2L9BA

Heterodimer between rna14p monkeytail domain and rna15p hinge domain of the yeast cf ia complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
ANFLSQKFPELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQEWTRAHPEDAASLLELCPQLSFVTAELLLTNGICKVDDLIPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Locked Tether Formation by Cooperative Folding of Rna14p Monkeytail and Rna15p Hinge Domains in the Yeast CF IA Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords mRNA 3'-end-processing protein RNA15
total genus 30
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.630 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l9bA00
4EBAG 2L9BA
chains in the Genus database with same CATH superfamily
3HXDA 2P9KG 4HOSA 2R59A 4FHJA 3MGBA 4GMJA 1N52A 4JL0A 2IU1A 3D9KA 4AVXA 4UI9J 3IV0A 4KZ0A 4WAFA 2VSNA 3FTZA 1EF1C 3JXIA 4URKA 3GYZA 2WXHA 4G11A 3UT8A 3QAQA 3MA5A 5FQ7A 1TN8A 1KT1A 1MQSA 4MS6A 5ENNA 4FC8A 2DWZA 1BD8A 4OAVB 2WQ7A 1OWLA 4HI8A 2V0PA 4UWGA 5CCMA 3TWRA 3KS2A 2B0OE 2VGXA 2VJ8A 1TNOA 2BKKB 3FUFA 1S70B 4XI9A 1GW6A 4DRXE 3QK0A 4AEZC 1HF8A 3SF4A 3DSUA 1SW6A 3FU0A 2XEEA 4YVOA 1E8ZA 4EZKA 1H6OA 3S7BA 2DZNA 4XKBA 5ENTD 1W3BA 4J7WA 4PDXA 5AENA 1FT1A 4H7YA 4B94A 2FO1E 4R7LA 3JUEA 3J5PA 3LS8A 1O5MA 2XQ0A 4FLBA 4F3VA 2C0MA 2QFCA 2YHCA 1E90A 1SA5A 5G05C 2KBXA 3Q7FA 4JZYA 1E8WA 2LNIA 4MRUA 5H7PA 2LUHA 3FTWA 4FJYA 2CFZA 1NZNA 4I6EA 2BTDA 1SZAA 3UKUG 3AG1E 3BUAA 4J8YA 3B7TA 4A1GA 5EIBE 5EILA 4GZ6A 5CEAA 4B8CB 2OCCE 2ZISA 4DPRA 1HU3A 4ILGA 5ENSD 5CRVA 1E8XA 2X6JA 2DBAA 5ENQD 4I9CA 3LVQE 5FINA 4TXQA 4O1OA 4AY5A 5BW8C 1QQEA 3FWVA 2WQHA 3AS4A 3U66A 1MJ0A 4CT0A 4U8VD 2GRNB 3L9TA 4YNDA 5FZRA 2R17C 3HRAA 3TXMA 5BNWA 3TGOA 3SD5A 1DNPA 2BEDA 1FPPA 1BI7B 2AJAA 1UOHA 5A6CA 4HLLA 1SQMA 2X3MA 2DYSE 2I6HA 1TNYA 3WXXA 1K1BA 4HOUA 4GMLA 4IN3B 5G55A 1SA4A 4GZ3A 4I2WA 1IKND 4N5QA 4YDOA 3ZYKA 3ZU7B 2YNQA 1YMPA 3LXUX 2LSUA 1TJFA 4ACLA 2HM8A 5ENOD 2XCCA 1OWNA 4U96D 2H6IA 3AS8A 1IHBA 3I3NA 2XRYA 4GB9A 2I1KA 2IF4A 4GTQA 3IBEA 5CMYA 4HLEA 3ZVVA 4P29A 2LAIA 3ONKA 3S7DA 2X6KA 3EDTB 1H6PA 4WNGA 2QC9A 2MOWA 2GROB 4JEHA 3CEQA 5ITZF 3HXFA 3OAWA 3D9HA 4CDNA 1JUQA 3EUVA 2VYIA 3PZ1A 4HRLA 4Q94A 3T8KA 3HXBA 2LXMA 2WXOA 2E2EA 5FQ6A 5G04J 5JJ7A 2HE0A 3L08A 2P9IG 3ZW3A 3QC1A 4K5AB 3RRMB 3FTSA 2LO6A 2KCKA 3DPDA 1XGWA 1X5BA 3QWWA 3OXFA 5EYLA 3RRNB 4C0MA 4HORA 5KJLA 1H0AA 5AN8A 2CFUA 2YQ8A 1N94A 4QFVA 2WXFA 5CEDB 4UWKA 3W9FA 4TXPA 4PH4B 3IXEA 2AXZA 2WXIA 1YYHA 4G26A 4DK5A 1LD8A 5FIOA 3PZ2A 4LUNU 3ASNE 3WG7E 3PS6A 5G05J 3FEYA 3QARA 1HG2A 2L6BA 3E34A 3GZ2A 4J8FA 4AY6A 4LCTA 3LDZA 3U4TA 3NOCD 2F8XK 1E96B 4AP2A 3DPYA 2J49A 4DX5D 4GMRA 1N4QA 3VTYA 5BT1A 3L16A 3ABME 2Y4TA 2QY7A 4CGVA 2OVFA 3U9WA 3ZXSA 3DSVA 3DSWA 4O1PA 3ZYMA 4I2ZA 4HXIA 3ZN3A 3UI2A 2EILE 3CR3A 4W9RA 4ANXA 2XPZA 4RQIA 2GRRB 3RRUA 4L2LA 4CGWA 1TYQG 2V4LA 1HO8A 2AVPA 1B89A 3D9LA 5D66A 4AIFA 4LRZA 4FU3A 4GTMA 4RG9A 4BY6A 2CHWA 4PS3A 3J5QB 2ZIRA 4HB5A 4NRHB 2V5FA 4DX1A 1EPUA 2I2OA 3QJZA 4OYSA 4L9PA 4XI0A 4G8KA 4DJAA 1Q2ZA 3ZUVB 2Y1LE 3AAAC 1WDYA 4BERA 4E85A 4OAUC 3Q9NC 1QBQA 3CVPA 3ISMC 3GZSA 3LY7A 5A23A 2WXRA 3S2AA 3L17A 4F7AA 3OXLA 3AJIA 3FHEA 4WNDA 3JYSA 4N3AA 3ZPJA 5KJKA 1IHGA 1JPLA 5A7DB 1JWGA 2IOSA 2MRIA 2PQRA 3ULYA 3UUXA 2ILRA 4GPMA 4E6HA 3AG2E 1N9AA 5AQAA 3FUMA 4FLHA 3DBSA 4L23A 1Z3YA 4UI9K 3ZRHA 4GTPA 4I9EA 3ZYLA 3ZNGA 2DIWA 3TXNA 4ANWA 4X8QA 2PM6A 3AS5A 3URZA 5KWDA 1SVXA 3PE4A 3APDA 3TWTA 2IOLA 2VSOE 3HDXA 1OT8A 1LTXA 4DX2A 1UG3A 3ZYQA 5J90A 3DXKG 4J8SA 1KT0A 4ZFHA 4D10C 3DWLG 3BG0B 3MKRA 1A5EA 4K03A 3L54A 4XX5A 1E8YA 3PE3A 1U3DA 3UIOC 1A17A 3FH7A 5BV0A 1IXVA 3FU5A 2IQCA 4XEIG 4TXRA 2R05A 3CHPA 3KSQA 4WWNA 2UWJG 4KVMA 4U0ZA 3AG3E 2AXVA 3CHQA 3SZ7A 4I1OB 5CBNA 1MZCA 3FH5A 4NURA 3HVEB 4CCAA 2IFUA 3CQCB 1DVPA 3R7RA 2J08A 3SFYA 4C9BB 1H6KA 3L13A 5KJMA 4NQ0A 4M7CA 2RG8A 1SZ9A 4LNUD 5E75A 5EX3A 3RKVA 3FDHA 4N2SA 3V2XA 3CKBA 5JHAA 4B0ZA 3SNXA 2AW6A 1OCRE 3FTVA 1HZ4A 3QDNA 3FUIA 4I1MA 3W9GA 3LY8A 2LAHA 4FHKA 2NYJA 3ASOE 4LG6A 1TEZA 3DRAA 3UTMA 4GCOA 5ARGA 3TJPA 3PZDA 3UIPC 3C3RA 4Q69A 4HRMB 1S64A 3KEAA 1TR4A 3LJNA 4N39A 5FTPA 2HR2A 3TWVA 4OVUA 1IQRA 3D9IA 4ZHBA 4K0RA 5HS0A 2XGOA 3E37A 2WVIA 2GGFA 3SHFA 4WWPA 2ZGGA 1AWCB 1S63A 3IHVA 4MLPA 4RLYA 4HFGA 4UQYA 3B95A 2KC7A 3TWSA 1P5QA 1HH8A 2FBNA 3ZHEB 1N54A 3CIAA 3PZ4A 2L6JA 4HRNA 4CEMA 3R9AB 1FVFA 3TWXA 3D9JA 3LCAA 3NAWA 4B8AA 2XENA 2X38A 2J9QA 3FP3A 3O48A 1OWOA 2Y0BG 4ABNA 3K9IA 4XIFA 1HX8A 3ABKE 2NC9A 3L82A 1KZPA 4L7TA 3I4RB 2PM7A 1NA0A 4HQDA 4WWOA 2L0IA 4RG6A 1N0RA 5G04C 3MZLB 3V31A 3HYMB 3EU5A 3CK9A 2OOEA 4KMOA 4Z68A 3HXCA 4MBGA 4L1BA 1OCCE 3EHMA 3JQ1A 3ULQA 3C5RA 3VLDA 4JB8P 4ME2A 3UT7A 5LCWC 4YDWA 3GZ1A 3HVEA 1VDYA 1D8DA 2R02A 4APOA 3PH0C 3TWQA 3ZIMA 4A3TA 4A63B 1JCSA 4GZCA 5IY5E 3JUIA 4AJWA 4WNFA 5B1BE 3QB2A 3FTYA 5AAOA 5LFAA 4F53A 4YDEA 2JLBA 3JQ0A 5HRYA 5BPPA 3EIJA 2ETCA 4J6IA 4ATZD 3EHRA 3I5PA 3ML8A 3Q4AB 4A3VA 4GTVA 3P1UA 3LVRE 2DZOA 2UY1A 4EQFA 3G2VA 3RIBA 2OVBA 2QYUA 4EZJA 1TN6A 2XRZA 1YA0A 3R9MA 5FWQA 4U0UA 5DIZA 4GTRA 4BTBA 2P9UG 3FFLA 4MKTA 4KVOA 5BXOA 1K3ZD 3G2WA 3PNTB 1N4SA 1EYHA 4PS8A 3CVWA 2WXGA 3LPZA 1V54E 4UQZA 3L22A 4HOQA 4CRWA 1ZB1A 1H2TC 3G2UA 2UY1B 2WXKA 1UJKA 2F0YA 4JHRA 3R7QA 5D0OD 4CT4A 4Y6WA 3Q73A 5D0QD 4UWHA 4HS2A 1OY3D 2XGSA 3FUNA 5AJLA 3ASHA 1ELKA 1TN7A 4LNBA 4M3OA 4I1AA 5T4YA 4CYMD 2Y4UA 2P58C 3NF1A 1MX2A 1QNFA 4U95D 4UQXA 4FADA 4EHMA 5ARFA 4CDRA 2VTBB 5HI7A 2RKKA 4EZLA 3SFXA 2V4HC 1H2UA 2IO3C 4AV7A 1FT2A 4ANVA 4AM9A 4G24A 3D3MA 5G2NA 3CQGB 4IRUA 4IYPA 4FA6A 3ZFWA 2X6HA 2WXQA 3MKQB 1QZ2A 4JD2G 1K1AA 3U3WA 4XZ4A 3CK8A 3FTXA 1Z6TA 4HVBA 5EYPF 3ESKA 3PEUB 4G8LA 2H6HA 3SBTB 2WMOA 3DSSA 5HKPA 1NI1A 3NBNB 1KZOA 2EIME 3TG4A 3FU6A 3TWUA 2EINE 1Y8MA 5BV1A 4PS7A 2P9SG 1U3CA 4F1PA 3TG5A 5FT9A 1Z3XA 1H19A 3BU8A 3CVYA 5CMWA 4DLQA 3T9KA 4BSXA 4ILHB 3PUJA 4G23A 4BETA 3EIQC 2GRMA 3TL5A 4EBAG 3Q79A 3NZUA 1PY1A 2WXNA 1E7UA 2DCPA 1DCEA 5EIDA 2JABA 1MX4A 5BXUA 2AWIA 4DI3A 3KSLA 4TUMA 5LX8A 3TWWA 4BWRA 1D8EA 4G25A 3RO3A 4KXKB 2RFAA 3HIZA 1PC2A 3SFZA 3ABLE 1NFIE 1O1SA 1X81A 4EPZA 4GPKA 3LYAA 1ELWA 3P2BA 1OWPA 5ENPD 1E7VA 1V55E 2XCBA 1JWFA 3FEXA 2XGMA 3DSXA 3E30A 1MX6A 3UT4A 4GTTA 5EX0A 4Q96A 4GA2A 3RAUA 3AU4A 1U2VG 3B7BA 3Q15A 5M72A 1HE8A 5CCLA 3X2QE 2GRQB 5EDSA 5AQ9A 1HS6A 5AIJA 4BTAA 2RFMA 3DXMG 2C2LA 1RW2A 3QWVA 4Y6CA 2J09A 2IEJA 4BX9A 4BFRA 5CRUA 3SO8A 1RZ4A 4AXHA 4JA7A 4A55A 4FP7A 4ACKA 2FULA 3FUHA 3BQOA 3CVUA 5JJTA 2QZAA 4ILIA 1IQUA 1S0PA 4BEPA 5ANLA 4LEUA 2FEZA 5KJNA 3S7FA 5D2MC 2NSZA 3KAEA 2KCVA 2AXUA 4GYWA 1FVHA 4WUYA 2ZXWE 2CG2A 4V3IA 1PAQA 4O60A 2A4ZA 3APCA 3C3OA 4HI9A 1ZU2A 2H6GA 1TJCA 3SY2A 4ANUA 1DC2A 4JEUA 3SGHA 3FH8A 4ATGA 4KYOB 3JCKC 1UJJA 2DVWA 2CHZA 4GTSA 2Y69E 2P2CP 2BF0X 2Q7FA 2FF4A 3ML9A 2NXPA 4LERA 3MV2B 1N95A 2E0IA 3FTUA 5FZQA 2XS1A 4HNAD 1OCOE 3CGHA 3UKRG 4UWFA 3ASDA 4DUIA 1L5JA 3ZGQA 3IHYA 5E76A 2PQNA 2KZTB 1N11A 2J07A 4GZ5A 4BT8A 1MHQA 2CHXA 5FJYA 2I9CA 4N3BA 4JPSA 3CHOA 4XE0A 3QOUA 1XNFA 1TNZA 3CHRA 1N4RA 3NZSA 3Q49B 3DSTA 5JMND 2L9BA 1N4PA 3CVXA 5AJDA 3MKQA 2IY0C 1BI8B 3ASFA 1INZA 3EJNA 4GTOA 4BESA 1D9SA 4JHJA 1TNUA 2WXJA 1K8KG 4JA9A 5C1DA 4GZDA 2ONDA 3V30A 3D9OA 3CVQA 2VSXE 1HFAA 3CKCA 4PUCA 4F6RD 4N2QA 4CZ2D 4HOTA 2MYOA 4WNEA 3OXGA 1NP7A 2WB2A 1LD7A 4JC8A 2ZU6B 3MJWA 2LSVA 4KBQA 2GRLA 2J4DA 3I4GA 5CERB 4C0EA 2EQXA 2HYZA 4J0UA 1LF8A 5B3SE 4GU5A 4DI4A 3UMVA 4OVVA 3SQVA 3UQ3A 4RVBA 3T8MA 1EDUA 3G2TA 4KT6B 1OCZE 3ZHEA 1UN9A 5J08A 1WAO1 5DBKA 3TAXA 4U0SA 2XEHA 2QYJA 2FO7A 3CVNA 2IO2C 1ZBPA 5AQ7A 3BEEA 3FUJA 1Y6IA 5AQBA 4JHKA 3C72A 4GYOA 4N5CA 2CG3A 2KZTA 2A5EA 2BUGA 3EHQA 5ENRD 3FUKA 2M63A 3HG0D 3Q9UC 3EU9A 1O1TA 1UN8A 3MV3B 5T3RA 2VGEA 3GW4A 3C98A 4C48B 3SI5A 3Q78A 3Q75A 2X6IA 3UPVA 3D9MA 2LXLA 2FI7A 2KATA 2V5QC 5T8IA 3LKUA 2DYRE 5CHEE 4FJZA 5KNHD 1NA3A 3ULEG 2R2LA 2WXMA 1QYMA 3ENEA 2RD0A 3CHMA 3LY9A 2OEWA 2KM4A 1NL4A 4BSZB 3G2SA 1HG5A 3CK7A 3VTXA 4BT9A 1HXIA 3PEVB 5HQ8A 3C3QA 2YHEA 3E4BA 3PVLA 5LCWJ 3PUKA 2VTBA 3ZXPA 3IEGA 4TUUA 1OUVA 4QQIA 4L2YA 3CVVA 4U7EB 3ONLA 4TRQA 2KCLA 3UM0A 2V8SE 4JVSA 5JA4D 3ZEFA 1JCQA 2R03A 1O1RA 5KNGA 4JXTA 3ESLA 3ZKJA 4GAAA 4NACA 4YDYA 2OEVA 5EN5D 2JEKA 3BG1B 3CVLA 2I1JA 4I17A 5JHBA 2PZIA 3APFA 3RU0A 4GA0A 3T5XA 3D9NA 3UINC 1N0QA 3FY4A 3SBSA 4GCNA 2WXLA 3B7RL 2VGYA 3PREA 2XZTG 3JXJA 4K5CA 3DEOA 3CSFA 3PNLB 2P9PG 2KXPC 1KLXA 3FULA 3PZ3A 2XS8A 3ASGA 5LP0A 1WM5A 2Y3AA 4IULA 3B7UX 3B7SA 3MX3A 4K5BA 4U04A 3UX4A 4LNGA 2XHEA 2XEVA 5KCMA 5LOZA 2BKGA 1Z5SC 4FULA 3N71A 3MCXA 2B6CA 2ETBA 5CBOA 3UXGA 1G3NB 4J8DA 1IYGA 4O6FA 1FCHA 3PDNA 4UI9C 1ELRA 1H2VC 3FU3A 3NOGD 2XPYA 3CSTA 2ETAA 5BUZA 1BPOA 3E32A 2J4BA 3VLEA 5AARA 2WQ6A 3FUDA 4TV3A 3UM2A 4RSYA 3QWPA 3LJ3A 3MEKA 4GA1A 2WM9A 2WMNA 2XZDG 2J8SD 4YVQC 1AP7A 3CHSA 2WXPA 4I6GA 4EECA 1WY6A 4APFA 3UM1A 1WG0A 1OWMA 4XKCA 2PL2A 4U63A 3CV0A 5KBAA 3AU5A 2VSYA 3KEZA 3V2OA 2HO1A 3RO2A 4UUCA 3IKOB 4LSZE 3T5VA 5FQ4A 4B93B 5C2YA 5AYWD 3HXEA 5CECB 3NQPA 2WPVA 5B1AE 2EIJE 4DLOA 2F37A 2A5UA 3NB2A 4EBAA 2X6FA 4I43A 4CDMA 1YCSB 4DX7D 1OXJA 1BLXB 1UW4B 2C0LA 3Q5MA 3V79K 5JJ6A 4N3CA 2VQ2A 2ZGDA 4BX8A 5ANRA 3F6QA 4DX6D 2R5SA 5FQ8A 3U64A 2P9LG 4F1SA 3S7JA 4U07A 4AOFA 5EKQD 3Q47B 3PRZA 3FUEA 4NIKA 4U8YD 3D9PA 2YINA 3MYVA 1TNBA 3VLFA 2L0TB 4UWLA 4GYYA 3Q7AA 3E33A 3OTNA 2PNNA 3RK6A 1MYOA 2IONA 4KZCA 3B13A 4G1TA 3QNKA 3RSEG 2GRPB 2H6FA 3O4ZA 4G2VA 3DEPA 4H7XA 2MHKA 3AG4E 2P9NG 1KPSB 2EIKE 4B89A 1BU9A 1JCRA 4JW1A 5FZSA 2IJGX 3HHMA 4HBDA 4J8EA 4U8HA 4A1SA 2OV8A 2GW1A 3L6AA 2XPIA 2F8YA 3CLJA 1DCQA 3QKYA 3KD7A 3LEWA 3UM3A 2VGXB 3RJVA 4I6JA 3EHNA
chains in the Genus database with same CATH topology
4N5CA 3NF1A 2CG3A 2KZTA 2V5FA 2BUGA 1EPUA 2I2OA 3QJZA 1QNFA 3FUKA 4OYSA 4UQXA 4HOSA 2M63A 2R59A 4FADA 4XI0A 4FHJA 4DJAA 1UN8A 3MV3B 3MGBA 5T3RA 5ARFA 4CDRA 4GMJA 2VTBB 3GW4A 3C98A 5HI7A 3SI5A 4EZLA 1N52A 4E85A 1H2UA 2X6IA 4JL0A 3UPVA 3D9MA 2FI7A 2KATA 4AV7A 3CVPA 5T8IA 3GZSA 4ANVA 3LY7A 4AM9A 3LKUA 2IU1A 3D9KA 4G24A 5A23A 4AVXA 4UI9J 3IV0A 2WXRA 3D3MA 4KZ0A 4WAFA 3S2AA 5G2NA 2VSNA 5CHEE 3FTZA 3L17A 1EF1C 4FJZA 3CQGB 4IRUA 4F7AA 3GYZA 4URKA 3OXLA 4IYPA 4FA6A 3ZFWA 2X6HA 2WXHA 1NA3A 4G11A 3UT8A 2WXQA 3QAQA 3MKQB 3FHEA 3MA5A 4WNDA 3JYSA 1QZ2A 5FQ7A 2WXMA 1KT1A 3ENEA 4I6JA 4N3AA 3ZPJA 3U3WA 4XZ4A 2RD0A 3CHMA 1MQSA 3CK8A 3LY9A 4FC8A 4MS6A 5ENNA 2KM4A 3FTXA 5KJKA 1IHGA 1Z6TA 1JPLA 4HVBA 2WQ7A 1OWLA 5A7DB 1JWGA 4UWGA 2IOSA 2V0PA 3ESKA 2MRIA 2PQRA 3UUXA 5CCMA 3PEUB 2ILRA 3G2SA 3KS2A 1HG5A 3CK7A 3VTXA 2VGXA 2VJ8A 2WMOA 3SBTB 4BT9A 1HXIA 4E6HA 3PEVB 3FUFA 5HQ8A 4XI9A 1GW6A 2YHEA 3FUMA 3QK0A 4AEZC 4FLHA 1HF8A 3E4BA 3SF4A 3DBSA 3PVLA 4L23A 3TG4A 1Z3YA 4UI9K 5LCWJ 3PUKA 3ZRHA 3FU6A 2VTBA 4I9EA 1Y8MA 3ZYLA 3FU0A 3IEGA 4PS7A 5BV1A 1U3CA 2DIWA 4TUUA 3TXNA 1OUVA 5FT9A 3TG5A 1Z3XA 4ANWA 1H19A 3CVYA 4L2YA 5CMWA 4DLQA 2PM6A 3AS5A 3CVVA 3URZA 4YVOA 4BSXA 1E8ZA 4ILHB 3PUJA 4G23A 4EZKA 3PE4A 3S7BA 3APDA 3ONLA 4TRQA 3EIQC 2GRMA 2KCLA 3TL5A 4EBAG 2V8SE 4GYOA 4JVSA 4XKBA 2IOLA 3NZUA 2VSOE 3ZEFA 1W3BA 3HDXA 1PY1A 2WXNA 1E7UA 1UG3A 3ZYQA 5J90A 2DCPA 4J8SA 1KT0A 4PDXA 4D10C 4JXTA 5AENA 3BG0B 3ESLA 4H7YA 3MKRA 4B94A 4K03A 4R7LA 4GAAA 3L54A 4NACA 2AWIA 3LS8A 4XX5A 2XQ0A 1E8YA 4DI3A 3PE3A 4FLBA 2JEKA 2C0MA 3BG1B 3CVLA 1U3DA 2I1JA 2QFCA 4I17A 4F3VA 5LX8A 1A17A 2YHCA 3FH7A 1E90A 5JHBA 2PZIA 4BWRA 5G05C 5BV0A 4G25A 3RO3A 3FU5A 3APFA 2IQCA 4JZYA 3RU0A 4KXKB 4GA0A 1E8WA 1PC2A 2LNIA 3HIZA 3T5XA 3SFZA 3CHPA 3D9NA 4WWNA 2UWJG 4KVMA 4MRUA 4U0ZA 3FY4A 4EPZA 3SBSA 2AXVA 4GCNA 2WXLA 3CHQA 3B7RL 3FTWA 3SZ7A 4GPKA 4I1OB 3LYAA 1ELWA 3FH5A 4FJYA 2VGYA 3HVEB 3PREA 4NURA 2CFZA 2IFUA 1NZNA 4CCAA 3P2BA 1OWPA 3CQCB 1DVPA 2BTDA 4I6EA 3R7RA 1SZAA 2J08A 1E7VA 4C9BB 1H6KA 3CSFA 3L13A 3PNLB 5KJMA 4NQ0A 3B7TA 4A1GA 2XCBA 1KLXA 3FULA 1JWFA 3FEXA 2RG8A 2XGMA 4GZ6A 1SZ9A 5E75A 3RKVA 5EX3A 3FDHA 4N2SA 3ASGA 3CKBA 5LP0A 5JHAA 4B0ZA 3SNXA 4B8CB 1WM5A 2Y3AA 2AW6A 3FTVA 4DPRA 3UT4A 1HU3A 5EX0A 1HZ4A 4IULA 4Q96A 3B7UX 3FUIA 3QDNA 3B7SA 3AU4A 3MX3A 4GA2A 4ILGA 3Q15A 5M72A 4I1MA 1HE8A 4U04A 1E8XA 5CCLA 2X6JA 3LY8A 3UX4A 2DBAA 2LAHA 4I9CA 5EDSA 2XHEA 3LVQE 1HS6A 5AIJA 4BTAA 4FHKA 2C2LA 2XEVA 5KCMA 4AY5A 5BW8C 1QQEA 5LOZA 3QWVA 4Y6CA 2J09A 4FULA 4BX9A 3FWVA 3N71A 2WQHA 3AS4A 3MCXA 4BFRA 4AXHA 3U66A 1TEZA 4JA7A 4A55A 4FP7A 4CT0A 4ACKA 4GCOA 2FULA 5ARGA 3TJPA 3FUHA 3CVUA 5JJTA 3PZDA 4YNDA 5FZRA 4ILIA 4Q69A 1IQUA 2R17C 1S0PA 4J8DA 5ANLA 4LEUA 4N39A 2FEZA 5FTPA 3SD5A 3TXMA 2HR2A 5BNWA 3TGOA 5KJNA 3S7FA 4OVUA 1IQRA 2NSZA 1IYGA 3KAEA 3D9IA 4O6FA 4K0RA 1FCHA 1DNPA 2AXUA 2KCVA 4GYWA 2XGOA 3PDNA 4UI9C 2WVIA 2GGFA 1FVHA 4WUYA 3SHFA 1ELRA 1H2VC 2CG2A 1PAQA 3FU3A 4V3IA 2A4ZA 3APCA 4WWPA 2XPYA 3IHVA 3CSTA 4MLPA 1ZU2A 5BUZA 1BPOA 2J4BA 4HFGA 1TJCA 4UQYA 2KC7A 3VLEA 5A6CA 2WQ6A 1SQMA 4ANUA 1P5QA 2I6HA 2X3MA 3WXXA 1HH8A 3FUDA 4JEUA 4TV3A 2FBNA 3SGHA 3ZHEB 4HOUA 1N54A 3FH8A 4ATGA 3CIAA 4KYOB 4GMLA 4RSYA 4IN3B 3JCKC 5G55A 3QWPA 2L6JA 4GZ3A 1UJJA 3R9AB 1FVFA 4I2WA 3LJ3A 4CEMA 3D9JA 3LCAA 2CHZA 3ZYKA 4B8AA 2X38A 2J9QA 3MEKA 3FP3A 4GA1A 2BF0X 3O48A 2WM9A 1OWOA 2Q7FA 2YNQA 2WMNA 2FF4A 3ML9A 4ABNA 3LXUX 4YVQC 2LSUA 3K9IA 1TJFA 2NXPA 4XIFA 4ACLA 1HX8A 2HM8A 2NC9A 4LERA 2XCCA 3MV2B 1OWNA 2E0IA 3CHSA 3FTUA 2WXPA 4I6GA 5FZQA 4EECA 3AS8A 1WY6A 3I4RB 4L7TA 4APFA 3CGHA 2PM7A 4UWFA 1NA0A 1OWMA 3ASDA 2PL2A 3I3NA 2XRYA 4GB9A 4XKCA 1L5JA 2I1KA 2L0IA 3IHYA 4U63A 4WWOA 3ZGQA 3CV0A 4RG6A 2IF4A 5E76A 2PQNA 3IBEA 5CMYA 2KZTB 5G04C 4HLEA 3MZLB 3ZVVA 3AU5A 4P29A 3HYMB 2LAIA 2VSYA 3ONKA 2J07A 3KEZA 3CK9A 4GZ5A 3S7DA 2OOEA 2X6KA 3EDTB 4KMOA 4BT8A 4WNGA 1MHQA 2HO1A 2MOWA 3RO2A 4L1BA 4JEHA 3EHMA 2CHXA 3CEQA 2P58C 3IKOB 3JQ1A 5FJYA 3OAWA 2I9CA 4N3BA 5FQ4A 3ULQA 4JPSA 3VLDA 3T5VA 3CHOA 5C2YA 5AYWD 4XE0A 4CDNA 3QOUA 1JUQA 2VYIA 2WPVA 3NQPA 1XNFA 4ME2A 4Q94A 3UT7A 4DLOA 5LCWC 2A5UA 3CHRA 2WXOA 2E2EA 3GZ1A 3HVEA 3NZSA 4EBAA 1VDYA 2X6FA 4APOA 5FQ6A 3PH0C 3Q49B 4I43A 5G04J 4CDMA 3ZIMA 5JJ7A 4A3TA 2L9BA 3L08A 1UW4B 2C0LA 5AJDA 3MKQA 3CVXA 3Q5MA 4GZCA 3ZW3A 3QC1A 3RRMB 5JJ6A 3FTSA 4N3CA 3ASFA 3JUIA 4AJWA 1INZA 3EJNA 4WNFA 2LO6A 2VQ2A 2KCKA 3DPDA 1XGWA 1X5BA 3FTYA 3QB2A 3QWWA 4BX8A 3OXFA 4JHJA 2WXJA 3RRNB 4C0MA 4JA9A 5ANRA 5C1DA 4HORA 4GZDA 2ONDA 2R5SA 3D9OA 5FQ8A 3U64A 4F53A 2JLBA 3JQ0A 5KJLA 5LFAA 1H0AA 5BPPA 2CFUA 2YQ8A 4F1SA 4QFVA 2WXFA 3S7JA 4UWKA 3EIJA 4U07A 4AOFA 5EKQD 3Q47B 3CVQA 2VSXE 4PH4B 1HFAA 3CKCA 2AXZA 4J6IA 2WXIA 3PRZA 3FUEA 4G26A 3I5PA 3ML8A 4PUCA 4DK5A 3Q4AB 4A3VA 3D9PA 2YINA 4LUNU 4N2QA 3P1UA 3LVRE 2UY1A 4EQFA 4HOTA 3MYVA 3PS6A 3G2VA 5G05J 3FEYA 3RIBA 4WNEA 2OVBA 3QARA 1HG2A 3VLFA 4EZJA 2L0TB 2XRZA 3GZ2A 1YA0A 4J8FA 3OXGA 4AY6A 4UWLA 5FWQA 1NP7A 4GYYA 4LCTA 4U0UA 2WB2A 3LDZA 3OTNA 4JC8A 3U4TA 1E96B 4AP2A 2IONA 2ZU6B 5DIZA 4KZCA 3RK6A 3B13A 3MJWA 2LSVA 2J49A 4G1TA 4BTBA 3FFLA 4MKTA 3QNKA 4KVOA 4KBQA 3VTYA 5BT1A 2GRLA 3L16A 3G2WA 3PNTB 2Y4TA 2J4DA 1EYHA 2QY7A 3I4GA 3O4ZA 4PS8A 4C0EA 4CGVA 3CVWA 4G2VA 2WXGA 2OVFA 4H7XA 2EQXA 2MHKA 3LPZA 3U9WA 2HYZA 3ZXSA 3ZYMA 4J0UA 4B89A 4UQZA 4I2ZA 3L22A 1LF8A 4HXIA 4GU5A 4HOQA 3ZN3A 4CRWA 1H2TC 3G2UA 4DI4A 3UMVA 3CR3A 2UY1B 2WXKA 4JW1A 4W9RA 1UJKA 4OVVA 5FZSA 3UQ3A 4ANXA 4RVBA 1EDUA 2IJGX 2XPZA 3G2TA 3T8MA 4KT6B 4JHRA 3HHMA 3R7QA 5D0OD 3RRUA 4L2LA 4CT4A 4Y6WA 4CGWA 3ZHEA 1UN9A 2V4LA 5D0QD 1HO8A 5J08A 4J8EA 4UWHA 2AVPA 1WAO1 1B89A 4U8HA 5DBKA 4HS2A 3TAXA 4U0SA 2XGSA 3D9LA 2FO7A 3CVNA 4A1SA 2OV8A 4AIFA 2GW1A 1ZBPA 2XPIA 3L6AA 3CLJA 4LRZA 3FUNA 4FU3A 5AJLA 3BEEA 1ELKA 3QKYA 4RG9A 4BY6A 3FUJA 1Y6IA 2CHWA 4M3OA 4JHKA 3KD7A 4I1AA 3LEWA 4PS3A 2VGXB 5T4YA 3RJVA 3ASHA 2Y4UA 4NRHB 3EHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBA G;  2L9B A; 
#chains in the Genus database with same CATH topology
 3HXD A;  2P9K G;  4HOS A;  2R59 A;  4FHJ A;  3MGB A;  4GMJ A;  1N52 A;  4JL0 A;  2IU1 A;  3D9K A;  4AVX A;  4UI9 J;  3IV0 A;  4KZ0 A;  4WAF A;  2VSN A;  3FTZ A;  1EF1 C;  3JXI A;  4URK A;  3GYZ A;  2WXH A;  4G11 A;  3UT8 A;  3QAQ A;  3MA5 A;  5FQ7 A;  1TN8 A;  1KT1 A;  1MQS A;  4MS6 A;  5ENN A;  4FC8 A;  2DWZ A;  1BD8 A;  4OAV B;  2WQ7 A;  1OWL A;  4HI8 A;  2V0P A;  4UWG A;  5CCM A;  3TWR A;  3KS2 A;  2B0O E;  2VGX A;  2VJ8 A;  1TNO A;  2BKK B;  3FUF A;  1S70 B;  4XI9 A;  1GW6 A;  4DRX E;  3QK0 A;  4AEZ C;  1HF8 A;  3SF4 A;  3DSU A;  1SW6 A;  3FU0 A;  2XEE A;  4YVO A;  1E8Z A;  4EZK A;  1H6O A;  3S7B A;  2DZN A;  4XKB A;  5ENT D;  1W3B A;  4J7W A;  4PDX A;  5AEN A;  1FT1 A;  4H7Y A;  4B94 A;  2FO1 E;  4R7L A;  3JUE A;  3J5P A;  3LS8 A;  1O5M A;  2XQ0 A;  4FLB A;  4F3V A;  2C0M A;  2QFC A;  2YHC A;  1E90 A;  1SA5 A;  5G05 C;  2KBX A;  3Q7F A;  4JZY A;  1E8W A;  2LNI A;  4MRU A;  5H7P A;  2LUH A;  3FTW A;  4FJY A;  2CFZ A;  1NZN A;  4I6E A;  2BTD A;  1SZA A;  3UKU G;  3AG1 E;  3BUA A;  4J8Y A;  3B7T A;  4A1G A;  5EIB E;  5EIL A;  4GZ6 A;  5CEA A;  4B8C B;  2OCC E;  2ZIS A;  4DPR A;  1HU3 A;  4ILG A;  5ENS D;  5CRV A;  1E8X A;  2X6J A;  2DBA A;  5ENQ D;  4I9C A;  3LVQ E;  5FIN A;  4TXQ A;  4O1O A;  4AY5 A;  5BW8 C;  1QQE A;  3FWV A;  2WQH A;  3AS4 A;  3U66 A;  1MJ0 A;  4CT0 A;  4U8V D;  2GRN B;  3L9T A;  4YND A;  5FZR A;  2R17 C;  3HRA A;  3TXM A;  5BNW A;  3TGO A;  3SD5 A;  1DNP A;  2BED A;  1FPP A;  1BI7 B;  2AJA A;  1UOH A;  5A6C A;  4HLL A;  1SQM A;  2X3M A;  2DYS E;  2I6H A;  1TNY A;  3WXX A;  1K1B A;  4HOU A;  4GML A;  4IN3 B;  5G55 A;  1SA4 A;  4GZ3 A;  4I2W A;  1IKN D;  4N5Q A;  4YDO A;  3ZYK A;  3ZU7 B;  2YNQ A;  1YMP A;  3LXU X;  2LSU A;  1TJF A;  4ACL A;  2HM8 A;  5ENO D;  2XCC A;  1OWN A;  4U96 D;  2H6I A;  3AS8 A;  1IHB A;  3I3N A;  2XRY A;  4GB9 A;  2I1K A;  2IF4 A;  4GTQ A;  3IBE A;  5CMY A;  4HLE A;  3ZVV A;  4P29 A;  2LAI A;  3ONK A;  3S7D A;  2X6K A;  3EDT B;  1H6P A;  4WNG A;  2QC9 A;  2MOW A;  2GRO B;  4JEH A;  3CEQ A;  5ITZ F;  3HXF A;  3OAW A;  3D9H A;  4CDN A;  1JUQ A;  3EUV A;  2VYI A;  3PZ1 A;  4HRL A;  4Q94 A;  3T8K A;  3HXB A;  2LXM A;  2WXO A;  2E2E A;  5FQ6 A;  5G04 J;  5JJ7 A;  2HE0 A;  3L08 A;  2P9I G;  3ZW3 A;  3QC1 A;  4K5A B;  3RRM B;  3FTS A;  2LO6 A;  2KCK A;  3DPD A;  1XGW A;  1X5B A;  3QWW A;  3OXF A;  5EYL A;  3RRN B;  4C0M A;  4HOR A;  5KJL A;  1H0A A;  5AN8 A;  2CFU A;  2YQ8 A;  1N94 A;  4QFV A;  2WXF A;  5CED B;  4UWK A;  3W9F A;  4TXP A;  4PH4 B;  3IXE A;  2AXZ A;  2WXI A;  1YYH A;  4G26 A;  4DK5 A;  1LD8 A;  5FIO A;  3PZ2 A;  4LUN U;  3ASN E;  3WG7 E;  3PS6 A;  5G05 J;  3FEY A;  3QAR A;  1HG2 A;  2L6B A;  3E34 A;  3GZ2 A;  4J8F A;  4AY6 A;  4LCT A;  3LDZ A;  3U4T A;  3NOC D;  2F8X K;  1E96 B;  4AP2 A;  3DPY A;  2J49 A;  4DX5 D;  4GMR A;  1N4Q A;  3VTY A;  5BT1 A;  3L16 A;  3ABM E;  2Y4T A;  2QY7 A;  4CGV A;  2OVF A;  3U9W A;  3ZXS A;  3DSV A;  3DSW A;  4O1P A;  3ZYM A;  4I2Z A;  4HXI A;  3ZN3 A;  3UI2 A;  2EIL E;  3CR3 A;  4W9R A;  4ANX A;  2XPZ A;  4RQI A;  2GRR B;  3RRU A;  4L2L A;  4CGW A;  1TYQ G;  2V4L A;  1HO8 A;  2AVP A;  1B89 A;  3D9L A;  5D66 A;  4AIF A;  4LRZ A;  4FU3 A;  4GTM A;  4RG9 A;  4BY6 A;  2CHW A;  4PS3 A;  3J5Q B;  2ZIR A;  4HB5 A;  4NRH B;  2V5F A;  4DX1 A;  1EPU A;  2I2O A;  3QJZ A;  4OYS A;  4L9P A;  4XI0 A;  4G8K A;  4DJA A;  1Q2Z A;  3ZUV B;  2Y1L E;  3AAA C;  1WDY A;  4BER A;  4E85 A;  4OAU C;  3Q9N C;  1QBQ A;  3CVP A;  3ISM C;  3GZS A;  3LY7 A;  5A23 A;  2WXR A;  3S2A A;  3L17 A;  4F7A A;  3OXL A;  3AJI A;  3FHE A;  4WND A;  3JYS A;  4N3A A;  3ZPJ A;  5KJK A;  1IHG A;  1JPL A;  5A7D B;  1JWG A;  2IOS A;  2MRI A;  2PQR A;  3ULY A;  3UUX A;  2ILR A;  4GPM A;  4E6H A;  3AG2 E;  1N9A A;  5AQA A;  3FUM A;  4FLH A;  3DBS A;  4L23 A;  1Z3Y A;  4UI9 K;  3ZRH A;  4GTP A;  4I9E A;  3ZYL A;  3ZNG A;  2DIW A;  3TXN A;  4ANW A;  4X8Q A;  2PM6 A;  3AS5 A;  3URZ A;  5KWD A;  1SVX A;  3PE4 A;  3APD A;  3TWT A;  2IOL A;  2VSO E;  3HDX A;  1OT8 A;  1LTX A;  4DX2 A;  1UG3 A;  3ZYQ A;  5J90 A;  3DXK G;  4J8S A;  1KT0 A;  4ZFH A;  4D10 C;  3DWL G;  3BG0 B;  3MKR A;  1A5E A;  4K03 A;  3L54 A;  4XX5 A;  1E8Y A;  3PE3 A;  1U3D A;  3UIO C;  1A17 A;  3FH7 A;  5BV0 A;  1IXV A;  3FU5 A;  2IQC A;  4XEI G;  4TXR A;  2R05 A;  3CHP A;  3KSQ A;  4WWN A;  2UWJ G;  4KVM A;  4U0Z A;  3AG3 E;  2AXV A;  3CHQ A;  3SZ7 A;  4I1O B;  5CBN A;  1MZC A;  3FH5 A;  4NUR A;  3HVE B;  4CCA A;  2IFU A;  3CQC B;  1DVP A;  3R7R A;  2J08 A;  3SFY A;  4C9B B;  1H6K A;  3L13 A;  5KJM A;  4NQ0 A;  4M7C A;  2RG8 A;  1SZ9 A;  4LNU D;  5E75 A;  5EX3 A;  3RKV A;  3FDH A;  4N2S A;  3V2X A;  3CKB A;  5JHA A;  4B0Z A;  3SNX A;  2AW6 A;  1OCR E;  3FTV A;  1HZ4 A;  3QDN A;  3FUI A;  4I1M A;  3W9G A;  3LY8 A;  2LAH A;  4FHK A;  2NYJ A;  3ASO E;  4LG6 A;  1TEZ A;  3DRA A;  3UTM A;  4GCO A;  5ARG A;  3TJP A;  3PZD A;  3UIP C;  3C3R A;  4Q69 A;  4HRM B;  1S64 A;  3KEA A;  1TR4 A;  3LJN A;  4N39 A;  5FTP A;  2HR2 A;  3TWV A;  4OVU A;  1IQR A;  3D9I A;  4ZHB A;  4K0R A;  5HS0 A;  2XGO A;  3E37 A;  2WVI A;  2GGF A;  3SHF A;  4WWP A;  2ZGG A;  1AWC B;  1S63 A;  3IHV A;  4MLP A;  4RLY A;  4HFG A;  4UQY A;  3B95 A;  2KC7 A;  3TWS A;  1P5Q A;  1HH8 A;  2FBN A;  3ZHE B;  1N54 A;  3CIA A;  3PZ4 A;  2L6J A;  4HRN A;  4CEM A;  3R9A B;  1FVF A;  3TWX A;  3D9J A;  3LCA A;  3NAW A;  4B8A A;  2XEN A;  2X38 A;  2J9Q A;  3FP3 A;  3O48 A;  1OWO A;  2Y0B G;  4ABN A;  3K9I A;  4XIF A;  1HX8 A;  3ABK E;  2NC9 A;  3L82 A;  1KZP A;  4L7T A;  3I4R B;  2PM7 A;  1NA0 A;  4HQD A;  4WWO A;  2L0I A;  4RG6 A;  1N0R A;  5G04 C;  3MZL B;  3V31 A;  3HYM B;  3EU5 A;  3CK9 A;  2OOE A;  4KMO A;  4Z68 A;  3HXC A;  4MBG A;  4L1B A;  1OCC E;  3EHM A;  3JQ1 A;  3ULQ A;  3C5R A;  3VLD A;  4JB8 P;  4ME2 A;  3UT7 A;  5LCW C;  4YDW A;  3GZ1 A;  3HVE A;  1VDY A;  1D8D A;  2R02 A;  4APO A;  3PH0 C;  3TWQ A;  3ZIM A;  4A3T A;  4A63 B;  1JCS A;  4GZC A;  5IY5 E;  3JUI A;  4AJW A;  4WNF A;  5B1B E;  3QB2 A;  3FTY A;  5AAO A;  5LFA A;  4F53 A;  4YDE A;  2JLB A;  3JQ0 A;  5HRY A;  5BPP A;  3EIJ A;  2ETC A;  4J6I A;  4ATZ D;  3EHR A;  3I5P A;  3ML8 A;  3Q4A B;  4A3V A;  4GTV A;  3P1U A;  3LVR E;  2DZO A;  2UY1 A;  4EQF A;  3G2V A;  3RIB A;  2OVB A;  2QYU A;  4EZJ A;  1TN6 A;  2XRZ A;  1YA0 A;  3R9M A;  5FWQ A;  4U0U A;  5DIZ A;  4GTR A;  4BTB A;  2P9U G;  3FFL A;  4MKT A;  4KVO A;  5BXO A;  1K3Z D;  3G2W A;  3PNT B;  1N4S A;  1EYH A;  4PS8 A;  3CVW A;  2WXG A;  3LPZ A;  1V54 E;  4UQZ A;  3L22 A;  4HOQ A;  4CRW A;  1ZB1 A;  1H2T C;  3G2U A;  2UY1 B;  2WXK A;  1UJK A;  2F0Y A;  4JHR A;  3R7Q A;  5D0O D;  4CT4 A;  4Y6W A;  3Q73 A;  5D0Q D;  4UWH A;  4HS2 A;  1OY3 D;  2XGS A;  3FUN A;  5AJL A;  3ASH A;  1ELK A;  1TN7 A;  4LNB A;  4M3O A;  4I1A A;  5T4Y A;  4CYM D;  2Y4U A;  2P58 C;  3NF1 A;  1MX2 A;  1QNF A;  4U95 D;  4UQX A;  4FAD A;  4EHM A;  5ARF A;  4CDR A;  2VTB B;  5HI7 A;  2RKK A;  4EZL A;  3SFX A;  2V4H C;  1H2U A;  2IO3 C;  4AV7 A;  1FT2 A;  4ANV A;  4AM9 A;  4G24 A;  3D3M A;  5G2N A;  3CQG B;  4IRU A;  4IYP A;  4FA6 A;  3ZFW A;  2X6H A;  2WXQ A;  3MKQ B;  1QZ2 A;  4JD2 G;  1K1A A;  3U3W A;  4XZ4 A;  3CK8 A;  3FTX A;  1Z6T A;  4HVB A;  5EYP F;  3ESK A;  3PEU B;  4G8L A;  2H6H A;  3SBT B;  2WMO A;  3DSS A;  5HKP A;  1NI1 A;  3NBN B;  1KZO A;  2EIM E;  3TG4 A;  3FU6 A;  3TWU A;  2EIN E;  1Y8M A;  5BV1 A;  4PS7 A;  2P9S G;  1U3C A;  4F1P A;  3TG5 A;  5FT9 A;  1Z3X A;  1H19 A;  3BU8 A;  3CVY A;  5CMW A;  4DLQ A;  3T9K A;  4BSX A;  4ILH B;  3PUJ A;  4G23 A;  4BET A;  3EIQ C;  2GRM A;  3TL5 A;  4EBA G;  3Q79 A;  3NZU A;  1PY1 A;  2WXN A;  1E7U A;  2DCP A;  1DCE A;  5EID A;  2JAB A;  1MX4 A;  5BXU A;  2AWI A;  4DI3 A;  3KSL A;  4TUM A;  5LX8 A;  3TWW A;  4BWR A;  1D8E A;  4G25 A;  3RO3 A;  4KXK B;  2RFA A;  3HIZ A;  1PC2 A;  3SFZ A;  3ABL E;  1NFI E;  1O1S A;  1X81 A;  4EPZ A;  4GPK A;  3LYA A;  1ELW A;  3P2B A;  1OWP A;  5ENP D;  1E7V A;  1V55 E;  2XCB A;  1JWF A;  3FEX A;  2XGM A;  3DSX A;  3E30 A;  1MX6 A;  3UT4 A;  4GTT A;  5EX0 A;  4Q96 A;  4GA2 A;  3RAU A;  3AU4 A;  1U2V G;  3B7B A;  3Q15 A;  5M72 A;  1HE8 A;  5CCL A;  3X2Q E;  2GRQ B;  5EDS A;  5AQ9 A;  1HS6 A;  5AIJ A;  4BTA A;  2RFM A;  3DXM G;  2C2L A;  1RW2 A;  3QWV A;  4Y6C A;  2J09 A;  2IEJ A;  4BX9 A;  4BFR A;  5CRU A;  3SO8 A;  1RZ4 A;  4AXH A;  4JA7 A;  4A55 A;  4FP7 A;  4ACK A;  2FUL A;  3FUH A;  3BQO A;  3CVU A;  5JJT A;  2QZA A;  4ILI A;  1IQU A;  1S0P A;  4BEP A;  5ANL A;  4LEU A;  2FEZ A;  5KJN A;  3S7F A;  5D2M C;  2NSZ A;  3KAE A;  2KCV A;  2AXU A;  4GYW A;  1FVH A;  4WUY A;  2ZXW E;  2CG2 A;  4V3I A;  1PAQ A;  4O60 A;  2A4Z A;  3APC A;  3C3O A;  4HI9 A;  1ZU2 A;  2H6G A;  1TJC A;  3SY2 A;  4ANU A;  1DC2 A;  4JEU A;  3SGH A;  3FH8 A;  4ATG A;  4KYO B;  3JCK C;  1UJJ A;  2DVW A;  2CHZ A;  4GTS A;  2Y69 E;  2P2C P;  2BF0 X;  2Q7F A;  2FF4 A;  3ML9 A;  2NXP A;  4LER A;  3MV2 B;  1N95 A;  2E0I A;  3FTU A;  5FZQ A;  2XS1 A;  4HNA D;  1OCO E;  3CGH A;  3UKR G;  4UWF A;  3ASD A;  4DUI A;  1L5J A;  3ZGQ A;  3IHY A;  5E76 A;  2PQN A;  2KZT B;  1N11 A;  2J07 A;  4GZ5 A;  4BT8 A;  1MHQ A;  2CHX A;  5FJY A;  2I9C A;  4N3B A;  4JPS A;  3CHO A;  4XE0 A;  3QOU A;  1XNF A;  1TNZ A;  3CHR A;  1N4R A;  3NZS A;  3Q49 B;  3DST A;  5JMN D;  2L9B A;  1N4P A;  3CVX A;  5AJD A;  3MKQ A;  2IY0 C;  1BI8 B;  3ASF A;  1INZ A;  3EJN A;  4GTO A;  4BES A;  1D9S A;  4JHJ A;  1TNU A;  2WXJ A;  1K8K G;  4JA9 A;  5C1D A;  4GZD A;  2OND A;  3V30 A;  3D9O A;  3CVQ A;  2VSX E;  1HFA A;  3CKC A;  4PUC A;  4F6R D;  4N2Q A;  4CZ2 D;  4HOT A;  2MYO A;  4WNE A;  3OXG A;  1NP7 A;  2WB2 A;  1LD7 A;  4JC8 A;  2ZU6 B;  3MJW A;  2LSV A;  4KBQ A;  2GRL A;  2J4D A;  3I4G A;  5CER B;  4C0E A;  2EQX A;  2HYZ A;  4J0U A;  1LF8 A;  5B3S E;  4GU5 A;  4DI4 A;  3UMV A;  4OVV A;  3SQV A;  3UQ3 A;  4RVB A;  3T8M A;  1EDU A;  3G2T A;  4KT6 B;  1OCZ E;  3ZHE A;  1UN9 A;  5J08 A;  1WAO 1;  5DBK A;  3TAX A;  4U0S A;  2XEH A;  2QYJ A;  2FO7 A;  3CVN A;  2IO2 C;  1ZBP A;  5AQ7 A;  3BEE A;  3FUJ A;  1Y6I A;  5AQB A;  4JHK A;  3C72 A;  4GYO A;  4N5C A;  2CG3 A;  2KZT A;  2A5E A;  2BUG A;  3EHQ A;  5ENR D;  3FUK A;  2M63 A;  3HG0 D;  3Q9U C;  3EU9 A;  1O1T A;  1UN8 A;  3MV3 B;  5T3R A;  2VGE A;  3GW4 A;  3C98 A;  4C48 B;  3SI5 A;  3Q78 A;  3Q75 A;  2X6I A;  3UPV A;  3D9M A;  2LXL A;  2FI7 A;  2KAT A;  2V5Q C;  5T8I A;  3LKU A;  2DYR E;  5CHE E;  4FJZ A;  5KNH D;  1NA3 A;  3ULE G;  2R2L A;  2WXM A;  1QYM A;  3ENE A;  2RD0 A;  3CHM A;  3LY9 A;  2OEW A;  2KM4 A;  1NL4 A;  4BSZ B;  3G2S A;  1HG5 A;  3CK7 A;  3VTX A;  4BT9 A;  1HXI A;  3PEV B;  5HQ8 A;  3C3Q A;  2YHE A;  3E4B A;  3PVL A;  5LCW J;  3PUK A;  2VTB A;  3ZXP A;  3IEG A;  4TUU A;  1OUV A;  4QQI A;  4L2Y A;  3CVV A;  4U7E B;  3ONL A;  4TRQ A;  2KCL A;  3UM0 A;  2V8S E;  4JVS A;  5JA4 D;  3ZEF A;  1JCQ A;  2R03 A;  1O1R A;  5KNG A;  4JXT A;  3ESL A;  3ZKJ A;  4GAA A;  4NAC A;  4YDY A;  2OEV A;  5EN5 D;  2JEK A;  3BG1 B;  3CVL A;  2I1J A;  4I17 A;  5JHB A;  2PZI A;  3APF A;  3RU0 A;  4GA0 A;  3T5X A;  3D9N A;  3UIN C;  1N0Q A;  3FY4 A;  3SBS A;  4GCN A;  2WXL A;  3B7R L;  2VGY A;  3PRE A;  2XZT G;  3JXJ A;  4K5C A;  3DEO A;  3CSF A;  3PNL B;  2P9P G;  2KXP C;  1KLX A;  3FUL A;  3PZ3 A;  2XS8 A;  3ASG A;  5LP0 A;  1WM5 A;  2Y3A A;  4IUL A;  3B7U X;  3B7S A;  3MX3 A;  4K5B A;  4U04 A;  3UX4 A;  4LNG A;  2XHE A;  2XEV A;  5KCM A;  5LOZ A;  2BKG A;  1Z5S C;  4FUL A;  3N71 A;  3MCX A;  2B6C A;  2ETB A;  5CBO A;  3UXG A;  1G3N B;  4J8D A;  1IYG A;  4O6F A;  1FCH A;  3PDN A;  4UI9 C;  1ELR A;  1H2V C;  3FU3 A;  3NOG D;  2XPY A;  3CST A;  2ETA A;  5BUZ A;  1BPO A;  3E32 A;  2J4B A;  3VLE A;  5AAR A;  2WQ6 A;  3FUD A;  4TV3 A;  3UM2 A;  4RSY A;  3QWP A;  3LJ3 A;  3MEK A;  4GA1 A;  2WM9 A;  2WMN A;  2XZD G;  2J8S D;  4YVQ C;  1AP7 A;  3CHS A;  2WXP A;  4I6G A;  4EEC A;  1WY6 A;  4APF A;  3UM1 A;  1WG0 A;  1OWM A;  4XKC A;  2PL2 A;  4U63 A;  3CV0 A;  5KBA A;  3AU5 A;  2VSY A;  3KEZ A;  3V2O A;  2HO1 A;  3RO2 A;  4UUC A;  3IKO B;  4LSZ E;  3T5V A;  5FQ4 A;  4B93 B;  5C2Y A;  5AYW D;  3HXE A;  5CEC B;  3NQP A;  2WPV A;  5B1A E;  2EIJ E;  4DLO A;  2F37 A;  2A5U A;  3NB2 A;  4EBA A;  2X6F A;  4I43 A;  4CDM A;  1YCS B;  4DX7 D;  1OXJ A;  1BLX B;  1UW4 B;  2C0L A;  3Q5M A;  3V79 K;  5JJ6 A;  4N3C A;  2VQ2 A;  2ZGD A;  4BX8 A;  5ANR A;  3F6Q A;  4DX6 D;  2R5S A;  5FQ8 A;  3U64 A;  2P9L G;  4F1S A;  3S7J A;  4U07 A;  4AOF A;  5EKQ D;  3Q47 B;  3PRZ A;  3FUE A;  4NIK A;  4U8Y D;  3D9P A;  2YIN A;  3MYV A;  1TNB A;  3VLF A;  2L0T B;  4UWL A;  4GYY A;  3Q7A A;  3E33 A;  3OTN A;  2PNN A;  3RK6 A;  1MYO A;  2ION A;  4KZC A;  3B13 A;  4G1T A;  3QNK A;  3RSE G;  2GRP B;  2H6F A;  3O4Z A;  4G2V A;  3DEP A;  4H7X A;  2MHK A;  3AG4 E;  2P9N G;  1KPS B;  2EIK E;  4B89 A;  1BU9 A;  1JCR A;  4JW1 A;  5FZS A;  2IJG X;  3HHM A;  4HBD A;  4J8E A;  4U8H A;  4A1S A;  2OV8 A;  2GW1 A;  3L6A A;  2XPI A;  2F8Y A;  3CLJ A;  1DCQ A;  3QKY A;  3KD7 A;  3LEW A;  3UM3 A;  2VGX B;  3RJV A;  4I6J A;  3EHN A; 
#chains in the Genus database with same CATH homology
 4N5C A;  3NF1 A;  2CG3 A;  2KZT A;  2V5F A;  2BUG A;  1EPU A;  2I2O A;  3QJZ A;  1QNF A;  3FUK A;  4OYS A;  4UQX A;  4HOS A;  2M63 A;  2R59 A;  4FAD A;  4XI0 A;  4FHJ A;  4DJA A;  1UN8 A;  3MV3 B;  3MGB A;  5T3R A;  5ARF A;  4CDR A;  4GMJ A;  2VTB B;  3GW4 A;  3C98 A;  5HI7 A;  3SI5 A;  4EZL A;  1N52 A;  4E85 A;  1H2U A;  2X6I A;  4JL0 A;  3UPV A;  3D9M A;  2FI7 A;  2KAT A;  4AV7 A;  3CVP A;  5T8I A;  3GZS A;  4ANV A;  3LY7 A;  4AM9 A;  3LKU A;  2IU1 A;  3D9K A;  4G24 A;  5A23 A;  4AVX A;  4UI9 J;  3IV0 A;  2WXR A;  3D3M A;  4KZ0 A;  4WAF A;  3S2A A;  5G2N A;  2VSN A;  5CHE E;  3FTZ A;  3L17 A;  1EF1 C;  4FJZ A;  3CQG B;  4IRU A;  4F7A A;  3GYZ A;  4URK A;  3OXL A;  4IYP A;  4FA6 A;  3ZFW A;  2X6H A;  2WXH A;  1NA3 A;  4G11 A;  3UT8 A;  2WXQ A;  3QAQ A;  3MKQ B;  3FHE A;  3MA5 A;  4WND A;  3JYS A;  1QZ2 A;  5FQ7 A;  2WXM A;  1KT1 A;  3ENE A;  4I6J A;  4N3A A;  3ZPJ A;  3U3W A;  4XZ4 A;  2RD0 A;  3CHM A;  1MQS A;  3CK8 A;  3LY9 A;  4FC8 A;  4MS6 A;  5ENN A;  2KM4 A;  3FTX A;  5KJK A;  1IHG A;  1Z6T A;  1JPL A;  4HVB A;  2WQ7 A;  1OWL A;  5A7D B;  1JWG A;  4UWG A;  2IOS A;  2V0P A;  3ESK A;  2MRI A;  2PQR A;  3UUX A;  5CCM A;  3PEU B;  2ILR A;  3G2S A;  3KS2 A;  1HG5 A;  3CK7 A;  3VTX A;  2VGX A;  2VJ8 A;  2WMO A;  3SBT B;  4BT9 A;  1HXI A;  4E6H A;  3PEV B;  3FUF A;  5HQ8 A;  4XI9 A;  1GW6 A;  2YHE A;  3FUM A;  3QK0 A;  4AEZ C;  4FLH A;  1HF8 A;  3E4B A;  3SF4 A;  3DBS A;  3PVL A;  4L23 A;  3TG4 A;  1Z3Y A;  4UI9 K;  5LCW J;  3PUK A;  3ZRH A;  3FU6 A;  2VTB A;  4I9E A;  1Y8M A;  3ZYL A;  3FU0 A;  3IEG A;  4PS7 A;  5BV1 A;  1U3C A;  2DIW A;  4TUU A;  3TXN A;  1OUV A;  5FT9 A;  3TG5 A;  1Z3X A;  4ANW A;  1H19 A;  3CVY A;  4L2Y A;  5CMW A;  4DLQ A;  2PM6 A;  3AS5 A;  3CVV A;  3URZ A;  4YVO A;  4BSX A;  1E8Z A;  4ILH B;  3PUJ A;  4G23 A;  4EZK A;  3PE4 A;  3S7B A;  3APD A;  3ONL A;  4TRQ A;  3EIQ C;  2GRM A;  2KCL A;  3TL5 A;  4EBA G;  2V8S E;  4GYO A;  4JVS A;  4XKB A;  2IOL A;  3NZU A;  2VSO E;  3ZEF A;  1W3B A;  3HDX A;  1PY1 A;  2WXN A;  1E7U A;  1UG3 A;  3ZYQ A;  5J90 A;  2DCP A;  4J8S A;  1KT0 A;  4PDX A;  4D10 C;  4JXT A;  5AEN A;  3BG0 B;  3ESL A;  4H7Y A;  3MKR A;  4B94 A;  4K03 A;  4R7L A;  4GAA A;  3L54 A;  4NAC A;  2AWI A;  3LS8 A;  4XX5 A;  2XQ0 A;  1E8Y A;  4DI3 A;  3PE3 A;  4FLB A;  2JEK A;  2C0M A;  3BG1 B;  3CVL A;  1U3D A;  2I1J A;  2QFC A;  4I17 A;  4F3V A;  5LX8 A;  1A17 A;  2YHC A;  3FH7 A;  1E90 A;  5JHB A;  2PZI A;  4BWR A;  5G05 C;  5BV0 A;  4G25 A;  3RO3 A;  3FU5 A;  3APF A;  2IQC A;  4JZY A;  3RU0 A;  4KXK B;  4GA0 A;  1E8W A;  1PC2 A;  2LNI A;  3HIZ A;  3T5X A;  3SFZ A;  3CHP A;  3D9N A;  4WWN A;  2UWJ G;  4KVM A;  4MRU A;  4U0Z A;  3FY4 A;  4EPZ A;  3SBS A;  2AXV A;  4GCN A;  2WXL A;  3CHQ A;  3B7R L;  3FTW A;  3SZ7 A;  4GPK A;  4I1O B;  3LYA A;  1ELW A;  3FH5 A;  4FJY A;  2VGY A;  3HVE B;  3PRE A;  4NUR A;  2CFZ A;  2IFU A;  1NZN A;  4CCA A;  3P2B A;  1OWP A;  3CQC B;  1DVP A;  2BTD A;  4I6E A;  3R7R A;  1SZA A;  2J08 A;  1E7V A;  4C9B B;  1H6K A;  3CSF A;  3L13 A;  3PNL B;  5KJM A;  4NQ0 A;  3B7T A;  4A1G A;  2XCB A;  1KLX A;  3FUL A;  1JWF A;  3FEX A;  2RG8 A;  2XGM A;  4GZ6 A;  1SZ9 A;  5E75 A;  3RKV A;  5EX3 A;  3FDH A;  4N2S A;  3ASG A;  3CKB A;  5LP0 A;  5JHA A;  4B0Z A;  3SNX A;  4B8C B;  1WM5 A;  2Y3A A;  2AW6 A;  3FTV A;  4DPR A;  3UT4 A;  1HU3 A;  5EX0 A;  1HZ4 A;  4IUL A;  4Q96 A;  3B7U X;  3FUI A;  3QDN A;  3B7S A;  3AU4 A;  3MX3 A;  4GA2 A;  4ILG A;  3Q15 A;  5M72 A;  4I1M A;  1HE8 A;  4U04 A;  1E8X A;  5CCL A;  2X6J A;  3LY8 A;  3UX4 A;  2DBA A;  2LAH A;  4I9C A;  5EDS A;  2XHE A;  3LVQ E;  1HS6 A;  5AIJ A;  4BTA A;  4FHK A;  2C2L A;  2XEV A;  5KCM A;  4AY5 A;  5BW8 C;  1QQE A;  5LOZ A;  3QWV A;  4Y6C A;  2J09 A;  4FUL A;  4BX9 A;  3FWV A;  3N71 A;  2WQH A;  3AS4 A;  3MCX A;  4BFR A;  4AXH A;  3U66 A;  1TEZ A;  4JA7 A;  4A55 A;  4FP7 A;  4CT0 A;  4ACK A;  4GCO A;  2FUL A;  5ARG A;  3TJP A;  3FUH A;  3CVU A;  5JJT A;  3PZD A;  4YND A;  5FZR A;  4ILI A;  4Q69 A;  1IQU A;  2R17 C;  1S0P A;  4J8D A;  5ANL A;  4LEU A;  4N39 A;  2FEZ A;  5FTP A;  3SD5 A;  3TXM A;  2HR2 A;  5BNW A;  3TGO A;  5KJN A;  3S7F A;  4OVU A;  1IQR A;  2NSZ A;  1IYG A;  3KAE A;  3D9I A;  4O6F A;  4K0R A;  1FCH A;  1DNP A;  2AXU A;  2KCV A;  4GYW A;  2XGO A;  3PDN A;  4UI9 C;  2WVI A;  2GGF A;  1FVH A;  4WUY A;  3SHF A;  1ELR A;  1H2V C;  2CG2 A;  1PAQ A;  3FU3 A;  4V3I A;  2A4Z A;  3APC A;  4WWP A;  2XPY A;  3IHV A;  3CST A;  4MLP A;  1ZU2 A;  5BUZ A;  1BPO A;  2J4B A;  4HFG A;  1TJC A;  4UQY A;  2KC7 A;  3VLE A;  5A6C A;  2WQ6 A;  1SQM A;  4ANU A;  1P5Q A;  2I6H A;  2X3M A;  3WXX A;  1HH8 A;  3FUD A;  4JEU A;  4TV3 A;  2FBN A;  3SGH A;  3ZHE B;  4HOU A;  1N54 A;  3FH8 A;  4ATG A;  3CIA A;  4KYO B;  4GML A;  4RSY A;  4IN3 B;  3JCK C;  5G55 A;  3QWP A;  2L6J A;  4GZ3 A;  1UJJ A;  3R9A B;  1FVF A;  4I2W A;  3LJ3 A;  4CEM A;  3D9J A;  3LCA A;  2CHZ A;  3ZYK A;  4B8A A;  2X38 A;  2J9Q A;  3MEK A;  3FP3 A;  4GA1 A;  2BF0 X;  3O48 A;  2WM9 A;  1OWO A;  2Q7F A;  2YNQ A;  2WMN A;  2FF4 A;  3ML9 A;  4ABN A;  3LXU X;  4YVQ C;  2LSU A;  3K9I A;  1TJF A;  2NXP A;  4XIF A;  4ACL A;  1HX8 A;  2HM8 A;  2NC9 A;  4LER A;  2XCC A;  3MV2 B;  1OWN A;  2E0I A;  3CHS A;  3FTU A;  2WXP A;  4I6G A;  5FZQ A;  4EEC A;  3AS8 A;  1WY6 A;  3I4R B;  4L7T A;  4APF A;  3CGH A;  2PM7 A;  4UWF A;  1NA0 A;  1OWM A;  3ASD A;  2PL2 A;  3I3N A;  2XRY A;  4GB9 A;  4XKC A;  1L5J A;  2I1K A;  2L0I A;  3IHY A;  4U63 A;  4WWO A;  3ZGQ A;  3CV0 A;  4RG6 A;  2IF4 A;  5E76 A;  2PQN A;  3IBE A;  5CMY A;  2KZT B;  5G04 C;  4HLE A;  3MZL B;  3ZVV A;  3AU5 A;  4P29 A;  3HYM B;  2LAI A;  2VSY A;  3ONK A;  2J07 A;  3KEZ A;  3CK9 A;  4GZ5 A;  3S7D A;  2OOE A;  2X6K A;  3EDT B;  4KMO A;  4BT8 A;  4WNG A;  1MHQ A;  2HO1 A;  2MOW A;  3RO2 A;  4L1B A;  4JEH A;  3EHM A;  2CHX A;  3CEQ A;  2P58 C;  3IKO B;  3JQ1 A;  5FJY A;  3OAW A;  2I9C A;  4N3B A;  5FQ4 A;  3ULQ A;  4JPS A;  3VLD A;  3T5V A;  3CHO A;  5C2Y A;  5AYW D;  4XE0 A;  4CDN A;  3QOU A;  1JUQ A;  2VYI A;  2WPV A;  3NQP A;  1XNF A;  4ME2 A;  4Q94 A;  3UT7 A;  4DLO A;  5LCW C;  2A5U A;  3CHR A;  2WXO A;  2E2E A;  3GZ1 A;  3HVE A;  3NZS A;  4EBA A;  1VDY A;  2X6F A;  4APO A;  5FQ6 A;  3PH0 C;  3Q49 B;  4I43 A;  5G04 J;  4CDM A;  3ZIM A;  5JJ7 A;  4A3T A;  2L9B A;  3L08 A;  1UW4 B;  2C0L A;  5AJD A;  3MKQ A;  3CVX A;  3Q5M A;  4GZC A;  3ZW3 A;  3QC1 A;  3RRM B;  5JJ6 A;  3FTS A;  4N3C A;  3ASF A;  3JUI A;  4AJW A;  1INZ A;  3EJN A;  4WNF A;  2LO6 A;  2VQ2 A;  2KCK A;  3DPD A;  1XGW A;  1X5B A;  3FTY A;  3QB2 A;  3QWW A;  4BX8 A;  3OXF A;  4JHJ A;  2WXJ A;  3RRN B;  4C0M A;  4JA9 A;  5ANR A;  5C1D A;  4HOR A;  4GZD A;  2OND A;  2R5S A;  3D9O A;  5FQ8 A;  3U64 A;  4F53 A;  2JLB A;  3JQ0 A;  5KJL A;  5LFA A;  1H0A A;  5BPP A;  2CFU A;  2YQ8 A;  4F1S A;  4QFV A;  2WXF A;  3S7J A;  4UWK A;  3EIJ A;  4U07 A;  4AOF A;  5EKQ D;  3Q47 B;  3CVQ A;  2VSX E;  4PH4 B;  1HFA A;  3CKC A;  2AXZ A;  4J6I A;  2WXI A;  3PRZ A;  3FUE A;  4G26 A;  3I5P A;  3ML8 A;  4PUC A;  4DK5 A;  3Q4A B;  4A3V A;  3D9P A;  2YIN A;  4LUN U;  4N2Q A;  3P1U A;  3LVR E;  2UY1 A;  4EQF A;  4HOT A;  3MYV A;  3PS6 A;  3G2V A;  5G05 J;  3FEY A;  3RIB A;  4WNE A;  2OVB A;  3QAR A;  1HG2 A;  3VLF A;  4EZJ A;  2L0T B;  2XRZ A;  3GZ2 A;  1YA0 A;  4J8F A;  3OXG A;  4AY6 A;  4UWL A;  5FWQ A;  1NP7 A;  4GYY A;  4LCT A;  4U0U A;  2WB2 A;  3LDZ A;  3OTN A;  4JC8 A;  3U4T A;  1E96 B;  4AP2 A;  2ION A;  2ZU6 B;  5DIZ A;  4KZC A;  3RK6 A;  3B13 A;  3MJW A;  2LSV A;  2J49 A;  4G1T A;  4BTB A;  3FFL A;  4MKT A;  3QNK A;  4KVO A;  4KBQ A;  3VTY A;  5BT1 A;  2GRL A;  3L16 A;  3G2W A;  3PNT B;  2Y4T A;  2J4D A;  1EYH A;  2QY7 A;  3I4G A;  3O4Z A;  4PS8 A;  4C0E A;  4CGV A;  3CVW A;  4G2V A;  2WXG A;  2OVF A;  4H7X A;  2EQX A;  2MHK A;  3LPZ A;  3U9W A;  2HYZ A;  3ZXS A;  3ZYM A;  4J0U A;  4B89 A;  4UQZ A;  4I2Z A;  3L22 A;  1LF8 A;  4HXI A;  4GU5 A;  4HOQ A;  3ZN3 A;  4CRW A;  1H2T C;  3G2U A;  4DI4 A;  3UMV A;  3CR3 A;  2UY1 B;  2WXK A;  4JW1 A;  4W9R A;  1UJK A;  4OVV A;  5FZS A;  3UQ3 A;  4ANX A;  4RVB A;  1EDU A;  2IJG X;  2XPZ A;  3G2T A;  3T8M A;  4KT6 B;  4JHR A;  3HHM A;  3R7Q A;  5D0O D;  3RRU A;  4L2L A;  4CT4 A;  4Y6W A;  4CGW A;  3ZHE A;  1UN9 A;  2V4L A;  5D0Q D;  1HO8 A;  5J08 A;  4J8E A;  4UWH A;  2AVP A;  1WAO 1;  1B89 A;  4U8H A;  5DBK A;  4HS2 A;  3TAX A;  4U0S A;  2XGS A;  3D9L A;  2FO7 A;  3CVN A;  4A1S A;  2OV8 A;  4AIF A;  2GW1 A;  1ZBP A;  2XPI A;  3L6A A;  3CLJ A;  4LRZ A;  3FUN A;  4FU3 A;  5AJL A;  3BEE A;  1ELK A;  3QKY A;  4RG9 A;  4BY6 A;  3FUJ A;  1Y6I A;  2CHW A;  4M3O A;  4JHK A;  3KD7 A;  4I1A A;  3LEW A;  4PS3 A;  2VGX B;  5T4Y A;  3RJV A;  3ASH A;  2Y4U A;  4NRH B;  3EHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...