2L9MA

Structure of ciap1 card
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
132
structure length
132
Chain Sequence
GSHMLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CARD-mediated autoinhibition of cIAP1's E3 ligase activity suppresses cell proliferation and migration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis inhibitor
molecule keywords Baculoviral IAP repeat-containing protein 2
total genus 24
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2l9mA00
1NGRA 1A1ZA 2YVIA 2M5VA 3T6PA 2N00A 4IZAB 3MOPK 2IB1A 4DWNA 4A2WA 3EZQA 4F42A 2OF5A 2OF5H 4D8OA 1E41A 1FADA 4N1JA 2GF5A 2N7ZA 4N1KA 4F44A 3J63A 3EZQB 4RHWA 1Z6TA 2G7RA 4P4HI 4A2QA 4M9XA 2A5YB 3MOPA 2KM6A 4I16A 2F1SA 2L6AA 3MOPG 4QOBA 1D2ZA 4UZ0A 4IZ5E 2B1WA 4O7QA 4P4HA 2YQFA 3J6JA 3KATA 2KN6A 2BBRA 2LWEA 4RHWE 2VGQA 4E9MA 2YGSA 1D2ZB 2LS7A 2DBGA 2HM2Q 2N97A 2A9IA 1WH4A 2N1FA 1WXPA 1UCPA 1A1WA 2N83A 4LWDA 1DDFA 1WMGA 2MB9A 4N1LA 4M9ZA 2NSNA 2YU0A 1ICHA 1N3KA 2LWDA 4M9SA 4O9FA 3CL3A 2MS7A 4JQWA 3LQQA 3QF2A 3YGSP 2MN4A 2BBZA 4O9LA 2D96A 3CRDA 4JUPA 4EWIA 1C15A 3YGSC 3LQRA 4ZBWA 2N80A 2DBHA 2NAQA 2MPCA 2DO9A 2O71A 1E3YA 4O6XA 4IZ7B 2DBDA 2DBFA 2L9MA 4FH0A 4NQKA 1PN5A 1YGOA 2P1HA 1DGNA 2NZ7A 1CWWA 1CY5A 2MS8A
chains in the Genus database with same CATH superfamily
1NGRA 1A1ZA 2YVIA 2M5VA 3T6PA 2N00A 4IZAB 3MOPK 2IB1A 2XV9A 4DWNA 4A2WA 3EZQA 4F42A 2OF5A 2OF5H 4D8OA 1E41A 1FADA 4N1JA 2GF5A 2N7ZA 4N1KA 4F44A 3J63A 3EZQB 4RHWA 1Z6TA 2G7RA 4P4HI 4A2QA 4M9XA 2A5YB 3MOPA 2KM6A 4I16A 2F1SA 2L6AA 3MOPG 4QOBA 1D2ZA 4UZ0A 4IZ5E 2B1WA 4O7QA 4P4HA 2YQFA 3J6JA 3KATA 2KN6A 2BBRA 2LWEA 2MJMA 4RHWE 2VGQA 4E9MA 2YGSA 1D2ZB 2LS7A 2DBGA 2HM2Q 2N97A 2A9IA 1WH4A 2N1FA 1WXPA 1UCPA 1A1WA 2N83A 4LWDA 1DDFA 1WMGA 2MB9A 4N1LA 4M9ZA 2NSNA 2YU0A 1ICHA 1N3KA 2LWDA 4M9SA 4O9FA 3CL3A 2MS7A 4JQWA 3LQQA 3QF2A 3YGSP 2MN4A 2BBZA 4O9LA 2D96A 3CRDA 4JUPA 4EWIA 1C15A 3YGSC 3LQRA 4ZBWA 2N80A 2DBHA 2NAQA 2MPCA 2DO9A 2O71A 1E3YA 4O6XA 4IZ7B 2DBDA 2DBFA 2L9MA 4FH0A 4NQKA 1PN5A 1YGOA 2P1HA 1DGNA 2NZ7A 1CWWA 1CY5A 2MS8A
chains in the Genus database with same CATH topology
1NGRA 1A1ZA 2YVIA 2M5VA 3T6PA 2N00A 4IZAB 3MOPK 2IB1A 2XV9A 4DWNA 4A2WA 3EZQA 4F42A 2OF5A 2OF5H 4D8OA 1E41A 1FADA 4N1JA 2GF5A 2N7ZA 4N1KA 4F44A 3J63A 3EZQB 4RHWA 1Z6TA 2G7RA 4P4HI 4A2QA 4M9XA 2A5YB 3MOPA 2KM6A 4I16A 2F1SA 2L6AA 3MOPG 4QOBA 1D2ZA 4UZ0A 4IZ5E 2B1WA 4O7QA 4P4HA 2YQFA 3J6JA 3KATA 2KN6A 2BBRA 2LWEA 2MJMA 4RHWE 2VGQA 4E9MA 2YGSA 1D2ZB 2LS7A 2DBGA 2HM2Q 2N97A 2A9IA 1WH4A 2N1FA 1WXPA 1UCPA 1A1WA 2N83A 4LWDA 1DDFA 1WMGA 2MB9A 4N1LA 4M9ZA 2NSNA 2YU0A 1ICHA 1N3KA 2LWDA 4M9SA 4O9FA 3CL3A 2MS7A 4JQWA 3LQQA 3QF2A 3YGSP 2MN4A 2BBZA 4O9LA 2D96A 3CRDA 4JUPA 4EWIA 1C15A 3YGSC 3LQRA 4ZBWA 2N80A 2DBHA 2NAQA 2MPCA 2DO9A 2O71A 1E3YA 4O6XA 4IZ7B 2DBDA 2DBFA 2L9MA 4FH0A 4NQKA 1PN5A 1YGOA 2P1HA 1DGNA 2NZ7A 1CWWA 1CY5A 2MS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGR A;  1A1Z A;  2YVI A;  2M5V A;  3T6P A;  2N00 A;  4IZA B;  3MOP K;  2IB1 A;  4DWN A;  4A2W A;  3EZQ A;  4F42 A;  2OF5 A;  2OF5 H;  4D8O A;  1E41 A;  1FAD A;  4N1J A;  2GF5 A;  2N7Z A;  4N1K A;  4F44 A;  3J63 A;  3EZQ B;  4RHW A;  1Z6T A;  2G7R A;  4P4H I;  4A2Q A;  4M9X A;  2A5Y B;  3MOP A;  2KM6 A;  4I16 A;  2F1S A;  2L6A A;  3MOP G;  4QOB A;  1D2Z A;  4UZ0 A;  4IZ5 E;  2B1W A;  4O7Q A;  4P4H A;  2YQF A;  3J6J A;  3KAT A;  2KN6 A;  2BBR A;  2LWE A;  4RHW E;  2VGQ A;  4E9M A;  2YGS A;  1D2Z B;  2LS7 A;  2DBG A;  2HM2 Q;  2N97 A;  2A9I A;  1WH4 A;  2N1F A;  1WXP A;  1UCP A;  1A1W A;  2N83 A;  4LWD A;  1DDF A;  1WMG A;  2MB9 A;  4N1L A;  4M9Z A;  2NSN A;  2YU0 A;  1ICH A;  1N3K A;  2LWD A;  4M9S A;  4O9F A;  3CL3 A;  2MS7 A;  4JQW A;  3LQQ A;  3QF2 A;  3YGS P;  2MN4 A;  2BBZ A;  4O9L A;  2D96 A;  3CRD A;  4JUP A;  4EWI A;  1C15 A;  3YGS C;  3LQR A;  4ZBW A;  2N80 A;  2DBH A;  2NAQ A;  2MPC A;  2DO9 A;  2O71 A;  1E3Y A;  4O6X A;  4IZ7 B;  2DBD A;  2DBF A;  2L9M A;  4FH0 A;  4NQK A;  1PN5 A;  1YGO A;  2P1H A;  1DGN A;  2NZ7 A;  1CWW A;  1CY5 A;  2MS8 A; 
#chains in the Genus database with same CATH topology
 1NGR A;  1A1Z A;  2YVI A;  2M5V A;  3T6P A;  2N00 A;  4IZA B;  3MOP K;  2IB1 A;  2XV9 A;  4DWN A;  4A2W A;  3EZQ A;  4F42 A;  2OF5 A;  2OF5 H;  4D8O A;  1E41 A;  1FAD A;  4N1J A;  2GF5 A;  2N7Z A;  4N1K A;  4F44 A;  3J63 A;  3EZQ B;  4RHW A;  1Z6T A;  2G7R A;  4P4H I;  4A2Q A;  4M9X A;  2A5Y B;  3MOP A;  2KM6 A;  4I16 A;  2F1S A;  2L6A A;  3MOP G;  4QOB A;  1D2Z A;  4UZ0 A;  4IZ5 E;  2B1W A;  4O7Q A;  4P4H A;  2YQF A;  3J6J A;  3KAT A;  2KN6 A;  2BBR A;  2LWE A;  2MJM A;  4RHW E;  2VGQ A;  4E9M A;  2YGS A;  1D2Z B;  2LS7 A;  2DBG A;  2HM2 Q;  2N97 A;  2A9I A;  1WH4 A;  2N1F A;  1WXP A;  1UCP A;  1A1W A;  2N83 A;  4LWD A;  1DDF A;  1WMG A;  2MB9 A;  4N1L A;  4M9Z A;  2NSN A;  2YU0 A;  1ICH A;  1N3K A;  2LWD A;  4M9S A;  4O9F A;  3CL3 A;  2MS7 A;  4JQW A;  3LQQ A;  3QF2 A;  3YGS P;  2MN4 A;  2BBZ A;  4O9L A;  2D96 A;  3CRD A;  4JUP A;  4EWI A;  1C15 A;  3YGS C;  3LQR A;  4ZBW A;  2N80 A;  2DBH A;  2NAQ A;  2MPC A;  2DO9 A;  2O71 A;  1E3Y A;  4O6X A;  4IZ7 B;  2DBD A;  2DBF A;  2L9M A;  4FH0 A;  4NQK A;  1PN5 A;  1YGO A;  2P1H A;  1DGN A;  2NZ7 A;  1CWW A;  1CY5 A;  2MS8 A; 
#chains in the Genus database with same CATH homology
 1NGR A;  1A1Z A;  2YVI A;  2M5V A;  3T6P A;  2N00 A;  4IZA B;  3MOP K;  2IB1 A;  2XV9 A;  4DWN A;  4A2W A;  3EZQ A;  4F42 A;  2OF5 A;  2OF5 H;  4D8O A;  1E41 A;  1FAD A;  4N1J A;  2GF5 A;  2N7Z A;  4N1K A;  4F44 A;  3J63 A;  3EZQ B;  4RHW A;  1Z6T A;  2G7R A;  4P4H I;  4A2Q A;  4M9X A;  2A5Y B;  3MOP A;  2KM6 A;  4I16 A;  2F1S A;  2L6A A;  3MOP G;  4QOB A;  1D2Z A;  4UZ0 A;  4IZ5 E;  2B1W A;  4O7Q A;  4P4H A;  2YQF A;  3J6J A;  3KAT A;  2KN6 A;  2BBR A;  2LWE A;  2MJM A;  4RHW E;  2VGQ A;  4E9M A;  2YGS A;  1D2Z B;  2LS7 A;  2DBG A;  2HM2 Q;  2N97 A;  2A9I A;  1WH4 A;  2N1F A;  1WXP A;  1UCP A;  1A1W A;  2N83 A;  4LWD A;  1DDF A;  1WMG A;  2MB9 A;  4N1L A;  4M9Z A;  2NSN A;  2YU0 A;  1ICH A;  1N3K A;  2LWD A;  4M9S A;  4O9F A;  3CL3 A;  2MS7 A;  4JQW A;  3LQQ A;  3QF2 A;  3YGS P;  2MN4 A;  2BBZ A;  4O9L A;  2D96 A;  3CRD A;  4JUP A;  4EWI A;  1C15 A;  3YGS C;  3LQR A;  4ZBW A;  2N80 A;  2DBH A;  2NAQ A;  2MPC A;  2DO9 A;  2O71 A;  1E3Y A;  4O6X A;  4IZ7 B;  2DBD A;  2DBF A;  2L9M A;  4FH0 A;  4NQK A;  1PN5 A;  1YGO A;  2P1H A;  1DGN A;  2NZ7 A;  1CWW A;  1CY5 A;  2MS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...