2L9BA

Heterodimer between rna14p monkeytail domain and rna15p hinge domain of the yeast cf ia complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
ANFLSQKFPELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQEWTRAHPEDAASLLELCPQLSFVTAELLLTNGICKVDDLIPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA 3'-end-processing protein RNA15
publication title Locked Tether Formation by Cooperative Folding of Rna14p Monkeytail and Rna15p Hinge Domains in the Yeast CF IA Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.630 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l9bA00
2L9BA 4EBAG
chains in the Genus database with same CATH superfamily
3Q9UC 2IONA 4HRLA 3UM3A 2KCVA 3AG4E 3AG3E 5AQ9A 4HFGA 3ASHA 4U8YD 5J08A 4G26A 3MYVA 3PZ4A 2CG2A 1S63A 4JB8P 3Q4AB 2PM6A 3FUKA 3ZYMA 2GRNB 3SZ7A 4WNDA 4XKBA 2LAHA 2P9UG 4C0MA 4ATGA 1D8DA 2JEKA 4I1OB 3CK7A 2IJGX 3TL5A 4ACLA 3PDNA 2UWJG 4GZ3A 1FCHA 5ENRD 4DJAA 2DIWA 3HVEA 3L6AA 4O60A 3URZA 4KZ0A 4KMOA 4BEPA 2LUHA 3F6QA 4JW1A 4ATZD 2AW6A 3ABKE 3B95A 2X6HA 3AS8A 4LCTA 5A23A 3FTUA 3KEAA 1E7UA 5FIOA 3KSLA 4ILIA 4U96D 3CVLA 1N0RA 2OVBA 2R59A 4I17A 2WQ7A 1MX4A 3EJNA 3NZUA 4G25A 5FZSA 4U0SA 5KJNA 3JQ0A 3NQPA 1JWGA 2DWZA 4ACKA 3CHMA 2X3MA 1HG2A 5BPPA 4DK5A 3ISMC 3MA5A 4GZ6A 4DUIA 2LNIA 4TXRA 5EIBE 3L16A 4E6HA 3L54A 1A17A 2V4HC 4JD2G 3CK8A 3DSXA 3FEYA 1HO8A 2AWIA 4KBQA 1BPOA 3CHSA 1NP7A 3CKCA 4Z68A 4N2SA 2NYJA 3HXDA 4YVOA 3QWWA 4WWNA 2KCKA 1Z3YA 1MHQA 4ILHB 3IXEA 3DSTA 3RAUA 4O1PA 3EDTB 1HF8A 5A7DB 1TN7A 2QYUA 3U3WA 4U8VD 2OVFA 4CDMA 1K1BA 4AY5A 2LSVA 5JA4D 1TR4A 3Q7FA 3SNXA 3T5XA 1UN9A 2J09A 4C9BB 1E7VA 4XKCA 4FULA 1HS6A 2JLBA 4E85A 4NACA 1Y8MA 3EHRA 5CMWA 3O48A 3PZ2A 2B0OE 1DC2A 4GMJA 2QZAA 4AOFA 3J5PA 2VQ2A 3FTYA 1IKND 3PNLB 1JPLA 4GTMA 2NXPA 3QARA 1ZBPA 1DCQA 3Q75A 3PNTB 4GZCA 3ASGA 4OYSA 3JQ1A 1N52A 3NOGD 3QAQA 3Q73A 3ZXPA 4C0EA 3PVLA 4ME2A 3EIQC 4KYOB 3HIZA 3NB2A 5FZQA 3RSEG 1D9SA 3ASOE 3FH8A 3ML8A 4XX5A 3SBSA 1QYMA 3C3OA 4GPKA 1FVHA 4HXIA 2L6BA 1OWLA 2ONDA 2ZXWE 3PZ3A 2XPIA 4FHKA 1TN6A 4U63A 3DPDA 2XCCA 5EKQD 3GYZA 2B6CA 1INZA 4F1PA 1KT0A 4N39A 1K8KG 2RFAA 4DLQA 2KZTA 4HLEA 3CVYA 2Y3AA 1TNBA 2UY1A 3FP3A 4DRXE 1WAO1 2Y4TA 2VSYA 2C0LA 5BW8C 2E2EA 4I1AA 5ENSD 4JEHA 4W9RA 1N4QA 5FTPA 3ESKA 5B3SE 4BY6A 4GCOA 3FHEA 3WXXA 4BT9A 4ANUA 3C3RA 3EHQA 5LCWC 3ASNE 3S2AA 2J08A 3E4BA 3QK0A 4LSZE 2Y0BG 5D0QD 4L23A 3CGHA 5AENA 3G2VA 5AQ7A 3KS2A 1AP7A 3SF4A 4U95D 3LKUA 4N5QA 1K3ZD 4I6GA 3FEXA 5EIDA 1OXJA 5FQ8A 2GRLA 3MKQB 4V3IA 1A5EA 3D9KA 4NQ0A 1NI1A 3CHRA 3SFZA 2YQ8A 3G2UA 4U07A 3O4ZA 5G55A 4HLLA 1O5MA 2WXHA 3SFXA 3IKOB 3LXUX 3T9KA 3FTSA 4FU3A 5G04C 5EDSA 2HO1A 4TUUA 4CGVA 3X2QE 3HG0D 1BU9A 1LTXA 3ZU7B 1DVPA 4N5CA 4APOA 3NAWA 3SI5A 2ILRA 2XCBA 4JZYA 3N71A 4A63B 2XGMA 4TRQA 3D9IA 3PS6A 3ZGQA 3UKRG 3FWVA 1H6OA 1E8WA 2H6IA 3PE4A 3DSVA 1ZB1A 3VTXA 4J8YA 4XIFA 4DX1A 3FDHA 4JVSA 3UTMA 2RKKA 1ELWA 2WXFA 2ZIRA 3T8KA 1H2VC 3ZKJA 4CGWA 4UQZA 5E76A 2H6HA 1FVFA 1RZ4A 3W9GA 2DZNA 1VDYA 5IY5E 3Q49B 1TJCA 5CECB 1N9AA 4YVQC 4G1TA 4HNAD 1Q2ZA 5FJYA 5CCMA 3S7JA 5FINA 3TGOA 3VTYA 3V31A 4B0ZA 4KVMA 2IOSA 2I6HA 1JCRA 2KATA 3PE3A 2DZOA 4BTBA 1SW6A 4BSXA 4UQYA 2YNQA 4HI8A 4M3OA 1HG5A 4N3CA 1HE8A 2HR2A 4PS8A 2HM8A 5AIJA 1BI8B 1OY3D 3LEWA 4Q96A 2GW1A 3UXGA 5LFAA 4DX6D 5CBNA 3Q79A 3W9FA 1DCEA 5G05J 1Z5SC 4M7CA 3ML9A 2VGXA 3D9HA 1WDYA 1UOHA 5BXUA 3LY7A 3ZHEA 2ETAA 3DXMG 3UT7A 3B7BA 5C1DA 4EQFA 2A5EA 4DPRA 2IFUA 3PZ1A 5KJLA 4UI9J 4FJZA 1ZU2A 2DCPA 4OAVB 3TWWA 4CEMA 4JA9A 2V5FA 3QDNA 2ETCA 1UG3A 4EBAG 1BLXB 3JYSA 2L6JA 4BFRA 5D2MC 4BETA 2P9NG 4RG9A 5EYPF 4AIFA 3S7DA 2P58C 4J8DA 2R2LA 2MRIA 4D10C 3UT8A 2PL2A 3J5QB 2GRRB 4JXTA 2RD0A 1TJFA 3FFLA 2EIME 2A4ZA 2PM7A 5E75A 2GROB 3TWQA 1N0QA 3I3NA 3LJNA 1O1TA 1EF1C 3EUVA 4ZHBA 4KVOA 3PUKA 3I5PA 3ZFWA 1FPPA 5CEDB 1O1SA 2H6FA 3OXLA 4MKTA 2R17C 3FUDA 4I6JA 1TN8A 2C2LA 4UQXA 2YHCA 3APCA 3GZ1A 4AXHA 2AXUA 5ARGA 4F6RD 2WXRA 3DXKG 4YDOA 3FTXA 4AEZC 4R7LA 3HVEB 3ZPJA 5BT1A 3RK6A 4JHJA 2E0IA 4FLHA 2OEVA 4GCNA 4IYPA 4AVXA 4BESA 3JXJA 3ZXSA 5G2NA 4N2QA 3UM0A 1DNPA 2NSZA 1HU3A 2XPYA 3U64A 2IO2C 1TYQG 3SY2A 4J0UA 4BTAA 4HRNA 2WXPA 3APDA 4RQIA 4UWKA 4H7XA 1G3NB 3HXBA 5FQ4A 2WMNA 4PS7A 3LVQE 2WQ6A 4LNUD 4JC8A 5M72A 3V2XA 4ANXA 2I1JA 3AU5A 3ULQA 1SA5A 4B94A 2X6FA 4CDRA 5JHBA 1PY1A 2EILE 4LG6A 3RO2A 5BV1A 4F7AA 4LRZA 4KZCA 1QQEA 3ZNGA 2PQRA 3LJ3A 4HOUA 3CR3A 3FU0A 3FUHA 5KBAA 4I1MA 4G8KA 4K5CA 1QNFA 3P2BA 4TXQA 1P5QA 1SQMA 1NL4A 4WWOA 3MX3A 4GMLA 4GTRA 3EHNA 2L0IA 4TUMA 2WXGA 3SQVA 3I4GA 2LAIA 3U4TA 1WY6A 4I2ZA 1S70B 4U04A 4CT0A 4KT6B 3L17A 4UWGA 1BI7B 1ELRA 2CG3A 3CVNA 4Q69A 4G23A 4DX5D 2NC9A 2DYSE 3ZRHA 3TXMA 1QZ2A 1V54E 2PNNA 1OCOE 4JL0A 1NFIE 3V30A 2LSUA 3BUAA 1E8ZA 3CVWA 2DBAA 5KNGA 2KXPC 3QWVA 4YNDA 2WVIA 3B7SA 1O1RA 3CQCB 4OAUC 4UWLA 3T8MA 2VGYA 1IHBA 5HRYA 4IULA 4DLOA 1GW6A 2XPZA 4IN3B 3AAAC 1NA3A 2WM9A 1TNZA 2EIJE 2V5QC 3DPYA 3IBEA 5JJTA 3B13A 5B1BE 3SD5A 3FUIA 2R05A 4WNEA 3CVVA 2GRMA 3AU4A 4FHJA 5JMND 3DEPA 1HH8A 3CHOA 1X81A 5JJ7A 1LD8A 4AY6A 1XNFA 4AV7A 1YYHA 3AJIA 5J90A 2J4DA 2XQ0A 2R5SA 2YINA 4LNBA 2I9CA 3UX4A 3TWUA 2P9PG 3RIBA 3C3QA 2VSNA 4HBDA 2QC9A 2R03A 3DWLG 3FU6A 4LUNU 5ENTD 3K9IA 2A5UA 1H2UA 3IHVA 3CSFA 4A1SA 1KT1A 3ASDA 3OXGA 2M63A 1H6KA 1OCRE 3OAWA 1TNOA 4L2LA 4ILGA 1PC2A 3ZW3A 4GMRA 3NBNB 3D9PA 3ASFA 4DX7D 3RRNB 3FH5A 4FADA 3MCXA 2FO1E 3LY8A 5HKPA 4B8CB 4YDWA 4BX9A 2AXVA 2AXZA 2L9BA 3UKUG 3G2SA 2VGEA 2CHXA 4GA1A 4K5BA 4RVBA 4I9CA 2CFUA 5JJ6A 2KM4A 1QBQA 3QWPA 2KZTB 5CMYA 3Q47B 1OUVA 3BG0B 2UY1B 5HS0A 4GYYA 1RW2A 2Y4UA 2EIKE 3D9LA 4B8AA 3FY4A 3CSTA 1E90A 5AJDA 4KXKB 1MJ0A 2IQCA 2BF0X 4EHMA 3FULA 5ARFA 1MYOA 3TXNA 1N95A 3ZVVA 4GYWA 4WAFA 5AARA 2KBXA 3GZ2A 3HXCA 2WMOA 5BUZA 3HDXA 5CRVA 3ULYA 2V8SE 4GTQA 5EILA 3UQ3A 1IYGA 2CHWA 3B7TA 3QC1A 3E33A 3VLEA 1U2VG 4GTPA 5KNHD 4MLPA 2JABA 3LVRE 2IF4A 1SZAA 2XZTG 4BX8A 1LD7A 3NF1A 5KJMA 4UWHA 3QNKA 1BD8A 2F37A 2BKKB 4G11A 3PEVB 4I9EA 3RO3A 3DRAA 2DVWA 5ITZF 4OVUA 2XEEA 3HRAA 4Y6WA 4CT4A 4X8QA 5CERB 4URKA 3TWRA 4EZJA 3CK9A 4CCAA 5LOZA 4NURA 1H2TC 4Y6CA 4UUCA 2AVPA 5FQ6A 3FH7A 2IU1A 5D66A 4DI4A 5FWQA 4QQIA 5ENPD 4CRWA 2LO6A 2WB2A 2V0PA 3E30A 3MV2B 3D9OA 3AG1E 3U66A 3Q7AA 1AWCB 5C2YA 4UI9K 5AN8A 3ZEFA 3UIOC 3UPVA 2OCCE 2LXLA 3DEOA 5ENOD 3ZIMA 1YA0A 4O6FA 3RJVA 1KZOA 1HX8A 5CEAA 3JUEA 3ZUVB 3KEZA 1JUQA 3UM2A 3E34A 5BV0A 4PS3A 1E96B 1EDUA 3SO8A 1OT8A 4MBGA 3C98A 3RU0A 3PZDA 4A3TA 4EBAA 4L2YA 2KC7A 1MX2A 2R02A 3SHFA 3L82A 3FUFA 4GTSA 3APFA 2BTDA 1KLXA 5JHAA 4HB5A 3UIPC 4HORA 2FO7A 4L9PA 3LCAA 3MJWA 4A1GA 2Y1LE 3S7FA 3OXFA 1XGWA 2ETBA 1N11A 2YHEA 3R9MA 1K1AA 3JUIA 3QKYA 3HXFA 3CLJA 4TXPA 3PREA 4BERA 2WXOA 4FP7A 4XZ4A 1HFAA 1WG0A 3LPZA 4APFA 4GAAA 5EX3A 4HS2A 4H7YA 4RG6A 4FA6A 3FUJA 1WM5A 4GA0A 4JHRA 3TWTA 3IHYA 2XENA 2HE0A 2WXMA 2QY7A 3DSSA 3ONLA 3G2WA 5EYLA 4K03A 1JCQA 3CEQA 2VSOE 5ANLA 5ENQD 1KZPA 3EU5A 4RSYA 2XRYA 2VGXB 5FT9A 3RKVA 2FULA 3SFYA 1X5BA 4HI9A 4XE0A 3ZHEB 2QFCA 1W3BA 4TV3A 2WXLA 4NRHB 4B93B 1S64A 1SVXA 4ANVA 2MYOA 2OEWA 2ZU6B 4HRMB 4JA7A 1HXIA 3CV0A 4GA2A 3UINC 3BEEA 4IRUA 3UT4A 1IQRA 3FU5A 2VSXE 3FTVA 1UJKA 3ZYKA 3D9NA 4CYMD 3TAXA 2VYIA 1SA4A 5EN5D 2XGSA 3Q5MA 3FTZA 4GTOA 4U0UA 3Q78A 2CHZA 4U8HA 3DBSA 4J7WA 4HQDA 1IXVA 3D3MA 4JEUA 1JCSA 2F0YA 4CDNA 3JXIA 4A55A 3TWVA 3EHMA 3LY9A 5BNWA 3LDZA 2L0TB 3DSUA 1YCSB 3CHQA 3V79K 4U0ZA 3FTWA 4NIKA 3U9WA 3CHPA 5LCWJ 2ZGGA 3BQOA 2MOWA 4DI3A 1Z3XA 2C0MA 2XRZA 3B7UX 3I4RB 2I2OA 4PUCA 4GZ5A 5B1AE 3PUJA 1MQSA 5ENNA 3PRZA 3TWXA 3UMVA 4U7EB 3TG4A 3CIAA 2GGFA 3DSWA 4Q94A 5LX8A 1E8XA 3EIJA 1LF8A 3JCKC 4DX2A 3VLDA 2J9QA 1N4SA 2WXKA 2ZGDA 3GW4A 3CQGB 3MV3B 3L13A 4GTVA 4YDEA 2WQHA 4N3AA 2OV8A 1N94A 1H0AA 4A3VA 4J8SA 2CFZA 1TNYA 4XI9A 4G2VA 3CVPA 1PAQA 3SBTB 4AM9A 2XS8A 3HHMA 5G04J 3R7QA 2WXIA 4F53A 3L22A 2J8SD 1U3CA 5BXOA 4XI0A 2IY0C 4LERA 3D9MA 5G05C 2I1KA 2QYJA 4HOQA 3FUNA 3ZYQA 2F8YA 4GPMA 2MHKA 3HXEA 4GU5A 3ULEG 3RRMB 4EZKA 3ENEA 4UI9C 3OTNA 2P9IG 5LP0A 2VTBA 5A6CA 5AYWD 4PDXA 3WG7E 1EYHA 3MZLB 4CZ2D 1NZNA 3TJPA 5KWDA 3QJZA 3B7RL 3VLFA 4EPZA 1JWFA 3BG1B 4AJWA 1E8YA 4JPSA 4LNGA 2GRQB 3Q15A 2F8XK 1NA0A 4HVBA 3GZSA 5AQBA 1OWPA 2BUGA 2H6GA 3KD7A 4N3BA 4FC8A 2DYRE 3CVXA 3HYMB 2WXQA 5AJLA 4AP2A 5KJKA 1YMPA 5D0OD 3ESLA 2EQXA 5T4YA 3UM1A 2FI7A 4PH4B 1IQUA 2VTBB 2XZDG 1HZ4A 1H6PA 3IV0A 4XEIG 3R9AB 3L9TA 1SZ9A 5CHEE 2IEJA 1UW4B 4P29A 1N54A 4B89A 4YDYA 5KCMA 4EECA 3G2TA 4L7TA 5HQ8A 2BKGA 4GYOA 2XEHA 3CVUA 3TG5A 3CVQA 1TEZA 2BEDA 2GRPB 3AS5A 2J49A 3MKQA 5HI7A 5FZRA 4I43A 5T8IA 5CCLA 3ONKA 2IO3C 3FUMA 3SGHA 4WNFA 4OVVA 3P1UA 1Z6TA 3KSQA 4EZLA 5DBKA 3MEKA 5H7PA 1FT2A 1EPUA 1MZCA 3Q9NC 3RRUA 3KAEA 1V55E 2P9KG 3UUXA 3ABME 3BU8A 2AJAA 1FT1A 4MS6A 4O1OA 2PQNA 3LYAA 3PEUB 4J8EA 2RFMA 3UI2A 1IHGA 2FBNA 3AG2E 3PH0C 4GTTA 1N4RA 2HYZA 4FJYA 1L5JA 4WWPA 2OOEA 1U3DA 4BT8A 2EINE 3C72A 2Q7FA 1KPSB 5AQAA 3C5RA 2FEZA 1UN8A 2FF4A 3V2OA 4J6IA 5T3RA 4LEUA 2X38A 1ELKA 2IOLA 3MGBA 3E32A 2ZISA 2WXNA 3L08A 1MX6A 2V4LA 5FQ7A 1H19A 4MRUA 3QB2A 3QOUA 5CBOA 2X6JA 5CRUA 3NOCD 4C48B 3ZYLA 2XS1A 4K0RA 3AS4A 2WXJA 3E37A 4BSZB 4K5AB 4ZFHA 4JHKA 4GZDA 2P2CP 2VJ8A 3IEGA 2PZIA 1UJJA 3TWSA 2X6KA 2WPVA 3CKBA 4I2WA 2XEVA 1OCZE 1D8EA 4HOSA 3ABLE 1Y6IA 1OWNA 4L1BA 4QFVA 2J4BA 3R7RA 4ABNA 2Y69E 3T5VA 2KCLA 1OWMA 2X6IA 1N4PA 2XHEA 1TNUA 2P9LG 2J07A 4WNGA 4J8FA 4GB9A 3FUEA 2XGOA 5ANRA 4HOTA 3ZN3A 5EX0A 3FU3A 4RLYA 5DIZA 3NZSA 1OWOA 2LXMA 4I6EA 3MKRA 4BWRA 2P9SG 2RG8A 4WUYA 3D9JA 4FLBA 4F3VA 1B89A 1OCCE 3LS8A 4G8LA 4ANWA 3EU9A 4G24A 3S7BA 1S0PA 4F1SA 5AAOA 4UWFA
chains in the Genus database with same CATH topology
3TG4A 3UX4A 1DVPA 4N5CA 2IONA 4APOA 3RIBA 3CIAA 2VSNA 2GGFA 3SI5A 2ILRA 2KCVA 2XCBA 4Q94A 5LX8A 4JZYA 1E8XA 3EIJA 1LF8A 3JCKC 3N71A 3ASHA 4HFGA 3VLDA 2XGMA 5J08A 2J9QA 4G26A 4TRQA 3FU6A 3D9IA 3PS6A 2WXKA 3ZGQA 3MYVA 3GW4A 2CG2A 3CQGB 4LUNU 3FWVA 3MV3B 3L13A 3K9IA 2A5UA 1H2UA 1E8WA 3IHVA 2WQHA 3CSFA 4A1SA 4N3AA 1KT1A 2OV8A 3ASDA 3OXGA 2M63A 1H6KA 3PE4A 3Q4AB 2PM6A 3OAWA 1H0AA 4A3VA 3VTXA 3FUKA 4L2LA 4J8SA 2CFZA 4XIFA 3ZYMA 3FDHA 3SZ7A 4ILGA 4WNDA 4XKBA 1PC2A 4JVSA 2LAHA 4XI9A 3ZW3A 4G2VA 1ELWA 3CVPA 2WXFA 4C0MA 3D9PA 1PAQA 3ASFA 4ATGA 3SBTB 4AM9A 3RRNB 2JEKA 4I1OB 3CK7A 2IJGX 3HHMA 3FH5A 1H2VC 5G04J 4FADA 3MCXA 4CGWA 3TL5A 4UQZA 3LY8A 5E76A 3R7QA 2WXIA 4ACLA 3L22A 3PDNA 2UWJG 4GZ3A 1FVFA 1FCHA 4F53A 4DJAA 4B8CB 1U3CA 2DIWA 3HVEA 4BX9A 1VDYA 4XI0A 3L6AA 3Q49B 3URZA 1TJCA 2AXVA 2AXZA 3D9MA 4LERA 2I1KA 2L9BA 5G05C 3G2SA 4KZ0A 2CHXA 4YVQC 4G1TA 4GA1A 4KMOA 5FJYA 5CCMA 4HOQA 3S7JA 3TGOA 4RVBA 4I9CA 3FUNA 2CFUA 3VTYA 3ZYQA 4JW1A 5JJ6A 4B0ZA 2KM4A 4KVMA 3QWPA 2IOSA 2I6HA 2MHKA 4GU5A 2AW6A 2KATA 2KZTB 5CMYA 3RRMB 3Q47B 1OUVA 2X6HA 3PE3A 4EZKA 3AS8A 4LCTA 3ENEA 3BG0B 5A23A 4BTBA 3FTUA 2UY1B 4UI9C 4GYYA 1E7UA 2Y4UA 3D9LA 4B8AA 3FY4A 3CSTA 4ILIA 1E90A 3OTNA 5AJDA 4BSXA 4KXKB 4UQYA 2YNQA 3CVLA 4M3OA 5LP0A 1HG5A 2IQCA 4N3CA 1HE8A 2BF0X 2OVBA 5A6CA 2VTBA 3FULA 5AYWD 5ARFA 4PDXA 3TXNA 2HR2A 1EYHA 3ZVVA 2R59A 3MZLB 4I17A 4PS8A 2HM8A 4GYWA 4WAFA 2WQ7A 3GZ2A 5AIJA 3EJNA 3NZUA 4G25A 2WMOA 3LEWA 4Q96A 5BUZA 3HDXA 2GW1A 2V8SE 1NZNA 3TJPA 5LFAA 5FZSA 3UQ3A 3QJZA 3B7RL 1IYGA 2CHWA 3B7TA 3QC1A 3VLFA 4U0SA 3VLEA 5G05J 4EPZA 1JWFA 3BG1B 3ML9A 2VGXA 4AJWA 1E8YA 4MLPA 3LVRE 5KJNA 3JQ0A 2IF4A 1SZAA 3NQPA 1JWGA 3LY7A 3ZHEA 4ACKA 4BX8A 3CHMA 3UT7A 5C1DA 3NF1A 4EQFA 4JPSA 5KJMA 2X3MA 1HG2A 3Q15A 4UWHA 4DK5A 5BPPA 3QNKA 1NA0A 3MA5A 3GZSA 4GZ6A 4HVBA 4DPRA 1OWPA 2BUGA 4G11A 2IFUA 3PEVB 3KD7A 4I9EA 4N3BA 2LNIA 4FC8A 3RO3A 5KJLA 4UI9J 3HYMB 3CVXA 4FJZA 4OVUA 1ZU2A 2DCPA 3L16A 2WXQA 5AJLA 4E6HA 3L54A 4AP2A 4Y6WA 1A17A 4CT4A 5KJKA 4URKA 5D0OD 3ESLA 2EQXA 5T4YA 4CEMA 4EZJA 3CK9A 4JA9A 2FI7A 4PH4B 1IQUA 2V5FA 2VTBB 3QDNA 4CCAA 1UG3A 4NURA 1H2TC 5LOZA 4Y6CA 3CK8A 1HZ4A 4EBAG 3FEYA 2AVPA 5FQ6A 3FH7A 2IU1A 3JYSA 1HO8A 2AWIA 2L6JA 3IV0A 4KBQA 3R9AB 4BFRA 1BPOA 3CHSA 1NP7A 3CKCA 4DI4A 5FWQA 4N2SA 1SZ9A 5CHEE 4RG9A 4CRWA 2LO6A 2WB2A 4AIFA 1UW4B 2V0PA 4P29A 4YVOA 1N54A 3S7DA 3QWWA 3MV2B 2P58C 3D9OA 4B89A 4J8DA 4WWNA 2KCKA 2MRIA 3U66A 4D10C 1Z3YA 5KCMA 1MHQA 4ILHB 4EECA 3G2TA 5C2YA 4L7TA 3UT8A 5HQ8A 3EDTB 4UI9K 4GYOA 3CVUA 3TG5A 3ZEFA 1HF8A 2PL2A 3CVQA 5A7DB 1TEZA 3UPVA 4JXTA 2RD0A 3U3WA 2OVFA 3AS5A 2J49A 3ZIMA 1TJFA 3FFLA 4CDMA 1YA0A 2A4ZA 4AY5A 2PM7A 2LSVA 3MKQA 4O6FA 5HI7A 3RJVA 5E75A 5FZRA 4I43A 1HX8A 5T8IA 3KEZA 3SNXA 3T5XA 5CCLA 3I3NA 1JUQA 3ONKA 1UN9A 5BV0A 2J09A 4PS3A 4C9BB 1E96B 1EDUA 1E7VA 1EF1C 3C98A 3FUMA 4XKCA 4FULA 1HS6A 3RU0A 4KVOA 3PUKA 3SGHA 4WNFA 3I5PA 3PZDA 4A3TA 3ZFWA 4EBAA 4L2YA 2JLBA 2KC7A 3SHFA 4E85A 4NACA 3OXLA 4MKTA 4OVVA 1Y8MA 2R17C 3FUFA 5CMWA 3O48A 3P1UA 1Z6TA 3FUDA 3APFA 4I6JA 4EZLA 2BTDA 3MEKA 5DBKA 4GMJA 2C2LA 1KLXA 4UQXA 2YHCA 5JHAA 3APCA 3GZ1A 4AOFA 4AXHA 4HORA 2FO7A 1EPUA 2VQ2A 3LCAA 2AXUA 3FTYA 5ARGA 3MJWA 2WXRA 3PNLB 1JPLA 4A1GA 3FTXA 4AEZC 2NXPA 3QARA 4R7LA 3S7FA 1ZBPA 3HVEB 3OXFA 3PNTB 3RRUA 3ZPJA 3KAEA 5BT1A 4GZCA 3ASGA 4OYSA 3RK6A 3JQ1A 1XGWA 4JHJA 2E0IA 1N52A 2YHEA 4FLHA 3UUXA 4GCNA 4IYPA 3JUIA 3QAQA 4AVXA 3QKYA 3ZXSA 5G2NA 4N2QA 3CLJA 4MS6A 1DNPA 2NSZA 4C0EA 2PQNA 3LYAA 1HU3A 3PVLA 4ME2A 3PREA 2XPYA 3PEUB 4J8EA 2WXOA 3EIQC 4FP7A 4KYOB 4XZ4A 1HFAA 3U64A 1IHGA 3HIZA 2FBNA 5FZQA 3LPZA 4APFA 3FH8A 3ML8A 4XX5A 4GAAA 4J0UA 4HS2A 3PH0C 5EX3A 4BTAA 3SBSA 2WXPA 3APDA 4H7YA 4RG6A 4FA6A 3FUJA 4GPKA 4FJYA 1FVHA 2HYZA 4UWKA 1WM5A 1L5JA 4H7XA 4GA0A 4HXIA 2WMNA 2OOEA 4JHRA 4WWPA 4PS7A 5FQ4A 1OWLA 3IHYA 2ONDA 1U3DA 2WXMA 3LVQE 2WQ6A 4BT8A 2QY7A 4JC8A 5M72A 2XPIA 3ONLA 4FHKA 4ANXA 4U63A 2I1JA 3AU5A 3DPDA 3ULQA 4CDRA 4B94A 2Q7FA 2X6FA 5JHBA 2XCCA 5EKQD 1PY1A 3G2WA 3GYZA 1INZA 4K03A 2FEZA 1UN8A 2FF4A 4J6IA 5T3RA 3RO2A 5BV1A 4LEUA 4F7AA 2X38A 1KT0A 3CEQA 2VSOE 4LRZA 4KZCA 1QQEA 1ELKA 2IOLA 5ANLA 2PQRA 3MGBA 3LJ3A 4HOUA 3CR3A 3FU0A 4N39A 3FUHA 4RSYA 2XRYA 2VGXB 4DLQA 5FT9A 3RKVA 2FULA 2KZTA 4I1MA 1X5BA 4HLEA 3CVYA 2WXNA 3L08A 4XE0A 3ZHEB 2Y3AA 1QNFA 2V4LA 2QFCA 1W3BA 2UY1A 3FP3A 4TV3A 3P2BA 5FQ7A 2WXLA 4NRHB 1H19A 1WAO1 1P5QA 1SQMA 4MRUA 2Y4TA 4WWOA 2VSYA 4ANVA 3QB2A 2C0LA 3MX3A 5BW8C 2E2EA 4I1AA 2ZU6B 4GMLA 3QOUA 4JA7A 4JEHA 2X6JA 3EHNA 2L0IA 1HXIA 3CV0A 4W9RA 4GA2A 2WXGA 3ZYLA 3BEEA 4IRUA 3UT4A 1IQRA 3ESKA 3FU5A 2VSXE 2LAIA 3I4GA 5FTPA 4K0RA 3U4TA 4BY6A 4GCOA 1WY6A 3FHEA 3AS4A 3FTVA 3WXXA 4BT9A 2WXJA 4I2ZA 4CT0A 4U04A 4KT6B 4ANUA 3L17A 4UWGA 5LCWC 1UJKA 3ZYKA 1ELRA 3S2AA 2J08A 3D9NA 4JHKA 2CG3A 3CVNA 4Q69A 3E4BA 4GZDA 2VJ8A 3IEGA 2PZIA 1UJJA 4G23A 2NC9A 3TAXA 2X6KA 3QK0A 2WPVA 5D0QD 2VYIA 3CKBA 4I2WA 4L23A 2XEVA 3CGHA 2XGSA 4HOSA 1Y6IA 3Q5MA 1OWNA 3TXMA 3FTZA 1QZ2A 3ZRHA 4U0UA 5AENA 3G2VA 4L1BA 2J4BA 4QFVA 3R7RA 3KS2A 4ABNA 3T5VA 2CHZA 2KCLA 4U8HA 3DBSA 3SF4A 3LKUA 4JL0A 1OWMA 2X6IA 3D3MA 4JEUA 2XHEA 4CDNA 4I6GA 2LSUA 1E8ZA 3CVWA 2DBAA 4A55A 2J07A 3FEXA 3QWVA 4WNGA 4YNDA 2WVIA 3EHMA 3LY9A 3B7SA 5BNWA 3LDZA 5FQ8A 2GRLA 3CQCB 3MKQB 4GB9A 2L0TB 4J8FA 3FUEA 3CHQA 2XGOA 4V3IA 4UWLA 3T8MA 4U0ZA 2VGYA 5ANRA 4IULA 3D9KA 4HOTA 4DLOA 4NQ0A 3CHRA 1GW6A 3ZN3A 5EX0A 3FTWA 2XPZA 3FU3A 5DIZA 4IN3B 3SFZA 3NZSA 3U9WA 1OWOA 1NA3A 2YQ8A 3G2UA 2WM9A 3MKRA 3CHPA 3O4ZA 4I6EA 4U07A 5G55A 3IBEA 4BWRA 5JJTA 3B13A 3SD5A 5LCWJ 2RG8A 4WUYA 3D9JA 2WXHA 3IKOB 3FUIA 4FLBA 4WNEA 4F3VA 1B89A 2MOWA 3LXUX 4DI3A 1Z3XA 3CVVA 2C0MA 3FTSA 2GRMA 3AU4A 3LS8A 2XRZA 4FHJA 4ANWA 3B7UX 3I4RB 4G24A 4FU3A 1HH8A 3CHOA 5G04C 2I2OA 3S7BA 5EDSA 4PUCA 5JJ7A 4AY6A 1S0PA 1XNFA 4AV7A 4GZ5A 2HO1A 3PUJA 1MQSA 4TUUA 4F1SA 5J90A 2J4DA 5ENNA 3PRZA 2XQ0A 2R5SA 2YINA 4CGVA 2I9CA 3UMVA 4UWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9B A;  4EBA G; 
#chains in the Genus database with same CATH topology
 3Q9U C;  2ION A;  4HRL A;  3UM3 A;  2KCV A;  3AG4 E;  3AG3 E;  5AQ9 A;  4HFG A;  3ASH A;  4U8Y D;  5J08 A;  4G26 A;  3MYV A;  3PZ4 A;  2CG2 A;  1S63 A;  4JB8 P;  3Q4A B;  2PM6 A;  3FUK A;  3ZYM A;  2GRN B;  3SZ7 A;  4WND A;  4XKB A;  2LAH A;  2P9U G;  4C0M A;  4ATG A;  1D8D A;  2JEK A;  4I1O B;  3CK7 A;  2IJG X;  3TL5 A;  4ACL A;  3PDN A;  2UWJ G;  4GZ3 A;  1FCH A;  5ENR D;  4DJA A;  2DIW A;  3HVE A;  3L6A A;  4O60 A;  3URZ A;  4KZ0 A;  4KMO A;  4BEP A;  2LUH A;  3F6Q A;  4JW1 A;  4ATZ D;  2AW6 A;  3ABK E;  3B95 A;  2X6H A;  3AS8 A;  4LCT A;  5A23 A;  3FTU A;  3KEA A;  1E7U A;  5FIO A;  3KSL A;  4ILI A;  4U96 D;  3CVL A;  1N0R A;  2OVB A;  2R59 A;  4I17 A;  2WQ7 A;  1MX4 A;  3EJN A;  3NZU A;  4G25 A;  5FZS A;  4U0S A;  5KJN A;  3JQ0 A;  3NQP A;  1JWG A;  2DWZ A;  4ACK A;  3CHM A;  2X3M A;  1HG2 A;  5BPP A;  4DK5 A;  3ISM C;  3MA5 A;  4GZ6 A;  4DUI A;  2LNI A;  4TXR A;  5EIB E;  3L16 A;  4E6H A;  3L54 A;  1A17 A;  2V4H C;  4JD2 G;  3CK8 A;  3DSX A;  3FEY A;  1HO8 A;  2AWI A;  4KBQ A;  1BPO A;  3CHS A;  1NP7 A;  3CKC A;  4Z68 A;  4N2S A;  2NYJ A;  3HXD A;  4YVO A;  3QWW A;  4WWN A;  2KCK A;  1Z3Y A;  1MHQ A;  4ILH B;  3IXE A;  3DST A;  3RAU A;  4O1P A;  3EDT B;  1HF8 A;  5A7D B;  1TN7 A;  2QYU A;  3U3W A;  4U8V D;  2OVF A;  4CDM A;  1K1B A;  4AY5 A;  2LSV A;  5JA4 D;  1TR4 A;  3Q7F A;  3SNX A;  3T5X A;  1UN9 A;  2J09 A;  4C9B B;  1E7V A;  4XKC A;  4FUL A;  1HS6 A;  2JLB A;  4E85 A;  4NAC A;  1Y8M A;  3EHR A;  5CMW A;  3O48 A;  3PZ2 A;  2B0O E;  1DC2 A;  4GMJ A;  2QZA A;  4AOF A;  3J5P A;  2VQ2 A;  3FTY A;  1IKN D;  3PNL B;  1JPL A;  4GTM A;  2NXP A;  3QAR A;  1ZBP A;  1DCQ A;  3Q75 A;  3PNT B;  4GZC A;  3ASG A;  4OYS A;  3JQ1 A;  1N52 A;  3NOG D;  3QAQ A;  3Q73 A;  3ZXP A;  4C0E A;  3PVL A;  4ME2 A;  3EIQ C;  4KYO B;  3HIZ A;  3NB2 A;  5FZQ A;  3RSE G;  1D9S A;  3ASO E;  3FH8 A;  3ML8 A;  4XX5 A;  3SBS A;  1QYM A;  3C3O A;  4GPK A;  1FVH A;  4HXI A;  2L6B A;  1OWL A;  2OND A;  2ZXW E;  3PZ3 A;  2XPI A;  4FHK A;  1TN6 A;  4U63 A;  3DPD A;  2XCC A;  5EKQ D;  3GYZ A;  2B6C A;  1INZ A;  4F1P A;  1KT0 A;  4N39 A;  1K8K G;  2RFA A;  4DLQ A;  2KZT A;  4HLE A;  3CVY A;  2Y3A A;  1TNB A;  2UY1 A;  3FP3 A;  4DRX E;  1WAO 1;  2Y4T A;  2VSY A;  2C0L A;  5BW8 C;  2E2E A;  4I1A A;  5ENS D;  4JEH A;  4W9R A;  1N4Q A;  5FTP A;  3ESK A;  5B3S E;  4BY6 A;  4GCO A;  3FHE A;  3WXX A;  4BT9 A;  4ANU A;  3C3R A;  3EHQ A;  5LCW C;  3ASN E;  3S2A A;  2J08 A;  3E4B A;  3QK0 A;  4LSZ E;  2Y0B G;  5D0Q D;  4L23 A;  3CGH A;  5AEN A;  3G2V A;  5AQ7 A;  3KS2 A;  1AP7 A;  3SF4 A;  4U95 D;  3LKU A;  4N5Q A;  1K3Z D;  4I6G A;  3FEX A;  5EID A;  1OXJ A;  5FQ8 A;  2GRL A;  3MKQ B;  4V3I A;  1A5E A;  3D9K A;  4NQ0 A;  1NI1 A;  3CHR A;  3SFZ A;  2YQ8 A;  3G2U A;  4U07 A;  3O4Z A;  5G55 A;  4HLL A;  1O5M A;  2WXH A;  3SFX A;  3IKO B;  3LXU X;  3T9K A;  3FTS A;  4FU3 A;  5G04 C;  5EDS A;  2HO1 A;  4TUU A;  4CGV A;  3X2Q E;  3HG0 D;  1BU9 A;  1LTX A;  3ZU7 B;  1DVP A;  4N5C A;  4APO A;  3NAW A;  3SI5 A;  2ILR A;  2XCB A;  4JZY A;  3N71 A;  4A63 B;  2XGM A;  4TRQ A;  3D9I A;  3PS6 A;  3ZGQ A;  3UKR G;  3FWV A;  1H6O A;  1E8W A;  2H6I A;  3PE4 A;  3DSV A;  1ZB1 A;  3VTX A;  4J8Y A;  4XIF A;  4DX1 A;  3FDH A;  4JVS A;  3UTM A;  2RKK A;  1ELW A;  2WXF A;  2ZIR A;  3T8K A;  1H2V C;  3ZKJ A;  4CGW A;  4UQZ A;  5E76 A;  2H6H A;  1FVF A;  1RZ4 A;  3W9G A;  2DZN A;  1VDY A;  5IY5 E;  3Q49 B;  1TJC A;  5CEC B;  1N9A A;  4YVQ C;  4G1T A;  4HNA D;  1Q2Z A;  5FJY A;  5CCM A;  3S7J A;  5FIN A;  3TGO A;  3VTY A;  3V31 A;  4B0Z A;  4KVM A;  2IOS A;  2I6H A;  1JCR A;  2KAT A;  3PE3 A;  2DZO A;  4BTB A;  1SW6 A;  4BSX A;  4UQY A;  2YNQ A;  4HI8 A;  4M3O A;  1HG5 A;  4N3C A;  1HE8 A;  2HR2 A;  4PS8 A;  2HM8 A;  5AIJ A;  1BI8 B;  1OY3 D;  3LEW A;  4Q96 A;  2GW1 A;  3UXG A;  5LFA A;  4DX6 D;  5CBN A;  3Q79 A;  3W9F A;  1DCE A;  5G05 J;  1Z5S C;  4M7C A;  3ML9 A;  2VGX A;  3D9H A;  1WDY A;  1UOH A;  5BXU A;  3LY7 A;  3ZHE A;  2ETA A;  3DXM G;  3UT7 A;  3B7B A;  5C1D A;  4EQF A;  2A5E A;  4DPR A;  2IFU A;  3PZ1 A;  5KJL A;  4UI9 J;  4FJZ A;  1ZU2 A;  2DCP A;  4OAV B;  3TWW A;  4CEM A;  4JA9 A;  2V5F A;  3QDN A;  2ETC A;  1UG3 A;  4EBA G;  1BLX B;  3JYS A;  2L6J A;  4BFR A;  5D2M C;  4BET A;  2P9N G;  4RG9 A;  5EYP F;  4AIF A;  3S7D A;  2P58 C;  4J8D A;  2R2L A;  2MRI A;  4D10 C;  3UT8 A;  2PL2 A;  3J5Q B;  2GRR B;  4JXT A;  2RD0 A;  1TJF A;  3FFL A;  2EIM E;  2A4Z A;  2PM7 A;  5E75 A;  2GRO B;  3TWQ A;  1N0Q A;  3I3N A;  3LJN A;  1O1T A;  1EF1 C;  3EUV A;  4ZHB A;  4KVO A;  3PUK A;  3I5P A;  3ZFW A;  1FPP A;  5CED B;  1O1S A;  2H6F A;  3OXL A;  4MKT A;  2R17 C;  3FUD A;  4I6J A;  1TN8 A;  2C2L A;  4UQX A;  2YHC A;  3APC A;  3GZ1 A;  4AXH A;  2AXU A;  5ARG A;  4F6R D;  2WXR A;  3DXK G;  4YDO A;  3FTX A;  4AEZ C;  4R7L A;  3HVE B;  3ZPJ A;  5BT1 A;  3RK6 A;  4JHJ A;  2E0I A;  4FLH A;  2OEV A;  4GCN A;  4IYP A;  4AVX A;  4BES A;  3JXJ A;  3ZXS A;  5G2N A;  4N2Q A;  3UM0 A;  1DNP A;  2NSZ A;  1HU3 A;  2XPY A;  3U64 A;  2IO2 C;  1TYQ G;  3SY2 A;  4J0U A;  4BTA A;  4HRN A;  2WXP A;  3APD A;  4RQI A;  4UWK A;  4H7X A;  1G3N B;  3HXB A;  5FQ4 A;  2WMN A;  4PS7 A;  3LVQ E;  2WQ6 A;  4LNU D;  4JC8 A;  5M72 A;  3V2X A;  4ANX A;  2I1J A;  3AU5 A;  3ULQ A;  1SA5 A;  4B94 A;  2X6F A;  4CDR A;  5JHB A;  1PY1 A;  2EIL E;  4LG6 A;  3RO2 A;  5BV1 A;  4F7A A;  4LRZ A;  4KZC A;  1QQE A;  3ZNG A;  2PQR A;  3LJ3 A;  4HOU A;  3CR3 A;  3FU0 A;  3FUH A;  5KBA A;  4I1M A;  4G8K A;  4K5C A;  1QNF A;  3P2B A;  4TXQ A;  1P5Q A;  1SQM A;  1NL4 A;  4WWO A;  3MX3 A;  4GML A;  4GTR A;  3EHN A;  2L0I A;  4TUM A;  2WXG A;  3SQV A;  3I4G A;  2LAI A;  3U4T A;  1WY6 A;  4I2Z A;  1S70 B;  4U04 A;  4CT0 A;  4KT6 B;  3L17 A;  4UWG A;  1BI7 B;  1ELR A;  2CG3 A;  3CVN A;  4Q69 A;  4G23 A;  4DX5 D;  2NC9 A;  2DYS E;  3ZRH A;  3TXM A;  1QZ2 A;  1V54 E;  2PNN A;  1OCO E;  4JL0 A;  1NFI E;  3V30 A;  2LSU A;  3BUA A;  1E8Z A;  3CVW A;  2DBA A;  5KNG A;  2KXP C;  3QWV A;  4YND A;  2WVI A;  3B7S A;  1O1R A;  3CQC B;  4OAU C;  4UWL A;  3T8M A;  2VGY A;  1IHB A;  5HRY A;  4IUL A;  4DLO A;  1GW6 A;  2XPZ A;  4IN3 B;  3AAA C;  1NA3 A;  2WM9 A;  1TNZ A;  2EIJ E;  2V5Q C;  3DPY A;  3IBE A;  5JJT A;  3B13 A;  5B1B E;  3SD5 A;  3FUI A;  2R05 A;  4WNE A;  3CVV A;  2GRM A;  3AU4 A;  4FHJ A;  5JMN D;  3DEP A;  1HH8 A;  3CHO A;  1X81 A;  5JJ7 A;  1LD8 A;  4AY6 A;  1XNF A;  4AV7 A;  1YYH A;  3AJI A;  5J90 A;  2J4D A;  2XQ0 A;  2R5S A;  2YIN A;  4LNB A;  2I9C A;  3UX4 A;  3TWU A;  2P9P G;  3RIB A;  3C3Q A;  2VSN A;  4HBD A;  2QC9 A;  2R03 A;  3DWL G;  3FU6 A;  4LUN U;  5ENT D;  3K9I A;  2A5U A;  1H2U A;  3IHV A;  3CSF A;  4A1S A;  1KT1 A;  3ASD A;  3OXG A;  2M63 A;  1H6K A;  1OCR E;  3OAW A;  1TNO A;  4L2L A;  4ILG A;  1PC2 A;  3ZW3 A;  4GMR A;  3NBN B;  3D9P A;  3ASF A;  4DX7 D;  3RRN B;  3FH5 A;  4FAD A;  3MCX A;  2FO1 E;  3LY8 A;  5HKP A;  4B8C B;  4YDW A;  4BX9 A;  2AXV A;  2AXZ A;  2L9B A;  3UKU G;  3G2S A;  2VGE A;  2CHX A;  4GA1 A;  4K5B A;  4RVB A;  4I9C A;  2CFU A;  5JJ6 A;  2KM4 A;  1QBQ A;  3QWP A;  2KZT B;  5CMY A;  3Q47 B;  1OUV A;  3BG0 B;  2UY1 B;  5HS0 A;  4GYY A;  1RW2 A;  2Y4U A;  2EIK E;  3D9L A;  4B8A A;  3FY4 A;  3CST A;  1E90 A;  5AJD A;  4KXK B;  1MJ0 A;  2IQC A;  2BF0 X;  4EHM A;  3FUL A;  5ARF A;  1MYO A;  3TXN A;  1N95 A;  3ZVV A;  4GYW A;  4WAF A;  5AAR A;  2KBX A;  3GZ2 A;  3HXC A;  2WMO A;  5BUZ A;  3HDX A;  5CRV A;  3ULY A;  2V8S E;  4GTQ A;  5EIL A;  3UQ3 A;  1IYG A;  2CHW A;  3B7T A;  3QC1 A;  3E33 A;  3VLE A;  1U2V G;  4GTP A;  5KNH D;  4MLP A;  2JAB A;  3LVR E;  2IF4 A;  1SZA A;  2XZT G;  4BX8 A;  1LD7 A;  3NF1 A;  5KJM A;  4UWH A;  3QNK A;  1BD8 A;  2F37 A;  2BKK B;  4G11 A;  3PEV B;  4I9E A;  3RO3 A;  3DRA A;  2DVW A;  5ITZ F;  4OVU A;  2XEE A;  3HRA A;  4Y6W A;  4CT4 A;  4X8Q A;  5CER B;  4URK A;  3TWR A;  4EZJ A;  3CK9 A;  4CCA A;  5LOZ A;  4NUR A;  1H2T C;  4Y6C A;  4UUC A;  2AVP A;  5FQ6 A;  3FH7 A;  2IU1 A;  5D66 A;  4DI4 A;  5FWQ A;  4QQI A;  5ENP D;  4CRW A;  2LO6 A;  2WB2 A;  2V0P A;  3E30 A;  3MV2 B;  3D9O A;  3AG1 E;  3U66 A;  3Q7A A;  1AWC B;  5C2Y A;  4UI9 K;  5AN8 A;  3ZEF A;  3UIO C;  3UPV A;  2OCC E;  2LXL A;  3DEO A;  5ENO D;  3ZIM A;  1YA0 A;  4O6F A;  3RJV A;  1KZO A;  1HX8 A;  5CEA A;  3JUE A;  3ZUV B;  3KEZ A;  1JUQ A;  3UM2 A;  3E34 A;  5BV0 A;  4PS3 A;  1E96 B;  1EDU A;  3SO8 A;  1OT8 A;  4MBG A;  3C98 A;  3RU0 A;  3PZD A;  4A3T A;  4EBA A;  4L2Y A;  2KC7 A;  1MX2 A;  2R02 A;  3SHF A;  3L82 A;  3FUF A;  4GTS A;  3APF A;  2BTD A;  1KLX A;  5JHA A;  4HB5 A;  3UIP C;  4HOR A;  2FO7 A;  4L9P A;  3LCA A;  3MJW A;  4A1G A;  2Y1L E;  3S7F A;  3OXF A;  1XGW A;  2ETB A;  1N11 A;  2YHE A;  3R9M A;  1K1A A;  3JUI A;  3QKY A;  3HXF A;  3CLJ A;  4TXP A;  3PRE A;  4BER A;  2WXO A;  4FP7 A;  4XZ4 A;  1HFA A;  1WG0 A;  3LPZ A;  4APF A;  4GAA A;  5EX3 A;  4HS2 A;  4H7Y A;  4RG6 A;  4FA6 A;  3FUJ A;  1WM5 A;  4GA0 A;  4JHR A;  3TWT A;  3IHY A;  2XEN A;  2HE0 A;  2WXM A;  2QY7 A;  3DSS A;  3ONL A;  3G2W A;  5EYL A;  4K03 A;  1JCQ A;  3CEQ A;  2VSO E;  5ANL A;  5ENQ D;  1KZP A;  3EU5 A;  4RSY A;  2XRY A;  2VGX B;  5FT9 A;  3RKV A;  2FUL A;  3SFY A;  1X5B A;  4HI9 A;  4XE0 A;  3ZHE B;  2QFC A;  1W3B A;  4TV3 A;  2WXL A;  4NRH B;  4B93 B;  1S64 A;  1SVX A;  4ANV A;  2MYO A;  2OEW A;  2ZU6 B;  4HRM B;  4JA7 A;  1HXI A;  3CV0 A;  4GA2 A;  3UIN C;  3BEE A;  4IRU A;  3UT4 A;  1IQR A;  3FU5 A;  2VSX E;  3FTV A;  1UJK A;  3ZYK A;  3D9N A;  4CYM D;  3TAX A;  2VYI A;  1SA4 A;  5EN5 D;  2XGS A;  3Q5M A;  3FTZ A;  4GTO A;  4U0U A;  3Q78 A;  2CHZ A;  4U8H A;  3DBS A;  4J7W A;  4HQD A;  1IXV A;  3D3M A;  4JEU A;  1JCS A;  2F0Y A;  4CDN A;  3JXI A;  4A55 A;  3TWV A;  3EHM A;  3LY9 A;  5BNW A;  3LDZ A;  2L0T B;  3DSU A;  1YCS B;  3CHQ A;  3V79 K;  4U0Z A;  3FTW A;  4NIK A;  3U9W A;  3CHP A;  5LCW J;  2ZGG A;  3BQO A;  2MOW A;  4DI3 A;  1Z3X A;  2C0M A;  2XRZ A;  3B7U X;  3I4R B;  2I2O A;  4PUC A;  4GZ5 A;  5B1A E;  3PUJ A;  1MQS A;  5ENN A;  3PRZ A;  3TWX A;  3UMV A;  4U7E B;  3TG4 A;  3CIA A;  2GGF A;  3DSW A;  4Q94 A;  5LX8 A;  1E8X A;  3EIJ A;  1LF8 A;  3JCK C;  4DX2 A;  3VLD A;  2J9Q A;  1N4S A;  2WXK A;  2ZGD A;  3GW4 A;  3CQG B;  3MV3 B;  3L13 A;  4GTV A;  4YDE A;  2WQH A;  4N3A A;  2OV8 A;  1N94 A;  1H0A A;  4A3V A;  4J8S A;  2CFZ A;  1TNY A;  4XI9 A;  4G2V A;  3CVP A;  1PAQ A;  3SBT B;  4AM9 A;  2XS8 A;  3HHM A;  5G04 J;  3R7Q A;  2WXI A;  4F53 A;  3L22 A;  2J8S D;  1U3C A;  5BXO A;  4XI0 A;  2IY0 C;  4LER A;  3D9M A;  5G05 C;  2I1K A;  2QYJ A;  4HOQ A;  3FUN A;  3ZYQ A;  2F8Y A;  4GPM A;  2MHK A;  3HXE A;  4GU5 A;  3ULE G;  3RRM B;  4EZK A;  3ENE A;  4UI9 C;  3OTN A;  2P9I G;  5LP0 A;  2VTB A;  5A6C A;  5AYW D;  4PDX A;  3WG7 E;  1EYH A;  3MZL B;  4CZ2 D;  1NZN A;  3TJP A;  5KWD A;  3QJZ A;  3B7R L;  3VLF A;  4EPZ A;  1JWF A;  3BG1 B;  4AJW A;  1E8Y A;  4JPS A;  4LNG A;  2GRQ B;  3Q15 A;  2F8X K;  1NA0 A;  4HVB A;  3GZS A;  5AQB A;  1OWP A;  2BUG A;  2H6G A;  3KD7 A;  4N3B A;  4FC8 A;  2DYR E;  3CVX A;  3HYM B;  2WXQ A;  5AJL A;  4AP2 A;  5KJK A;  1YMP A;  5D0O D;  3ESL A;  2EQX A;  5T4Y A;  3UM1 A;  2FI7 A;  4PH4 B;  1IQU A;  2VTB B;  2XZD G;  1HZ4 A;  1H6P A;  3IV0 A;  4XEI G;  3R9A B;  3L9T A;  1SZ9 A;  5CHE E;  2IEJ A;  1UW4 B;  4P29 A;  1N54 A;  4B89 A;  4YDY A;  5KCM A;  4EEC A;  3G2T A;  4L7T A;  5HQ8 A;  2BKG A;  4GYO A;  2XEH A;  3CVU A;  3TG5 A;  3CVQ A;  1TEZ A;  2BED A;  2GRP B;  3AS5 A;  2J49 A;  3MKQ A;  5HI7 A;  5FZR A;  4I43 A;  5T8I A;  5CCL A;  3ONK A;  2IO3 C;  3FUM A;  3SGH A;  4WNF A;  4OVV A;  3P1U A;  1Z6T A;  3KSQ A;  4EZL A;  5DBK A;  3MEK A;  5H7P A;  1FT2 A;  1EPU A;  1MZC A;  3Q9N C;  3RRU A;  3KAE A;  1V55 E;  2P9K G;  3UUX A;  3ABM E;  3BU8 A;  2AJA A;  1FT1 A;  4MS6 A;  4O1O A;  2PQN A;  3LYA A;  3PEU B;  4J8E A;  2RFM A;  3UI2 A;  1IHG A;  2FBN A;  3AG2 E;  3PH0 C;  4GTT A;  1N4R A;  2HYZ A;  4FJY A;  1L5J A;  4WWP A;  2OOE A;  1U3D A;  4BT8 A;  2EIN E;  3C72 A;  2Q7F A;  1KPS B;  5AQA A;  3C5R A;  2FEZ A;  1UN8 A;  2FF4 A;  3V2O A;  4J6I A;  5T3R A;  4LEU A;  2X38 A;  1ELK A;  2IOL A;  3MGB A;  3E32 A;  2ZIS A;  2WXN A;  3L08 A;  1MX6 A;  2V4L A;  5FQ7 A;  1H19 A;  4MRU A;  3QB2 A;  3QOU A;  5CBO A;  2X6J A;  5CRU A;  3NOC D;  4C48 B;  3ZYL A;  2XS1 A;  4K0R A;  3AS4 A;  2WXJ A;  3E37 A;  4BSZ B;  4K5A B;  4ZFH A;  4JHK A;  4GZD A;  2P2C P;  2VJ8 A;  3IEG A;  2PZI A;  1UJJ A;  3TWS A;  2X6K A;  2WPV A;  3CKB A;  4I2W A;  2XEV A;  1OCZ E;  1D8E A;  4HOS A;  3ABL E;  1Y6I A;  1OWN A;  4L1B A;  4QFV A;  2J4B A;  3R7R A;  4ABN A;  2Y69 E;  3T5V A;  2KCL A;  1OWM A;  2X6I A;  1N4P A;  2XHE A;  1TNU A;  2P9L G;  2J07 A;  4WNG A;  4J8F A;  4GB9 A;  3FUE A;  2XGO A;  5ANR A;  4HOT A;  3ZN3 A;  5EX0 A;  3FU3 A;  4RLY A;  5DIZ A;  3NZS A;  1OWO A;  2LXM A;  4I6E A;  3MKR A;  4BWR A;  2P9S G;  2RG8 A;  4WUY A;  3D9J A;  4FLB A;  4F3V A;  1B89 A;  1OCC E;  3LS8 A;  4G8L A;  4ANW A;  3EU9 A;  4G24 A;  3S7B A;  1S0P A;  4F1S A;  5AAO A;  4UWF A; 
#chains in the Genus database with same CATH homology
 3TG4 A;  3UX4 A;  1DVP A;  4N5C A;  2ION A;  4APO A;  3RIB A;  3CIA A;  2VSN A;  2GGF A;  3SI5 A;  2ILR A;  2KCV A;  2XCB A;  4Q94 A;  5LX8 A;  4JZY A;  1E8X A;  3EIJ A;  1LF8 A;  3JCK C;  3N71 A;  3ASH A;  4HFG A;  3VLD A;  2XGM A;  5J08 A;  2J9Q A;  4G26 A;  4TRQ A;  3FU6 A;  3D9I A;  3PS6 A;  2WXK A;  3ZGQ A;  3MYV A;  3GW4 A;  2CG2 A;  3CQG B;  4LUN U;  3FWV A;  3MV3 B;  3L13 A;  3K9I A;  2A5U A;  1H2U A;  1E8W A;  3IHV A;  2WQH A;  3CSF A;  4A1S A;  4N3A A;  1KT1 A;  2OV8 A;  3ASD A;  3OXG A;  2M63 A;  1H6K A;  3PE4 A;  3Q4A B;  2PM6 A;  3OAW A;  1H0A A;  4A3V A;  3VTX A;  3FUK A;  4L2L A;  4J8S A;  2CFZ A;  4XIF A;  3ZYM A;  3FDH A;  3SZ7 A;  4ILG A;  4WND A;  4XKB A;  1PC2 A;  4JVS A;  2LAH A;  4XI9 A;  3ZW3 A;  4G2V A;  1ELW A;  3CVP A;  2WXF A;  4C0M A;  3D9P A;  1PAQ A;  3ASF A;  4ATG A;  3SBT B;  4AM9 A;  3RRN B;  2JEK A;  4I1O B;  3CK7 A;  2IJG X;  3HHM A;  3FH5 A;  1H2V C;  5G04 J;  4FAD A;  3MCX A;  4CGW A;  3TL5 A;  4UQZ A;  3LY8 A;  5E76 A;  3R7Q A;  2WXI A;  4ACL A;  3L22 A;  3PDN A;  2UWJ G;  4GZ3 A;  1FVF A;  1FCH A;  4F53 A;  4DJA A;  4B8C B;  1U3C A;  2DIW A;  3HVE A;  4BX9 A;  1VDY A;  4XI0 A;  3L6A A;  3Q49 B;  3URZ A;  1TJC A;  2AXV A;  2AXZ A;  3D9M A;  4LER A;  2I1K A;  2L9B A;  5G05 C;  3G2S A;  4KZ0 A;  2CHX A;  4YVQ C;  4G1T A;  4GA1 A;  4KMO A;  5FJY A;  5CCM A;  4HOQ A;  3S7J A;  3TGO A;  4RVB A;  4I9C A;  3FUN A;  2CFU A;  3VTY A;  3ZYQ A;  4JW1 A;  5JJ6 A;  4B0Z A;  2KM4 A;  4KVM A;  3QWP A;  2IOS A;  2I6H A;  2MHK A;  4GU5 A;  2AW6 A;  2KAT A;  2KZT B;  5CMY A;  3RRM B;  3Q47 B;  1OUV A;  2X6H A;  3PE3 A;  4EZK A;  3AS8 A;  4LCT A;  3ENE A;  3BG0 B;  5A23 A;  4BTB A;  3FTU A;  2UY1 B;  4UI9 C;  4GYY A;  1E7U A;  2Y4U A;  3D9L A;  4B8A A;  3FY4 A;  3CST A;  4ILI A;  1E90 A;  3OTN A;  5AJD A;  4BSX A;  4KXK B;  4UQY A;  2YNQ A;  3CVL A;  4M3O A;  5LP0 A;  1HG5 A;  2IQC A;  4N3C A;  1HE8 A;  2BF0 X;  2OVB A;  5A6C A;  2VTB A;  3FUL A;  5AYW D;  5ARF A;  4PDX A;  3TXN A;  2HR2 A;  1EYH A;  3ZVV A;  2R59 A;  3MZL B;  4I17 A;  4PS8 A;  2HM8 A;  4GYW A;  4WAF A;  2WQ7 A;  3GZ2 A;  5AIJ A;  3EJN A;  3NZU A;  4G25 A;  2WMO A;  3LEW A;  4Q96 A;  5BUZ A;  3HDX A;  2GW1 A;  2V8S E;  1NZN A;  3TJP A;  5LFA A;  5FZS A;  3UQ3 A;  3QJZ A;  3B7R L;  1IYG A;  2CHW A;  3B7T A;  3QC1 A;  3VLF A;  4U0S A;  3VLE A;  5G05 J;  4EPZ A;  1JWF A;  3BG1 B;  3ML9 A;  2VGX A;  4AJW A;  1E8Y A;  4MLP A;  3LVR E;  5KJN A;  3JQ0 A;  2IF4 A;  1SZA A;  3NQP A;  1JWG A;  3LY7 A;  3ZHE A;  4ACK A;  4BX8 A;  3CHM A;  3UT7 A;  5C1D A;  3NF1 A;  4EQF A;  4JPS A;  5KJM A;  2X3M A;  1HG2 A;  3Q15 A;  4UWH A;  4DK5 A;  5BPP A;  3QNK A;  1NA0 A;  3MA5 A;  3GZS A;  4GZ6 A;  4HVB A;  4DPR A;  1OWP A;  2BUG A;  4G11 A;  2IFU A;  3PEV B;  3KD7 A;  4I9E A;  4N3B A;  2LNI A;  4FC8 A;  3RO3 A;  5KJL A;  4UI9 J;  3HYM B;  3CVX A;  4FJZ A;  4OVU A;  1ZU2 A;  2DCP A;  3L16 A;  2WXQ A;  5AJL A;  4E6H A;  3L54 A;  4AP2 A;  4Y6W A;  1A17 A;  4CT4 A;  5KJK A;  4URK A;  5D0O D;  3ESL A;  2EQX A;  5T4Y A;  4CEM A;  4EZJ A;  3CK9 A;  4JA9 A;  2FI7 A;  4PH4 B;  1IQU A;  2V5F A;  2VTB B;  3QDN A;  4CCA A;  1UG3 A;  4NUR A;  1H2T C;  5LOZ A;  4Y6C A;  3CK8 A;  1HZ4 A;  4EBA G;  3FEY A;  2AVP A;  5FQ6 A;  3FH7 A;  2IU1 A;  3JYS A;  1HO8 A;  2AWI A;  2L6J A;  3IV0 A;  4KBQ A;  3R9A B;  4BFR A;  1BPO A;  3CHS A;  1NP7 A;  3CKC A;  4DI4 A;  5FWQ A;  4N2S A;  1SZ9 A;  5CHE E;  4RG9 A;  4CRW A;  2LO6 A;  2WB2 A;  4AIF A;  1UW4 B;  2V0P A;  4P29 A;  4YVO A;  1N54 A;  3S7D A;  3QWW A;  3MV2 B;  2P58 C;  3D9O A;  4B89 A;  4J8D A;  4WWN A;  2KCK A;  2MRI A;  3U66 A;  4D10 C;  1Z3Y A;  5KCM A;  1MHQ A;  4ILH B;  4EEC A;  3G2T A;  5C2Y A;  4L7T A;  3UT8 A;  5HQ8 A;  3EDT B;  4UI9 K;  4GYO A;  3CVU A;  3TG5 A;  3ZEF A;  1HF8 A;  2PL2 A;  3CVQ A;  5A7D B;  1TEZ A;  3UPV A;  4JXT A;  2RD0 A;  3U3W A;  2OVF A;  3AS5 A;  2J49 A;  3ZIM A;  1TJF A;  3FFL A;  4CDM A;  1YA0 A;  2A4Z A;  4AY5 A;  2PM7 A;  2LSV A;  3MKQ A;  4O6F A;  5HI7 A;  3RJV A;  5E75 A;  5FZR A;  4I43 A;  1HX8 A;  5T8I A;  3KEZ A;  3SNX A;  3T5X A;  5CCL A;  3I3N A;  1JUQ A;  3ONK A;  1UN9 A;  5BV0 A;  2J09 A;  4PS3 A;  4C9B B;  1E96 B;  1EDU A;  1E7V A;  1EF1 C;  3C98 A;  3FUM A;  4XKC A;  4FUL A;  1HS6 A;  3RU0 A;  4KVO A;  3PUK A;  3SGH A;  4WNF A;  3I5P A;  3PZD A;  4A3T A;  3ZFW A;  4EBA A;  4L2Y A;  2JLB A;  2KC7 A;  3SHF A;  4E85 A;  4NAC A;  3OXL A;  4MKT A;  4OVV A;  1Y8M A;  2R17 C;  3FUF A;  5CMW A;  3O48 A;  3P1U A;  1Z6T A;  3FUD A;  3APF A;  4I6J A;  4EZL A;  2BTD A;  3MEK A;  5DBK A;  4GMJ A;  2C2L A;  1KLX A;  4UQX A;  2YHC A;  5JHA A;  3APC A;  3GZ1 A;  4AOF A;  4AXH A;  4HOR A;  2FO7 A;  1EPU A;  2VQ2 A;  3LCA A;  2AXU A;  3FTY A;  5ARG A;  3MJW A;  2WXR A;  3PNL B;  1JPL A;  4A1G A;  3FTX A;  4AEZ C;  2NXP A;  3QAR A;  4R7L A;  3S7F A;  1ZBP A;  3HVE B;  3OXF A;  3PNT B;  3RRU A;  3ZPJ A;  3KAE A;  5BT1 A;  4GZC A;  3ASG A;  4OYS A;  3RK6 A;  3JQ1 A;  1XGW A;  4JHJ A;  2E0I A;  1N52 A;  2YHE A;  4FLH A;  3UUX A;  4GCN A;  4IYP A;  3JUI A;  3QAQ A;  4AVX A;  3QKY A;  3ZXS A;  5G2N A;  4N2Q A;  3CLJ A;  4MS6 A;  1DNP A;  2NSZ A;  4C0E A;  2PQN A;  3LYA A;  1HU3 A;  3PVL A;  4ME2 A;  3PRE A;  2XPY A;  3PEU B;  4J8E A;  2WXO A;  3EIQ C;  4FP7 A;  4KYO B;  4XZ4 A;  1HFA A;  3U64 A;  1IHG A;  3HIZ A;  2FBN A;  5FZQ A;  3LPZ A;  4APF A;  3FH8 A;  3ML8 A;  4XX5 A;  4GAA A;  4J0U A;  4HS2 A;  3PH0 C;  5EX3 A;  4BTA A;  3SBS A;  2WXP A;  3APD A;  4H7Y A;  4RG6 A;  4FA6 A;  3FUJ A;  4GPK A;  4FJY A;  1FVH A;  2HYZ A;  4UWK A;  1WM5 A;  1L5J A;  4H7X A;  4GA0 A;  4HXI A;  2WMN A;  2OOE A;  4JHR A;  4WWP A;  4PS7 A;  5FQ4 A;  1OWL A;  3IHY A;  2OND A;  1U3D A;  2WXM A;  3LVQ E;  2WQ6 A;  4BT8 A;  2QY7 A;  4JC8 A;  5M72 A;  2XPI A;  3ONL A;  4FHK A;  4ANX A;  4U63 A;  2I1J A;  3AU5 A;  3DPD A;  3ULQ A;  4CDR A;  4B94 A;  2Q7F A;  2X6F A;  5JHB A;  2XCC A;  5EKQ D;  1PY1 A;  3G2W A;  3GYZ A;  1INZ A;  4K03 A;  2FEZ A;  1UN8 A;  2FF4 A;  4J6I A;  5T3R A;  3RO2 A;  5BV1 A;  4LEU A;  4F7A A;  2X38 A;  1KT0 A;  3CEQ A;  2VSO E;  4LRZ A;  4KZC A;  1QQE A;  1ELK A;  2IOL A;  5ANL A;  2PQR A;  3MGB A;  3LJ3 A;  4HOU A;  3CR3 A;  3FU0 A;  4N39 A;  3FUH A;  4RSY A;  2XRY A;  2VGX B;  4DLQ A;  5FT9 A;  3RKV A;  2FUL A;  2KZT A;  4I1M A;  1X5B A;  4HLE A;  3CVY A;  2WXN A;  3L08 A;  4XE0 A;  3ZHE B;  2Y3A A;  1QNF A;  2V4L A;  2QFC A;  1W3B A;  2UY1 A;  3FP3 A;  4TV3 A;  3P2B A;  5FQ7 A;  2WXL A;  4NRH B;  1H19 A;  1WAO 1;  1P5Q A;  1SQM A;  4MRU A;  2Y4T A;  4WWO A;  2VSY A;  4ANV A;  3QB2 A;  2C0L A;  3MX3 A;  5BW8 C;  2E2E A;  4I1A A;  2ZU6 B;  4GML A;  3QOU A;  4JA7 A;  4JEH A;  2X6J A;  3EHN A;  2L0I A;  1HXI A;  3CV0 A;  4W9R A;  4GA2 A;  2WXG A;  3ZYL A;  3BEE A;  4IRU A;  3UT4 A;  1IQR A;  3ESK A;  3FU5 A;  2VSX E;  2LAI A;  3I4G A;  5FTP A;  4K0R A;  3U4T A;  4BY6 A;  4GCO A;  1WY6 A;  3FHE A;  3AS4 A;  3FTV A;  3WXX A;  4BT9 A;  2WXJ A;  4I2Z A;  4CT0 A;  4U04 A;  4KT6 B;  4ANU A;  3L17 A;  4UWG A;  5LCW C;  1UJK A;  3ZYK A;  1ELR A;  3S2A A;  2J08 A;  3D9N A;  4JHK A;  2CG3 A;  3CVN A;  4Q69 A;  3E4B A;  4GZD A;  2VJ8 A;  3IEG A;  2PZI A;  1UJJ A;  4G23 A;  2NC9 A;  3TAX A;  2X6K A;  3QK0 A;  2WPV A;  5D0Q D;  2VYI A;  3CKB A;  4I2W A;  4L23 A;  2XEV A;  3CGH A;  2XGS A;  4HOS A;  1Y6I A;  3Q5M A;  1OWN A;  3TXM A;  3FTZ A;  1QZ2 A;  3ZRH A;  4U0U A;  5AEN A;  3G2V A;  4L1B A;  2J4B A;  4QFV A;  3R7R A;  3KS2 A;  4ABN A;  3T5V A;  2CHZ A;  2KCL A;  4U8H A;  3DBS A;  3SF4 A;  3LKU A;  4JL0 A;  1OWM A;  2X6I A;  3D3M A;  4JEU A;  2XHE A;  4CDN A;  4I6G A;  2LSU A;  1E8Z A;  3CVW A;  2DBA A;  4A55 A;  2J07 A;  3FEX A;  3QWV A;  4WNG A;  4YND A;  2WVI A;  3EHM A;  3LY9 A;  3B7S A;  5BNW A;  3LDZ A;  5FQ8 A;  2GRL A;  3CQC B;  3MKQ B;  4GB9 A;  2L0T B;  4J8F A;  3FUE A;  3CHQ A;  2XGO A;  4V3I A;  4UWL A;  3T8M A;  4U0Z A;  2VGY A;  5ANR A;  4IUL A;  3D9K A;  4HOT A;  4DLO A;  4NQ0 A;  3CHR A;  1GW6 A;  3ZN3 A;  5EX0 A;  3FTW A;  2XPZ A;  3FU3 A;  5DIZ A;  4IN3 B;  3SFZ A;  3NZS A;  3U9W A;  1OWO A;  1NA3 A;  2YQ8 A;  3G2U A;  2WM9 A;  3MKR A;  3CHP A;  3O4Z A;  4I6E A;  4U07 A;  5G55 A;  3IBE A;  4BWR A;  5JJT A;  3B13 A;  3SD5 A;  5LCW J;  2RG8 A;  4WUY A;  3D9J A;  2WXH A;  3IKO B;  3FUI A;  4FLB A;  4WNE A;  4F3V A;  1B89 A;  2MOW A;  3LXU X;  4DI3 A;  1Z3X A;  3CVV A;  2C0M A;  3FTS A;  2GRM A;  3AU4 A;  3LS8 A;  2XRZ A;  4FHJ A;  4ANW A;  3B7U X;  3I4R B;  4G24 A;  4FU3 A;  1HH8 A;  3CHO A;  5G04 C;  2I2O A;  3S7B A;  5EDS A;  4PUC A;  5JJ7 A;  4AY6 A;  1S0P A;  1XNF A;  4AV7 A;  4GZ5 A;  2HO1 A;  3PUJ A;  1MQS A;  4TUU A;  4F1S A;  5J90 A;  2J4D A;  5ENN A;  3PRZ A;  2XQ0 A;  2R5S A;  2YIN A;  4CGV A;  2I9C A;  3UMV A;  4UWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...