2L9BA

Heterodimer between rna14p monkeytail domain and rna15p hinge domain of the yeast cf ia complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
b'ANFLSQKFPELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQEWTRAHPEDAASLLELCPQLSFVTAELLLTNGICKVDDLIPLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA 3'-end-processing protein RNA15
publication title Locked Tether Formation by Cooperative Folding of Rna14p Monkeytail and Rna15p Hinge Domains in the Yeast CF IA Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.630 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l9bA00
4EBAG 2L9BA
chains in the Genus database with same CATH superfamily
2Y69E 1S70B 4BT9A 5BV1A 2CG3A 3MZLB 2M63A 2RFMA 3DEOA 3QC1A 2BTDA 5AQBA 2KBXA 3FY4A 4GA0A 2FO7A 3PVLA 2VSYA 5BUZA 3FTUA 2J8SD 3NAWA 4IN3B 2X6FA 5CCLA 3PZ3A 4GMLA 3B7SA 2KZTB 4N5QA 3EIJA 4HOQA 1LD7A 2KM4A 2B0OE 1V54E 4EECA 3FU3A 3C72A 4K5CA 2DZNA 1TNOA 4N5CA 3LXUX 4HVBA 1YYHA 5ENPD 3U64A 2PZIA 4EZJA 4NIKA 2H6IA 3HHMA 3C98A 4LCTA 5LCWJ 3GW4A 1TNUA 3SFXA 5ITZF 3CVWA 3APDA 4J8FA 4N3BA 4UWKA 5KJNA 2AWIA 2FI7A 1EF1C 3B7TA 4FP7A 4U95D 1KPSB 5HI7A 3QAQA 2QC9A 1INZA 1IKND 1PY1A 2PNNA 3MGBA 4G8LA 4BTBA 3ULEG 3LKUA 2VGXB 1QQEA 5LFAA 1YA0A 4U63A 3UM0A 1MYOA 4ACKA 4GTMA 3PUJA 3LYAA 4JVSA 1Q2ZA 4TRQA 3K9IA 2FULA 4MLPA 4XI0A 3QB2A 1UW4B 5G55A 1TN7A 3HYMB 2C0MA 1W3BA 4RSYA 2CHXA 4FLBA 3RKVA 2EIJE 3CKBA 3GYZA 3T5VA 2J49A 4GTVA 2OEVA 1OUVA 5AN8A 1TYQG 4N3AA 4JXTA 3ZIMA 3ONKA 3FUHA 4TXPA 2KZTA 3ESKA 2P9SG 3VLEA 2WXFA 2R5SA 4C0MA 4GYWA 4E6HA 1EPUA 4J6IA 3L6AA 3B7UX 3CEQA 3SFYA 1S0PA 5BW8C 4KT6B 5G2NA 3QWPA 3MEKA 2WMNA 3L16A 2Y1LE 3CV0A 3FH8A 4HI9A 4I9EA 5CMYA 3E32A 5KNHD 1MJ0A 4TUUA 2VGEA 1N54A 2IOSA 3FTYA 3QWVA 2IJGX 5ARFA 2MRIA 4OVVA 3LCAA 3J5PA 4JEHA 4JC8A 2ETAA 2VGXA 5T3RA 2HR2A 3DSWA 2J09A 5BPPA 4CGVA 4WNEA 4CGWA 2IQCA 4B93B 4Z68A 1U3CA 4HOSA 4G1TA 4DRXE 2DVWA 2QFCA 5A23A 4DI3A 4HLLA 3ZKJA 1LF8A 4GZ3A 3JXIA 5BXUA 1S63A 4JA9A 4LUNU 1ELWA 3CVNA 3JUEA 2ZIRA 2LAIA 4HRLA 4OVUA 1K3ZD 4I6EA 3MCXA 1FVHA 4K0RA 1N9AA 3B13A 3DWLG 4BY6A 4ANVA 1FT1A 4JHJA 3V31A 5JA4D 5HQ8A 3S7FA 2WXMA 2QYUA 2BKGA 5EKQD 1OWPA 4FLHA 4Q69A 2DYSE 1G3NB 3LVRE 1DCEA 4BSZB 3BEEA 5EILA 3R7RA 3CIAA 1NL4A 2I1JA 3PZ4A 3RRUA 3CHQA 2BUGA 4LEUA 4CDMA 1QBQA 2E2EA 2XQ0A 3CKCA 4JB8P 4UI9K 4F6RD 1N0RA 3I4GA 3CVXA 5AQAA 4ILGA 5AQ9A 4TUMA 3CVUA 3QK0A 1SZAA 2IY0C 4NURA 3VLFA 4PDXA 3SBSA 2VJ8A 2WQ7A 1HZ4A 4DI4A 4HNAD 4FULA 1ZBPA 3RRMB 3MJWA 4GYYA 2OV8A 3EU9A 3UKUG 2PM7A 3FUDA 2WXPA 3Q75A 4XE0A 3TWWA 3L22A 2X6IA 2R17C 4K5BA 4K5AB 1N11A 2RFAA 3BU8A 1O5MA 3C3OA 3BG1B 3EHMA 4BX8A 4U0UA 2XGMA 4Y6WA 3CSTA 2FBNA 4N3CA 3S7BA 4WWNA 3SO8A 4QQIA 4ZFHA 4CEMA 2GROB 1UJKA 3G2SA 1ELRA 4E85A 3WXXA 1DNPA 4UQZA 4CDRA 4GCNA 3BQOA 4GB9A 3E30A 1Z3YA 5FJYA 3ASHA 3KEZA 3C5RA 4B8AA 2OOEA 1BD8A 3G2WA 2OVFA 2XRYA 3SZ7A 1BI8B 1TN6A 2I6HA 5HRYA 5D2MC 2X6HA 3FEXA 1UOHA 1JWGA 4APFA 4U04A 4YDEA 4C48B 3SI5A 4AJWA 1NP7A 4GA1A 1IHBA 4UUCA 4ABNA 4D10C 3FH7A 3OXFA 4ILHB 2J9QA 1HO8A 1LTXA 3CR3A 4NACA 4AP2A 3AS8A 2IF4A 5G04C 3UIOC 3FUJA 2Q7FA 2WXQA 3TWVA 4AM9A 2MYOA 4V3IA 3MV2B 3LVQE 3IKOB 3FU0A 2WM9A 5ARGA 1WY6A 3APCA 4U8YD 2GRRB 4B8CB 5KWDA 3Q79A 3RK6A 4J8DA 5DIZA 1L5JA 3UPVA 3G2UA 1JPLA 5ANLA 4J8SA 3RJVA 3EHRA 3D9OA 3DSXA 3ASNE 3TWUA 3Q7AA 2CG2A 4EQFA 3Q9UC 4U0ZA 3JXJA 3FUFA 3HXBA 4GMJA 4GTQA 3UI2A 3L82A 3VLDA 5BXOA 4RG6A 4J0UA 1E8XA 1TJCA 3FEYA 4KBQA 4DX2A 4N2QA 3HVEB 4YVQC 1BI7B 5D0QD 4GZCA 4BETA 1O1RA 5AQ7A 2Y4UA 5T4YA 3NBNB 1SA5A 2WXHA 4BFRA 4Y6CA 3R9MA 2F8YA 3AU4A 5E75A 3L17A 3P2BA 3D9LA 3RSEG 3E33A 1RZ4A 3W9GA 3PDNA 2FO1E 2PM6A 4A3TA 5ENOD 4WNDA 3U3WA 1OT8A 2FEZA 1K1AA 3T8KA 2P9NG 1KZPA 2P58C 2X3MA 4UWFA 2HO1A 2V0PA 1Y8MA 3NOGD 4GPMA 1RW2A 2WQHA 1BU9A 3UXGA 4A3VA 3TWSA 2I9CA 1U2VG 3CQCB 3TWTA 3E34A 4OAVB 3QDNA 5EYPF 3IEGA 2J08A 4FA6A 4JEUA 3GZ1A 5EX0A 4AV7A 1WAO1 3FU5A 3SBTB 3ZN3A 5J08A 2CHZA 5ENSD 4HRMB 3KS2A 3UM1A 3CHMA 2AW6A 1E8ZA 4GAAA 2IONA 2QZAA 3SF4A 3FUNA 4J8YA 5FT9A 3CHPA 5ENNA 3AG1E 4L2LA 3S2AA 3HVEA 3ONLA 2PQRA 4G25A 2P9PG 4HOTA 2WXRA 3OAWA 4HB5A 1E7VA 4U96D 3SFZA 1OXJA 4XKBA 4DX1A 2WXKA 3CHRA 1IHGA 3ZFWA 3PREA 4HBDA 4ATZD 2WXJA 3L13A 4A63B 3ABLE 3UT8A 4DX5D 2R59A 3PE3A 1QYMA 2JLBA 2C0LA 4CT4A 1OCRE 4AEZC 3GZ2A 2KCVA 1WM5A 2XGSA 2KXPC 3FDHA 3KEAA 4GA2A 3CHOA 4IRUA 1FCHA 4HXIA 4DX7D 4G24A 2DIWA 3TJPA 2XENA 3FUKA 3UINC 3UUXA 3HXCA 3PS6A 4GU5A 5AJDA 5CECB 4EZLA 4GTRA 4L2YA 4GTTA 4W9RA 4PS7A 2VSNA 1HS6A 3RO2A 3UX4A 4YVOA 4WNGA 4DPRA 3KSQA 1BPOA 4F7AA 1MX4A 3HDXA 2B6CA 2H6FA 4FADA 3Q9NC 5E76A 1HFAA 3ZW3A 1FT2A 2V8SE 3CVQA 2XGOA 1WDYA 2MHKA 4ANXA 4N2SA 5B1BE 1E96B 5ENRD 3FP3A 5FTPA 3CVPA 1N4PA 3UMVA 5G05C 2RKKA 3PZ2A 3DBSA 3EHNA 2MOWA 4KZCA 2KCKA 5KBAA 3N71A 2WXGA 3DXMG 3EDTB 3OXLA 4APOA 4I9CA 4LRZA 5AJLA 3B7BA 3V2OA 5H7PA 4I43A 4TV3A 3BG0B 4G23A 3KAEA 4TXRA 1BLXB 3FTXA 3DRAA 1Z6TA 2EIKE 3UIPC 2L9BA 1TN8A 5B1AE 4JZYA 4UI9C 3RRNB 3CGHA 4LERA 1HG5A 4KVOA 1A5EA 1K8KG 1OCZE 4DJAA 3ABKE 4BEPA 3Q15A 3D9HA 4ME2A 3IXEA 3ISMC 3S7JA 3Q49B 3TG4A 4PUCA 3L54A 1IQUA 2J07A 5FZRA 1VDYA 3LJ3A 2I2OA 4XI9A 3CVYA 3ZYQA 1MHQA 3W9FA 3ZHEA 1OY3D 4FHJA 1ELKA 3V79K 3KSLA 4XZ4A 3CK8A 2LSVA 1Y6IA 1E8YA 2ZISA 4U07A 3T9KA 2LUHA 4WWPA 4G26A 3CVVA 1QNFA 5JHBA 2ZGDA 4DX6D 3Q4AB 4JA7A 1MX6A 4K03A 3CHSA 2YQ8A 3ZNGA 5D0OD 4UQXA 3LS8A 4LNGA 3VTXA 4H7XA 4U0SA 4LNBA 1SQMA 4L1BA 1FVFA 5T8IA 1QZ2A 1IQRA 2XEVA 4WNFA 3CQGB 3ZYLA 4LG6A 3GZSA 1N4SA 4I2ZA 5ENQD 2GGFA 3QARA 4ACLA 2P9IG 4OYSA 4RQIA 3NQPA 4A1SA 2F8XK 2XPYA 3JUIA 2WXNA 3QWWA 3IV0A 3FTWA 1JCQA 3ABME 1AWCB 4IYPA 3SGHA 4WAFA 4KXKB 3I5PA 4BWRA 2GW1A 2AVPA 3LY9A 4YDYA 4J7WA 3R9AB 2ZGGA 4AY6A 4FHKA 2IFUA 3DPYA 1HH8A 2P2CP 3I3NA 3CSFA 3EU5A 3T8MA 3UKRG 2LAHA 4KYOB 1S64A 5EYLA 5KCMA 1KT0A 5FQ8A 3IHVA 3ZYKA 3ZPJA 1Z3XA 2P9LG 4AXHA 3NB2A 4ANWA 4LSZE 5EIDA 5FQ6A 3PEUB 4RVBA 2YINA 2IOLA 2CFUA 3C3QA 3AU5A 2WVIA 2AJAA 3Q78A 4JD2G 4BTAA 3LJNA 2CHWA 1X5BA 1E90A 2OVBA 1TNZA 3FU6A 3HXDA 4GTOA 3ASDA 3EIQC 1KLXA 3AAAC 4KZ0A 3EUVA 3TXNA 3V30A 3D9JA 4JPSA 1UN8A 1N4RA 4L23A 2KC7A 4MS6A 1SZ9A 2F37A 1TEZA 5CRVA 4C0EA 3DSUA 4BSXA 3OXGA 5JMND 4GTPA 3AS4A 1HXIA 5IY5E 3ZU7B 4AVXA 3HRAA 4O1OA 1WG0A 5ENTD 3UQ3A 3TWRA 2GRLA 2Y3AA 2XRZA 5EX3A 2P9KG 5LP0A 4FJYA 4HOUA 3MYVA 4A1GA 2LXMA 5CRUA 3AG3E 3PNLB 5G04J 2UY1B 2R2LA 5FQ4A 3SHFA 1NI1A 5FZSA 3NZUA 3RO3A 4JW1A 4DUIA 3G2VA 4PH4B 4DLOA 1UN9A 4O60A 4U8VD 5B3SE 1H0AA 4HQDA 3R7QA 1TR4A 2JEKA 1N4QA 1U3DA 3SY2A 5AAOA 3EHQA 3AS5A 4N39A 4HI8A 5JJTA 2LNIA 4GYOA 3TWQA 3EJNA 2P9UG 4JL0A 4A55A 5DBKA 1P5QA 2L6BA 3ASFA 1Z5SC 5JJ7A 2J4BA 2XPZA 2IO3C 1H2UA 3I4RB 1ZB1A 4XIFA 2XZTG 3DXKG 4URKA 4ILIA 5AIJA 4B94A 2XCBA 4BERA 4RG9A 3D9NA 2ETBA 3SD5A 4NQ0A 2YHEA 2LXLA 3FWVA 3V2XA 3ZUVB 3JYSA 4IULA 2GRPB 2DCPA 3FH5A 4DK5A 3MKRA 3TGOA 1D9SA 5BV0A 4LNUD 3CVLA 4CDNA 4BESA 4UWLA 4OAUC 3CK9A 3AJIA 2IO2C 1NA3A 3O48A 2RG8A 4U8HA 2H6GA 3D9MA 4EPZA 2JABA 3ASOE 4C9BB 2UY1A 1OWLA 5EIBE 4B0ZA 2WXIA 4L7TA 2GRMA 3PUKA 3F6QA 1NZNA 5ANRA 2HM8A 1H19A 2Y0BG 2XCCA 1FPPA 4ATGA 3PNTB 5CBOA 5LX8A 4I1OB 5A7DB 4L9PA 2BEDA 4FC8A 3LY8A 3FUIA 2R02A 1SVXA 3U9WA 5FINA 4M7CA 3PEVB 4CZ2D 4U7EB 2BF0X 1TNBA 2XZDG 1XGWA 2DBAA 4CT0A 1TNYA 3ULQA 4BX9A 4M3OA 3PH0C 2NYJA 3UM3A 3FTVA 2AXVA 1ZU2A 3CLJA 2OCCE 1YMPA 4XX5A 3D3MA 3DSTA 4G8KA 1OWMA 3NF1A 3FULA 3Q7FA 4Q96A 2LSUA 2I1KA 4X8QA 3D9IA 5CERB 2H6HA 4CCAA 5JJ6A 4WUYA 2KATA 1EDUA 2NXPA 3QKYA 3OTNA 2BKKB 2RD0A 4EBAA 2DWZA 4KVMA 5M72A 4PS8A 4GCOA 3UT4A 4H7YA 3ZHEB 1KT1A 4I17A 3ESLA 4HORA 3VTYA 3DSSA 1MZCA 2WQ6A 4CRWA 5CEAA 1H6PA 2UWJG 4EBAG 2XEEA 3WG7E 5A6CA 2VYIA 3JQ0A 1H2VC 2HYZA 1OCOE 2V4HC 3E4BA 3FTSA 2VSXE 5CHEE 3G2TA 4WWOA 2EILE 2E0IA 2DYRE 1JCRA 2LO6A 3RU0A 3X2QE 1DVPA 2L6JA 4HLEA 1H2TC 5AARA 2XEHA 3UT7A 1UJJA 4YNDA 3Q5MA 2HE0A 2ZXWE 1H6OA 3RIBA 5CBNA 3FFLA 1HG2A 3D9PA 1N94A 4G2VA 3ZVVA 2ILRA 3L08A 1DC2A 4DLQA 3QOUA 4I1MA 1V55E 4UWGA 1LD8A 3BUAA 2V5QC 2WMOA 2WB2A 3JQ1A 4EHMA 2R03A 1HF8A 1IYGA 4G11A 4XKCA 2XPIA 2WPVA 4HFGA 4F1PA 2WXLA 5D66A 4FU3A 1A17A 3LDZA 3HG0D 3DPDA 4ANUA 1HU3A 1AP7A 2EQXA 3DSVA 2GRQB 4B89A 2ETCA 3MKQB 2VSOE 2ONDA 1K1BA 2J4DA 5G05J 1DCQA 2EIME 3TAXA 1EYHA 3Q73A 2V5FA 4UWHA 1E8WA 4GZ5A 4KMOA 4O1PA 2XS1A 1O1TA 4F1SA 3ZYMA 3MV3B 3PZDA 3B95A 3TL5A 1O1SA 4JHRA 5CEDB 4F53A 1H6KA 2L0TB 1JWFA 2Y4TA 3DEPA 3T5XA 2R05A 1OCCE 2A5UA 2IEJA 3FUMA 3AG4E 1YCSB 3TXMA 3P1UA 5CMWA 4MKTA 3MX3A 1OWNA 2XHEA 3IBEA 3PE4A 2OEWA 2NC9A 4GMRA 3QJZA 4UI9J 4AOFA 1E7UA 3ZXSA 4CYMD 5FWQA 4QFVA 2CFZA 4I1AA 3ZXPA 2QYJA 1NFIE 1N52A 2YHCA 1UG3A 4TXQA 5HKPA 1SW6A 4BT8A 4ZHBA 2L0IA 1XNFA 5AENA 4F3VA 5KJKA 3NOCD 3ULYA 2ZU6B 3E37A 4J8EA 3APFA 3JCKC 2IU1A 4MBGA 3Q47B 3HXEA 2DZOA 3ZEFA 5JHAA 5BNWA 3MKQA 2VGYA 3LEWA 5FQ7A 4YDWA 3IHYA 1JCSA 3ZGQA 3SQVA 3TG5A 3FTZA 2GRNB 4I6JA 2VTBB 4NRHB 4UQYA 1MQSA 5C1DA 5FIOA 5LOZA 4GZDA 4AIFA 1NA0A 2VQ2A 3PRZA 4O6FA 3TWXA 1X81A 1IXVA 3C3RA 3L9TA 1TJFA 3NZSA 1HE8A 3SNXA 5KNGA 1SA4A 3CK7A 5CCMA 2X6JA 1PC2A 4FJZA 3HIZA 4P29A 2NSZA 5EN5D 2F0YA 2XS8A 5BT1A 2X6KA 2C2LA 1OWOA 2YNQA 2AXZA 3U66A 4HS2A 1JUQA 3LPZA 5C2YA 2QY7A 2KCLA 3J5QB 3U4TA 4JHKA 4GTSA 4I2WA 4EZKA 4XEIG 2A4ZA 1B89A 3ML8A 1D8EA 3QNKA 1GW6A 2X38A 2WXOA 3D9KA 3PZ1A 3ZRHA 3URZA 4AY5A 3FUEA 4GPKA 5HS0A 3ENEA 4HRNA 4RLYA 3KD7A 5AYWD 2PQNA 4PS3A 5FZQA 5KJLA 3AG2E 1N0QA 4MRUA 5J90A 1KZOA 5LCWC 2VTBA 1PAQA 3HXFA 3S7DA 2A5EA 1N95A 2PL2A 1D8DA 4R7LA 3ML9A 1MX2A 4YDOA 3RAUA 3MA5A 3O4ZA 3ASGA 5KJMA 2FF4A 3UM2A 3FHEA 4GZ6A 2AXUA 3LY7A 2V4LA 5EDSA 3B7RL 4Q94A 1HX8A 2EINE 4I6GA 3UTMA
chains in the Genus database with same CATH topology
4KVOA 2BF0X 2I6HA 1XGWA 2DBAA 4CT0A 3ULQA 4BX9A 4M3OA 4DJAA 2X6HA 3Q15A 4BT9A 5BV1A 3PH0C 2CG3A 4ME2A 3MZLB 2M63A 3FEXA 1JWGA 3FTVA 4APFA 4U04A 3S7JA 2AXVA 1ZU2A 3SI5A 3CLJA 4AJWA 3QC1A 2BTDA 1NP7A 3Q49B 3TG4A 4PUCA 3L54A 1IQUA 4XX5A 4GA1A 3D3MA 2J07A 5FZRA 1VDYA 1OWMA 3LJ3A 3FY4A 3NF1A 4ABNA 2I2OA 4XI9A 4D10C 3FULA 4GA0A 3CVYA 3FH7A 3ZYQA 1MHQA 2FO7A 4Q96A 3OXFA 3PVLA 2VSYA 4ILHB 3ZHEA 2LSUA 2I1KA 2J9QA 5BUZA 1HO8A 3FTUA 4FHJA 3CR3A 3D9IA 4NACA 4IN3B 1ELKA 2X6FA 5CCLA 4AP2A 4GMLA 3AS8A 4CCAA 2IF4A 4XZ4A 5G04C 5JJ6A 3FUJA 3CK8A 2Q7FA 2KATA 2WXQA 2KZTB 2LSVA 1Y6IA 1E8YA 3B7SA 4WUYA 4AM9A 1EDUA 2NXPA 3EIJA 3QKYA 4HOQA 3OTNA 2KM4A 4U07A 2RD0A 4V3IA 4EECA 4EBAA 4KVMA 4WWPA 5M72A 3MV2B 4PS8A 4G26A 3FU3A 4GCOA 3CVVA 1QNFA 3LVQE 3IKOB 5JHBA 3UT4A 4H7YA 3ZHEB 3FU0A 4N5CA 3LXUX 2WM9A 5ARGA 3Q4AB 4HVBA 1WY6A 3APCA 4JA7A 4B8CB 1KT1A 4I17A 4K03A 3ESLA 3U64A 4HORA 2PZIA 4EZJA 3CHSA 3RK6A 3VTYA 4J8DA 5DIZA 3HHMA 1L5JA 2YQ8A 3UPVA 3C98A 1JPLA 3G2UA 5D0OD 2WQ6A 5ANLA 4UQXA 4LCTA 5LCWJ 3LS8A 4J8SA 3RJVA 3GW4A 3VTXA 4H7XA 4CRWA 4U0SA 3D9OA 1SQMA 3CVWA 3APDA 4J8FA 4N3BA 4UWKA 5KJNA 2UWJG 4L1BA 2CG2A 2AWIA 2FI7A 4EBAG 1EF1C 1FVFA 3B7TA 4FP7A 4EQFA 4U0ZA 5HI7A 2VYIA 3JQ0A 3QAQA 5A6CA 1H2VC 2HYZA 1QZ2A 1IQRA 2XEVA 4WNFA 5T8IA 3FUFA 1INZA 1PY1A 3E4BA 3CQGB 3FTSA 2VSXE 5CHEE 3MGBA 4GMJA 3ZYLA 3G2TA 4BTBA 4WWOA 3GZSA 3LKUA 2E0IA 3VLDA 2VGXB 4I2ZA 1QQEA 4RG6A 5LFAA 2LO6A 3RU0A 1YA0A 4J0UA 1DVPA 1E8XA 1TJCA 3FEYA 2L6JA 4KBQA 4HLEA 1H2TC 2GGFA 4U63A 4ACKA 3QARA 4N2QA 3HVEB 4YVQC 3PUJA 3UT7A 3LYAA 1UJJA 4YNDA 3Q5MA 4JVSA 4ACLA 2WQ7A 4OYSA 3RIBA 4TRQA 3K9IA 3NQPA 5D0QD 3FFLA 4GZCA 2FULA 4MLPA 4A1SA 4XI0A 1HG2A 3D9PA 2Y4UA 2XPYA 3JUIA 3QB2A 5T4YA 2WXNA 1UW4B 5G55A 3QWWA 3IV0A 4G2VA 3FTWA 3ZVVA 2ILRA 2WXHA 3HYMB 4BFRA 3L08A 2C0MA 4Y6CA 1W3BA 4IYPA 4RSYA 2CHXA 3SGHA 4FLBA 4WAFA 4DLQA 3AU4A 5E75A 3QOUA 4I1MA 3RKVA 4KXKB 3CKBA 3L17A 3GYZA 3I5PA 2J49A 4UWGA 4BWRA 3T5VA 2GW1A 3P2BA 1OUVA 3D9LA 2AVPA 3LY9A 3R9AB 4N3AA 4AY6A 2WMOA 2WB2A 4FHKA 4JXTA 3PDNA 2IFUA 2PM6A 4A3TA 3ZIMA 3JQ1A 3ONKA 1HF8A 1HH8A 1IYGA 3FUHA 2KZTA 3I3NA 3CSFA 2XPIA 3ESKA 4G11A 4XKCA 3VLEA 2WPVA 4HFGA 3T8MA 4WNDA 2WXLA 2LAHA 2WXFA 3U3WA 2R5SA 4KYOB 4C0MA 4FU3A 1A17A 2FEZA 3LDZA 3DPDA 4ANUA 1HU3A 4GYWA 2P58C 4E6HA 2X3MA 1EPUA 2EQXA 5KCMA 4J6IA 4B89A 1KT0A 3MKQB 5FQ8A 3L6AA 3B7UX 4UWFA 3CEQA 3IHVA 2HO1A 2V0PA 3ZYKA 1S0PA 5BW8C 2VSOE 3ZPJA 2ONDA 4KT6B 1Y8MA 1Z3XA 2WQHA 2J4DA 5G2NA 5G05J 4AXHA 3TAXA 1EYHA 2V5FA 3QWPA 4A3VA 4UWHA 3MEKA 1E8WA 4GZ5A 2WMNA 4KMOA 4ANWA 2I9CA 3L16A 4F1SA 5FQ6A 3PEUB 3CV0A 3ZYMA 3FH8A 4I9EA 3CQCB 5CMYA 3MV3B 3PZDA 4RVBA 3TL5A 3QDNA 2YINA 3IEGA 2J08A 4JHRA 2IOLA 2CFUA 3AU5A 2WVIA 4TUUA 4F53A 1N54A 2IOSA 4BTAA 3FTYA 3QWVA 4FA6A 2CHWA 4JEUA 2IJGX 1X5BA 1H6KA 2L0TB 3GZ1A 5ARFA 2MRIA 5EX0A 4AV7A 1WAO1 4OVVA 1JWFA 2Y4TA 3FU5A 3SBTB 3ZN3A 5J08A 1E90A 2CHZA 2OVBA 3LCAA 3T5XA 3KS2A 4JEHA 3FU6A 4JC8A 2VGXA 3ASDA 1KLXA 3EIQC 3CHMA 2HR2A 4KZ0A 5T3RA 2AW6A 2A5UA 1E8ZA 3FUMA 4GAAA 3TXNA 2J09A 5BPPA 2IONA 4CGVA 4WNEA 4CGWA 2IQCA 3D9JA 3SF4A 3FUNA 5FT9A 3CHPA 4JPSA 5ENNA 4L2LA 3TXMA 3S2AA 3HVEA 1U3CA 3P1UA 4HOSA 1UN8A 4G1TA 4MKTA 3ONLA 3MX3A 5CMWA 1OWNA 2XHEA 3IBEA 2PQRA 3PE4A 4G25A 4L23A 2NC9A 4HOTA 2QFCA 2WXRA 3OAWA 2KC7A 3QJZA 4UI9J 4MS6A 5A23A 1E7VA 4AOFA 1E7UA 4XKBA 1SZ9A 3SFZA 3ZXSA 4DI3A 1TEZA 1LF8A 2WXKA 4GZ3A 5FWQA 4QFVA 2CFZA 4C0EA 4I1AA 3CHRA 4BSXA 4JA9A 1N52A 2YHCA 1UG3A 4LUNU 1IHGA 3ZFWA 3OXGA 3AS4A 4BT8A 3PREA 1ELWA 1HXIA 3CVNA 2L0IA 2LAIA 4OVUA 1XNFA 5AENA 4I6EA 4AVXA 4F3VA 5KJKA 3MCXA 2WXJA 1FVHA 3L13A 4K0RA 3UQ3A 3B13A 2ZU6B 4BY6A 2GRLA 2Y3AA 4ANVA 3UT8A 4J8EA 2R59A 2XRZA 3APFA 3JCKC 3PE3A 2JLBA 2IU1A 2C0LA 3Q47B 4CT4A 4JHJA 5EX3A 3ZEFA 5LP0A 5HQ8A 5JHAA 4FJYA 4HOUA 4AEZC 3GZ2A 3S7FA 5BNWA 3MKQA 2VGYA 2KCVA 1WM5A 3LEWA 2XGSA 2WXMA 5FQ7A 3MYVA 5EKQD 3FDHA 3IHYA 4A1GA 4GA2A 3ZGQA 1OWPA 3PNLB 3CHOA 5G04J 3TG5A 2UY1B 3FTZA 4I6JA 2VTBB 4FLHA 5FQ4A 3SHFA 5FZSA 4Q69A 4IRUA 1FCHA 3NZUA 4HXIA 3RO3A 4NRHB 4UQYA 4JW1A 4G24A 3LVRE 3G2VA 2DIWA 4PH4B 3TJPA 1MQSA 4DLOA 5C1DA 3BEEA 3FUKA 5LOZA 1UN9A 4GZDA 4AIFA 1NA0A 1H0AA 3R7RA 3CIAA 3R7QA 2VQ2A 3PRZA 4O6FA 1U3DA 2JEKA 2I1JA 3UUXA 3RRUA 3CHQA 3PS6A 4GU5A 2BUGA 3AS5A 5AJDA 4LEUA 4N39A 4CDMA 5JJTA 4EZLA 2LNIA 4GYOA 1TJFA 2E2EA 2XQ0A 3CKCA 4L2YA 3EJNA 3NZSA 4UI9K 4W9RA 4PS7A 2VSNA 1HE8A 3I4GA 1HS6A 4JL0A 3SNXA 3RO2A 3CVXA 3CK7A 4A55A 3UX4A 5CCMA 2X6JA 5DBKA 1PC2A 4FJZA 4YVOA 4ILGA 4WNGA 3HIZA 4P29A 3CVUA 1P5QA 4DPRA 2NSZA 3ASFA 1BPOA 5JJ7A 3QK0A 2J4BA 4F7AA 2XPZA 1SZAA 3HDXA 1H2UA 3I4RB 4NURA 4XIFA 3VLFA 4PDXA 5BT1A 2X6KA 4FADA 4URKA 3SBSA 2C2LA 1OWOA 2VJ8A 2YNQA 2AXZA 1HFAA 4ILIA 1HZ4A 5E76A 3ZW3A 4DI4A 4B94A 5AIJA 3U66A 4HS2A 4FULA 1JUQA 2XCBA 3LPZA 1ZBPA 2V8SE 3MJWA 3RRMB 4GYYA 5C2YA 2QY7A 2OV8A 4RG9A 3D9NA 3CVQA 3SD5A 2XGOA 4NQ0A 2KCLA 2YHEA 3FWVA 2PM7A 3U4TA 2MHKA 4ANXA 4JHKA 4N2SA 3FUDA 3JYSA 4IULA 2WXPA 4I2WA 1E96B 4XE0A 3FP3A 5FTPA 4EZKA 2DCPA 3FH5A 3L22A 4DK5A 2A4ZA 2X6IA 3CVPA 1B89A 3MKRA 3UMVA 3ML8A 2R17C 3TGOA 5G05C 3QNKA 1GW6A 2X38A 2WXOA 5BV0A 3CVLA 3DBSA 3D9KA 4CDNA 3EHNA 4UWLA 3ZRHA 3URZA 3BG1B 3EHMA 4BX8A 3CK9A 4U0UA 4AY5A 3FUEA 2XGMA 1NA3A 2MOWA 4KZCA 2KCKA 4Y6WA 3CSTA 3O48A 4GPKA 3ENEA 2FBNA 4N3CA 3S7BA 2RG8A 4U8HA 4WWNA 3N71A 2WXGA 3KD7A 5AYWD 2PQNA 4PS3A 5FZQA 4CEMA 3D9MA 5KJLA 4EPZA 1UJKA 3EDTB 3G2SA 3OXLA 4MRUA 4APOA 4C9BB 4I9CA 5J90A 2UY1A 1ELRA 4E85A 1OWLA 5LCWC 3WXXA 1DNPA 4LRZA 5AJLA 4B0ZA 4UQZA 1PAQA 2VTBA 4CDRA 4GCNA 4I43A 2WXIA 3BG0B 4TV3A 4G23A 4GB9A 3KAEA 3S7DA 4L7TA 2GRMA 3PUKA 3FTXA 1Z3YA 5FJYA 1NZNA 2PL2A 3ASHA 1Z6TA 3KEZA 4B8AA 2OOEA 5ANRA 2HM8A 4R7LA 1H19A 3ML9A 2XCCA 4ATGA 3PNTB 2L9BA 3MA5A 3O4ZA 3ASGA 5LX8A 3G2WA 5KJMA 2FF4A 4I1OB 3FHEA 5A7DB 4JZYA 4UI9C 4GZ6A 3RRNB 2OVFA 2XRYA 3CGHA 2AXUA 3FUIA 3LY8A 3LY7A 1HG5A 2V4LA 4FC8A 3B7RL 4LERA 3SZ7A 4Q94A 5EDSA 1HX8A 4I6GA 3U9WA 3PEVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBA G;  2L9B A; 
#chains in the Genus database with same CATH topology
 2Y69 E;  1S70 B;  4BT9 A;  5BV1 A;  2CG3 A;  3MZL B;  2M63 A;  2RFM A;  3DEO A;  3QC1 A;  2BTD A;  5AQB A;  2KBX A;  3FY4 A;  4GA0 A;  2FO7 A;  3PVL A;  2VSY A;  5BUZ A;  3FTU A;  2J8S D;  3NAW A;  4IN3 B;  2X6F A;  5CCL A;  3PZ3 A;  4GML A;  3B7S A;  2KZT B;  4N5Q A;  3EIJ A;  4HOQ A;  1LD7 A;  2KM4 A;  2B0O E;  1V54 E;  4EEC A;  3FU3 A;  3C72 A;  4K5C A;  2DZN A;  1TNO A;  4N5C A;  3LXU X;  4HVB A;  1YYH A;  5ENP D;  3U64 A;  2PZI A;  4EZJ A;  4NIK A;  2H6I A;  3HHM A;  3C98 A;  4LCT A;  5LCW J;  3GW4 A;  1TNU A;  3SFX A;  5ITZ F;  3CVW A;  3APD A;  4J8F A;  4N3B A;  4UWK A;  5KJN A;  2AWI A;  2FI7 A;  1EF1 C;  3B7T A;  4FP7 A;  4U95 D;  1KPS B;  5HI7 A;  3QAQ A;  2QC9 A;  1INZ A;  1IKN D;  1PY1 A;  2PNN A;  3MGB A;  4G8L A;  4BTB A;  3ULE G;  3LKU A;  2VGX B;  1QQE A;  5LFA A;  1YA0 A;  4U63 A;  3UM0 A;  1MYO A;  4ACK A;  4GTM A;  3PUJ A;  3LYA A;  4JVS A;  1Q2Z A;  4TRQ A;  3K9I A;  2FUL A;  4MLP A;  4XI0 A;  3QB2 A;  1UW4 B;  5G55 A;  1TN7 A;  3HYM B;  2C0M A;  1W3B A;  4RSY A;  2CHX A;  4FLB A;  3RKV A;  2EIJ E;  3CKB A;  3GYZ A;  3T5V A;  2J49 A;  4GTV A;  2OEV A;  1OUV A;  5AN8 A;  1TYQ G;  4N3A A;  4JXT A;  3ZIM A;  3ONK A;  3FUH A;  4TXP A;  2KZT A;  3ESK A;  2P9S G;  3VLE A;  2WXF A;  2R5S A;  4C0M A;  4GYW A;  4E6H A;  1EPU A;  4J6I A;  3L6A A;  3B7U X;  3CEQ A;  3SFY A;  1S0P A;  5BW8 C;  4KT6 B;  5G2N A;  3QWP A;  3MEK A;  2WMN A;  3L16 A;  2Y1L E;  3CV0 A;  3FH8 A;  4HI9 A;  4I9E A;  5CMY A;  3E32 A;  5KNH D;  1MJ0 A;  4TUU A;  2VGE A;  1N54 A;  2IOS A;  3FTY A;  3QWV A;  2IJG X;  5ARF A;  2MRI A;  4OVV A;  3LCA A;  3J5P A;  4JEH A;  4JC8 A;  2ETA A;  2VGX A;  5T3R A;  2HR2 A;  3DSW A;  2J09 A;  5BPP A;  4CGV A;  4WNE A;  4CGW A;  2IQC A;  4B93 B;  4Z68 A;  1U3C A;  4HOS A;  4G1T A;  4DRX E;  2DVW A;  2QFC A;  5A23 A;  4DI3 A;  4HLL A;  3ZKJ A;  1LF8 A;  4GZ3 A;  3JXI A;  5BXU A;  1S63 A;  4JA9 A;  4LUN U;  1ELW A;  3CVN A;  3JUE A;  2ZIR A;  2LAI A;  4HRL A;  4OVU A;  1K3Z D;  4I6E A;  3MCX A;  1FVH A;  4K0R A;  1N9A A;  3B13 A;  3DWL G;  4BY6 A;  4ANV A;  1FT1 A;  4JHJ A;  3V31 A;  5JA4 D;  5HQ8 A;  3S7F A;  2WXM A;  2QYU A;  2BKG A;  5EKQ D;  1OWP A;  4FLH A;  4Q69 A;  2DYS E;  1G3N B;  3LVR E;  1DCE A;  4BSZ B;  3BEE A;  5EIL A;  3R7R A;  3CIA A;  1NL4 A;  2I1J A;  3PZ4 A;  3RRU A;  3CHQ A;  2BUG A;  4LEU A;  4CDM A;  1QBQ A;  2E2E A;  2XQ0 A;  3CKC A;  4JB8 P;  4UI9 K;  4F6R D;  1N0R A;  3I4G A;  3CVX A;  5AQA A;  4ILG A;  5AQ9 A;  4TUM A;  3CVU A;  3QK0 A;  1SZA A;  2IY0 C;  4NUR A;  3VLF A;  4PDX A;  3SBS A;  2VJ8 A;  2WQ7 A;  1HZ4 A;  4DI4 A;  4HNA D;  4FUL A;  1ZBP A;  3RRM B;  3MJW A;  4GYY A;  2OV8 A;  3EU9 A;  3UKU G;  2PM7 A;  3FUD A;  2WXP A;  3Q75 A;  4XE0 A;  3TWW A;  3L22 A;  2X6I A;  2R17 C;  4K5B A;  4K5A B;  1N11 A;  2RFA A;  3BU8 A;  1O5M A;  3C3O A;  3BG1 B;  3EHM A;  4BX8 A;  4U0U A;  2XGM A;  4Y6W A;  3CST A;  2FBN A;  4N3C A;  3S7B A;  4WWN A;  3SO8 A;  4QQI A;  4ZFH A;  4CEM A;  2GRO B;  1UJK A;  3G2S A;  1ELR A;  4E85 A;  3WXX A;  1DNP A;  4UQZ A;  4CDR A;  4GCN A;  3BQO A;  4GB9 A;  3E30 A;  1Z3Y A;  5FJY A;  3ASH A;  3KEZ A;  3C5R A;  4B8A A;  2OOE A;  1BD8 A;  3G2W A;  2OVF A;  2XRY A;  3SZ7 A;  1BI8 B;  1TN6 A;  2I6H A;  5HRY A;  5D2M C;  2X6H A;  3FEX A;  1UOH A;  1JWG A;  4APF A;  4U04 A;  4YDE A;  4C48 B;  3SI5 A;  4AJW A;  1NP7 A;  4GA1 A;  1IHB A;  4UUC A;  4ABN A;  4D10 C;  3FH7 A;  3OXF A;  4ILH B;  2J9Q A;  1HO8 A;  1LTX A;  3CR3 A;  4NAC A;  4AP2 A;  3AS8 A;  2IF4 A;  5G04 C;  3UIO C;  3FUJ A;  2Q7F A;  2WXQ A;  3TWV A;  4AM9 A;  2MYO A;  4V3I A;  3MV2 B;  3LVQ E;  3IKO B;  3FU0 A;  2WM9 A;  5ARG A;  1WY6 A;  3APC A;  4U8Y D;  2GRR B;  4B8C B;  5KWD A;  3Q79 A;  3RK6 A;  4J8D A;  5DIZ A;  1L5J A;  3UPV A;  3G2U A;  1JPL A;  5ANL A;  4J8S A;  3RJV A;  3EHR A;  3D9O A;  3DSX A;  3ASN E;  3TWU A;  3Q7A A;  2CG2 A;  4EQF A;  3Q9U C;  4U0Z A;  3JXJ A;  3FUF A;  3HXB A;  4GMJ A;  4GTQ A;  3UI2 A;  3L82 A;  3VLD A;  5BXO A;  4RG6 A;  4J0U A;  1E8X A;  1TJC A;  3FEY A;  4KBQ A;  4DX2 A;  4N2Q A;  3HVE B;  4YVQ C;  1BI7 B;  5D0Q D;  4GZC A;  4BET A;  1O1R A;  5AQ7 A;  2Y4U A;  5T4Y A;  3NBN B;  1SA5 A;  2WXH A;  4BFR A;  4Y6C A;  3R9M A;  2F8Y A;  3AU4 A;  5E75 A;  3L17 A;  3P2B A;  3D9L A;  3RSE G;  3E33 A;  1RZ4 A;  3W9G A;  3PDN A;  2FO1 E;  2PM6 A;  4A3T A;  5ENO D;  4WND A;  3U3W A;  1OT8 A;  2FEZ A;  1K1A A;  3T8K A;  2P9N G;  1KZP A;  2P58 C;  2X3M A;  4UWF A;  2HO1 A;  2V0P A;  1Y8M A;  3NOG D;  4GPM A;  1RW2 A;  2WQH A;  1BU9 A;  3UXG A;  4A3V A;  3TWS A;  2I9C A;  1U2V G;  3CQC B;  3TWT A;  3E34 A;  4OAV B;  3QDN A;  5EYP F;  3IEG A;  2J08 A;  4FA6 A;  4JEU A;  3GZ1 A;  5EX0 A;  4AV7 A;  1WAO 1;  3FU5 A;  3SBT B;  3ZN3 A;  5J08 A;  2CHZ A;  5ENS D;  4HRM B;  3KS2 A;  3UM1 A;  3CHM A;  2AW6 A;  1E8Z A;  4GAA A;  2ION A;  2QZA A;  3SF4 A;  3FUN A;  4J8Y A;  5FT9 A;  3CHP A;  5ENN A;  3AG1 E;  4L2L A;  3S2A A;  3HVE A;  3ONL A;  2PQR A;  4G25 A;  2P9P G;  4HOT A;  2WXR A;  3OAW A;  4HB5 A;  1E7V A;  4U96 D;  3SFZ A;  1OXJ A;  4XKB A;  4DX1 A;  2WXK A;  3CHR A;  1IHG A;  3ZFW A;  3PRE A;  4HBD A;  4ATZ D;  2WXJ A;  3L13 A;  4A63 B;  3ABL E;  3UT8 A;  4DX5 D;  2R59 A;  3PE3 A;  1QYM A;  2JLB A;  2C0L A;  4CT4 A;  1OCR E;  4AEZ C;  3GZ2 A;  2KCV A;  1WM5 A;  2XGS A;  2KXP C;  3FDH A;  3KEA A;  4GA2 A;  3CHO A;  4IRU A;  1FCH A;  4HXI A;  4DX7 D;  4G24 A;  2DIW A;  3TJP A;  2XEN A;  3FUK A;  3UIN C;  3UUX A;  3HXC A;  3PS6 A;  4GU5 A;  5AJD A;  5CEC B;  4EZL A;  4GTR A;  4L2Y A;  4GTT A;  4W9R A;  4PS7 A;  2VSN A;  1HS6 A;  3RO2 A;  3UX4 A;  4YVO A;  4WNG A;  4DPR A;  3KSQ A;  1BPO A;  4F7A A;  1MX4 A;  3HDX A;  2B6C A;  2H6F A;  4FAD A;  3Q9N C;  5E76 A;  1HFA A;  3ZW3 A;  1FT2 A;  2V8S E;  3CVQ A;  2XGO A;  1WDY A;  2MHK A;  4ANX A;  4N2S A;  5B1B E;  1E96 B;  5ENR D;  3FP3 A;  5FTP A;  3CVP A;  1N4P A;  3UMV A;  5G05 C;  2RKK A;  3PZ2 A;  3DBS A;  3EHN A;  2MOW A;  4KZC A;  2KCK A;  5KBA A;  3N71 A;  2WXG A;  3DXM G;  3EDT B;  3OXL A;  4APO A;  4I9C A;  4LRZ A;  5AJL A;  3B7B A;  3V2O A;  5H7P A;  4I43 A;  4TV3 A;  3BG0 B;  4G23 A;  3KAE A;  4TXR A;  1BLX B;  3FTX A;  3DRA A;  1Z6T A;  2EIK E;  3UIP C;  2L9B A;  1TN8 A;  5B1A E;  4JZY A;  4UI9 C;  3RRN B;  3CGH A;  4LER A;  1HG5 A;  4KVO A;  1A5E A;  1K8K G;  1OCZ E;  4DJA A;  3ABK E;  4BEP A;  3Q15 A;  3D9H A;  4ME2 A;  3IXE A;  3ISM C;  3S7J A;  3Q49 B;  3TG4 A;  4PUC A;  3L54 A;  1IQU A;  2J07 A;  5FZR A;  1VDY A;  3LJ3 A;  2I2O A;  4XI9 A;  3CVY A;  3ZYQ A;  1MHQ A;  3W9F A;  3ZHE A;  1OY3 D;  4FHJ A;  1ELK A;  3V79 K;  3KSL A;  4XZ4 A;  3CK8 A;  2LSV A;  1Y6I A;  1E8Y A;  2ZIS A;  4U07 A;  3T9K A;  2LUH A;  4WWP A;  4G26 A;  3CVV A;  1QNF A;  5JHB A;  2ZGD A;  4DX6 D;  3Q4A B;  4JA7 A;  1MX6 A;  4K03 A;  3CHS A;  2YQ8 A;  3ZNG A;  5D0O D;  4UQX A;  3LS8 A;  4LNG A;  3VTX A;  4H7X A;  4U0S A;  4LNB A;  1SQM A;  4L1B A;  1FVF A;  5T8I A;  1QZ2 A;  1IQR A;  2XEV A;  4WNF A;  3CQG B;  3ZYL A;  4LG6 A;  3GZS A;  1N4S A;  4I2Z A;  5ENQ D;  2GGF A;  3QAR A;  4ACL A;  2P9I G;  4OYS A;  4RQI A;  3NQP A;  4A1S A;  2F8X K;  2XPY A;  3JUI A;  2WXN A;  3QWW A;  3IV0 A;  3FTW A;  1JCQ A;  3ABM E;  1AWC B;  4IYP A;  3SGH A;  4WAF A;  4KXK B;  3I5P A;  4BWR A;  2GW1 A;  2AVP A;  3LY9 A;  4YDY A;  4J7W A;  3R9A B;  2ZGG A;  4AY6 A;  4FHK A;  2IFU A;  3DPY A;  1HH8 A;  2P2C P;  3I3N A;  3CSF A;  3EU5 A;  3T8M A;  3UKR G;  2LAH A;  4KYO B;  1S64 A;  5EYL A;  5KCM A;  1KT0 A;  5FQ8 A;  3IHV A;  3ZYK A;  3ZPJ A;  1Z3X A;  2P9L G;  4AXH A;  3NB2 A;  4ANW A;  4LSZ E;  5EID A;  5FQ6 A;  3PEU B;  4RVB A;  2YIN A;  2IOL A;  2CFU A;  3C3Q A;  3AU5 A;  2WVI A;  2AJA A;  3Q78 A;  4JD2 G;  4BTA A;  3LJN A;  2CHW A;  1X5B A;  1E90 A;  2OVB A;  1TNZ A;  3FU6 A;  3HXD A;  4GTO A;  3ASD A;  3EIQ C;  1KLX A;  3AAA C;  4KZ0 A;  3EUV A;  3TXN A;  3V30 A;  3D9J A;  4JPS A;  1UN8 A;  1N4R A;  4L23 A;  2KC7 A;  4MS6 A;  1SZ9 A;  2F37 A;  1TEZ A;  5CRV A;  4C0E A;  3DSU A;  4BSX A;  3OXG A;  5JMN D;  4GTP A;  3AS4 A;  1HXI A;  5IY5 E;  3ZU7 B;  4AVX A;  3HRA A;  4O1O A;  1WG0 A;  5ENT D;  3UQ3 A;  3TWR A;  2GRL A;  2Y3A A;  2XRZ A;  5EX3 A;  2P9K G;  5LP0 A;  4FJY A;  4HOU A;  3MYV A;  4A1G A;  2LXM A;  5CRU A;  3AG3 E;  3PNL B;  5G04 J;  2UY1 B;  2R2L A;  5FQ4 A;  3SHF A;  1NI1 A;  5FZS A;  3NZU A;  3RO3 A;  4JW1 A;  4DUI A;  3G2V A;  4PH4 B;  4DLO A;  1UN9 A;  4O60 A;  4U8V D;  5B3S E;  1H0A A;  4HQD A;  3R7Q A;  1TR4 A;  2JEK A;  1N4Q A;  1U3D A;  3SY2 A;  5AAO A;  3EHQ A;  3AS5 A;  4N39 A;  4HI8 A;  5JJT A;  2LNI A;  4GYO A;  3TWQ A;  3EJN A;  2P9U G;  4JL0 A;  4A55 A;  5DBK A;  1P5Q A;  2L6B A;  3ASF A;  1Z5S C;  5JJ7 A;  2J4B A;  2XPZ A;  2IO3 C;  1H2U A;  3I4R B;  1ZB1 A;  4XIF A;  2XZT G;  3DXK G;  4URK A;  4ILI A;  5AIJ A;  4B94 A;  2XCB A;  4BER A;  4RG9 A;  3D9N A;  2ETB A;  3SD5 A;  4NQ0 A;  2YHE A;  2LXL A;  3FWV A;  3V2X A;  3ZUV B;  3JYS A;  4IUL A;  2GRP B;  2DCP A;  3FH5 A;  4DK5 A;  3MKR A;  3TGO A;  1D9S A;  5BV0 A;  4LNU D;  3CVL A;  4CDN A;  4BES A;  4UWL A;  4OAU C;  3CK9 A;  3AJI A;  2IO2 C;  1NA3 A;  3O48 A;  2RG8 A;  4U8H A;  2H6G A;  3D9M A;  4EPZ A;  2JAB A;  3ASO E;  4C9B B;  2UY1 A;  1OWL A;  5EIB E;  4B0Z A;  2WXI A;  4L7T A;  2GRM A;  3PUK A;  3F6Q A;  1NZN A;  5ANR A;  2HM8 A;  1H19 A;  2Y0B G;  2XCC A;  1FPP A;  4ATG A;  3PNT B;  5CBO A;  5LX8 A;  4I1O B;  5A7D B;  4L9P A;  2BED A;  4FC8 A;  3LY8 A;  3FUI A;  2R02 A;  1SVX A;  3U9W A;  5FIN A;  4M7C A;  3PEV B;  4CZ2 D;  4U7E B;  2BF0 X;  1TNB A;  2XZD G;  1XGW A;  2DBA A;  4CT0 A;  1TNY A;  3ULQ A;  4BX9 A;  4M3O A;  3PH0 C;  2NYJ A;  3UM3 A;  3FTV A;  2AXV A;  1ZU2 A;  3CLJ A;  2OCC E;  1YMP A;  4XX5 A;  3D3M A;  3DST A;  4G8K A;  1OWM A;  3NF1 A;  3FUL A;  3Q7F A;  4Q96 A;  2LSU A;  2I1K A;  4X8Q A;  3D9I A;  5CER B;  2H6H A;  4CCA A;  5JJ6 A;  4WUY A;  2KAT A;  1EDU A;  2NXP A;  3QKY A;  3OTN A;  2BKK B;  2RD0 A;  4EBA A;  2DWZ A;  4KVM A;  5M72 A;  4PS8 A;  4GCO A;  3UT4 A;  4H7Y A;  3ZHE B;  1KT1 A;  4I17 A;  3ESL A;  4HOR A;  3VTY A;  3DSS A;  1MZC A;  2WQ6 A;  4CRW A;  5CEA A;  1H6P A;  2UWJ G;  4EBA G;  2XEE A;  3WG7 E;  5A6C A;  2VYI A;  3JQ0 A;  1H2V C;  2HYZ A;  1OCO E;  2V4H C;  3E4B A;  3FTS A;  2VSX E;  5CHE E;  3G2T A;  4WWO A;  2EIL E;  2E0I A;  2DYR E;  1JCR A;  2LO6 A;  3RU0 A;  3X2Q E;  1DVP A;  2L6J A;  4HLE A;  1H2T C;  5AAR A;  2XEH A;  3UT7 A;  1UJJ A;  4YND A;  3Q5M A;  2HE0 A;  2ZXW E;  1H6O A;  3RIB A;  5CBN A;  3FFL A;  1HG2 A;  3D9P A;  1N94 A;  4G2V A;  3ZVV A;  2ILR A;  3L08 A;  1DC2 A;  4DLQ A;  3QOU A;  4I1M A;  1V55 E;  4UWG A;  1LD8 A;  3BUA A;  2V5Q C;  2WMO A;  2WB2 A;  3JQ1 A;  4EHM A;  2R03 A;  1HF8 A;  1IYG A;  4G11 A;  4XKC A;  2XPI A;  2WPV A;  4HFG A;  4F1P A;  2WXL A;  5D66 A;  4FU3 A;  1A17 A;  3LDZ A;  3HG0 D;  3DPD A;  4ANU A;  1HU3 A;  1AP7 A;  2EQX A;  3DSV A;  2GRQ B;  4B89 A;  2ETC A;  3MKQ B;  2VSO E;  2OND A;  1K1B A;  2J4D A;  5G05 J;  1DCQ A;  2EIM E;  3TAX A;  1EYH A;  3Q73 A;  2V5F A;  4UWH A;  1E8W A;  4GZ5 A;  4KMO A;  4O1P A;  2XS1 A;  1O1T A;  4F1S A;  3ZYM A;  3MV3 B;  3PZD A;  3B95 A;  3TL5 A;  1O1S A;  4JHR A;  5CED B;  4F53 A;  1H6K A;  2L0T B;  1JWF A;  2Y4T A;  3DEP A;  3T5X A;  2R05 A;  1OCC E;  2A5U A;  2IEJ A;  3FUM A;  3AG4 E;  1YCS B;  3TXM A;  3P1U A;  5CMW A;  4MKT A;  3MX3 A;  1OWN A;  2XHE A;  3IBE A;  3PE4 A;  2OEW A;  2NC9 A;  4GMR A;  3QJZ A;  4UI9 J;  4AOF A;  1E7U A;  3ZXS A;  4CYM D;  5FWQ A;  4QFV A;  2CFZ A;  4I1A A;  3ZXP A;  2QYJ A;  1NFI E;  1N52 A;  2YHC A;  1UG3 A;  4TXQ A;  5HKP A;  1SW6 A;  4BT8 A;  4ZHB A;  2L0I A;  1XNF A;  5AEN A;  4F3V A;  5KJK A;  3NOC D;  3ULY A;  2ZU6 B;  3E37 A;  4J8E A;  3APF A;  3JCK C;  2IU1 A;  4MBG A;  3Q47 B;  3HXE A;  2DZO A;  3ZEF A;  5JHA A;  5BNW A;  3MKQ A;  2VGY A;  3LEW A;  5FQ7 A;  4YDW A;  3IHY A;  1JCS A;  3ZGQ A;  3SQV A;  3TG5 A;  3FTZ A;  2GRN B;  4I6J A;  2VTB B;  4NRH B;  4UQY A;  1MQS A;  5C1D A;  5FIO A;  5LOZ A;  4GZD A;  4AIF A;  1NA0 A;  2VQ2 A;  3PRZ A;  4O6F A;  3TWX A;  1X81 A;  1IXV A;  3C3R A;  3L9T A;  1TJF A;  3NZS A;  1HE8 A;  3SNX A;  5KNG A;  1SA4 A;  3CK7 A;  5CCM A;  2X6J A;  1PC2 A;  4FJZ A;  3HIZ A;  4P29 A;  2NSZ A;  5EN5 D;  2F0Y A;  2XS8 A;  5BT1 A;  2X6K A;  2C2L A;  1OWO A;  2YNQ A;  2AXZ A;  3U66 A;  4HS2 A;  1JUQ A;  3LPZ A;  5C2Y A;  2QY7 A;  2KCL A;  3J5Q B;  3U4T A;  4JHK A;  4GTS A;  4I2W A;  4EZK A;  4XEI G;  2A4Z A;  1B89 A;  3ML8 A;  1D8E A;  3QNK A;  1GW6 A;  2X38 A;  2WXO A;  3D9K A;  3PZ1 A;  3ZRH A;  3URZ A;  4AY5 A;  3FUE A;  4GPK A;  5HS0 A;  3ENE A;  4HRN A;  4RLY A;  3KD7 A;  5AYW D;  2PQN A;  4PS3 A;  5FZQ A;  5KJL A;  3AG2 E;  1N0Q A;  4MRU A;  5J90 A;  1KZO A;  5LCW C;  2VTB A;  1PAQ A;  3HXF A;  3S7D A;  2A5E A;  1N95 A;  2PL2 A;  1D8D A;  4R7L A;  3ML9 A;  1MX2 A;  4YDO A;  3RAU A;  3MA5 A;  3O4Z A;  3ASG A;  5KJM A;  2FF4 A;  3UM2 A;  3FHE A;  4GZ6 A;  2AXU A;  3LY7 A;  2V4L A;  5EDS A;  3B7R L;  4Q94 A;  1HX8 A;  2EIN E;  4I6G A;  3UTM A; 
#chains in the Genus database with same CATH homology
 4KVO A;  2BF0 X;  2I6H A;  1XGW A;  2DBA A;  4CT0 A;  3ULQ A;  4BX9 A;  4M3O A;  4DJA A;  2X6H A;  3Q15 A;  4BT9 A;  5BV1 A;  3PH0 C;  2CG3 A;  4ME2 A;  3MZL B;  2M63 A;  3FEX A;  1JWG A;  3FTV A;  4APF A;  4U04 A;  3S7J A;  2AXV A;  1ZU2 A;  3SI5 A;  3CLJ A;  4AJW A;  3QC1 A;  2BTD A;  1NP7 A;  3Q49 B;  3TG4 A;  4PUC A;  3L54 A;  1IQU A;  4XX5 A;  4GA1 A;  3D3M A;  2J07 A;  5FZR A;  1VDY A;  1OWM A;  3LJ3 A;  3FY4 A;  3NF1 A;  4ABN A;  2I2O A;  4XI9 A;  4D10 C;  3FUL A;  4GA0 A;  3CVY A;  3FH7 A;  3ZYQ A;  1MHQ A;  2FO7 A;  4Q96 A;  3OXF A;  3PVL A;  2VSY A;  4ILH B;  3ZHE A;  2LSU A;  2I1K A;  2J9Q A;  5BUZ A;  1HO8 A;  3FTU A;  4FHJ A;  3CR3 A;  3D9I A;  4NAC A;  4IN3 B;  1ELK A;  2X6F A;  5CCL A;  4AP2 A;  4GML A;  3AS8 A;  4CCA A;  2IF4 A;  4XZ4 A;  5G04 C;  5JJ6 A;  3FUJ A;  3CK8 A;  2Q7F A;  2KAT A;  2WXQ A;  2KZT B;  2LSV A;  1Y6I A;  1E8Y A;  3B7S A;  4WUY A;  4AM9 A;  1EDU A;  2NXP A;  3EIJ A;  3QKY A;  4HOQ A;  3OTN A;  2KM4 A;  4U07 A;  2RD0 A;  4V3I A;  4EEC A;  4EBA A;  4KVM A;  4WWP A;  5M72 A;  3MV2 B;  4PS8 A;  4G26 A;  3FU3 A;  4GCO A;  3CVV A;  1QNF A;  3LVQ E;  3IKO B;  5JHB A;  3UT4 A;  4H7Y A;  3ZHE B;  3FU0 A;  4N5C A;  3LXU X;  2WM9 A;  5ARG A;  3Q4A B;  4HVB A;  1WY6 A;  3APC A;  4JA7 A;  4B8C B;  1KT1 A;  4I17 A;  4K03 A;  3ESL A;  3U64 A;  4HOR A;  2PZI A;  4EZJ A;  3CHS A;  3RK6 A;  3VTY A;  4J8D A;  5DIZ A;  3HHM A;  1L5J A;  2YQ8 A;  3UPV A;  3C98 A;  1JPL A;  3G2U A;  5D0O D;  2WQ6 A;  5ANL A;  4UQX A;  4LCT A;  5LCW J;  3LS8 A;  4J8S A;  3RJV A;  3GW4 A;  3VTX A;  4H7X A;  4CRW A;  4U0S A;  3D9O A;  1SQM A;  3CVW A;  3APD A;  4J8F A;  4N3B A;  4UWK A;  5KJN A;  2UWJ G;  4L1B A;  2CG2 A;  2AWI A;  2FI7 A;  4EBA G;  1EF1 C;  1FVF A;  3B7T A;  4FP7 A;  4EQF A;  4U0Z A;  5HI7 A;  2VYI A;  3JQ0 A;  3QAQ A;  5A6C A;  1H2V C;  2HYZ A;  1QZ2 A;  1IQR A;  2XEV A;  4WNF A;  5T8I A;  3FUF A;  1INZ A;  1PY1 A;  3E4B A;  3CQG B;  3FTS A;  2VSX E;  5CHE E;  3MGB A;  4GMJ A;  3ZYL A;  3G2T A;  4BTB A;  4WWO A;  3GZS A;  3LKU A;  2E0I A;  3VLD A;  2VGX B;  4I2Z A;  1QQE A;  4RG6 A;  5LFA A;  2LO6 A;  3RU0 A;  1YA0 A;  4J0U A;  1DVP A;  1E8X A;  1TJC A;  3FEY A;  2L6J A;  4KBQ A;  4HLE A;  1H2T C;  2GGF A;  4U63 A;  4ACK A;  3QAR A;  4N2Q A;  3HVE B;  4YVQ C;  3PUJ A;  3UT7 A;  3LYA A;  1UJJ A;  4YND A;  3Q5M A;  4JVS A;  4ACL A;  2WQ7 A;  4OYS A;  3RIB A;  4TRQ A;  3K9I A;  3NQP A;  5D0Q D;  3FFL A;  4GZC A;  2FUL A;  4MLP A;  4A1S A;  4XI0 A;  1HG2 A;  3D9P A;  2Y4U A;  2XPY A;  3JUI A;  3QB2 A;  5T4Y A;  2WXN A;  1UW4 B;  5G55 A;  3QWW A;  3IV0 A;  4G2V A;  3FTW A;  3ZVV A;  2ILR A;  2WXH A;  3HYM B;  4BFR A;  3L08 A;  2C0M A;  4Y6C A;  1W3B A;  4IYP A;  4RSY A;  2CHX A;  3SGH A;  4FLB A;  4WAF A;  4DLQ A;  3AU4 A;  5E75 A;  3QOU A;  4I1M A;  3RKV A;  4KXK B;  3CKB A;  3L17 A;  3GYZ A;  3I5P A;  2J49 A;  4UWG A;  4BWR A;  3T5V A;  2GW1 A;  3P2B A;  1OUV A;  3D9L A;  2AVP A;  3LY9 A;  3R9A B;  4N3A A;  4AY6 A;  2WMO A;  2WB2 A;  4FHK A;  4JXT A;  3PDN A;  2IFU A;  2PM6 A;  4A3T A;  3ZIM A;  3JQ1 A;  3ONK A;  1HF8 A;  1HH8 A;  1IYG A;  3FUH A;  2KZT A;  3I3N A;  3CSF A;  2XPI A;  3ESK A;  4G11 A;  4XKC A;  3VLE A;  2WPV A;  4HFG A;  3T8M A;  4WND A;  2WXL A;  2LAH A;  2WXF A;  3U3W A;  2R5S A;  4KYO B;  4C0M A;  4FU3 A;  1A17 A;  2FEZ A;  3LDZ A;  3DPD A;  4ANU A;  1HU3 A;  4GYW A;  2P58 C;  4E6H A;  2X3M A;  1EPU A;  2EQX A;  5KCM A;  4J6I A;  4B89 A;  1KT0 A;  3MKQ B;  5FQ8 A;  3L6A A;  3B7U X;  4UWF A;  3CEQ A;  3IHV A;  2HO1 A;  2V0P A;  3ZYK A;  1S0P A;  5BW8 C;  2VSO E;  3ZPJ A;  2OND A;  4KT6 B;  1Y8M A;  1Z3X A;  2WQH A;  2J4D A;  5G2N A;  5G05 J;  4AXH A;  3TAX A;  1EYH A;  2V5F A;  3QWP A;  4A3V A;  4UWH A;  3MEK A;  1E8W A;  4GZ5 A;  2WMN A;  4KMO A;  4ANW A;  2I9C A;  3L16 A;  4F1S A;  5FQ6 A;  3PEU B;  3CV0 A;  3ZYM A;  3FH8 A;  4I9E A;  3CQC B;  5CMY A;  3MV3 B;  3PZD A;  4RVB A;  3TL5 A;  3QDN A;  2YIN A;  3IEG A;  2J08 A;  4JHR A;  2IOL A;  2CFU A;  3AU5 A;  2WVI A;  4TUU A;  4F53 A;  1N54 A;  2IOS A;  4BTA A;  3FTY A;  3QWV A;  4FA6 A;  2CHW A;  4JEU A;  2IJG X;  1X5B A;  1H6K A;  2L0T B;  3GZ1 A;  5ARF A;  2MRI A;  5EX0 A;  4AV7 A;  1WAO 1;  4OVV A;  1JWF A;  2Y4T A;  3FU5 A;  3SBT B;  3ZN3 A;  5J08 A;  1E90 A;  2CHZ A;  2OVB A;  3LCA A;  3T5X A;  3KS2 A;  4JEH A;  3FU6 A;  4JC8 A;  2VGX A;  3ASD A;  1KLX A;  3EIQ C;  3CHM A;  2HR2 A;  4KZ0 A;  5T3R A;  2AW6 A;  2A5U A;  1E8Z A;  3FUM A;  4GAA A;  3TXN A;  2J09 A;  5BPP A;  2ION A;  4CGV A;  4WNE A;  4CGW A;  2IQC A;  3D9J A;  3SF4 A;  3FUN A;  5FT9 A;  3CHP A;  4JPS A;  5ENN A;  4L2L A;  3TXM A;  3S2A A;  3HVE A;  1U3C A;  3P1U A;  4HOS A;  1UN8 A;  4G1T A;  4MKT A;  3ONL A;  3MX3 A;  5CMW A;  1OWN A;  2XHE A;  3IBE A;  2PQR A;  3PE4 A;  4G25 A;  4L23 A;  2NC9 A;  4HOT A;  2QFC A;  2WXR A;  3OAW A;  2KC7 A;  3QJZ A;  4UI9 J;  4MS6 A;  5A23 A;  1E7V A;  4AOF A;  1E7U A;  4XKB A;  1SZ9 A;  3SFZ A;  3ZXS A;  4DI3 A;  1TEZ A;  1LF8 A;  2WXK A;  4GZ3 A;  5FWQ A;  4QFV A;  2CFZ A;  4C0E A;  4I1A A;  3CHR A;  4BSX A;  4JA9 A;  1N52 A;  2YHC A;  1UG3 A;  4LUN U;  1IHG A;  3ZFW A;  3OXG A;  3AS4 A;  4BT8 A;  3PRE A;  1ELW A;  1HXI A;  3CVN A;  2L0I A;  2LAI A;  4OVU A;  1XNF A;  5AEN A;  4I6E A;  4AVX A;  4F3V A;  5KJK A;  3MCX A;  2WXJ A;  1FVH A;  3L13 A;  4K0R A;  3UQ3 A;  3B13 A;  2ZU6 B;  4BY6 A;  2GRL A;  2Y3A A;  4ANV A;  3UT8 A;  4J8E A;  2R59 A;  2XRZ A;  3APF A;  3JCK C;  3PE3 A;  2JLB A;  2IU1 A;  2C0L A;  3Q47 B;  4CT4 A;  4JHJ A;  5EX3 A;  3ZEF A;  5LP0 A;  5HQ8 A;  5JHA A;  4FJY A;  4HOU A;  4AEZ C;  3GZ2 A;  3S7F A;  5BNW A;  3MKQ A;  2VGY A;  2KCV A;  1WM5 A;  3LEW A;  2XGS A;  2WXM A;  5FQ7 A;  3MYV A;  5EKQ D;  3FDH A;  3IHY A;  4A1G A;  4GA2 A;  3ZGQ A;  1OWP A;  3PNL B;  3CHO A;  5G04 J;  3TG5 A;  2UY1 B;  3FTZ A;  4I6J A;  2VTB B;  4FLH A;  5FQ4 A;  3SHF A;  5FZS A;  4Q69 A;  4IRU A;  1FCH A;  3NZU A;  4HXI A;  3RO3 A;  4NRH B;  4UQY A;  4JW1 A;  4G24 A;  3LVR E;  3G2V A;  2DIW A;  4PH4 B;  3TJP A;  1MQS A;  4DLO A;  5C1D A;  3BEE A;  3FUK A;  5LOZ A;  1UN9 A;  4GZD A;  4AIF A;  1NA0 A;  1H0A A;  3R7R A;  3CIA A;  3R7Q A;  2VQ2 A;  3PRZ A;  4O6F A;  1U3D A;  2JEK A;  2I1J A;  3UUX A;  3RRU A;  3CHQ A;  3PS6 A;  4GU5 A;  2BUG A;  3AS5 A;  5AJD A;  4LEU A;  4N39 A;  4CDM A;  5JJT A;  4EZL A;  2LNI A;  4GYO A;  1TJF A;  2E2E A;  2XQ0 A;  3CKC A;  4L2Y A;  3EJN A;  3NZS A;  4UI9 K;  4W9R A;  4PS7 A;  2VSN A;  1HE8 A;  3I4G A;  1HS6 A;  4JL0 A;  3SNX A;  3RO2 A;  3CVX A;  3CK7 A;  4A55 A;  3UX4 A;  5CCM A;  2X6J A;  5DBK A;  1PC2 A;  4FJZ A;  4YVO A;  4ILG A;  4WNG A;  3HIZ A;  4P29 A;  3CVU A;  1P5Q A;  4DPR A;  2NSZ A;  3ASF A;  1BPO A;  5JJ7 A;  3QK0 A;  2J4B A;  4F7A A;  2XPZ A;  1SZA A;  3HDX A;  1H2U A;  3I4R B;  4NUR A;  4XIF A;  3VLF A;  4PDX A;  5BT1 A;  2X6K A;  4FAD A;  4URK A;  3SBS A;  2C2L A;  1OWO A;  2VJ8 A;  2YNQ A;  2AXZ A;  1HFA A;  4ILI A;  1HZ4 A;  5E76 A;  3ZW3 A;  4DI4 A;  4B94 A;  5AIJ A;  3U66 A;  4HS2 A;  4FUL A;  1JUQ A;  2XCB A;  3LPZ A;  1ZBP A;  2V8S E;  3MJW A;  3RRM B;  4GYY A;  5C2Y A;  2QY7 A;  2OV8 A;  4RG9 A;  3D9N A;  3CVQ A;  3SD5 A;  2XGO A;  4NQ0 A;  2KCL A;  2YHE A;  3FWV A;  2PM7 A;  3U4T A;  2MHK A;  4ANX A;  4JHK A;  4N2S A;  3FUD A;  3JYS A;  4IUL A;  2WXP A;  4I2W A;  1E96 B;  4XE0 A;  3FP3 A;  5FTP A;  4EZK A;  2DCP A;  3FH5 A;  3L22 A;  4DK5 A;  2A4Z A;  2X6I A;  3CVP A;  1B89 A;  3MKR A;  3UMV A;  3ML8 A;  2R17 C;  3TGO A;  5G05 C;  3QNK A;  1GW6 A;  2X38 A;  2WXO A;  5BV0 A;  3CVL A;  3DBS A;  3D9K A;  4CDN A;  3EHN A;  4UWL A;  3ZRH A;  3URZ A;  3BG1 B;  3EHM A;  4BX8 A;  3CK9 A;  4U0U A;  4AY5 A;  3FUE A;  2XGM A;  1NA3 A;  2MOW A;  4KZC A;  2KCK A;  4Y6W A;  3CST A;  3O48 A;  4GPK A;  3ENE A;  2FBN A;  4N3C A;  3S7B A;  2RG8 A;  4U8H A;  4WWN A;  3N71 A;  2WXG A;  3KD7 A;  5AYW D;  2PQN A;  4PS3 A;  5FZQ A;  4CEM A;  3D9M A;  5KJL A;  4EPZ A;  1UJK A;  3EDT B;  3G2S A;  3OXL A;  4MRU A;  4APO A;  4C9B B;  4I9C A;  5J90 A;  2UY1 A;  1ELR A;  4E85 A;  1OWL A;  5LCW C;  3WXX A;  1DNP A;  4LRZ A;  5AJL A;  4B0Z A;  4UQZ A;  1PAQ A;  2VTB A;  4CDR A;  4GCN A;  4I43 A;  2WXI A;  3BG0 B;  4TV3 A;  4G23 A;  4GB9 A;  3KAE A;  3S7D A;  4L7T A;  2GRM A;  3PUK A;  3FTX A;  1Z3Y A;  5FJY A;  1NZN A;  2PL2 A;  3ASH A;  1Z6T A;  3KEZ A;  4B8A A;  2OOE A;  5ANR A;  2HM8 A;  4R7L A;  1H19 A;  3ML9 A;  2XCC A;  4ATG A;  3PNT B;  2L9B A;  3MA5 A;  3O4Z A;  3ASG A;  5LX8 A;  3G2W A;  5KJM A;  2FF4 A;  4I1O B;  3FHE A;  5A7D B;  4JZY A;  4UI9 C;  4GZ6 A;  3RRN B;  2OVF A;  2XRY A;  3CGH A;  2AXU A;  3FUI A;  3LY8 A;  3LY7 A;  1HG5 A;  2V4L A;  4FC8 A;  3B7R L;  4LER A;  3SZ7 A;  4Q94 A;  5EDS A;  1HX8 A;  4I6G A;  3U9W A;  3PEV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...