2L9VA

Nmr structure of the ff domain l24a mutant's folding transition state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
49
structure length
49
Chain Sequence
b'WNTKEEAKQAFKEALKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-processing factor 40 homolog A
molecule tags Rna binding protein
source organism Homo sapiens
publication title Nonnative interactions in the FF domain folding pathway from an atomic resolution structure of a sparsely populated intermediate: an NMR relaxation dispersion study.
pubmed doi rcsb
total genus 15
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2l9vA00
2JUCA 2KISA 2DODA 2KZGA 2L9VA 2LKSA 2CQNA 2K85A 4FQGA 2DOEA 2B7EA 2KFDA 1UZCA 2KIQA 2DOFA 2E71A
chains in the Genus database with same CATH superfamily
1Z0XA 3ZGKA 1FY7A 3DBRB 4RS8A 4IRIA 3CP8A 4AM3A 4A3IJ 2R7DA 2PMUA 4FISA 3W3CA 3QAHA 2JA6J 3PNTA 4ZYHA 3OYAA 3BTLA 3RYPA 1R1UA 2EBIA 4N9IA 3BQZA 4QWQA 4A3CJ 1D1BA 4RAZA 5DM7F 4BJTA 3FXKA 3MAJA 2E7WA 2DA4A 5LRRA 2PJRB 2IA2A 2IGMA 3ERED 1YX5A 3KP5A 1E17A 1RR8C 9ANTA 4LB6B 1OR7C 2PJRA 4CYDA 1ETWA 4F7ZA 2LSOA 3AG1H 2MLKA 1SVOA 2YX7A 3RPUD 4M6VA 4P5OA 5B3SH 1B72B 1IUYA 4U0VA 2FJ1A 2RN7A 2VBWA 5HDKA 2BXYA 2NOGA 2FRHA 1ZKGA 3QPLA 5D5VB 3V7SA 3KP3A 5EYRA 4E70A 3IKTA 2O9LA 4J00A 5EGOB 1GXPA 2XGEA 2KP6A 2KZGA 2W48A 2NXNB 1T6SA 1U9NA 4LLNA 1JI8A 5JLWA 2WA0A 4C30A 2R0QC 3GTJJ 2K02A 2F5DA 4BQQA 2LOOA 3WHCA 3SQNA 3JREA 2J5OA 4FTHA 5EG0A 4PSXA 3JRFA 4YRVA 3CC7I 3CLOA 2XRNA 4RAFA 1DPRA 1EV7A 2L54A 2DU9A 2XDVA 2MLGA 2LR8A 2K3PA 2PQ8A 3HKZN 1SEUA 2PX9A 3J7ZI 3U21A 2AS5F 2MSYA 2VJIA 3EUAA 3KE2A 3CCJI 1FJLA 3L2WA 5KAIC 3ZQFA 1GHCA 4E7IA 3HHHA 1J9IA 2H1LA 1U0JA 1JKRC 2R7OA 5BNGA 1IXSB 3TDUC 2VOPA 2IS6A 2NVQJ 1E3PA 2O0YA 1R1VA 2MD0A 5J8FA 5JI6A 1BM9A 3E5UA 2UUZA 4ZDLA 2NVUB 3CCSI 2Y48A 4FE7A 5D8KB 3E6DA 3OYKA 3FWEA 2XKOA 3HGGA 1DPUA 3H0GJ 2M7AA 3SZPA 3JW4A 3CC4I 1MBHA 3I55I 1JGSA 1WI3A 5ERIA 1UFMA 3SJMA 2XB0X 3WG7H 5D5UB 2JUGA 4RB0A 1XB4A 4L0YB 5J6XA 3ZXSA 2Z3YA 1X1CA 2FEZA 3LMMA 3G73A 1QBJA 3OYFA 2LK2A 5CQGA 1IDZA 1AHDP 1O3QA 2ADUA 3HTUA 2IAIA 1AA7A 4KIFA 4LG0A 3S3NA 1R5GA 1P7IA 2VBXA 3TBIA 3DTIA 4ZTFA 1LVKA 3G6EI 3PO3J 3TL4X 3OYMA 3U1DA 2W85A 1ZRDA 2M9HA 1A6IA 3AFHA 4G12A 2CFOA 2BY1A 3LSGA 5CVRA 4DBRA 2IXSA 3FMQA 4G6TB 2YX4A 3TQNA 4I2OA 1S7OA 1LEBA 3DWLE 1LB2A 4A3LJ 3K1MA 2KRFA 2Z99A 1QPIA 1ENHA 2IT0A 4QTRA 3TO9A 2VODA 5CLSA 3FHZA 4OAYA 2IA1A 1BA5A 2D1VA 4FASD 4HV5A 5FLVA 3V7RA 5CVUA 4L9TA 3W2WA 4WX9A 1JJ8C 3BG6A 4BBSJ 2XGXA 1KA8A 1D8JA 3PNVA 4UV9A 4RM3A 1TNTA 2KFDA 2H6BA 4CCNA 3A01A 3CCMI 2MABA 2DLLA 3FF5A 1MMSA 4MQ9F 2HXOA 2JJ7A 1JUPA 4JP0A 1FBUA 2AXTC 2LFBA 1RIOH 1GUUA 2HOSA 4ABZA 2JQ7A 1U5TB 2ELJA 2ZFWA 3QPSA 3M8FA 4A0YA 4RAGA 4I99C 2WADA 2BGCA 1X19A 3LSPA 2M8EA 2XPWA 3FXQA 5F1JA 4PGHA 1UMQA 5CVIA 5HLIA 3SEQA 3OL3A 3IAM2 5HLHA 4LJZF 4DOZA 1U2WA 1O4XA 3F8MA 5HODA 2XUBA 1JUMA 5EGOA 4X6AJ 1I5ZA 1MMDA 2ESHA 4EJUA 4OIQF 3E5QA 2O61A 1FMWA 2HGCA 3BTJA 5J8CA 4NQWA 3W2VA 2DOFA 2K4JA 2DMTA 4RGRA 1D8KA 2HFHA 2GXAA 2QSFX 3S15J 1TNSA 1XX5A 1IUFA 4CGZA 1G6NA 5H20A 1MJAA 4A69C 2COMA 4EM0B 4HG2A 2ICWG 4BHPA 1FX7A 2L4MA 5FJ8J 5L3GA 2DOEA 1LUJB 1JT0A 3MVPA 2L9RA 3SDGA 2PI0A 2ZFUA 3GZ5A 4HYEA 2BVMA 4CCKA 2IS2A 1T0FA 4AIHA 3CMEI 2W84A 4XOPA 1QHGA 2YS9A 3I58A 3TP3A 3HOXJ 3S17J 1HKQA 2XIGA 3FMSA 3K2AA 3NARA 1I6HJ 3WU1B 3BJAA 3K2ZA 3SFIA 3ZMZA 5C4XJ 1G3SA 2LKXA 1ZELA 2Z16A 4UXNA 4IOAF 3L09A 3EETA 3MMYB 2R7XA 3IRQA 5E1ZB 1PP7U 2GLOA 3BOQA 3CUQB 3K4LA 3P9IA 4DNCA 3LQRA 2M4GA 3LOCA 3BCAA 3H0DA 4A3FJ 3DU6A 3V8KA 3FXRA 3M9AA 2X4HA 3OR2C 1OCRH 2DW4A 2HPIA 3TOAA 1UG2A 2HEOA 3J81Z 1WCMJ 4AUXA 4A5NA 2VUMJ 4XRSA 2ZNZA 4BE2A 3OIPA 2L02A 4MNUA 2CQNA 3NWSA 4HLYA 1P4AA 4UVBA 5F0CA 2FNPA 2PG4A 1C0WA 1AOYA 4CYCA 3GYHX 3DTKA 3KEYA 5LHHA 2EFWA 4L9JA 2OU2A 1YHQI 2NNNA 1OJLA 2LP0A 1LQ1A 2ESNA 3DF8A 1BI2A 2DMNA 1KQ8A 4BE1A 3KYLA 2PJPA 1YRNA 2FQ4A 1P6RA 5CVVA 1T08B 5H6QA 1SANA 2XROA 4MEXF 2ZSHB 4AIDA 2HKXA 1JUSA 4Y7NJ 4V19K 2LG4A 1T0FC 3RCOA 2R7WA 4L9VA 3DKWA 3HSFA 3ECOA 2DDAA 2CRGA 4LB5A 4OIOF 4XRSG 4V2FA 2EZKA 3WGHA 2JK3A 3FBNB 3HPGA 4O6JA 2DODA 2EPFA 4I98B 4KIGA 2PFBA 2XF7A 2MYSA 4EGZA 2ZCWA 1E0EA 3M1CA 4KITB 2P6SA 1SD4A 3FXMA 4N9HA 3OOUA 1LVAA 4BXXJ 4RB2C 3CMYA 1U6GA 4AYBN 4MTDA 3OYDA 3O2PE 2Y9ZA 3ZMSA 1D5VA 4HX4A 2LBFB 5E20A 3F23A 4XKVA 2CUEA 4FCYA 4AD9A 1OISA 4I02A 4IQJA 4HF2A 1HKSA 2XV4S 2IP2A 4KDPA 2KISA 4WK8F 1RRJA 4XLHA 3F21A 3S2WA 5KVRA 1OCPA 3VSLA 1WJAA 2E5NA 1OFCX 3ESWB 4I0BA 3LNQA 1EA3A 3F3XA 3J81K 1UHMA 2JA8J 4C3HJ 3F6VA 1Y0NA 5K7ZA 2XB5A 3OIQA 3R4KA 3JSOA 4JYKA 3BQYA 2E1MC 3C2GA 4CZCA 2BBYA 4B48A 2X1DA 4L0ZB 4BQOA 1KU3A 1E2XA 4LMYA 2QBYB 3GCMA 1QQIA 2JRMA 3FK7A 1R49A 3K4MA 2H8WA 4CUGA 1UG0A 4IZZA 1FBSA 1I3QJ 1WI9A 4RLFA 1ZG3A 5E3MA 3JTHA 1BJZA 2CV0A 1T2KA 5DDGA 1G3TA 1W36D 2HDWA 4C9YA 3C7JA 3GVAA 4C2UA 3T5XA 3H5NA 4KT5C 1OMIA 1JKQC 4E6KG 3BG3A 3LFKA 3LA7A 5F27A 4L5EA 1SMYF 3P9KA 1TW2A 4UVCA 2OAZA 4B8XA 3WTUC 4CCJA 4HNUA 2HWVA 2PN6A 3J7AO 3OS2A 4HA8A 2OC6A 3Q3SA 4CHUA 2ECBA 5LHGA 2DBBA 4HSTA 2HS5A 1H89C 3BG7A 3GBGA 2MBFA 1IF1A 4M73A 2E60A 1UHWA 3L2QA 4LITA 2DYSH 4L5IA 3CJQB 2KL4A 1WPKA 4BXUA 1XS9A 2V1UA 2BE5F 2M0CA 1KQ9A 1ZN2A 2BV6A 1YTYA 1H8AC 1YS7A 1W5CC 2HYFA 3I5UA 1LDJA 1A36A 4Z2YA 3FK6A 1ZLKA 2JPBA 3G4SI 1O3TA 5ILVA 2MC3A 3JAMK 4ZTJA 3FMRA 5F0HA 5KHDA 3J7YJ 4AVPA 3LSRA 5LLQA 4KMUX 3T1BA 2ZXJA 3R0AA 5D8LB 4ANJA 4II2A 1BOAA 2QWWA 3F9KA 2P81A 4LLGF 3JRDA 2GA2A 4GYIA 4OWRB 2XF5A 2HQRA 2KMUA 1BW6A 2K9MA 2FA5A 2YPRA 3SXYA 1VQ7I 3BR0A 4XONA 1PVEA 1X2MA 1JTYA 1R5HA 1JT6A 3ZRGA 3Q0VA 1ULYA 2L7KA 4HF1A 1UHSA 3COAC 1I1SA 1UZCA 1KONA 3TO7A 1FP2A 2M3AA 2N8GA 1REPC 1TQPA 4D9JA 2R7UA 1HW2A 1B59A 3IH2A 3KYCB 4YIRX 1DUXC 4U87A 3T8TA 5E8IA 2GM4A 2W4SA 1X4OA 2E71A 4N0BA 1OYWA 3CUOA 2VJ4A 4Y3OA 2NVYJ 3O6BB 2M8GX 1GXQA 4C3IJ 2M2EA 3DV8A 3JCUC 2MW8A 3G1LA 2L0KA 5DTDA 1SVLA 3HOWJ 5JHFA 2QF7A 3BJOA 3GFMA 3CESA 4MFEA 4ASNA 5FRNA 2JA7J 3HYIA 1NK2P 1FZPB 2I5UA 3CDIA 3EYYA 3MEXA 3ABMH 1IN8A 3K4NA 2NS0A 1HDDC 4KNYA 1MBJA 1T8IA 1USTA 4IHYA 4Q4ZF 1W5TA 5FKKA 4AIKA 1GV2A 3OYBA 5KK1A 2P0WA 4I0AA 3VB2A 1KU2A 1Z3XA 1FOWA 3QOEA 4IF4A 4ZYEA 1RNLA 3E6BA 1GLNA 2VQCA 2KRCA 2BOLA 3GEZA 2R7SA 2A69F 2STWA 1HC8A 3I4NJ 4OOIA 5D4SA 2FD5A 3CCYA 3IRRA 2JSPA 3I53A 4JK1X 3KP7A 3GTLJ 4AYBA 2RV8A 2GOXB 1L3LA 3ELKA 3AG4H 4PFPA 1IRXA 5J40A 3MKWB 1GVJA 2O8XA 3S93A 2XHKA 2Y0SA 2CQQA 3OYJA 2NRAC 2AQEA 1MBGA 1RPWA 1TLHB 3ZQIA 2C6YA 1N25A 4P9FA 4A6DA 3WGGA 4M3DA 3EUHC 1G59A 3PQKA 1ETQA 4U7BA 3MKLA 3GX4X 1R5ID 3I0TA 3OOPA 2O03A 3TW6A 4B3XA 2HU9A 4WCGA 2Q2EA 3DFGA 2QZ8A 3KP4A 1J7KA 5L3EA 4XL9A 1GT0C 2ISZA 2QUFA 2LD5A 4KMFA 1DP7P 1EH7A 2E1NA 1B8IB 1IXRC 1RESA 2DXIA 2GBYA 1Y39A 5ICGA 2JN6A 5DV5A 4ZH4F 2JT1A 2RQQA 3CF2A 1OYYA 3VEPA 1PP8F 2KJBA 3WU0A 1TZLA 2KIQA 1AWCA 2ELHA 3RPUA 4B43A 1G3YA 1UAAA 2X48A 1J59A 1EJ9A 2XAGA 4XBFA 1W4MA 1KU9A 2KT0A 3IAS2 4M6YA 5DCMB 2CJJA 3HIFA 2Y75A 3IL2A 3PSFA 2L2OA 3MKZA 3S1MJ 5EEAA 4BY7J 4XLPF 1M1EB 5LGTA 1K4SA 2QVOA 3H9JA 1IW7F 2VL8A 2EFNA 1WJDA 2LRDA 2V6CA 3WGIA 1ITYA 3TKYA 4Z6YA 3CMAI 3HKZA 3SFZA 4ZJZA 1OPCA 4GRIA 4D7MA 5H2FC 1XG1A 2X1CA 3TMOA 1R23A 4A3JJ 2L5QA 2EZHA 5FB2A 1YJWI 3MKYB 3K4CA 2OA4A 5GPCA 2Y2ZA 4CSWA 3R60A 4Y33A 2VKEA 1R36A 2W1OA 3DP7A 5L3DA 1JTXA 3M4OJ 4Q47A 5IY5H 4GCVA 2L3DA 1U8BA 3K10A 5IYDJ 2HTJA 2B7EA 2DT7B 1NG7A 1WJEA 1EH6A 4GGGA 3OYGA 2KQRA 2A68F 5FKLA 2EIKH 3K69A 2L01A 5DUIA 2K9NA 2XKPA 2IGNA 4J19A 5LEJA 2GZWA 4N4OB 1MNMC 3HOUJ 1IG7A 2Q1ZB 3HUGB 3HRUA 2CS3A 1X3ZB 1MSEC 3HSRA 4KIBA 1QZEA 1B72A 3BZ6A 3W6KB 4NDLA 1IRZA 1TWAJ 3BR2A 2Z2SB 3V8LA 1W1WE 1O3SA 2HOAA 5LD2C 3LSIA 2FOWA 2K7LA 1FBQA 2MGQA 1G8XA 4UV8A 2W82A 4EJTA 2G7UA 2XPVA 1BIAA 3BZKA 3UNGC 2E2JJ 2CGPA 3JSPA 3WU2C 3GTOJ 3OL4A 1OQYA 1FOKA 1S7EA 4A0XA 1V5EA 1MMAA 3L2UA 4XRFA 1O3RA 5FLXK 1YJ9I 3C3WA 1BL0A 3F72A 1IV8A 2HKOA 5KCMA 2DPDA 2JTVA 2BEOA 4AVZA 3V4GA 1PUFB 4E7SA 1IJWC 3IWZA 3NRVA 3RIRA 3EDPA 1ZGAA 3AL0C 3RKYA 4UY8I 4IEJA 4QSHA 2EK5A 4NUBA 2KDZA 5D6FA 1QGPA 1DGRM 2NS7A 2X85A 2V79A 1ERDA 1VQNI 2EINH 5TRDA 1FTZA 1CF7A 3QYBA 4ESJA 4CA0A 3QPTA 1S7AA 3CJTB 2FE3A 4IHWA 4IVNA 1G2HA 1WJFA 3CD6I 4C3JJ 1VQ4I 3SHFA 2EZLA 4G7HF 2Z9OA 2LVSA 3VFZA 5AONA 2OUMA 1LFBA 5E17F 1F43A 2XGDA 1VF9A 3OYIA 1JHHA 4H4KC 3KLNA 4KISA 1XGMA 1MMNA 1XD7A 3CP2A 3WTZA 2QKLB 5FFXA 2DA1A 1I6XA 1V54H 1BC8C 1LE8A 2CV1A 1FWZA 1IC8A 3QPHA 3WODF 1YOVB 4JBAA 2DPUA 2FNAA 3F0CA 5ICCA 2ZC2A 4ENNA 3KFWX 1A35A 2BVLA 2QKMB 1UB9A 4YIFA 3OSFA 3TO6A 1JJ6C 2UZKA 4MEYF 1N77A 2NVTJ 3VDXA 5K1YA 4BXFA 1XSXA 2ZO4A 4XLAA 1Y8RB 3A0BC 4BAYA 4MTEA 3GFIA 2WAFA 4Y15A 3Q5FA 3PM1A 5LGUA 2VKHA 2E36A 2KIFA 2A6EF 1W7PA 4CDGA 1QHHD 2CQ7A 2YSRA 5BOXA 3A0HC 4M74A 3DU5A 3F6OA 2L7MP 5TGTA 3Q9SA 2JUCA 4BE0A 2D2WA 3REOA 2X9DA 3RYRA 3Q0UA 4PJNA 1D0YA 4XM3A 1SFOJ 3W2AA 4JX4A 3ML6A 1FOXA 3HL2A 2XAUA 2Y0MA 2QQAA 4B47A 4BQNA 2K85A 2E1MB 4A3GJ 1UELB 2W00A 4P1WA 2OV7A 2Q0OA 3GXOA 2XAHA 2VE9A 2DFIA 4R8HA 2HDCA 1O57A 1MIJA 3VYSB 4XOTA 1LPQA 1NH3A 1O7FA 3RJPA 4NBQA 3HOSA 2JA2A 1T33A 1ETKA 3D1NI 5DEQA 5J3LA 5J47A 5JHUA 2ZMEC 1A04A 4A3KJ 4DIQA 3GZ6A 2STTA 4Y52J 1XMAA 3WE3A 1ZR4A 3F22A 3C1DA 2VKDA 1X1PA 4XIDA 1MNDA 2W57A 2OZUA 4O3MA 3LL7A 5AIPA 5IP9J 2EFOA 1DGWY 4ZYGA 4ZZDA 5GTHC 4LOCA 4IHTA 1FEXA 1NK3P 2EV5A 1HF0A 2TRTA 3GF2A 2FOKA 3D0SA 4FQGA 2Y9YA 4U0WA 1W7PB 1X1DA 1LEAA 3K1NA 4XSXF 4EJWA 1K78B 1ZLJA 2R93J 2HXIA 5D6EA 3L7WA 4I09A 2EIJH 4M3EA 5DYMA 2GOMA 3VWBA 2K4BA 2B0LA 3D5RC 3KLOA 2TDXA 1QRYA 2LY2A 4NC8A 5BMZA 1WJ5A 3S1NJ 2ACJA 3L2RA 1T56A 3BWGA 1U8RA 3JTGA 3ULQB 1ONVA 2L7ZA 4G8XA 1P4WA 3H9QA 1AKHA 2H1KA 5LHIA 2OCCH 5J4YA 3TW7A 5BS6A 3CCEI 2M4KA 3BG5A 4EGYA 2E1CA 2Z1DA 1VQ6I 4BACA 2IPQX 3GMEA 3J80K 1HKTA 1J2XA 1ZGJA 3PNYA 4PSWA 4F92B 5GAEJ 3UR3C 5J4VA 1BI0A 5BQTA 2CMPA 1P2FA 2EJRA 2IEKA 2LF7A 3KCCA 2LNBA 2R7RA 2EILH 1JKOC 4H0EA 2Z5UA 3IC7A 4OAZA 3A4CA 2ID6A 2DN0A 2EQRA 5DUKA 5FD5A 3TOBA 3AAFA 2UWMA 2R5YB 3HJEA 2M30A 2G9WA 3BR1A 4JX5A 3CCLI 2JZYA 1TL8A 2RDPA 2E34A 1U9OA 5DD8A 4M9XA 1BJAA 2H27A 5J1YA 5H6RA 3CCVI 2R7FA 2DYRH 1LDKB 2Y30A 5F64A 3ZQQA 2KRHA 1RR7A 3LAPA 1V3FA 3TGNA 2OBPA 3R6SA 1VQOI 3CUQC 1BW5A 3FISA 2RC4A 2K9QA 3BPVA 3S3OA 1XC5A 2FSWA 4XK4A 1U5TA 3BT9A 2ZXWH 3OR1C 4E7KA 3MFKA 1HQCA 5F04A 1SFEA 2MH9A 3WHBA 4PK4A 5C4JJ 1VTNC 4LK0F 1MJ9A 3I3LA 2A61A 4HX8A 4LD5A 1ZQ3P 1NTCA 1SAUA 2XC7A 3OSGA 5TISC 1VQLI 2L4AA 3BY6A 2QM3A 4Q5SF 1FC3A 1VFCA 3P7NA 2QA4I 1PUEE 3S16J 3OS1A 2H94A 4RA2A 2CUFA 3K4JA 1TQIA 5M5XJ 1YITI 2WY8Q 2EA2A 5LGNA 2H6CA 3E0JB 4EM1A 4CXFA 1ON2A 5KAFC 4B4CA 2V9PA 5K5QA 3K0LA 3ABLH 2ZB9A 3H5RA 4LFUA 5ICFA 1RI7A 3LSJA 2X6YA 4ON0A 3FM3A 1DU6A 3JRAA 1X1BA 3CDLA 2YU9J 4R1HA 5DM6F 4X1EA 4G7ZF 5FKNA 2X6WA 1XSVA 3ERMA 4U7DA 2KIUA 5ILSA 4KN4X 2O8KA 1Z6TA 2FU4A 3UKGA 3B6CA 1VQ9I 1E3OC 4OIPF 3LQQA 3QWLA 1HSTA 1FPQA 2CH0A 2FXAA 4G6QA 3GUDA 2OQRA 2CWEA 3O8HA 3MZHA 5IT9Z 1R58A 4BGDA 1XGNA 4RB1A 3BROA 1U5TC 1MJBA 3KIOA 2BY2A 4HDVA 5JVGF 3MD2A 2FMYA 5IOZA 2DFFA 2R7TA 1Y56A 5B5EC 1EH8A 2VONA 2VT2A 3M8JA 1RUNA 3JRIA 2Z33A 4D5CA 4FT8A 2EFQA 3S32A 2FF4A 5JVTA 1AKHB 1ZREA 2QYOA 5EZHA 3VSKA 5D4RA 2VQGA 3QU3A 1R00A 2EA4A 1JGGA 3P5JA 2ZKZA 2K27A 6PAXA 3E6MA 5IP7J 2H09A 3BCBA 2VC1A 5M5YJ 1X2NA 4FX4A 3K4KA 5HOOA 3RZDJ 2GAUA 2CW7A 2R5YA 2X6OA 2CO5A 2IGOA 4RDUA 1LKXA 3RSNA 1X1AA 3QP5A 3LFUA 3NAUA 1D0ZA 4JX6A 1MW7A 2HQ5A 5FKOA 5D5WB 1ZHFA 3V7CA 2DDBA 1YG2A 4KFCA 1SC7A 3OYLA 1KGSA 1B6AA 1BOBA 3EUHA 2R5ZA 4IHXA 1F9NA 4XLCA 4EEFG 2NYXA 2X6XA 1X3WB 4EJVA 3M8EA 3F8BA 3MCZA 2VC0A 4F52A 2QENA 1T38A 4I01A 2DJNA 4NQWB 4EVIA 3G71I 1S8NA 3PFYA 4ZC3A 1FYMA 4B44A 2PLYA 1WQ2A 5IPAA 3ABKH 1B1BA 2LLKA 4D5FA 3CCQI 3IV5A 1SD7A 4KICA 4AWXB 2E1OA 2DA2A 2F5VA 5AIQA 4BJ6C 2D45A 4UUSB 3FKJA 4L18B 4RGSA 4DZJA 3ZQLA 3H36A 1R7JA 3SZGA 4MGRA 5F6FA 2WV1A 1Q1VA 1HBXG 2NNYA 1WJBA 2XAFA 1FP1D 2KZVA 2EZIA 3SZTA 1RUOA 2ZBKA 3IWFA 5FLMJ 4A5MA 2NAZA 1ON1A 2TCTA 3KZYA 4MIMA 2CG4A 4G6DA 1XCBA 2VQLA 2H8RA 1A5JA 3H9GA 3NQOA 3RPQA 4BY1J 3GTKJ 3ZMVA 3BC8A 3K70C 1Z1DA 4IHVA 2VN2A 5E1WA 3GTMJ 3FXJA 1B4AA 2MFZA 4AU7A 5HDGA 1D1AA 5GADJ 1K83J 2GXGA 3B02A 2EFPA 4E7LA 4ZYAA 1J0RA 2DK5A 2I10A 1IRGA 2KLOA 2ETHA 3HBLA 1Z67A 3QODA 5K5RA 4E7JA 2LKSA 5LFAA 4MO7A 4W1UA 1QO0D 1MDMA 2P5VA 1OCZH 2G0EA 2W24A 1P92A 2K9SA 1Y1WJ 2XPUA 3D5SC 1G3WA 2O6GE 1F36A 3JRGA 3GTPJ 1R4NB 3QQAA 3R0JA 5TJJA 1Q1HA 1IN7A 1KYZA 2QQ8A 1YW8A 2V1DA 2K3FA 1H9GA 1I3AA 3ZP5A 1HCRA 4U88A 3QYEA 4A0ZA 1S29A 5K7FA 3H3ZA 2DT5A 1K4TA 4G7OF 3IKVA 2DK8A 3RKWA 2V9KA 4LIUA 2MC4A 4E7ZA 1IN6A 5CQEA 2HVSA 3X2QH 3I59B 3H5AA 2RNJA 2XASA 2ECCA 2M45A 2OTJI 3QYFA 3F8CA 2VT3A 5E1XA 3A03A 1V55H 1Y6IA 2XAJA 1QZYA 4GYGA 1XPXA 3TDZC 3LAJA 3ZQCA 1BBYA 4BEHB 2F4IA 3ZQHA 1Z6RA 2V9VA 1HDPA 4IOCF 1TWCJ 2HOEA 2VI6A 5M3MJ 3KX2A 3H1CA 1R4MB 1MKMA 4A3BJ 4IL6C 2BXZA 4AIJA 3IH3A 3RQ4A 2OCEA 1XMKA 2WWYA 1ZG1A 2ELKA 3HSEA 4PGGA 4MLOA 2ZMEA 3FXLA 2NS8A 1A31A 1YO5C 2BW3A 4S0HB 3BTIA 4HSRA 4Y4RA 3QOPA 1HW1A 2Q2EB 4M9ZA 3PSIA 4II3A 5FGMA 1V4RA 3OIOA 3ZPLA 1PJRA 1F1ZA 2B63J 4WF2A 2Y31A 5ICEA 1MH4A 4BDZA 5FKMA 2PBIA 1XGSA 5B66C 5EEGA 4LG0B 1NHAA 2ZSIB 3LA2A 1IAWA 3WTYC 2F48A 1XDSA 4S04A 1STZA 2DAOA 1N78A 2QLZA 2DOAA 3S8PA 1FTTA 1QVUA 1USSA 5CYVA 2UXNA 1Z91A 5IYBJ 2OTLI 3TEDA 2MH2A 2F6CA 2OD5A 2BW3B 3K1PA 2KDOA 2IW5A 5B1BH 3ROUA 1VZ0A 4EQQA 2ZMEB 3BP8A 3CMMA 3CF5F 1PUFA 4PJMA 3ABUA 3HPHA 5HVQC 3WTXC 1D0XA 2M5WA 1W36C 1VI0A 2L9NA 2D1HA 3FXUA 3NEUA 3SDBA 3LSHA 1KZHA 1X4PA 4IPAA 1ZR2A 4EV0A 4RM2A 3WTVC 2DTRA 1OR7A 1W7PD 4CO8A 2V1XA 2WC2A 3IH4A 2HOTA 1LFPA 3JRHA 1RETA 3PL8A 5IT3A 2GQQA 4YG2F 4IX7A 2HNHA 3K6GA 4HAMA 1D3YA 3S2DJ 1BI3A 5E79C 2WB1A 2OF7A 3GTQJ 1ORKA 3F8NA 3HTSB 3MZYA 5DD4A 4M3BA 4HW0A 5J1RA 1ODDA 3FIWA 4KN7X 3SYTA 2HVRA 3PUBA 3OMYA 1UCRA 2A6TA 4YEJA 2RNGA 2E35A 3V42A 2RGVA 1WSUA 1Z05A 5E3LA 4XRMA 3OYEA 4ESBA 3JR9A 3VOEA 2VQHA 4PJJA 4YIIA 4B09A 4O5VA 3KEOA 1QPMA 2KHMA 3GZNB 2ZJPF 2IVMA 4BH9A 5HDNA 2HVQA 2K9LA 1Z7UA 5EDNA 1YYVA 2F4MB 1Y1VJ 2JA5J 3MZ8A 4XN0A 1MDMB 3EPZA 3P9CA 3GLXA 4F55A 3Q9VA 3H3VK 2IA0A 1YI2I 4PDKA 2HDDA 3JRBA 1H88C 3AKZA 3L2VA 1R1TA 1MZBA 4ZZLA 3G1OA 2HYJA 2QCOA 5GPAA 3DTEA 2PMZN 2PMZA 1S72I 5K7HA 2XSJC 3S1QJ 2DJIA 2VXDA 2DA6A 4KJZA 3HEFA 3CC2I 3H92A 1OKRA 2MA3A 4F3QA 2B9SA 1RC9A 3DBHB 4M3GA 2WY7Q 2HYGD 5GTIC 1K6YA 4RBOA 4WXDA 2LC2A 4MQVA 2Y0SN 3KZZA 4LGWA 4ENKA 1W0UA 4I76A 4IKFA 2V1NA 4CYCB 4KUMA 2R7VA 3MWMA 2CW0F 1POGA 5DCFA 4XLFA 4GXOA 2E5ZA 3RDIA 1PYVA 2DMQA 4HF0A 3RI4A 2P5LC 4UUSA 1MBKA 4PCQA 1ZAOA 5IP6A 4W97A 2XSDC 4QPQA 3DPUA 1B9NA 1SAXA 3PIOF 1SD5A 3CTAA 4HNTA 1UJ8A 4C2MJ 4IO9F 2A3SA 2DFEA 4IXAA 2MG4A 4XLNF 1MBEA 1I50J 2DQLA 2DCEA 5HNFA 4XKWA 2BHZA 4G94A 3SEZA 1W0TA 1N75A 3I4MJ 2LKPA 3L00A 5FFZA 1U3EM 3T0YA 2F5FA 3CDHA 1YS6A 2HPMA 1AU7A 1WVRA 1TQMA 5FROA 1YX3A 3ZN1A 2XAQA 2COBA 3HC7A 4XLEA 4D1QA 5L3FA 2VJ5A 1TP4A 1JKPC 5F0FA 2Q8KA 3C18A 1LE8B 3AG3H 4BQAA 3LSTA 3C2BA 2IGKA 2F2EA 4DYCA 3JRCA 3ZCOA 4P55A 3PIPF 5CJ9A 2DQRA 5J1UA 3L9FA 1MBFA 4UHTA 4DW6A 2YU3A 3VYRB 3FX3A 4OINF 1Z77A 2BYVE 4BNCA 3A2KA 2W7NA 4EJOA 2XF6A 4A6EA 2P5KA 4QIWN 2E2IJ 2X51A 2ZJQF 2DA7A 2LREA 3CLQA 2M34A 2ZNYA 3DPLC 1VQMI 4XKCA 4LLLA 2M0MA 1ETVA 3G1MA 1T95A 1QU3A 4HLXA 3RTRA 2FMLA 3OS0A 2BHYA 3GW2A 1YRNB 5HS7A 1ZG5A 5ILUA 4JOMA 1H0MA 3FZVA 4ITVA 5K5OA 1ETXA 1YIOA 2VKVA 2VB6A 1K79A 2E2HJ 3MQ0A 2LYCA 1ETOA 4MFDA 4NB5A 2QGUA 1FIAA 1X58A 3RKQA 1K6OA 3HB9A 2XVCA 1ETYA 1Y0UA 3OYCA 5IOYA 5CKTA 2L9VA 2WTEA 3O8GA 1HW5A 4RMNA 2WAQN 1RKTA 2P6TA 1I27A 4F91B 4HQEA 4E4HA 1B9MA 3QP6A 3CO6C 2FX0A 2JVGA 3M1EA 3CJNA 2GXBA 2QQ9A 2O7OA 3VODA 2DI3A 1SVMA 2JRTA 3CO7C 4XMYA 2EV6A 2LH9A 4ZDOA 2VLAA 1YFHA 3HOZJ 3HRMA 4IRGA 2WV0A 1KQ0A 4PUSA 1J75A 4BHBA 1VQ8I 3ECHA 1Z3YA 1IXCA 4EATA 1FIPA 4HZFA 2AXLA 3AG2H 3J7AY 4CCLA 4XSZF 1WGXA 2RREA 2R5ZB 3PUFA 3IUOA 4DGWB 2LY1A 2GIVA 2EWNA 4M6XA 4GDFA 5HS9A 2CFXA 3U9GA 4L5JA 1G4DA 1W5SA 3GLLA 1KU7A 1VNDA 4Y17A 2KIMA 1OCTC 2FBHA 3I4PA 2FUG2 2YUSA 3GFLA 3LSKA 1HOMA 3M3YJ 1HA8A 1ZH5A 4NC6A 3DLAA 5FLXZ 3BLYA 4FE4A 1I39A 1LJ9A 1O7LA 1FSEA 3RKXA 2F4OB 3BPXA 2HZTA 4CH7A 1I1GA 2ME0A 3I64A 1XSDA 3IHUA 1WFXA 4HV6A 3VPRA 1S9HA 3TP0A 4LIVA 1TWGJ 3ONQA 4BYYA 1DDNA 1MGTA 1IZ1A 1HLVA 4HBLA 2VBZA 4ENJA 3HRTA 4J01A 2O5RA 2VASA 4M71A 2A5WA 1Y8QB 2QQBA 5JFRA 3BZCA 4DYRA 2VXZA 3DKYA 5CVJA 3G3ZA 1A6QA 3CQZJ 3BG9A 1TWFJ 4XR6A 1B8IA 5F1RA 2K86A 2CSOA 2OQGA 1FMVA 2CQXA 3HOYJ 3V8JA 2GIZA 3M07A 1KYWA 2VE8A 3GWZA 1OCCH 1YE9A 2A6HF 4RGXA 4BS9A 2XRLA 2V6EA 4RAYA 1PDNC 4V2GA 5BPDA 5KNLA 1D5YA 3L1PA 2GWRA 3FKIJ 1TW3A 4OMYA 4X0GA 1WZ2A 3I71A 4CZZA 1S6LA 3KYDB 1MNEA 2V26A 1S5LC 3FXOA 5E8GA 5IT9K 2LF8A 4G9YA 4UUVA 2IS1A 1TWHJ 4A93J 3HG9A 4GFBA 2WB1N 4GO1A 3QU6A 3AL0B 2VOOA 3HXLA 1FT9A 4XQFA 3H35A 1WWXA 4CCMA 3K70D 1L0OC 2V7FA 2EH3A 4QLCU 3DBLB 3HM5A 3OYNA 1ZRFA 4HOBA 4CCOA 2HQNA 1R9TJ 2CW8A 3N4MA 2LDUA 1XGOA 1FSHA 2BY3A 4HQMA 3WTSC 2K40A 1WH7A 3ZQ7A 3S3MA 4K2EA 1Z9CA 3E97A 4PJLA 3KPHA 1MMGA 3LWFA 3ASOH 3LSMA 5HLGA 1LNWA 5LRSA 4Q48A 2LY9A 2NOJB 3CCUI 4R79A 5HNHA 1OCOH 4WXCA 2QSGX 1GDTA 3DEWA 5IYCJ 2JMWA 2FBKA 2EB7A 5E3NA 4ENMA 4C2TA 3DEEA 1BR1A 2YR2A 4M9SA 3PQJA 3KZIC 5GP9A 4P9UA 1SFUA 5FRMA 3ISPA 1WJCA 2ZJ2A 3GO5A 5D5XB 1R22A 1BC7C 3WG9A 1VQKI 4A2UA 3I9V2 2NVXJ 1WKMA 3W6VA 1FLIA 3DQVC 4KA4A 1SD6A 2CQKA 1SFXA 4HEA2 2OPTA 3M7GA 1JXSA 1IO2A 3ZOBA 3F8FA 1J5YA 1IGNA 4LK1F 2R7QA 1GV5A 4BU2A 3G2BA 2VJJA 2PEXA 4TV7A 2DMPA 3CJRB 4N4NB 4UVAA 2R92J 2DT6A 4FHTA 2RKHA 2E19A 5EZGA 3NWTA 2W25A 4RLQA 3DCFA 4NC7A 4B1RA 2KPMA 2ZXIA 4HDUA 1ZK8A 3WTTC 3FHNA 2ZJRF 1IN5A 2A05A 2KKOA 2L9SA 4HPQA 1T39A 5F08A 1CF7B 1JHFA 2CU7A 1BN5A 2RQPA 2X1EA 4JQFA 3KETA 4XORA 3T8RA 1XDUA 3BDDA 4WWCA 1CQTA 3ZR8X 3S14J 1DQUA 2JPCA 2A07F 5GAGJ 3DPTA 3JAMZ 2UV1A 1MD0A 1WH5A 3L2CA 3HOTA 1E3HA 1YJNI 1FOYA 3GFJA 1LFUP 2WAEA 1OYIA 1MSFC 2DO7A 4DYQA 1H9TA 4OU0A 3OV8A 4OMZA 4D7NA 4A3DJ 3FBIB 2IRFG 2KJCA 4XNFA 5B1AH 3OWTA 1QZZA 2M1BA 4F93B 1GVDA 4M3FA 4ZYDA 1U78A 3KP6A 4E7HA 4YFNF 5ED4A 3J80Z 1YLFA 3HGYA 3DXJF 4I7HA 2JSCA 4XN3A 1IV6A 1WRJA 4EMSA 2JVHA 4IHSA 2E7XA 1FYLA 2P4WA 5C44J 1LDDA 1R6RA 1P9QC 2VPLA 2WBMA 3BR5A 2CV2A 3HDDA 3RQIA 4FX0A 3K7AJ 1TC3C 1SFKA 3K9TA 1K78A 1MH3A 2G7HA 4ETSA 4ZDPA 5LEKA 1YIJI 1VQPI 5JLXA 2CUJA 3ZN0A 1FNNA 1IRFA 4AC0A 1EKEA 3I54A 3D5LA 5E18F 3OY9A 3BTCA 2IJLA 1ZTRA 3EUKL 1DU0A 3K4BA 2WAQA 3ZMUA 3KP2A 2MD5A 3PJRA 2ME6A 2Y69H 5HLTA 4A12A 4UUTA 2GA1A 2DMUA 1QA6A 1V5FA 3Q0WA 3R61A 4UB6C 1WHUA 2CUZA 2IS4A 1BI1A 3U1KA 5A2QZ 4NHJA 4XICA 2I8DA 1YQAA 2K5CA 3A1YA 4PJ0C 4DJAA 1Z21A 1ZGWA 1YW9A 3ZQGA 3DLLF 2X0LA 5DS9A 2RAEA 3HRSA 4WXHA 3E5XA 2AO9A 3HUGA 1Z7LA 3N05A 4DBQA 5FD6A 1FYKA 3HZJA 5FO5A 4HRIA 4A3EJ 1S3JA 1RKWA 3E3VA 2HTSA 3W6JB 3E7LA 5E3OA 2L7FP 3DKXA 3A01B 1ZARA 3VYUB 3CCRI 3OYHA 1ACIA 1NG6A 5EG0B 4DZPA 1IDYA 4ESFA 1CGPA 5GAHJ 1XN7A 2IBDA 5M5WJ 5LBQA 2HI3A 5HS8A 4BL0B 2DFHA 3H3UA 1XTAA 2ISYA 2P8TA 4DQ2A 2F5CA 4HX7A 2A5YB 3HOVJ 2RVCA 4D0PA 1X3UA 5A2QK 1TBXA 2LBFA 4HNVA 1VQ5I 1R71A 3DEUA 2CYYA 4PZJA 2VIXA 4BHCA 1F5TA 4BBRJ 4MHGA 4RB3C 1TT0A 2VBYA 2PMHA 1YW7A 2DA3A 1HXDA 1T98A 2M87A 3O3KA 1K7AA 3BJ6A 1F4KA 1BR2A 3E1SA 1BR4A 2O3FA 5DCMA 1J09A 2OJED 4BKXA 4PFOA 4YFKF 3N97A 4RGUA 3CZ6A 3S1RJ 1K61A 4KT6A 2FBIA 5JR3A 5BPIA 3RZOJ 4S05A 3EQLF 3B73A 1DP3A 1IN4A 4OIRF 2BY0A 3E6CC 4U0YA 5EJCA 1SMTA 4YELA 4BDYA 2QBYA 1JE8A 3VYTB 2AHQA 1ZRCA 3BR3A 1ZYRF 4M72A 5L3CA 2HZDA 3BR6A 4XKBA 1APLC 3S2HJ 3MN2A 4CICA 4YFXF 2M7BA 5C3EJ 4IRHA 2EIMH 3B6AA 3WTWC 5CPRB 4NNJA 3ZMTA 3PO2J 3KEQA 4BUPA 1EF4A 2XGCA 1D1CA 2FQ3A 2VPRA 3C2HA 1HSJA 1P7JA 2JWTA 2ID3A 2J5PA 2ZXHA 4BJ5C 1P4XA 2EV0A 2R3SA 3PFIA 4LG3A 4BEHA 3I56I 2D5VA 4EM2A 4B3AA 2LMDA 2R4GA 3U2RA 2AQFA 2HQAA 2HR3A 4IJAA 2R7ZJ 3LA3A 3FDYA 2F5EA 3A02A 2LTPA 3ASNH 3I59A 5EEHA 2V4JC 5EF6A 4A3MJ 1QVTA 2QEXI 2QSHX 3FM5A 2OZ6A 1QNTA 2DTZA 4UNOA 2DA5A 4FETA 5M3FJ 4Y13A 1V5GA 3IP4B 3ZMDA 1XMXA 5L3BA 2P7CB 4IQ4A 4I6ZA 3HHGA 2BZTA 4P96A 1OLTA 3WE2A 4KYWA 4QPOA 1XCVA 3CUQA 1TTYA 4L9NA 4UB8C 3QRFF 3GTGJ 1RZ4A 1BIBA 3EYIA 2P7VB 3ABTA 2UXXA 1TT5B
chains in the Genus database with same CATH topology
2JUCA 2KISA 2DODA 2KZGA 2L9VA 2LKSA 2CQNA 2K85A 4FQGA 2DOEA 2B7EA 2KFDA 1UZCA 2KIQA 2DOFA 2E71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUC A;  2KIS A;  2DOD A;  2KZG A;  2L9V A;  2LKS A;  2CQN A;  2K85 A;  4FQG A;  2DOE A;  2B7E A;  2KFD A;  1UZC A;  2KIQ A;  2DOF A;  2E71 A; 
#chains in the Genus database with same CATH topology
 1Z0X A;  3ZGK A;  1FY7 A;  3DBR B;  4RS8 A;  4IRI A;  3CP8 A;  4AM3 A;  4A3I J;  2R7D A;  2PMU A;  4FIS A;  3W3C A;  3QAH A;  2JA6 J;  3PNT A;  4ZYH A;  3OYA A;  3BTL A;  3RYP A;  1R1U A;  2EBI A;  4N9I A;  3BQZ A;  4QWQ A;  4A3C J;  1D1B A;  4RAZ A;  5DM7 F;  4BJT A;  3FXK A;  3MAJ A;  2E7W A;  2DA4 A;  5LRR A;  2PJR B;  2IA2 A;  2IGM A;  3ERE D;  1YX5 A;  3KP5 A;  1E17 A;  1RR8 C;  9ANT A;  4LB6 B;  1OR7 C;  2PJR A;  4CYD A;  1ETW A;  4F7Z A;  2LSO A;  3AG1 H;  2MLK A;  1SVO A;  2YX7 A;  3RPU D;  4M6V A;  4P5O A;  5B3S H;  1B72 B;  1IUY A;  4U0V A;  2FJ1 A;  2RN7 A;  2VBW A;  5HDK A;  2BXY A;  2NOG A;  2FRH A;  1ZKG A;  3QPL A;  5D5V B;  3V7S A;  3KP3 A;  5EYR A;  4E70 A;  3IKT A;  2O9L A;  4J00 A;  5EGO B;  1GXP A;  2XGE A;  2KP6 A;  2KZG A;  2W48 A;  2NXN B;  1T6S A;  1U9N A;  4LLN A;  1JI8 A;  5JLW A;  2WA0 A;  4C30 A;  2R0Q C;  3GTJ J;  2K02 A;  2F5D A;  4BQQ A;  2LOO A;  3WHC A;  3SQN A;  3JRE A;  2J5O A;  4FTH A;  5EG0 A;  4PSX A;  3JRF A;  4YRV A;  3CC7 I;  3CLO A;  2XRN A;  4RAF A;  1DPR A;  1EV7 A;  2L54 A;  2DU9 A;  2XDV A;  2MLG A;  2LR8 A;  2K3P A;  2PQ8 A;  3HKZ N;  1SEU A;  2PX9 A;  3J7Z I;  3U21 A;  2AS5 F;  2MSY A;  2VJI A;  3EUA A;  3KE2 A;  3CCJ I;  1FJL A;  3L2W A;  5KAI C;  3ZQF A;  1GHC A;  4E7I A;  3HHH A;  1J9I A;  2H1L A;  1U0J A;  1JKR C;  2R7O A;  5BNG A;  1IXS B;  3TDU C;  2VOP A;  2IS6 A;  2NVQ J;  1E3P A;  2O0Y A;  1R1V A;  2MD0 A;  5J8F A;  5JI6 A;  1BM9 A;  3E5U A;  2UUZ A;  4ZDL A;  2NVU B;  3CCS I;  2Y48 A;  4FE7 A;  5D8K B;  3E6D A;  3OYK A;  3FWE A;  2XKO A;  3HGG A;  1DPU A;  3H0G J;  2M7A A;  3SZP A;  3JW4 A;  3CC4 I;  1MBH A;  3I55 I;  1JGS A;  1WI3 A;  5ERI A;  1UFM A;  3SJM A;  2XB0 X;  3WG7 H;  5D5U B;  2JUG A;  4RB0 A;  1XB4 A;  4L0Y B;  5J6X A;  3ZXS A;  2Z3Y A;  1X1C A;  2FEZ A;  3LMM A;  3G73 A;  1QBJ A;  3OYF A;  2LK2 A;  5CQG A;  1IDZ A;  1AHD P;  1O3Q A;  2ADU A;  3HTU A;  2IAI A;  1AA7 A;  4KIF A;  4LG0 A;  3S3N A;  1R5G A;  1P7I A;  2VBX A;  3TBI A;  3DTI A;  4ZTF A;  1LVK A;  3G6E I;  3PO3 J;  3TL4 X;  3OYM A;  3U1D A;  2W85 A;  1ZRD A;  2M9H A;  1A6I A;  3AFH A;  4G12 A;  2CFO A;  2BY1 A;  3LSG A;  5CVR A;  4DBR A;  2IXS A;  3FMQ A;  4G6T B;  2YX4 A;  3TQN A;  4I2O A;  1S7O A;  1LEB A;  3DWL E;  1LB2 A;  4A3L J;  3K1M A;  2KRF A;  2Z99 A;  1QPI A;  1ENH A;  2IT0 A;  4QTR A;  3TO9 A;  2VOD A;  5CLS A;  3FHZ A;  4OAY A;  2IA1 A;  1BA5 A;  2D1V A;  4FAS D;  4HV5 A;  5FLV A;  3V7R A;  5CVU A;  4L9T A;  3W2W A;  4WX9 A;  1JJ8 C;  3BG6 A;  4BBS J;  2XGX A;  1KA8 A;  1D8J A;  3PNV A;  4UV9 A;  4RM3 A;  1TNT A;  2KFD A;  2H6B A;  4CCN A;  3A01 A;  3CCM I;  2MAB A;  2DLL A;  3FF5 A;  1MMS A;  4MQ9 F;  2HXO A;  2JJ7 A;  1JUP A;  4JP0 A;  1FBU A;  2AXT C;  2LFB A;  1RIO H;  1GUU A;  2HOS A;  4ABZ A;  2JQ7 A;  1U5T B;  2ELJ A;  2ZFW A;  3QPS A;  3M8F A;  4A0Y A;  4RAG A;  4I99 C;  2WAD A;  2BGC A;  1X19 A;  3LSP A;  2M8E A;  2XPW A;  3FXQ A;  5F1J A;  4PGH A;  1UMQ A;  5CVI A;  5HLI A;  3SEQ A;  3OL3 A;  3IAM 2;  5HLH A;  4LJZ F;  4DOZ A;  1U2W A;  1O4X A;  3F8M A;  5HOD A;  2XUB A;  1JUM A;  5EGO A;  4X6A J;  1I5Z A;  1MMD A;  2ESH A;  4EJU A;  4OIQ F;  3E5Q A;  2O61 A;  1FMW A;  2HGC A;  3BTJ A;  5J8C A;  4NQW A;  3W2V A;  2DOF A;  2K4J A;  2DMT A;  4RGR A;  1D8K A;  2HFH A;  2GXA A;  2QSF X;  3S15 J;  1TNS A;  1XX5 A;  1IUF A;  4CGZ A;  1G6N A;  5H20 A;  1MJA A;  4A69 C;  2COM A;  4EM0 B;  4HG2 A;  2ICW G;  4BHP A;  1FX7 A;  2L4M A;  5FJ8 J;  5L3G A;  2DOE A;  1LUJ B;  1JT0 A;  3MVP A;  2L9R A;  3SDG A;  2PI0 A;  2ZFU A;  3GZ5 A;  4HYE A;  2BVM A;  4CCK A;  2IS2 A;  1T0F A;  4AIH A;  3CME I;  2W84 A;  4XOP A;  1QHG A;  2YS9 A;  3I58 A;  3TP3 A;  3HOX J;  3S17 J;  1HKQ A;  2XIG A;  3FMS A;  3K2A A;  3NAR A;  1I6H J;  3WU1 B;  3BJA A;  3K2Z A;  3SFI A;  3ZMZ A;  5C4X J;  1G3S A;  2LKX A;  1ZEL A;  2Z16 A;  4UXN A;  4IOA F;  3L09 A;  3EET A;  3MMY B;  2R7X A;  3IRQ A;  5E1Z B;  1PP7 U;  2GLO A;  3BOQ A;  3CUQ B;  3K4L A;  3P9I A;  4DNC A;  3LQR A;  2M4G A;  3LOC A;  3BCA A;  3H0D A;  4A3F J;  3DU6 A;  3V8K A;  3FXR A;  3M9A A;  2X4H A;  3OR2 C;  1OCR H;  2DW4 A;  2HPI A;  3TOA A;  1UG2 A;  2HEO A;  3J81 Z;  1WCM J;  4AUX A;  4A5N A;  2VUM J;  4XRS A;  2ZNZ A;  4BE2 A;  3OIP A;  2L02 A;  4MNU A;  2CQN A;  3NWS A;  4HLY A;  1P4A A;  4UVB A;  5F0C A;  2FNP A;  2PG4 A;  1C0W A;  1AOY A;  4CYC A;  3GYH X;  3DTK A;  3KEY A;  5LHH A;  2EFW A;  4L9J A;  2OU2 A;  1YHQ I;  2NNN A;  1OJL A;  2LP0 A;  1LQ1 A;  2ESN A;  3DF8 A;  1BI2 A;  2DMN A;  1KQ8 A;  4BE1 A;  3KYL A;  2PJP A;  1YRN A;  2FQ4 A;  1P6R A;  5CVV A;  1T08 B;  5H6Q A;  1SAN A;  2XRO A;  4MEX F;  2ZSH B;  4AID A;  2HKX A;  1JUS A;  4Y7N J;  4V19 K;  2LG4 A;  1T0F C;  3RCO A;  2R7W A;  4L9V A;  3DKW A;  3HSF A;  3ECO A;  2DDA A;  2CRG A;  4LB5 A;  4OIO F;  4XRS G;  4V2F A;  2EZK A;  3WGH A;  2JK3 A;  3FBN B;  3HPG A;  4O6J A;  2DOD A;  2EPF A;  4I98 B;  4KIG A;  2PFB A;  2XF7 A;  2MYS A;  4EGZ A;  2ZCW A;  1E0E A;  3M1C A;  4KIT B;  2P6S A;  1SD4 A;  3FXM A;  4N9H A;  3OOU A;  1LVA A;  4BXX J;  4RB2 C;  3CMY A;  1U6G A;  4AYB N;  4MTD A;  3OYD A;  3O2P E;  2Y9Z A;  3ZMS A;  1D5V A;  4HX4 A;  2LBF B;  5E20 A;  3F23 A;  4XKV A;  2CUE A;  4FCY A;  4AD9 A;  1OIS A;  4I02 A;  4IQJ A;  4HF2 A;  1HKS A;  2XV4 S;  2IP2 A;  4KDP A;  2KIS A;  4WK8 F;  1RRJ A;  4XLH A;  3F21 A;  3S2W A;  5KVR A;  1OCP A;  3VSL A;  1WJA A;  2E5N A;  1OFC X;  3ESW B;  4I0B A;  3LNQ A;  1EA3 A;  3F3X A;  3J81 K;  1UHM A;  2JA8 J;  4C3H J;  3F6V A;  1Y0N A;  5K7Z A;  2XB5 A;  3OIQ A;  3R4K A;  3JSO A;  4JYK A;  3BQY A;  2E1M C;  3C2G A;  4CZC A;  2BBY A;  4B48 A;  2X1D A;  4L0Z B;  4BQO A;  1KU3 A;  1E2X A;  4LMY A;  2QBY B;  3GCM A;  1QQI A;  2JRM A;  3FK7 A;  1R49 A;  3K4M A;  2H8W A;  4CUG A;  1UG0 A;  4IZZ A;  1FBS A;  1I3Q J;  1WI9 A;  4RLF A;  1ZG3 A;  5E3M A;  3JTH A;  1BJZ A;  2CV0 A;  1T2K A;  5DDG A;  1G3T A;  1W36 D;  2HDW A;  4C9Y A;  3C7J A;  3GVA A;  4C2U A;  3T5X A;  3H5N A;  4KT5 C;  1OMI A;  1JKQ C;  4E6K G;  3BG3 A;  3LFK A;  3LA7 A;  5F27 A;  4L5E A;  1SMY F;  3P9K A;  1TW2 A;  4UVC A;  2OAZ A;  4B8X A;  3WTU C;  4CCJ A;  4HNU A;  2HWV A;  2PN6 A;  3J7A O;  3OS2 A;  4HA8 A;  2OC6 A;  3Q3S A;  4CHU A;  2ECB A;  5LHG A;  2DBB A;  4HST A;  2HS5 A;  1H89 C;  3BG7 A;  3GBG A;  2MBF A;  1IF1 A;  4M73 A;  2E60 A;  1UHW A;  3L2Q A;  4LIT A;  2DYS H;  4L5I A;  3CJQ B;  2KL4 A;  1WPK A;  4BXU A;  1XS9 A;  2V1U A;  2BE5 F;  2M0C A;  1KQ9 A;  1ZN2 A;  2BV6 A;  1YTY A;  1H8A C;  1YS7 A;  1W5C C;  2HYF A;  3I5U A;  1LDJ A;  1A36 A;  4Z2Y A;  3FK6 A;  1ZLK A;  2JPB A;  3G4S I;  1O3T A;  5ILV A;  2MC3 A;  3JAM K;  4ZTJ A;  3FMR A;  5F0H A;  5KHD A;  3J7Y J;  4AVP A;  3LSR A;  5LLQ A;  4KMU X;  3T1B A;  2ZXJ A;  3R0A A;  5D8L B;  4ANJ A;  4II2 A;  1BOA A;  2QWW A;  3F9K A;  2P81 A;  4LLG F;  3JRD A;  2GA2 A;  4GYI A;  4OWR B;  2XF5 A;  2HQR A;  2KMU A;  1BW6 A;  2K9M A;  2FA5 A;  2YPR A;  3SXY A;  1VQ7 I;  3BR0 A;  4XON A;  1PVE A;  1X2M A;  1JTY A;  1R5H A;  1JT6 A;  3ZRG A;  3Q0V A;  1ULY A;  2L7K A;  4HF1 A;  1UHS A;  3COA C;  1I1S A;  1UZC A;  1KON A;  3TO7 A;  1FP2 A;  2M3A A;  2N8G A;  1REP C;  1TQP A;  4D9J A;  2R7U A;  1HW2 A;  1B59 A;  3IH2 A;  3KYC B;  4YIR X;  1DUX C;  4U87 A;  3T8T A;  5E8I A;  2GM4 A;  2W4S A;  1X4O A;  2E71 A;  4N0B A;  1OYW A;  3CUO A;  2VJ4 A;  4Y3O A;  2NVY J;  3O6B B;  2M8G X;  1GXQ A;  4C3I J;  2M2E A;  3DV8 A;  3JCU C;  2MW8 A;  3G1L A;  2L0K A;  5DTD A;  1SVL A;  3HOW J;  5JHF A;  2QF7 A;  3BJO A;  3GFM A;  3CES A;  4MFE A;  4ASN A;  5FRN A;  2JA7 J;  3HYI A;  1NK2 P;  1FZP B;  2I5U A;  3CDI A;  3EYY A;  3MEX A;  3ABM H;  1IN8 A;  3K4N A;  2NS0 A;  1HDD C;  4KNY A;  1MBJ A;  1T8I A;  1UST A;  4IHY A;  4Q4Z F;  1W5T A;  5FKK A;  4AIK A;  1GV2 A;  3OYB A;  5KK1 A;  2P0W A;  4I0A A;  3VB2 A;  1KU2 A;  1Z3X A;  1FOW A;  3QOE A;  4IF4 A;  4ZYE A;  1RNL A;  3E6B A;  1GLN A;  2VQC A;  2KRC A;  2BOL A;  3GEZ A;  2R7S A;  2A69 F;  2STW A;  1HC8 A;  3I4N J;  4OOI A;  5D4S A;  2FD5 A;  3CCY A;  3IRR A;  2JSP A;  3I53 A;  4JK1 X;  3KP7 A;  3GTL J;  4AYB A;  2RV8 A;  2GOX B;  1L3L A;  3ELK A;  3AG4 H;  4PFP A;  1IRX A;  5J40 A;  3MKW B;  1GVJ A;  2O8X A;  3S93 A;  2XHK A;  2Y0S A;  2CQQ A;  3OYJ A;  2NRA C;  2AQE A;  1MBG A;  1RPW A;  1TLH B;  3ZQI A;  2C6Y A;  1N25 A;  4P9F A;  4A6D A;  3WGG A;  4M3D A;  3EUH C;  1G59 A;  3PQK A;  1ETQ A;  4U7B A;  3MKL A;  3GX4 X;  1R5I D;  3I0T A;  3OOP A;  2O03 A;  3TW6 A;  4B3X A;  2HU9 A;  4WCG A;  2Q2E A;  3DFG A;  2QZ8 A;  3KP4 A;  1J7K A;  5L3E A;  4XL9 A;  1GT0 C;  2ISZ A;  2QUF A;  2LD5 A;  4KMF A;  1DP7 P;  1EH7 A;  2E1N A;  1B8I B;  1IXR C;  1RES A;  2DXI A;  2GBY A;  1Y39 A;  5ICG A;  2JN6 A;  5DV5 A;  4ZH4 F;  2JT1 A;  2RQQ A;  3CF2 A;  1OYY A;  3VEP A;  1PP8 F;  2KJB A;  3WU0 A;  1TZL A;  2KIQ A;  1AWC A;  2ELH A;  3RPU A;  4B43 A;  1G3Y A;  1UAA A;  2X48 A;  1J59 A;  1EJ9 A;  2XAG A;  4XBF A;  1W4M A;  1KU9 A;  2KT0 A;  3IAS 2;  4M6Y A;  5DCM B;  2CJJ A;  3HIF A;  2Y75 A;  3IL2 A;  3PSF A;  2L2O A;  3MKZ A;  3S1M J;  5EEA A;  4BY7 J;  4XLP F;  1M1E B;  5LGT A;  1K4S A;  2QVO A;  3H9J A;  1IW7 F;  2VL8 A;  2EFN A;  1WJD A;  2LRD A;  2V6C A;  3WGI A;  1ITY A;  3TKY A;  4Z6Y A;  3CMA I;  3HKZ A;  3SFZ A;  4ZJZ A;  1OPC A;  4GRI A;  4D7M A;  5H2F C;  1XG1 A;  2X1C A;  3TMO A;  1R23 A;  4A3J J;  2L5Q A;  2EZH A;  5FB2 A;  1YJW I;  3MKY B;  3K4C A;  2OA4 A;  5GPC A;  2Y2Z A;  4CSW A;  3R60 A;  4Y33 A;  2VKE A;  1R36 A;  2W1O A;  3DP7 A;  5L3D A;  1JTX A;  3M4O J;  4Q47 A;  5IY5 H;  4GCV A;  2L3D A;  1U8B A;  3K10 A;  5IYD J;  2HTJ A;  2B7E A;  2DT7 B;  1NG7 A;  1WJE A;  1EH6 A;  4GGG A;  3OYG A;  2KQR A;  2A68 F;  5FKL A;  2EIK H;  3K69 A;  2L01 A;  5DUI A;  2K9N A;  2XKP A;  2IGN A;  4J19 A;  5LEJ A;  2GZW A;  4N4O B;  1MNM C;  3HOU J;  1IG7 A;  2Q1Z B;  3HUG B;  3HRU A;  2CS3 A;  1X3Z B;  1MSE C;  3HSR A;  4KIB A;  1QZE A;  1B72 A;  3BZ6 A;  3W6K B;  4NDL A;  1IRZ A;  1TWA J;  3BR2 A;  2Z2S B;  3V8L A;  1W1W E;  1O3S A;  2HOA A;  5LD2 C;  3LSI A;  2FOW A;  2K7L A;  1FBQ A;  2MGQ A;  1G8X A;  4UV8 A;  2W82 A;  4EJT A;  2G7U A;  2XPV A;  1BIA A;  3BZK A;  3UNG C;  2E2J J;  2CGP A;  3JSP A;  3WU2 C;  3GTO J;  3OL4 A;  1OQY A;  1FOK A;  1S7E A;  4A0X A;  1V5E A;  1MMA A;  3L2U A;  4XRF A;  1O3R A;  5FLX K;  1YJ9 I;  3C3W A;  1BL0 A;  3F72 A;  1IV8 A;  2HKO A;  5KCM A;  2DPD A;  2JTV A;  2BEO A;  4AVZ A;  3V4G A;  1PUF B;  4E7S A;  1IJW C;  3IWZ A;  3NRV A;  3RIR A;  3EDP A;  1ZGA A;  3AL0 C;  3RKY A;  4UY8 I;  4IEJ A;  4QSH A;  2EK5 A;  4NUB A;  2KDZ A;  5D6F A;  1QGP A;  1DGR M;  2NS7 A;  2X85 A;  2V79 A;  1ERD A;  1VQN I;  2EIN H;  5TRD A;  1FTZ A;  1CF7 A;  3QYB A;  4ESJ A;  4CA0 A;  3QPT A;  1S7A A;  3CJT B;  2FE3 A;  4IHW A;  4IVN A;  1G2H A;  1WJF A;  3CD6 I;  4C3J J;  1VQ4 I;  3SHF A;  2EZL A;  4G7H F;  2Z9O A;  2LVS A;  3VFZ A;  5AON A;  2OUM A;  1LFB A;  5E17 F;  1F43 A;  2XGD A;  1VF9 A;  3OYI A;  1JHH A;  4H4K C;  3KLN A;  4KIS A;  1XGM A;  1MMN A;  1XD7 A;  3CP2 A;  3WTZ A;  2QKL B;  5FFX A;  2DA1 A;  1I6X A;  1V54 H;  1BC8 C;  1LE8 A;  2CV1 A;  1FWZ A;  1IC8 A;  3QPH A;  3WOD F;  1YOV B;  4JBA A;  2DPU A;  2FNA A;  3F0C A;  5ICC A;  2ZC2 A;  4ENN A;  3KFW X;  1A35 A;  2BVL A;  2QKM B;  1UB9 A;  4YIF A;  3OSF A;  3TO6 A;  1JJ6 C;  2UZK A;  4MEY F;  1N77 A;  2NVT J;  3VDX A;  5K1Y A;  4BXF A;  1XSX A;  2ZO4 A;  4XLA A;  1Y8R B;  3A0B C;  4BAY A;  4MTE A;  3GFI A;  2WAF A;  4Y15 A;  3Q5F A;  3PM1 A;  5LGU A;  2VKH A;  2E36 A;  2KIF A;  2A6E F;  1W7P A;  4CDG A;  1QHH D;  2CQ7 A;  2YSR A;  5BOX A;  3A0H C;  4M74 A;  3DU5 A;  3F6O A;  2L7M P;  5TGT A;  3Q9S A;  2JUC A;  4BE0 A;  2D2W A;  3REO A;  2X9D A;  3RYR A;  3Q0U A;  4PJN A;  1D0Y A;  4XM3 A;  1SFO J;  3W2A A;  4JX4 A;  3ML6 A;  1FOX A;  3HL2 A;  2XAU A;  2Y0M A;  2QQA A;  4B47 A;  4BQN A;  2K85 A;  2E1M B;  4A3G J;  1UEL B;  2W00 A;  4P1W A;  2OV7 A;  2Q0O A;  3GXO A;  2XAH A;  2VE9 A;  2DFI A;  4R8H A;  2HDC A;  1O57 A;  1MIJ A;  3VYS B;  4XOT A;  1LPQ A;  1NH3 A;  1O7F A;  3RJP A;  4NBQ A;  3HOS A;  2JA2 A;  1T33 A;  1ETK A;  3D1N I;  5DEQ A;  5J3L A;  5J47 A;  5JHU A;  2ZME C;  1A04 A;  4A3K J;  4DIQ A;  3GZ6 A;  2STT A;  4Y52 J;  1XMA A;  3WE3 A;  1ZR4 A;  3F22 A;  3C1D A;  2VKD A;  1X1P A;  4XID A;  1MND A;  2W57 A;  2OZU A;  4O3M A;  3LL7 A;  5AIP A;  5IP9 J;  2EFO A;  1DGW Y;  4ZYG A;  4ZZD A;  5GTH C;  4LOC A;  4IHT A;  1FEX A;  1NK3 P;  2EV5 A;  1HF0 A;  2TRT A;  3GF2 A;  2FOK A;  3D0S A;  4FQG A;  2Y9Y A;  4U0W A;  1W7P B;  1X1D A;  1LEA A;  3K1N A;  4XSX F;  4EJW A;  1K78 B;  1ZLJ A;  2R93 J;  2HXI A;  5D6E A;  3L7W A;  4I09 A;  2EIJ H;  4M3E A;  5DYM A;  2GOM A;  3VWB A;  2K4B A;  2B0L A;  3D5R C;  3KLO A;  2TDX A;  1QRY A;  2LY2 A;  4NC8 A;  5BMZ A;  1WJ5 A;  3S1N J;  2ACJ A;  3L2R A;  1T56 A;  3BWG A;  1U8R A;  3JTG A;  3ULQ B;  1ONV A;  2L7Z A;  4G8X A;  1P4W A;  3H9Q A;  1AKH A;  2H1K A;  5LHI A;  2OCC H;  5J4Y A;  3TW7 A;  5BS6 A;  3CCE I;  2M4K A;  3BG5 A;  4EGY A;  2E1C A;  2Z1D A;  1VQ6 I;  4BAC A;  2IPQ X;  3GME A;  3J80 K;  1HKT A;  1J2X A;  1ZGJ A;  3PNY A;  4PSW A;  4F92 B;  5GAE J;  3UR3 C;  5J4V A;  1BI0 A;  5BQT A;  2CMP A;  1P2F A;  2EJR A;  2IEK A;  2LF7 A;  3KCC A;  2LNB A;  2R7R A;  2EIL H;  1JKO C;  4H0E A;  2Z5U A;  3IC7 A;  4OAZ A;  3A4C A;  2ID6 A;  2DN0 A;  2EQR A;  5DUK A;  5FD5 A;  3TOB A;  3AAF A;  2UWM A;  2R5Y B;  3HJE A;  2M30 A;  2G9W A;  3BR1 A;  4JX5 A;  3CCL I;  2JZY A;  1TL8 A;  2RDP A;  2E34 A;  1U9O A;  5DD8 A;  4M9X A;  1BJA A;  2H27 A;  5J1Y A;  5H6R A;  3CCV I;  2R7F A;  2DYR H;  1LDK B;  2Y30 A;  5F64 A;  3ZQQ A;  2KRH A;  1RR7 A;  3LAP A;  1V3F A;  3TGN A;  2OBP A;  3R6S A;  1VQO I;  3CUQ C;  1BW5 A;  3FIS A;  2RC4 A;  2K9Q A;  3BPV A;  3S3O A;  1XC5 A;  2FSW A;  4XK4 A;  1U5T A;  3BT9 A;  2ZXW H;  3OR1 C;  4E7K A;  3MFK A;  1HQC A;  5F04 A;  1SFE A;  2MH9 A;  3WHB A;  4PK4 A;  5C4J J;  1VTN C;  4LK0 F;  1MJ9 A;  3I3L A;  2A61 A;  4HX8 A;  4LD5 A;  1ZQ3 P;  1NTC A;  1SAU A;  2XC7 A;  3OSG A;  5TIS C;  1VQL I;  2L4A A;  3BY6 A;  2QM3 A;  4Q5S F;  1FC3 A;  1VFC A;  3P7N A;  2QA4 I;  1PUE E;  3S16 J;  3OS1 A;  2H94 A;  4RA2 A;  2CUF A;  3K4J A;  1TQI A;  5M5X J;  1YIT I;  2WY8 Q;  2EA2 A;  5LGN A;  2H6C A;  3E0J B;  4EM1 A;  4CXF A;  1ON2 A;  5KAF C;  4B4C A;  2V9P A;  5K5Q A;  3K0L A;  3ABL H;  2ZB9 A;  3H5R A;  4LFU A;  5ICF A;  1RI7 A;  3LSJ A;  2X6Y A;  4ON0 A;  3FM3 A;  1DU6 A;  3JRA A;  1X1B A;  3CDL A;  2YU9 J;  4R1H A;  5DM6 F;  4X1E A;  4G7Z F;  5FKN A;  2X6W A;  1XSV A;  3ERM A;  4U7D A;  2KIU A;  5ILS A;  4KN4 X;  2O8K A;  1Z6T A;  2FU4 A;  3UKG A;  3B6C A;  1VQ9 I;  1E3O C;  4OIP F;  3LQQ A;  3QWL A;  1HST A;  1FPQ A;  2CH0 A;  2FXA A;  4G6Q A;  3GUD A;  2OQR A;  2CWE A;  3O8H A;  3MZH A;  5IT9 Z;  1R58 A;  4BGD A;  1XGN A;  4RB1 A;  3BRO A;  1U5T C;  1MJB A;  3KIO A;  2BY2 A;  4HDV A;  5JVG F;  3MD2 A;  2FMY A;  5IOZ A;  2DFF A;  2R7T A;  1Y56 A;  5B5E C;  1EH8 A;  2VON A;  2VT2 A;  3M8J A;  1RUN A;  3JRI A;  2Z33 A;  4D5C A;  4FT8 A;  2EFQ A;  3S32 A;  2FF4 A;  5JVT A;  1AKH B;  1ZRE A;  2QYO A;  5EZH A;  3VSK A;  5D4R A;  2VQG A;  3QU3 A;  1R00 A;  2EA4 A;  1JGG A;  3P5J A;  2ZKZ A;  2K27 A;  6PAX A;  3E6M A;  5IP7 J;  2H09 A;  3BCB A;  2VC1 A;  5M5Y J;  1X2N A;  4FX4 A;  3K4K A;  5HOO A;  3RZD J;  2GAU A;  2CW7 A;  2R5Y A;  2X6O A;  2CO5 A;  2IGO A;  4RDU A;  1LKX A;  3RSN A;  1X1A A;  3QP5 A;  3LFU A;  3NAU A;  1D0Z A;  4JX6 A;  1MW7 A;  2HQ5 A;  5FKO A;  5D5W B;  1ZHF A;  3V7C A;  2DDB A;  1YG2 A;  4KFC A;  1SC7 A;  3OYL A;  1KGS A;  1B6A A;  1BOB A;  3EUH A;  2R5Z A;  4IHX A;  1F9N A;  4XLC A;  4EEF G;  2NYX A;  2X6X A;  1X3W B;  4EJV A;  3M8E A;  3F8B A;  3MCZ A;  2VC0 A;  4F52 A;  2QEN A;  1T38 A;  4I01 A;  2DJN A;  4NQW B;  4EVI A;  3G71 I;  1S8N A;  3PFY A;  4ZC3 A;  1FYM A;  4B44 A;  2PLY A;  1WQ2 A;  5IPA A;  3ABK H;  1B1B A;  2LLK A;  4D5F A;  3CCQ I;  3IV5 A;  1SD7 A;  4KIC A;  4AWX B;  2E1O A;  2DA2 A;  2F5V A;  5AIQ A;  4BJ6 C;  2D45 A;  4UUS B;  3FKJ A;  4L18 B;  4RGS A;  4DZJ A;  3ZQL A;  3H36 A;  1R7J A;  3SZG A;  4MGR A;  5F6F A;  2WV1 A;  1Q1V A;  1HBX G;  2NNY A;  1WJB A;  2XAF A;  1FP1 D;  2KZV A;  2EZI A;  3SZT A;  1RUO A;  2ZBK A;  3IWF A;  5FLM J;  4A5M A;  2NAZ A;  1ON1 A;  2TCT A;  3KZY A;  4MIM A;  2CG4 A;  4G6D A;  1XCB A;  2VQL A;  2H8R A;  1A5J A;  3H9G A;  3NQO A;  3RPQ A;  4BY1 J;  3GTK J;  3ZMV A;  3BC8 A;  3K70 C;  1Z1D A;  4IHV A;  2VN2 A;  5E1W A;  3GTM J;  3FXJ A;  1B4A A;  2MFZ A;  4AU7 A;  5HDG A;  1D1A A;  5GAD J;  1K83 J;  2GXG A;  3B02 A;  2EFP A;  4E7L A;  4ZYA A;  1J0R A;  2DK5 A;  2I10 A;  1IRG A;  2KLO A;  2ETH A;  3HBL A;  1Z67 A;  3QOD A;  5K5R A;  4E7J A;  2LKS A;  5LFA A;  4MO7 A;  4W1U A;  1QO0 D;  1MDM A;  2P5V A;  1OCZ H;  2G0E A;  2W24 A;  1P92 A;  2K9S A;  1Y1W J;  2XPU A;  3D5S C;  1G3W A;  2O6G E;  1F36 A;  3JRG A;  3GTP J;  1R4N B;  3QQA A;  3R0J A;  5TJJ A;  1Q1H A;  1IN7 A;  1KYZ A;  2QQ8 A;  1YW8 A;  2V1D A;  2K3F A;  1H9G A;  1I3A A;  3ZP5 A;  1HCR A;  4U88 A;  3QYE A;  4A0Z A;  1S29 A;  5K7F A;  3H3Z A;  2DT5 A;  1K4T A;  4G7O F;  3IKV A;  2DK8 A;  3RKW A;  2V9K A;  4LIU A;  2MC4 A;  4E7Z A;  1IN6 A;  5CQE A;  2HVS A;  3X2Q H;  3I59 B;  3H5A A;  2RNJ A;  2XAS A;  2ECC A;  2M45 A;  2OTJ I;  3QYF A;  3F8C A;  2VT3 A;  5E1X A;  3A03 A;  1V55 H;  1Y6I A;  2XAJ A;  1QZY A;  4GYG A;  1XPX A;  3TDZ C;  3LAJ A;  3ZQC A;  1BBY A;  4BEH B;  2F4I A;  3ZQH A;  1Z6R A;  2V9V A;  1HDP A;  4IOC F;  1TWC J;  2HOE A;  2VI6 A;  5M3M J;  3KX2 A;  3H1C A;  1R4M B;  1MKM A;  4A3B J;  4IL6 C;  2BXZ A;  4AIJ A;  3IH3 A;  3RQ4 A;  2OCE A;  1XMK A;  2WWY A;  1ZG1 A;  2ELK A;  3HSE A;  4PGG A;  4MLO A;  2ZME A;  3FXL A;  2NS8 A;  1A31 A;  1YO5 C;  2BW3 A;  4S0H B;  3BTI A;  4HSR A;  4Y4R A;  3QOP A;  1HW1 A;  2Q2E B;  4M9Z A;  3PSI A;  4II3 A;  5FGM A;  1V4R A;  3OIO A;  3ZPL A;  1PJR A;  1F1Z A;  2B63 J;  4WF2 A;  2Y31 A;  5ICE A;  1MH4 A;  4BDZ A;  5FKM A;  2PBI A;  1XGS A;  5B66 C;  5EEG A;  4LG0 B;  1NHA A;  2ZSI B;  3LA2 A;  1IAW A;  3WTY C;  2F48 A;  1XDS A;  4S04 A;  1STZ A;  2DAO A;  1N78 A;  2QLZ A;  2DOA A;  3S8P A;  1FTT A;  1QVU A;  1USS A;  5CYV A;  2UXN A;  1Z91 A;  5IYB J;  2OTL I;  3TED A;  2MH2 A;  2F6C A;  2OD5 A;  2BW3 B;  3K1P A;  2KDO A;  2IW5 A;  5B1B H;  3ROU A;  1VZ0 A;  4EQQ A;  2ZME B;  3BP8 A;  3CMM A;  3CF5 F;  1PUF A;  4PJM A;  3ABU A;  3HPH A;  5HVQ C;  3WTX C;  1D0X A;  2M5W A;  1W36 C;  1VI0 A;  2L9N A;  2D1H A;  3FXU A;  3NEU A;  3SDB A;  3LSH A;  1KZH A;  1X4P A;  4IPA A;  1ZR2 A;  4EV0 A;  4RM2 A;  3WTV C;  2DTR A;  1OR7 A;  1W7P D;  4CO8 A;  2V1X A;  2WC2 A;  3IH4 A;  2HOT A;  1LFP A;  3JRH A;  1RET A;  3PL8 A;  5IT3 A;  2GQQ A;  4YG2 F;  4IX7 A;  2HNH A;  3K6G A;  4HAM A;  1D3Y A;  3S2D J;  1BI3 A;  5E79 C;  2WB1 A;  2OF7 A;  3GTQ J;  1ORK A;  3F8N A;  3HTS B;  3MZY A;  5DD4 A;  4M3B A;  4HW0 A;  5J1R A;  1ODD A;  3FIW A;  4KN7 X;  3SYT A;  2HVR A;  3PUB A;  3OMY A;  1UCR A;  2A6T A;  4YEJ A;  2RNG A;  2E35 A;  3V42 A;  2RGV A;  1WSU A;  1Z05 A;  5E3L A;  4XRM A;  3OYE A;  4ESB A;  3JR9 A;  3VOE A;  2VQH A;  4PJJ A;  4YII A;  4B09 A;  4O5V A;  3KEO A;  1QPM A;  2KHM A;  3GZN B;  2ZJP F;  2IVM A;  4BH9 A;  5HDN A;  2HVQ A;  2K9L A;  1Z7U A;  5EDN A;  1YYV A;  2F4M B;  1Y1V J;  2JA5 J;  3MZ8 A;  4XN0 A;  1MDM B;  3EPZ A;  3P9C A;  3GLX A;  4F55 A;  3Q9V A;  3H3V K;  2IA0 A;  1YI2 I;  4PDK A;  2HDD A;  3JRB A;  1H88 C;  3AKZ A;  3L2V A;  1R1T A;  1MZB A;  4ZZL A;  3G1O A;  2HYJ A;  2QCO A;  5GPA A;  3DTE A;  2PMZ N;  2PMZ A;  1S72 I;  5K7H A;  2XSJ C;  3S1Q J;  2DJI A;  2VXD A;  2DA6 A;  4KJZ A;  3HEF A;  3CC2 I;  3H92 A;  1OKR A;  2MA3 A;  4F3Q A;  2B9S A;  1RC9 A;  3DBH B;  4M3G A;  2WY7 Q;  2HYG D;  5GTI C;  1K6Y A;  4RBO A;  4WXD A;  2LC2 A;  4MQV A;  2Y0S N;  3KZZ A;  4LGW A;  4ENK A;  1W0U A;  4I76 A;  4IKF A;  2V1N A;  4CYC B;  4KUM A;  2R7V A;  3MWM A;  2CW0 F;  1POG A;  5DCF A;  4XLF A;  4GXO A;  2E5Z A;  3RDI A;  1PYV A;  2DMQ A;  4HF0 A;  3RI4 A;  2P5L C;  4UUS A;  1MBK A;  4PCQ A;  1ZAO A;  5IP6 A;  4W97 A;  2XSD C;  4QPQ A;  3DPU A;  1B9N A;  1SAX A;  3PIO F;  1SD5 A;  3CTA A;  4HNT A;  1UJ8 A;  4C2M J;  4IO9 F;  2A3S A;  2DFE A;  4IXA A;  2MG4 A;  4XLN F;  1MBE A;  1I50 J;  2DQL A;  2DCE A;  5HNF A;  4XKW A;  2BHZ A;  4G94 A;  3SEZ A;  1W0T A;  1N75 A;  3I4M J;  2LKP A;  3L00 A;  5FFZ A;  1U3E M;  3T0Y A;  2F5F A;  3CDH A;  1YS6 A;  2HPM A;  1AU7 A;  1WVR A;  1TQM A;  5FRO A;  1YX3 A;  3ZN1 A;  2XAQ A;  2COB A;  3HC7 A;  4XLE A;  4D1Q A;  5L3F A;  2VJ5 A;  1TP4 A;  1JKP C;  5F0F A;  2Q8K A;  3C18 A;  1LE8 B;  3AG3 H;  4BQA A;  3LST A;  3C2B A;  2IGK A;  2F2E A;  4DYC A;  3JRC A;  3ZCO A;  4P55 A;  3PIP F;  5CJ9 A;  2DQR A;  5J1U A;  3L9F A;  1MBF A;  4UHT A;  4DW6 A;  2YU3 A;  3VYR B;  3FX3 A;  4OIN F;  1Z77 A;  2BYV E;  4BNC A;  3A2K A;  2W7N A;  4EJO A;  2XF6 A;  4A6E A;  2P5K A;  4QIW N;  2E2I J;  2X51 A;  2ZJQ F;  2DA7 A;  2LRE A;  3CLQ A;  2M34 A;  2ZNY A;  3DPL C;  1VQM I;  4XKC A;  4LLL A;  2M0M A;  1ETV A;  3G1M A;  1T95 A;  1QU3 A;  4HLX A;  3RTR A;  2FML A;  3OS0 A;  2BHY A;  3GW2 A;  1YRN B;  5HS7 A;  1ZG5 A;  5ILU A;  4JOM A;  1H0M A;  3FZV A;  4ITV A;  5K5O A;  1ETX A;  1YIO A;  2VKV A;  2VB6 A;  1K79 A;  2E2H J;  3MQ0 A;  2LYC A;  1ETO A;  4MFD A;  4NB5 A;  2QGU A;  1FIA A;  1X58 A;  3RKQ A;  1K6O A;  3HB9 A;  2XVC A;  1ETY A;  1Y0U A;  3OYC A;  5IOY A;  5CKT A;  2L9V A;  2WTE A;  3O8G A;  1HW5 A;  4RMN A;  2WAQ N;  1RKT A;  2P6T A;  1I27 A;  4F91 B;  4HQE A;  4E4H A;  1B9M A;  3QP6 A;  3CO6 C;  2FX0 A;  2JVG A;  3M1E A;  3CJN A;  2GXB A;  2QQ9 A;  2O7O A;  3VOD A;  2DI3 A;  1SVM A;  2JRT A;  3CO7 C;  4XMY A;  2EV6 A;  2LH9 A;  4ZDO A;  2VLA A;  1YFH A;  3HOZ J;  3HRM A;  4IRG A;  2WV0 A;  1KQ0 A;  4PUS A;  1J75 A;  4BHB A;  1VQ8 I;  3ECH A;  1Z3Y A;  1IXC A;  4EAT A;  1FIP A;  4HZF A;  2AXL A;  3AG2 H;  3J7A Y;  4CCL A;  4XSZ F;  1WGX A;  2RRE A;  2R5Z B;  3PUF A;  3IUO A;  4DGW B;  2LY1 A;  2GIV A;  2EWN A;  4M6X A;  4GDF A;  5HS9 A;  2CFX A;  3U9G A;  4L5J A;  1G4D A;  1W5S A;  3GLL A;  1KU7 A;  1VND A;  4Y17 A;  2KIM A;  1OCT C;  2FBH A;  3I4P A;  2FUG 2;  2YUS A;  3GFL A;  3LSK A;  1HOM A;  3M3Y J;  1HA8 A;  1ZH5 A;  4NC6 A;  3DLA A;  5FLX Z;  3BLY A;  4FE4 A;  1I39 A;  1LJ9 A;  1O7L A;  1FSE A;  3RKX A;  2F4O B;  3BPX A;  2HZT A;  4CH7 A;  1I1G A;  2ME0 A;  3I64 A;  1XSD A;  3IHU A;  1WFX A;  4HV6 A;  3VPR A;  1S9H A;  3TP0 A;  4LIV A;  1TWG J;  3ONQ A;  4BYY A;  1DDN A;  1MGT A;  1IZ1 A;  1HLV A;  4HBL A;  2VBZ A;  4ENJ A;  3HRT A;  4J01 A;  2O5R A;  2VAS A;  4M71 A;  2A5W A;  1Y8Q B;  2QQB A;  5JFR A;  3BZC A;  4DYR A;  2VXZ A;  3DKY A;  5CVJ A;  3G3Z A;  1A6Q A;  3CQZ J;  3BG9 A;  1TWF J;  4XR6 A;  1B8I A;  5F1R A;  2K86 A;  2CSO A;  2OQG A;  1FMV A;  2CQX A;  3HOY J;  3V8J A;  2GIZ A;  3M07 A;  1KYW A;  2VE8 A;  3GWZ A;  1OCC H;  1YE9 A;  2A6H F;  4RGX A;  4BS9 A;  2XRL A;  2V6E A;  4RAY A;  1PDN C;  4V2G A;  5BPD A;  5KNL A;  1D5Y A;  3L1P A;  2GWR A;  3FKI J;  1TW3 A;  4OMY A;  4X0G A;  1WZ2 A;  3I71 A;  4CZZ A;  1S6L A;  3KYD B;  1MNE A;  2V26 A;  1S5L C;  3FXO A;  5E8G A;  5IT9 K;  2LF8 A;  4G9Y A;  4UUV A;  2IS1 A;  1TWH J;  4A93 J;  3HG9 A;  4GFB A;  2WB1 N;  4GO1 A;  3QU6 A;  3AL0 B;  2VOO A;  3HXL A;  1FT9 A;  4XQF A;  3H35 A;  1WWX A;  4CCM A;  3K70 D;  1L0O C;  2V7F A;  2EH3 A;  4QLC U;  3DBL B;  3HM5 A;  3OYN A;  1ZRF A;  4HOB A;  4CCO A;  2HQN A;  1R9T J;  2CW8 A;  3N4M A;  2LDU A;  1XGO A;  1FSH A;  2BY3 A;  4HQM A;  3WTS C;  2K40 A;  1WH7 A;  3ZQ7 A;  3S3M A;  4K2E A;  1Z9C A;  3E97 A;  4PJL A;  3KPH A;  1MMG A;  3LWF A;  3ASO H;  3LSM A;  5HLG A;  1LNW A;  5LRS A;  4Q48 A;  2LY9 A;  2NOJ B;  3CCU I;  4R79 A;  5HNH A;  1OCO H;  4WXC A;  2QSG X;  1GDT A;  3DEW A;  5IYC J;  2JMW A;  2FBK A;  2EB7 A;  5E3N A;  4ENM A;  4C2T A;  3DEE A;  1BR1 A;  2YR2 A;  4M9S A;  3PQJ A;  3KZI C;  5GP9 A;  4P9U A;  1SFU A;  5FRM A;  3ISP A;  1WJC A;  2ZJ2 A;  3GO5 A;  5D5X B;  1R22 A;  1BC7 C;  3WG9 A;  1VQK I;  4A2U A;  3I9V 2;  2NVX J;  1WKM A;  3W6V A;  1FLI A;  3DQV C;  4KA4 A;  1SD6 A;  2CQK A;  1SFX A;  4HEA 2;  2OPT A;  3M7G A;  1JXS A;  1IO2 A;  3ZOB A;  3F8F A;  1J5Y A;  1IGN A;  4LK1 F;  2R7Q A;  1GV5 A;  4BU2 A;  3G2B A;  2VJJ A;  2PEX A;  4TV7 A;  2DMP A;  3CJR B;  4N4N B;  4UVA A;  2R92 J;  2DT6 A;  4FHT A;  2RKH A;  2E19 A;  5EZG A;  3NWT A;  2W25 A;  4RLQ A;  3DCF A;  4NC7 A;  4B1R A;  2KPM A;  2ZXI A;  4HDU A;  1ZK8 A;  3WTT C;  3FHN A;  2ZJR F;  1IN5 A;  2A05 A;  2KKO A;  2L9S A;  4HPQ A;  1T39 A;  5F08 A;  1CF7 B;  1JHF A;  2CU7 A;  1BN5 A;  2RQP A;  2X1E A;  4JQF A;  3KET A;  4XOR A;  3T8R A;  1XDU A;  3BDD A;  4WWC A;  1CQT A;  3ZR8 X;  3S14 J;  1DQU A;  2JPC A;  2A07 F;  5GAG J;  3DPT A;  3JAM Z;  2UV1 A;  1MD0 A;  1WH5 A;  3L2C A;  3HOT A;  1E3H A;  1YJN I;  1FOY A;  3GFJ A;  1LFU P;  2WAE A;  1OYI A;  1MSF C;  2DO7 A;  4DYQ A;  1H9T A;  4OU0 A;  3OV8 A;  4OMZ A;  4D7N A;  4A3D J;  3FBI B;  2IRF G;  2KJC A;  4XNF A;  5B1A H;  3OWT A;  1QZZ A;  2M1B A;  4F93 B;  1GVD A;  4M3F A;  4ZYD A;  1U78 A;  3KP6 A;  4E7H A;  4YFN F;  5ED4 A;  3J80 Z;  1YLF A;  3HGY A;  3DXJ F;  4I7H A;  2JSC A;  4XN3 A;  1IV6 A;  1WRJ A;  4EMS A;  2JVH A;  4IHS A;  2E7X A;  1FYL A;  2P4W A;  5C44 J;  1LDD A;  1R6R A;  1P9Q C;  2VPL A;  2WBM A;  3BR5 A;  2CV2 A;  3HDD A;  3RQI A;  4FX0 A;  3K7A J;  1TC3 C;  1SFK A;  3K9T A;  1K78 A;  1MH3 A;  2G7H A;  4ETS A;  4ZDP A;  5LEK A;  1YIJ I;  1VQP I;  5JLX A;  2CUJ A;  3ZN0 A;  1FNN A;  1IRF A;  4AC0 A;  1EKE A;  3I54 A;  3D5L A;  5E18 F;  3OY9 A;  3BTC A;  2IJL A;  1ZTR A;  3EUK L;  1DU0 A;  3K4B A;  2WAQ A;  3ZMU A;  3KP2 A;  2MD5 A;  3PJR A;  2ME6 A;  2Y69 H;  5HLT A;  4A12 A;  4UUT A;  2GA1 A;  2DMU A;  1QA6 A;  1V5F A;  3Q0W A;  3R61 A;  4UB6 C;  1WHU A;  2CUZ A;  2IS4 A;  1BI1 A;  3U1K A;  5A2Q Z;  4NHJ A;  4XIC A;  2I8D A;  1YQA A;  2K5C A;  3A1Y A;  4PJ0 C;  4DJA A;  1Z21 A;  1ZGW A;  1YW9 A;  3ZQG A;  3DLL F;  2X0L A;  5DS9 A;  2RAE A;  3HRS A;  4WXH A;  3E5X A;  2AO9 A;  3HUG A;  1Z7L A;  3N05 A;  4DBQ A;  5FD6 A;  1FYK A;  3HZJ A;  5FO5 A;  4HRI A;  4A3E J;  1S3J A;  1RKW A;  3E3V A;  2HTS A;  3W6J B;  3E7L A;  5E3O A;  2L7F P;  3DKX A;  3A01 B;  1ZAR A;  3VYU B;  3CCR I;  3OYH A;  1ACI A;  1NG6 A;  5EG0 B;  4DZP A;  1IDY A;  4ESF A;  1CGP A;  5GAH J;  1XN7 A;  2IBD A;  5M5W J;  5LBQ A;  2HI3 A;  5HS8 A;  4BL0 B;  2DFH A;  3H3U A;  1XTA A;  2ISY A;  2P8T A;  4DQ2 A;  2F5C A;  4HX7 A;  2A5Y B;  3HOV J;  2RVC A;  4D0P A;  1X3U A;  5A2Q K;  1TBX A;  2LBF A;  4HNV A;  1VQ5 I;  1R71 A;  3DEU A;  2CYY A;  4PZJ A;  2VIX A;  4BHC A;  1F5T A;  4BBR J;  4MHG A;  4RB3 C;  1TT0 A;  2VBY A;  2PMH A;  1YW7 A;  2DA3 A;  1HXD A;  1T98 A;  2M87 A;  3O3K A;  1K7A A;  3BJ6 A;  1F4K A;  1BR2 A;  3E1S A;  1BR4 A;  2O3F A;  5DCM A;  1J09 A;  2OJE D;  4BKX A;  4PFO A;  4YFK F;  3N97 A;  4RGU A;  3CZ6 A;  3S1R J;  1K61 A;  4KT6 A;  2FBI A;  5JR3 A;  5BPI A;  3RZO J;  4S05 A;  3EQL F;  3B73 A;  1DP3 A;  1IN4 A;  4OIR F;  2BY0 A;  3E6C C;  4U0Y A;  5EJC A;  1SMT A;  4YEL A;  4BDY A;  2QBY A;  1JE8 A;  3VYT B;  2AHQ A;  1ZRC A;  3BR3 A;  1ZYR F;  4M72 A;  5L3C A;  2HZD A;  3BR6 A;  4XKB A;  1APL C;  3S2H J;  3MN2 A;  4CIC A;  4YFX F;  2M7B A;  5C3E J;  4IRH A;  2EIM H;  3B6A A;  3WTW C;  5CPR B;  4NNJ A;  3ZMT A;  3PO2 J;  3KEQ A;  4BUP A;  1EF4 A;  2XGC A;  1D1C A;  2FQ3 A;  2VPR A;  3C2H A;  1HSJ A;  1P7J A;  2JWT A;  2ID3 A;  2J5P A;  2ZXH A;  4BJ5 C;  1P4X A;  2EV0 A;  2R3S A;  3PFI A;  4LG3 A;  4BEH A;  3I56 I;  2D5V A;  4EM2 A;  4B3A A;  2LMD A;  2R4G A;  3U2R A;  2AQF A;  2HQA A;  2HR3 A;  4IJA A;  2R7Z J;  3LA3 A;  3FDY A;  2F5E A;  3A02 A;  2LTP A;  3ASN H;  3I59 A;  5EEH A;  2V4J C;  5EF6 A;  4A3M J;  1QVT A;  2QEX I;  2QSH X;  3FM5 A;  2OZ6 A;  1QNT A;  2DTZ A;  4UNO A;  2DA5 A;  4FET A;  5M3F J;  4Y13 A;  1V5G A;  3IP4 B;  3ZMD A;  1XMX A;  5L3B A;  2P7C B;  4IQ4 A;  4I6Z A;  3HHG A;  2BZT A;  4P96 A;  1OLT A;  3WE2 A;  4KYW A;  4QPO A;  1XCV A;  3CUQ A;  1TTY A;  4L9N A;  4UB8 C;  3QRF F;  3GTG J;  1RZ4 A;  1BIB A;  3EYI A;  2P7V B;  3ABT A;  2UXX A;  1TT5 B; 
#chains in the Genus database with same CATH homology
 2JUC A;  2KIS A;  2DOD A;  2KZG A;  2L9V A;  2LKS A;  2CQN A;  2K85 A;  4FQG A;  2DOE A;  2B7E A;  2KFD A;  1UZC A;  2KIQ A;  2DOF A;  2E71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...