZ A;  4B0Z A;  2WM9 A;  5D0Q D;  2J49 A;  3ULY A;  1H6K A;  1DVP A;  5CCM A;  3CQC B;  3Q15 A;  3UT8 A;  4E6H A;  2KAT A;  4DK5 A;  4GYY A;  3W9G A;  3P2B A;  2YNQ A;  4KZ0 A;  2L0I A;  1TN7 A;  3K9I A;  5CHE E;  1O5M A;  5T4Y A;  2WXP A;  1N0Q A;  3LVQ E;  4GML A;  4J8E A;  2I6H A;  1K1B A;  3B7B A;  1EF1 C;  1O1S A;  1D8E A;  5J08 A;  3LKU A;  3LY7 A;  1E96 B;  3QNK A;  1KLX A;  2OEW A;  2DBA A;  5M72 A;  4LEU A;  3O4Z A;  5CED B;  3JXI A;  3FHE A;  1OT8 A;  1IKN D;  2J8S D;  3DSX A;  3MX3 A;  4LNG A;  3EDT B;  1BI7 B;  2JLB A;  1TN6 A;  4JHJ A;  5AN8 A;  2NSZ A;  3UKU G;  3QB2 A;  3ZXP A;  2PM7 A;  4XKC A;  1PY1 A;  2H6H A;  5ENS D;  2DYR E;  3FWV A;  4HNA D;  4N5Q A;  2L0T B;  3AU4 A;  1SVX A;  3C3O A;  4U0U A;  4LER A;  2C2L A;  1RZ4 A;  1JPL A;  4O1O A;  3D9L A;  1EPU A;  3UQ3 A;  1NA3 A;  5CBO A;  3NZS A;  2CG3 A;  3MV3 B;  4YDY A;  4XZ4 A;  3MKQ A;  3FFL A;  5E76 A;  1TNZ A;  2R17 C;  2WXK A;  2GW1 A;  3D9K A;  3FH5 A;  4HLL A;  4YDW A;  2QFC A;  2X6F A;  4P29 A;  3MA5 A;  3C72 A;  4JPS A;  3B7R L;  3L9T A;  4LNB A;  3AJI A;  1UJK A;  3N71 A;  5G04 C;  3BEE A;  4GYW A;  2GRQ B;  2VSY A;  4LUN U;  3PH0 C;  3KS2 A;  1HG5 A;  3PZ4 A;  4PS3 A;  3ZPJ A;  2J4D A;  2VQ2 A;  4PH4 B;  3B7S A;  4UWG A;  2MRI A;  4RSY A;  4K0R A;  3C98 A;  4GTV A;  3L54 A;  1JCS A;  3U4T A;  3LDZ A;  2H6I A;  3G2W A;  3SBS A;  4M7C A;  1N4Q A;  1OY3 D;  2XPY A;  2PM6 A;  3OTN A;  1MQS A;  3AG2 E;  5JHB A;  4F6R D;  3G2U A;  2VTB A;  2LAI A;  4N3A A;  4GA0 A;  4UI9 K;  2WXH A;  1HFA A;  2C0M A;  4FLH A;  4DLQ A;  3AS4 A;  3VLD A;  4RLY A;  4HRM B;  3CHO A;  3KSL A;  2RD0 A;  2DVW A;  4GZ5 A;  3ISM C;  4B89 A;  4BTA A;  3U66 A;  3IEG A;  3RRM B;  5ARG A;  4XI0 A;  3EHM A;  1E7V A;  3J5P A;  2P9K G;  3RAU A;  2VSN A;  1PC2 A;  3ZYL A;  3ENE A;  3B13 A;  3CK8 A;  5ANR A;  5KJL A;  3EU9 A;  4RVB A;  4A1S A;  4GCO A;  4FUL A;  1E8Y A;  1MZC A;  4TXP A;  2MYO A;  3DXK G;  4UI9 C;  1HU3 A;  1NP7 A;  2Y69 E;  4U8H A;  3VTX A;  4BTB A;  5FT9 A;  4A1G A;  2P9I G;  1ZBP A;  2DWZ A;  3D9O A;  3UUX A;  1SZ9 A;  1INZ A;  2YHE A;  4I9C A;  2P9L G;  3CK7 A;  4OVU A;  3HHM A;  4RG9 A;  4ILI A;  5G2N A;  4BX9 A;  3UM0 A;  2KC7 A;  2IO3 C;  3FTX A;  3UIN C;  5CCL A;  3NQP A;  4FLB A;  3QWV A;  4HOS A;  3PUK A;  2HM8 A;  2RFA A;  2NXP A;  1X5B A;  2R2L A;  2WMO A;  2DIW A;  3GZ2 A;  5LX8 A;  4GTT A;  5AJD A;  1KZO A;  4JB8 P;  3ZYQ A;  3QWP A;  2ZGG A;  3RSE G;  4PS8 A;  4GTS A;  5KCM A;  2F37 A;  4JD2 G;  2QY7 A;  4MBG A;  3SF4 A;  1NZN A;  4IUL A;  4DI3 A;  3ONK A;  1LD7 A;  4N2Q A;  3D9J A;  4FA6 A;  3WG7 E;  4N5C A;  5AEN A;  3V2O A;  4OAU C;  2E2E A;  3S7B A;  2DCP A;  2LXM A;  4KMO A;  4HS2 A;  2ZIR A;  1X81 A;  3LYA A;  4J8F A;  1E7U A;  2LO6 A;  2VJ8 A;  3R7Q A;  3BUA A;  4L9P A;  1IHB A;  3EHQ A;  1TNU A;  5KJN A;  4WND A;  3AAA C;  3Q79 A;  3EJN A;  3KD7 A;  1OUV A;  4WNG A;  2FO7 A;  2QC9 A;  2I1J A;  3CVY A;  4N39 A;  4BWR A;  5AQB A;  5BUZ A;  1FPP A;  1BLX B;  4CYM D;  3IV0 A;  3PRE A;  4HOT A;  4M3O A;  4ANW A;  1VDY A;  2PNN A;  2XS8 A;  4GU5 A;  2XPZ A;  4WNF A;  3HXB A;  4J8D A;  3Q73 A;  2GRO B;  1UOH A;  4ILG A;  4IN3 B;  1SZA A;  2BKK B;  2WXG A;  1QNF A;  3HRA A;  3EIQ C;  2BKG A;  1Z3Y A;  4EPZ A;  3NB2 A;  2XEN A;  1EYH A;  3FTW A;  1JCR A;  3LY8 A;  1N4R A;  1K3Z D;  5B3S E;  1OCZ E;  1NL4 A;  3RJV A;  3UTM A;  3FH8 A;  1K1A A;  1KZP A;  5JJT A;  2P58 C;  3CVX A;  4U7E B;  1E8X A;  4YVQ C;  2IOL A;  3HXE A;  3ZYK A;  3FUJ A;  3PNT B;  4ZHB A;  3I4R B;  1IYG A;  4NIK A;  2FUL A;  2B6C A;  2EIL E;  3AG1 E;  3CGH A;  2YQ8 A;  4CDN A;  4EBA G;  3CLJ A;  1HH8 A;  1ELR A;  3CHR A;  4CZ2 D;  3MEK A;  4CT0 A;  4BT8 A;  3FUE A;  3GZ1 A;  4J8Y A;  5C2Y A;  3TWV A;  3IBE A;  2EIN E;  3D9I A;  1SQM A;  4JHR A;  3RU0 A;  5EKQ D;  4K5B A;  2DZN A;  1HG2 A;  1E8Z A;  3ZGQ A;  3CVP A;  1QQE A;  4LCT A;  1ELK A;  3JXJ A;  3JQ1 A;  3D9P A;  5EIB E;  4AM9 A;  5CER B;  4YVO A;  4G24 A;  3LY9 A;  4OVV A;  1V54 E;  4J7W A;  3FU5 A;  2OEV A;  2CG2 A;  5CRV A;  3JQ0 A;  3LJ3 A;  4EEC A;  1D9S A;  2V8S E;  3FDH A;  5HS0 A;  3CQG B;  2HYZ A;  2PZI A;  3GW4 A;  2EIK E;  4GA2 A;  4LG6 A;  4HRL A;  4GCN A;  4UI9 J;  1WM5 A;  4AJW A;  2P9N G;  1HS6 A;  5D2M C;  2YHC A;  4U04 A;  3FTS A;  1O1R A;  1OCO E;  4QFV A;  1UG3 A;  2GRN B;  3QJZ A;  4YDE A;  3V2X A;  3AG3 E;  5FZS A;  3HVE B;  5EID A;  3ZN3 A;  4GB9 A;  4TV3 A;  3NZU A;  4ANX A;  3ZYM A;  4CT4 A;  4HLE A;  4L23 A;  1N52 A;  3L6A A;  3ZEF A;  3U64 A;  2OCC E;  3HYM B;  3QC1 A;  4DRX E;  4DPR A;  4DUI A;  2WXR A;  4WUY A;  3T5V A;  1NA0 A;  2OVB A;  1LF8 A;  2AXV A;  3C5R A;  5EYL A;  2WMN A;  2AXU A;  4JXT A;  3SNX A;  3AS5 A;  4F1P A;  3GZS A;  5A6C A;  3S2A A;  4BSZ B;  4KVM A;  4MLP A;  3V30 A;  4TRQ A;  3TAX A;  5FJY A;  3Q9N C;  2XGS A;  1UW4 B;  3E30 A;  4GPM A;  2PL2 A;  3PZ3 A;  5EN5 D;  3FY4 A;  4PDX A;  4I2Z A;  3BG1 B;  5AQA A;  5CBN A;  2V4H C;  3ASN E;  2F8X K;  3CV0 A;  5AJL A;  4ANU A;  1UN8 A;  2VGX B;  3L22 A;  3E37 A;  3TGO A;  3MYV A;  1S70 B;  4QQI A;  4OYS A;  2WXF A;  2EIM E;  4HI9 A;  3O48 A;  1MX6 A;  4L1B A;  4O60 A;  3TXM A;  2VGX A;  4J0U A;  2I1K A;  5FZR A;  2L6J A;  1N0R A;  4ANV A;  3ML8 A;  2HR2 A;  4NRH B;  4EZL A;  4JA7 A;  1GW6 A;  1TYQ G;  4NUR A;  3S7F A;  3CK9 A;  3AS8 A;  4FC8 A;  2CFU A;  4L7T A;  5FTP A;  1N11 A;  4XX5 A;  3FP3 A;  3MKR A;  3ZNG A;  5KJM A;  4JEH A;  4C0E A;  4A63 B;  2AJA A;  2Y0B G;  1H2T C;  3ABK E;  2WXO A;  4K5C A;  3JUI A;  2ZU6 B;  1ELW A;  5ENR D;  4N2S A;  4I1M A;  2KCL A;  3QAR A;  1TJC A;  4EZK A;  3ML9 A;  3FUK A;  4F1S A;  4DI4 A;  4JA9 A;  3CHQ A;  3CVN A;  3L08 A;  3TXN A;  1JUQ A;  1BPO A;  5D0O D;  2M63 A;  4GMR A;  1B89 A;  3DRA A;  3MGB A;  1FT2 A;  4R7L A;  3APC A;  3CR3 A;  3CVU A;  3QOU A;  4XE0 A;  1FVH A;  4HOR A;  4LNU D;  2MHK A;  4UWF A;  2XRZ A;  2XS1 A;  3PDN A;  2Y4U A;  3PEV B;  3TWW A;  3HDX A;  2OND A;  3PZ1 A;  5LP0 A;  5KJK A;  4TXR A;  3UM2 A;  5FZQ A;  3J5Q B;  3TG4 A;  1D8D A;  2ZGD A;  2IFU A;  3DBS A;  5BV0 A;  4CGV A;  1SA4 A;  2IQC A;  2QZA A;  5CEC B;  4BFR A;  4KVO A;  3KEZ A;  3ZVV A;  4UWL A;  3L13 A;  5LCW J;  4BES A;  3KSQ A;  2V5F A;  2BF0 X;  2P9U G;  4GTR A;  4I9E A;  4APO A;  2LSU A;  1Z6T A;  1EDU A;  5EX3 A;  2R02 A;  3F6Q A;  2RKK A;  3G2V A;  3WXX A;  2F8Y A;  1L5J A;  2Q7F A;  3FUI A;  3ZHE B;  4KBQ A;  1H0A A;  3APF A;  2XCB A;  3FEY A;  5ENT D;  3T8M A;  2R05 A;  3B7T A;  2XPI A;  3LXU X;  5ENO D;  1IQR A;  4V3I A;  3RIB A;  3ESK A;  3JUE A;  4G8L A;  2KCV A;  3LS8 A;  4XKB A;  3E34 A;  3ULQ A;  3NOG D;  3D9H A;  1HF8 A;  5H7P A;  2UWJ G;  4XEI G;  1WAO 1;  4UWK A;  3SZ7 A;  3SQV A;  5A7D B;  3Q78 A;  3Q47 B;  3E33 A;  4UWH A;  4A3T A;  3TL5 A;  5KWD A;  4GTO A;  3ZRH A;  1N95 A;  4JZY A;  3PE4 A;  4G25 A;  3TJP A;  5JA4 D;  2X6K A;  3TWQ A;  2J09 A;  3FUH A;  1OWM A;  4HOQ A;  1QBQ A;  2ZIS A;  1IQU A;  3LJN A;  1Y6I A;  4Y6W A;  1MX4 A;  4HB5 A;  5FIN A;  1A17 A;  1TR4 A;  4FU3 A;  4DX5 D;  2XEV A;  3CHM A;  4IRU A;  2RG8 A;  3HG0 D;  1P5Q A;  4EQF A;  3LPZ A;  5EYP F;  3D3M A;  4YDO A;  4Q96 A;  5ITZ F;  4G8K A;  1KPS B;  2AWI A;  3G2T A;  5AIJ A;  2WQH A;  2P2C P;  4FJZ A;  4I1O B;  2CFZ A;  3QK0 A;  2VTB B;  4I6G A;  1N9A A;  2EQX A;  2B0O E;  3IKO B;  3CKC A;  1SW6 A;  4WAF A;  1ZB1 A;  3ONL A;  4U0S A;  2LXL A;  3FTY A;  5A23 A;  4MKT A;  3FH7 A;  3I4G A;  4GPK A;  4Q69 A;  3URZ A;  3ZUV B;  3NBN B;  3CVQ A;  3ABL E;  3DEP A;  2XGO A;  4HI8 A;  4JC8 A;  3PZ2 A;  3Q4A B;  3HXC A;  3HVE A;  2VGE A;  5BPP A;  3IHY A;  3DSW A;  4GZ3 A;  4HQD A;  5CMW A;  2WXN A;  4O6F A;  3Q75 A;  3GYZ A;  3OXL A;  5ENQ D;  1MHQ A;  2OOE A;  3C3Q A;  2CHX A;  1SA5 A;  4A3V A;  1Z3X A;  2WB2 A;  2LAH A;  4Z68 A;  2V0P A;  2Y1L E;  1NI1 A;  5IY5 E;  1DCQ A;  3I3N A;  4WWP A;  3CIA A;  5HQ8 A;  1U3C A;  4BY6 A;  3EU5 A;  5G05 J;  3FTU A;  3HXD A;  3TWT A;  4H7X A;  3UIP C;  3ZU7 B;  2GRL A;  2WQ7 A;  2IF4 A;  1XNF A;  3R9M A;  5ANL A;  4JL0 A;  5ARF A;  5HKP A;  4JHK A;  1FCH A;  2XZD G;  1BU9 A;  2AW6 A;  4XIF A;  2KZT B;  1O1T A;  3UT4 A;  4JW1 A;  4DLO A;  2H6G A;  5FQ8 A;  5JHA A;  2CHZ A;  2IEJ A;  5BXU A;  3CEQ A;  3OXG A;  1E8W A;  3DWL G;  4G1T A;  4B8A A;  3LEW A;  2AXZ A;  3LVR E;  3CHP A;  4C9B B;  3TWR A;  4U8V D;  2FEZ A;  1QYM A;  3CVL A;  1QZ2 A;  2R5S A; 
#chains in the Genus database with same CATH homology
 1E8Y A;  2Y4T A;  4L1B A;  4CGW A;  3TXM A;  4WWO A;  2VGX A;  4BSX A;  4J0U A;  4UI9 C;  4AOF A;  1HU3 A;  3QWW A;  4H7Y A;  4D10 C;  2I1K A;  5FZR A;  2L6J A;  2VSO E;  5AYW D;  5T8I A;  1NP7 A;  3UX4 A;  5LOZ A;  4U8H A;  3VTX A;  4ANV A;  4N3C A;  4BTB A;  2OV8 A;  3ML8 A;  4FAD A;  4WNE A;  5FT9 A;  4AIF A;  4A1G A;  1ZBP A;  3E4B A;  2HR2 A;  3D9O A;  4NRH B;  3UMV A;  3UUX A;  4EZL A;  1SZ9 A;  4JA7 A;  1INZ A;  1GW6 A;  2YHE A;  3PS6 A;  4FHK A;  4I9C A;  4J6I A;  4NUR A;  3S7F A;  3CK7 A;  5DBK A;  1HXI A;  4OVU A;  2VGY A;  3CK9 A;  3HHM A;  4G2V A;  4ILI A;  3AS8 A;  4FC8 A;  2CFU A;  4RG9 A;  2J08 A;  5FQ6 A;  3LCA A;  5G2N A;  5EDS A;  1HE8 A;  1KT0 A;  2AVP A;  4L7T A;  5FTP A;  4EZJ A;  3IHV A;  4BX9 A;  2KC7 A;  3ASF A;  1N54 A;  3CHS A;  3OXF A;  4XX5 A;  3FEX A;  3FTX A;  3FP3 A;  1W3B A;  1ZU2 A;  4PUC A;  1IHG A;  3FU0 A;  3SD5 A;  3RRN B;  3MKR A;  5KJM A;  5BW8 C;  5CCL A;  3NQP A;  3R7R A;  3VLF A;  4JEH A;  3Q5M A;  2ION A;  3QWV A;  4FLB A;  3RK6 A;  4Y6C A;  2E0I A;  3FUL A;  3G2S A;  4NQ0 A;  4C0E A;  4UQY A;  4HOS A;  3ZXS A;  3PUK A;  4AVX A;  2HM8 A;  1H2T C;  2NXP A;  1X5B A;  2L9B A;  2WXO A;  2WMO A;  3L16 A;  3JUI A;  2XQ0 A;  4C0M A;  2DIW A;  2J07 A;  2ZU6 B;  1ELW A;  2A4Z A;  3GZ2 A;  4WWN A;  4N2S A;  5LCW C;  5LX8 A;  2XCC A;  2KCL A;  3MZL B;  4I1M A;  5AJD A;  4ATG A;  4DI3 A;  2WQ6 A;  3ZYQ A;  3QAR A;  3PEU B;  3QWP A;  4NAC A;  2GGF A;  4GZC A;  1TJC A;  3FUM A;  4EZK A;  3ML9 A;  3FUF A;  3JYS A;  4PS8 A;  3FUK A;  4F1S A;  4DI4 A;  4LRZ A;  5KCM A;  4JA9 A;  5JJ6 A;  2WPV A;  2QY7 A;  3CHQ A;  4EBA A;  3SF4 A;  3QKY A;  1Y8M A;  2PQR A;  2LNI A;  1NZN A;  3CVN A;  3JCK C;  3KAE A;  3ONK A;  3L08 A;  4IUL A;  4I2W A;  4L2Y A;  3APD A;  5G05 C;  1JUQ A;  1BPO A;  3TXN A;  3B7U X;  5D0O D;  4E85 A;  4N2Q A;  2M63 A;  1B89 A;  3D9J A;  3MGB A;  4R7L A;  4FA6 A;  3APC A;  3TG5 A;  3U9W A;  3CR3 A;  4N5C A;  5AEN A;  3QOU A;  3CVU A;  4XE0 A;  1FVH A;  5J90 A;  1KT1 A;  4HOR A;  1JWF A;  2E2E A;  2MOW A;  3S7B A;  3FTZ A;  2MHK A;  4UWF A;  3P1U A;  2XRZ A;  2DCP A;  4XI9 A;  4I1A A;  5FQ4 A;  4KMO A;  3T5X A;  4HS2 A;  3PDN A;  2Y4U A;  3MKQ B;  3PEV B;  1YA0 A;  4I6E A;  3LYA A;  4J8F A;  5BNW A;  5G55 A;  4GA1 A;  3HDX A;  1OWN A;  2OND A;  5FWQ A;  4ABN A;  1E7U A;  4DJA A;  3CVV A;  4HXI A;  1HO8 A;  3RRU A;  2LO6 A;  3SBT B;  2VJ8 A;  3EIJ A;  3R7Q A;  1H2U A;  5LP0 A;  3PE3 A;  5KJK A;  3ZFW A;  4F7A A;  2OVF A;  5FZQ A;  5T3R A;  3U3W A;  2BTD A;  4CDM A;  5KJN A;  1FVF A;  3ZW3 A;  1UJJ A;  3CST A;  3TG4 A;  5G04 J;  4G23 A;  2IJG X;  4WND A;  5BT1 A;  5DIZ A;  2IFU A;  3DBS A;  5BV0 A;  3L17 A;  2WXQ A;  1TEZ A;  3MV2 B;  4CGV A;  3EJN A;  2IQC A;  2WXI A;  4MS6 A;  4BFR A;  4L2L A;  3KD7 A;  1OUV A;  2I2O A;  3KEZ A;  4KVO A;  4WNG A;  3ZVV A;  2FO7 A;  1JWG A;  4UWL A;  2I1J A;  3L13 A;  5LCW J;  3CVY A;  4N39 A;  4BWR A;  4CEM A;  2V5F A;  1UN9 A;  2XHE A;  4J8S A;  4MRU A;  2BF0 X;  5BUZ A;  1HZ4 A;  2GRM A;  4I9E A;  4APO A;  5BV1 A;  2LSU A;  2XRY A;  5E75 A;  3IV0 A;  3PRE A;  4HOT A;  4M3O A;  4F53 A;  1Z6T A;  1DNP A;  4ANW A;  1EDU A;  2VSX E;  5EX3 A;  1VDY A;  3FUN A;  4IYP A;  4GAA A;  3ASH A;  3R9A B;  4GU5 A;  3G2V A;  3WXX A;  2XPZ A;  3NF1 A;  4PS7 A;  4WNF A;  2IOS A;  4GZ6 A;  4K03 A;  4J8D A;  1L5J A;  4UQX A;  2Q7F A;  4ILG A;  4KT6 B;  3FUI A;  4IN3 B;  1SZA A;  3ZHE B;  4KBQ A;  1H0A A;  3APF A;  2XCB A;  3FEY A;  3FU3 A;  4CDR A;  3T8M A;  2NC9 A;  2WXG A;  3HIZ A;  4I17 A;  4B8C B;  3B7T A;  2WXL A;  3UPV A;  3PVL A;  1QNF A;  2Y3A A;  2FI7 A;  3CVW A;  2UY1 B;  2X6H A;  1HX8 A;  2XPI A;  3EIQ C;  4TUU A;  1Z3Y A;  3LXU X;  4FP7 A;  1IQR A;  5ENN A;  3I5P A;  4V3I A;  4EPZ A;  4CRW A;  2KCK A;  3RIB A;  3RO3 A;  3VTY A;  3ZIM A;  3ESK A;  4ME2 A;  4HOU A;  5HI7 A;  1EYH A;  1OWP A;  2KCV A;  2I9C A;  3LS8 A;  3SHF A;  3MCX A;  1S0P A;  4XKB A;  3FTW A;  4I43 A;  4N3B A;  2KZT A;  2X6J A;  3LY8 A;  3ULQ A;  2J9Q A;  1HF8 A;  3SFZ A;  3CSF A;  3PZD A;  3RJV A;  3DPD A;  4B0Z A;  2WM9 A;  3FH8 A;  2UWJ G;  2J49 A;  5D0Q D;  5FQ7 A;  1H6K A;  2V4L A;  1DVP A;  5CCM A;  3CQC B;  3Q15 A;  5JJT A;  3UT8 A;  4E6H A;  2KAT A;  2P58 C;  4DK5 A;  4GYY A;  3CVX A;  1E8X A;  1WAO 1;  3P2B A;  2YNQ A;  4YVQ C;  4UWK A;  2IOL A;  3SZ7 A;  3ZYK A;  3FUJ A;  4Q94 A;  5A7D B;  3PNT B;  3I4R B;  4KZ0 A;  4APF A;  5JJ7 A;  2L0I A;  3Q47 B;  3K9I A;  5CHE E;  1IYG A;  5T4Y A;  2WXP A;  4GMJ A;  2FUL A;  4UWH A;  4A3T A;  3LVQ E;  4GML A;  4J8E A;  3TL5 A;  3CGH A;  2I6H A;  2YQ8 A;  4CDN A;  1EF1 C;  3ZRH A;  1E90 A;  4EBA G;  4JZY A;  3PE4 A;  4G25 A;  3ZHE A;  5J08 A;  3LKU A;  3LY7 A;  3TJP A;  1E96 B;  2X6K A;  1KLX A;  3CLJ A;  3QNK A;  2X38 A;  1HH8 A;  1ELR A;  2DBA A;  2J09 A;  3CHR A;  3CKB A;  5M72 A;  3FUH A;  4LEU A;  2LSV A;  3QAQ A;  2XGM A;  3MEK A;  3O4Z A;  4CT0 A;  3FHE A;  4BT8 A;  3FUE A;  3GZ1 A;  1OWM A;  4HOQ A;  1IQU A;  5C2Y A;  1Y6I A;  3IBE A;  4Y6W A;  3MX3 A;  4AEZ C;  3D9I A;  4KXK B;  1SQM A;  4GYO A;  4JHR A;  1TJF A;  3EDT B;  4KYO B;  3RU0 A;  5EKQ D;  1A17 A;  4FU3 A;  2JLB A;  2XEV A;  3CHM A;  4IRU A;  4JHJ A;  1OWL A;  2RG8 A;  2JEK A;  4ACK A;  3SGH A;  4AP2 A;  1P5Q A;  4EQF A;  3LPZ A;  1HG2 A;  3D3M A;  2PQN A;  4Q96 A;  2NSZ A;  1E8Z A;  3QB2 A;  3ZGQ A;  2PM7 A;  4XKC A;  3CVP A;  2R59 A;  1PY1 A;  1QQE A;  3D9N A;  2AWI A;  1ELK A;  3G2T A;  3OAW A;  4LCT A;  3S7J A;  5AIJ A;  3JQ1 A;  2WQH A;  3D9P A;  4FJZ A;  4I1O B;  3FWV A;  2CFZ A;  3QK0 A;  2WXM A;  2L0T B;  3AU4 A;  4AM9 A;  4U0U A;  4LER A;  2C2L A;  2VTB B;  4I6G A;  3PRZ A;  3FUD A;  1JPL A;  4YVO A;  3D9L A;  1EPU A;  4G24 A;  3LY9 A;  4OVV A;  3FU5 A;  2X3M A;  3UQ3 A;  2EQX A;  1NA3 A;  2CG2 A;  3IKO B;  3QDN A;  3JQ0 A;  4A55 A;  3CKC A;  3NZS A;  4WAF A;  1H19 A;  3LJ3 A;  4EEC A;  3ONL A;  2CG3 A;  3PUJ A;  4U0S A;  3MV3 B;  2V8S E;  3FDH A;  4XZ4 A;  3FTY A;  5A23 A;  3CQG B;  4MKT A;  2HYZ A;  2PZI A;  3FH7 A;  3GW4 A;  3MKQ A;  3I4G A;  3FFL A;  4GPK A;  4Q69 A;  5E76 A;  3URZ A;  4GA2 A;  2R17 C;  2WXK A;  4GCN A;  3CVQ A;  3PNL B;  2XGO A;  2GW1 A;  3D9K A;  2WVI A;  4UI9 J;  3FH5 A;  4W9R A;  1WM5 A;  2A5U A;  4JC8 A;  4AJW A;  1HS6 A;  2HO1 A;  2QFC A;  2X6F A;  2YHC A;  4P29 A;  3RO2 A;  4AXH A;  4U04 A;  3Q4A B;  3ASG A;  3MA5 A;  3FTS A;  3HVE A;  4QFV A;  1UG3 A;  4JPS A;  3B7R L;  5BPP A;  3IHY A;  3QJZ A;  4GZ3 A;  1UJK A;  2CHW A;  3N71 A;  5G04 C;  5CMW A;  2WXN A;  4BT9 A;  4O6F A;  5FZS A;  3HVE B;  3BEE A;  3GYZ A;  4GYW A;  4BX8 A;  3ZN3 A;  3OXL A;  2VSY A;  4GB9 A;  1MHQ A;  4JEU A;  2OOE A;  4LUN U;  4U07 A;  2CHX A;  3PH0 C;  4TV3 A;  3KS2 A;  1HG5 A;  2J4B A;  1XGW A;  4PS3 A;  3ZPJ A;  2J4D A;  3NZU A;  4A3V A;  2VQ2 A;  4ANX A;  1Z3X A;  4PH4 B;  3B7S A;  4UWG A;  3ZYM A;  4F3V A;  2KM4 A;  4YND A;  2MRI A;  3EHN A;  4CT4 A;  4RSY A;  4HLE A;  2WB2 A;  4K0R A;  3C98 A;  4L23 A;  2LAH A;  1N52 A;  3L6A A;  3L54 A;  3ZEF A;  2V0P A;  3U64 A;  3U4T A;  3LDZ A;  4KZC A;  2BUG A;  3HYM B;  4AV7 A;  3QC1 A;  4DPR A;  3G2W A;  2WXR A;  4FJY A;  4WUY A;  3T5V A;  1NA0 A;  2OVB A;  3SBS A;  1OWO A;  3D9M A;  3I3N A;  4G11 A;  1LF8 A;  2AXV A;  4U0Z A;  4WWP A;  3CIA A;  5HQ8 A;  4AY6 A;  2C0L A;  1U3C A;  2XPY A;  2PM6 A;  3OTN A;  4BY6 A;  1MQS A;  3SI5 A;  5G05 J;  3FTU A;  4HFG A;  5JHB A;  4I6J A;  2IU1 A;  3G2U A;  4H7X A;  2VTB A;  2LAI A;  4FHJ A;  2WMN A;  2AXU A;  4N3A A;  4GA0 A;  4UI9 K;  3AU5 A;  1H2V C;  4JXT A;  2GRL A;  1HFA A;  2WXH A;  1WY6 A;  2C0M A;  3AS5 A;  3SNX A;  2UY1 A;  4FLH A;  4JVS A;  2WQ7 A;  3UT7 A;  4ILH B;  3GZS A;  2YIN A;  4DLQ A;  3AS4 A;  4ACL A;  2IF4 A;  3ESL A;  1XNF A;  5A6C A;  3VLD A;  3S2A A;  5ANL A;  4JL0 A;  4KVM A;  5ARF A;  4MLP A;  5EX0 A;  3FU6 A;  3FTV A;  4JHK A;  4TRQ A;  1FCH A;  3TAX A;  5FJY A;  4G26 A;  1PAQ A;  2XGS A;  3CHO A;  1UW4 B;  2WXJ A;  4URK A;  2AW6 A;  4XIF A;  2KZT B;  2PL2 A;  3UT4 A;  3FY4 A;  2VYI A;  4JW1 A;  4HVB A;  4DLO A;  3S7D A;  2RD0 A;  2X6I A;  4I2Z A;  3BG1 B;  4PDX A;  5FQ8 A;  3MJW A;  4GZ5 A;  4B89 A;  4BTA A;  5JHA A;  2CHZ A;  3U66 A;  4GZD A;  3IEG A;  4AY5 A;  3CEQ A;  3CV0 A;  3OXG A;  1E8W A;  5AJL A;  3RRM B;  2FBN A;  4UQZ A;  2FF4 A;  5C1D A;  3ASD A;  5ARG A;  4B94 A;  4XI0 A;  4ANU A;  3Q49 B;  1U3D A;  1UN8 A;  3EHM A;  4G1T A;  2VGX B;  3L22 A;  1E7V A;  3LEW A;  5CMY A;  4B8A A;  4CCA A;  4RG6 A;  3VLE A;  3TGO A;  2AXZ A;  3BG0 B;  3LVR E;  3MYV A;  2VSN A;  2ILR A;  1PC2 A;  3CHP A;  3ZYL A;  3ENE A;  4C9B B;  3B13 A;  3CK8 A;  4OYS A;  5ANR A;  5KJL A;  2FEZ A;  4RVB A;  4U63 A;  4A1S A;  2WXF A;  4GCO A;  3RKV A;  4FUL A;  3CVL A;  1QZ2 A;  3O48 A;  2R5S A;  5LFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...