2L9VA

Nmr structure of the ff domain l24a mutant's folding transition state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
49
structure length
49
Chain Sequence
WNTKEEAKQAFKEALKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonnative interactions in the FF domain folding pathway from an atomic resolution structure of a sparsely populated intermediate: an NMR relaxation dispersion study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing factor 40 homolog A
total genus 15
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2l9vA00
1UZCA 2DOEA 2KFDA 2K85A 2KISA 2E71A 2KZGA 2L9VA 4FQGA 2CQNA 2B7EA 2DOFA 2KIQA 2LKSA 2DODA 2JUCA
chains in the Genus database with same CATH superfamily
5KK1A 4ZH4F 1FEXA 2PMZN 1D1AA 4XONA 2OA4A 3F72A 1Y6IA 1ZYRF 2CUFA 2STTA 4L9JA 2EQRA 5DCFA 4O5VA 4M9SA 3U1KA 2Y69H 2R7SA 1J2XA 2ZO4A 4II2A 3GZ6A 4W1UA 2EZLA 2R92J 4IL6C 3QODA 2PJRB 5FKKA 3BG3A 4U7BA 1XGMA 3FMQA 3BQZA 3H0DA 2OJED 2FMLA 4AIKA 2IGOA 3E0JB 3HOUJ 5LRSA 4BQNA 2QQAA 3M8EA 3BTJA 2QQ8A 2NOJB 1XDSA 3LSGA 4LOCA 5CVIA 1JT0A 5KNLA 1OCCH 2HXIA 1ZR2A 1FJLA 3I4NJ 2IEKA 2JA8J 1P7IA 2HNHA 3I56I 1F4KA 1Q1HA 2DAOA 3OIPA 3ZCOA 3IRQA 2HXOA 1AHDP 4PDKA 2QBYB 2E1MC 5D4RA 1S29A 5E8IA 4EMSA 5E3LA 4OIOF 4QPQA 1E3HA 3BJOA 1LFBA 2HR3A 4U88A 3C2HA 4HSRA 2V26A 3REOA 2V79A 4XSZF 4BQQA 3TKYA 2CQNA 1Y56A 2WTEA 4EQQA 3ZMDA 4L5IA 2A05A 1LVKA 2EFPA 2KP6A 2ZXIA 3LSJA 3W6KB 5ICEA 3PJRA 1ZK8A 3WGGA 3AG2H 2X1EA 2XIGA 3IAS2 2IT0A 1X1DA 3GTQJ 3V8KA 4UXNA 1RC9A 4CXFA 3A2KA 4RAZA 1I39A 2OUMA 4HX7A 1V55H 4X1EA 4BH9A 3DF8A 5F1JA 1AU7A 4UNOA 4G12A 1ZLJA 1NTCA 4ZC3A 1BI0A 1OCZH 4FCYA 1MBKA 4YG2F 2FBIA 3H3VK 1MBHA 5HS9A 1J9IA 2FU4A 2OTLI 2P7VB 4QIWN 3IWZA 4AM3A 5IYDJ 3W6VA 1ZELA 3K2ZA 4DZPA 3GX4X 3L2WA 5CKTA 1XCBA 2W48A 1FOKA 2VXDA 1HLVA 4FETA 1RUOA 1GUUA 2F4OB 3QU6A 1QBJA 1GXQA 2FJ1A 2F4MB 2LP0A 1HXDA 2NVXJ 5J8FA 4FISA 2VQCA 2HVQA 1JUPA 3EUAA 1GHCA 4G9YA 4XK4A 2GAUA 1Z05A 1TWFJ 3HTSB 2KDZA 1K4TA 2F6CA 1SD6A 1XSXA 2KLOA 2EBIA 3DU5A 1VQNI 3DQVC 1YS7A 5LHGA 2OQGA 4HX8A 5LFAA 1GXPA 1MIJA 4IRGA 2DOFA 3VSKA 2JA2A 4NC8A 3JSOA 1ZH5A 2JMWA 3M9AA 1I5ZA 3N05A 3O2PE 3MAJA 4G8XA 5E8GA 4IOAF 2HOTA 1MKMA 2L9NA 3Q3SA 3ULQB 1ITYA 2BVMA 2VONA 4AYBN 2O61A 4CSWA 4RB3C 4KDPA 1XD7A 3M7GA 2ID6A 1IN4A 3O6BB 4Z2YA 2BEOA 4M72A 2NVQJ 5C44J 4WX9A 3OYKA 5GADJ 3MKWB 2K9MA 3CLOA 3PFYA 1OYYA 1K6YA 3I64A 2DMPA 1T33A 3WE2A 3FKIJ 4LGWA 4KNYA 2VODA 3I9V2 1YJNI 1EH6A 1O7LA 2Z16A 4AIDA 3WGHA 2VT2A 1W7PD 2XF7A 5ILVA 3DTEA 3PIOF 3K4NA 4S04A 1XGOA 3CZ6A 2JVHA 5KCMA 2V4JC 1JTYA 2LMDA 4OMZA 5DUIA 2PI0A 1D1BA 3OYHA 1IV6A 2ZJ2A 1MDMB 4IHWA 1G59A 3CC2I 3GTPJ 1GLNA 1OYWA 4HSTA 1KU7A 2F5VA 4HAMA 1IRXA 4F3QA 3R6SA 3KP5A 4LK0F 1U9OA 4EGZA 1VQ4I 2DJIA 2F5CA 4CZZA 4ZZDA 1Z77A 3VYSB 2YR2A 2CW0F 3IH2A 4JOMA 2JPBA 4GXOA 3JR9A 4N4NB 4HZFA 1Z21A 3BTLA 3IHUA 4LB5A 3HHGA 2LK2A 5C4XJ 3JRCA 2HFHA 3PNTA 1P2FA 2H6CA 3K1PA 3LL7A 1L3LA 3LSTA 5EF6A 3CD6I 2QENA 3TDUC 3LA2A 4B3XA 2VQLA 4A3MJ 3BQYA 4EJTA 1FLIA 1R71A 2CV2A 4Y17A 4IX7A 1BJAA 1P9QC 2K3FA 3GUDA 4P9UA 3S14J 3DXJF 3F6OA 4IHYA 1MMAA 2XPVA 2K7LA 3LQRA 2EZKA 2O5RA 3CJTB 2X0LA 1GV2A 3PSIA 2L9SA 4XLHA 1D0XA 1WJCA 1R00A 2DA3A 4EM0B 3OYIA 2XAJA 1STZA 3CF5F 1R4NB 5E1ZB 5E3NA 2CGPA 2OZ6A 3IKTA 3G1OA 1OR7A 1B59A 1O3SA 2DW4A 2DJNA 5GPCA 4GRIA 2L4AA 1UG0A 2WAQN 1TWAJ 2O3FA 1R5ID 1MH4A 2DMTA 1WSUA 2CG4A 4YIRX 3G1LA 2CFXA 2EZHA 2JSPA 1XTAA 4F93B 1TWHJ 2QCOA 3BDDA 1ZREA 1N77A 5D6FA 2W25A 3RYPA 3RSNA 2EB7A 3D5SC 2JJ7A 3A01A 5ICFA 1YYVA 3OYMA 1HOMA 3J81Z 4M9ZA 4MLOA 1A5JA 1ENHA 4CA0A 1I3AA 4S05A 1VZ0A 2DA2A 4U0WA 1S6LA 2KRHA 5BPDA 2DPDA 3OIQA 1UHWA 1UJ8A 3D5LA 3RPUA 5EDNA 4WK8F 1KU3A 4BHPA 3GTLJ 2GA2A 4XN3A 4BKXA 1VQKI 2GOMA 1YFHA 2VKDA 4KYWA 4CO8A 3S15J 4OU0A 1SANA 2NS7A 3HOVJ 4OOIA 2YU9J 4UV8A 2J5PA 1BJZA 2BY3A 2A69F 2R5ZB 3EDPA 5K7HA 4P96A 3MVPA 4OIRF 3ZQLA 2VQGA 2HYFA 2Y48A 2DBBA 1H9GA 3DV8A 3FXKA 3OMYA 3UR3C 4A3IJ 3OOPA 3MZHA 4M3GA 4RS8A 1VNDA 1FYKA 2ETHA 2ZXHA 5HLIA 3HM5A 1ZRDA 2R7WA 2FMYA 1YW9A 3PIPF 4B8XA 1DQUA 3CC4I 4FQGA 5TISC 1O3QA 3S3MA 3KP7A 1ETKA 4HF0A 5FKNA 3KZZA 2Q8KA 2O9LA 3O3KA 2WBMA 3BR3A 4L9NA 4M71A 4XM3A 1YJ9I 2XUBA 1KQ9A 3W3CA 3TW7A 2L0KA 2EWNA 1FBUA 4RAYA 2E7XA 3RKXA 1L0OC 1U0JA 2MYSA 5AIQA 3U2RA 3ZN0A 3WGIA 1XC5A 2Z1DA 2NYXA 2E1OA 3GFLA 3SXYA 1VQ7I 2VJJA 2BV6A 4LLNA 2EFNA 1TQPA 3S32A 2E1CA 3PM1A 4DYRA 1FTTA 1XPXA 3P9IA 1LB2A 2H6BA 2QYOA 1FWZA 2CQ7A 4JBAA 5IT9K 1J59A 2Y9YA 3FM3A 3AFHA 2R5ZA 1P4WA 4QWQA 1S7EA 1H9TA 3F6VA 3Q9VA 2EINH 4OIQF 3ZQHA 1Y1VJ 5B1BH 4JQFA 1RKTA 4MNUA 3VOEA 2M45A 2MH9A 4ZYGA 3ABKH 5F64A 2UV1A 2Y0MA 2FOWA 3CJQB 4AVPA 5JHUA 2QM3A 3F8BA 4ABZA 2K85A 3KLNA 3LQQA 3FX3A 4D1QA 4BBRJ 2M7BA 3VEPA 1TT5B 5HS8A 4PJ0C 2LY1A 3FXMA 5FB2A 4BXUA 2DA7A 2X51A 2DT5A 1LDDA 4BGDA 1QHHD 4YIIA 2H1KA 2M9HA 3OOUA 2KZGA 2TDXA 3VSLA 1ZRFA 1TQIA 2XKOA 4XKBA 1IRZA 1R36A 4HLXA 2K40A 1ZG1A 1HCRA 4E7KA 2HTSA 4DNCA 2XRNA 3BC8A 2EJRA 1P4AA 1X1BA 3V42A 1TP4A 3QP5A 3K4KA 4I2OA 3HZJA 5L3DA 5LLQA 5K5OA 2LF8A 4V2FA 4KIBA 3FF5A 3WTXC 3CO7C 1XSDA 3R0JA 3BLYA 2LREA 1IC8A 2PN6A 3I4MJ 2IA0A 4DOZA 4FTHA 5CLSA 1NK2P 3AL0B 2WWYA 3FBNB 4WF2A 2LLKA 1AKHA 2H09A 2EILH 1SMYF 1U5TC 1DPRA 3ASOH 3WTVC 3CCSI 2ZKZA 3J7ZI 3G4SI 1APLC 4XLCA 2Z99A 4ZDOA 3HSEA 3QYFA 4XNFA 1MBGA 1F5TA 4IF4A 2V9PA 5IOZA 2EPFA 4GYIA 2FD5A 2ZB9A 2XAUA 1OPCA 1MNEA 1ORKA 1LEBA 2EV6A 2DMQA 2HQ5A 4AIJA 2EV5A 3CQZJ 1MJ9A 5KHDA 1YX5A 2FSWA 3TW6A 5L3EA 3PQJA 1ON1A 4IXAA 4A3CJ 2FOKA 2M7AA 4L9VA 4O6JA 1OR7C 1Z3XA 4M3FA 2IS4A 1VFCA 2EZIA 1F36A 4B3AA 2QWWA 3V7CA 3W2VA 3KEYA 2LSOA 5HDKA 3A1YA 4BE1A 1TTYA 1B4AA 4BJTA 2BY1A 1FIAA 2QZ8A 4CZCA 5JLWA 3HOTA 1ULYA 4BDYA 1YI2I 1JGSA 3H5AA 4HDUA 1F43A 3K4LA 3M8FA 1YQAA 3GZ5A 4JX4A 2H8RA 3ZQ7A 3K4BA 1X1PA 2UXNA 4OIPF 2DT7B 2GM4A 1OCOH 3W2WA 1YITI 1T8IA 3L2RA 2BZTA 2HYJA 2IS1A 5FKOA 2NAZA 4HNUA 1JXSA 3FK7A 4HQEA 1W5SA 3E6CC 3SZPA 3S2WA 4MTEA 3BR5A 4X0GA 3GMEA 4ON0A 4ESBA 4A2UA 1Y39A 1QZYA 2FNPA 5FROA 4E7HA 3BG5A 3BROA 5E20A 4NQWB 4MFEA 4Q5SF 3CDIA 3MKLA 1YO5C 1Z6RA 4NBQA 4JX6A 2HQNA 4P9FA 4UUTA 5F0HA 2ACJA 1SFXA 4G7OF 3S8PA 4M9XA 2HZTA 3RZDJ 3K7AJ 2K02A 2R7VA 3OYCA 2CV1A 1RI7A 3DU6A 1LFUP 2WAEA 1D3YA 2V9KA 4M74A 4Y13A 1IN7A 2K4JA 4LFUA 1LE8A 1SD4A 3K4CA 5ILSA 2Z9OA 2OD5A 5F27A 3JAMK 3CESA 3ELKA 4QLCU 3WTWC 3LOCA 4CH7A 2ZMEB 3WU0A 2LTPA 2M8GX 1V3FA 2OF7A 2QF7A 2MGQA 3ZR8X 2LF7A 5M5WJ 2ZJPF 2L54A 3GZNB 2OTJI 1BI3A 4F91B 1QVUA 2D2WA 2K9QA 2E5NA 1YX3A 2MG4A 2FBKA 3GXOA 2FQ4A 2ZCWA 1U9NA 2P0WA 3KP2A 3F8NA 2X9DA 1Y1WJ 1ZQ3P 2PMHA 1B72A 1PYVA 1D0ZA 4O3MA 3ZP5A 4HX4A 3BY6A 5HS7A 3SZTA 3F3XA 1IV8A 3LAPA 3CCUI 3J7YJ 1SFKA 1T56A 1IW7F 1DGWY 2Y30A 3TO6A 1K78B 1IG7A 4BL0B 5DEQA 2AO9A 3ZOBA 4YFKF 2QUFA 4I09A 3AG1H 2KT0A 3SYTA 3BR2A 4GO1A 2ECCA 1HKQA 4PFPA 2HYGD 3VB2A 1DU6A 1HW5A 4HBLA 4M6XA 4B47A 3QWLA 3Q9SA 4KITB 3FDYA 3FMRA 3RCOA 1ETOA 1QRYA 3PL8A 3L09A 4I0AA 1QVTA 3DPLC 3JRDA 1A36A 3FKJA 3RQIA 1WI3A 2HVRA 3SQNA 1M1EB 5F6FA 1P7JA 2JK3A 1OCPA 4MGRA 2VOOA 4A6EA 2YSRA 4BHBA 1FBQA 3H9JA 4I7HA 2DDBA 1WQ2A 2RREA 3W6JB 3RKYA 1FY7A 2A3SA 3V8LA 3ESWB 2GA1A 4M3EA 4LG3A 1ETXA 2M8EA 3JRAA 2MW8A 5CQEA 2KIUA 3IL2A 2W00A 4RM2A 2IA2A 1IXCA 3HRUA 4C3IJ 1CQTA 5K1YA 1PP7U 3PFIA 1O3TA 1JE8A 1YJWI 3UNGC 1ZTRA 4PSXA 1D8KA 3QU3A 3FZVA 4KT6A 4CYCB 5GAGJ 2E71A 1EA3A 4NNJA 3KEOA 5ED4A 2VBYA 2HQAA 1K61A 4KUMA 3I59A 2XGCA 4RB0A 3CMMA 2IBDA 1HKTA 1W5TA 1R9TJ 5EGOA 3N97A 2XAHA 3FWEA 3P9KA 3K69A 4RB2C 3J81K 1X4OA 2NRAC 2CU7A 4C3JJ 3BTIA 2FNAA 4ASNA 1ZARA 2D1HA 2NS8A 2HOEA 3E1SA 2CFOA 3OYFA 2L7KA 3DKXA 4Z6YA 2DOAA 1YLFA 1T0FC 3CMEI 3VPRA 2RAEA 1WH5A 2JA5J 2WB1A 1VQ5I 3RTRA 3J7AY 1T08B 4B09A 5B5EC 2AQEA 2MSYA 5HNFA 3HIFA 2V7FA 4P5OA 4PGHA 2COMA 1IN6A 3MN2A 4E4HA 2VI6A 2DFHA 5JI6A 3ZXSA 5J6XA 2QA4I 2DYRH 1WKMA 3C1DA 4A3BJ 3FBIB 4XR6A 4PSWA 3MKZA 4PJMA 2QVOA 3CP8A 4R8HA 2QQBA 2OBPA 1KZHA 4N0BA 4XN0A 1HSTA 1E17A 4PK4A 3TO7A 1USSA 2WAQA 4D9JA 5HLHA 1I6HJ 4L5JA 4EJUA 3JW4A 3RZOJ 2HS5A 2XGEA 3WG9A 1RR8C 3KE2A 2M30A 3P5JA 2ESNA 4BU2A 1WWXA 3CTAA 1HA8A 4X6AJ 4KA4A 1QHGA 3RKWA 2EA2A 5EEGA 5EYRA 2LY9A 3ZQQA 4XIDA 2E1NA 2HDDA 5D5WB 2E2JJ 6PAXA 3CUQA 3SFZA 4A0YA 3NEUA 2KIFA 4MEXF 2X6WA 2JRTA 5J40A 5DCMB 2GZWA 2HOSA 4R79A 3H36A 2IS6A 3QQAA 1MBJA 1USTA 2ZSHB 5ERIA 3CCRI 1E3OC 3WTYC 3CLQA 4RMNA 4II3A 2DFEA 3K10A 3LA7A 3LSHA 3UKGA 2FX0A 1IDZA 5LGUA 3HRTA 1B6AA 1IN5A 1NHAA 2I8DA 1B8IB 3EYIA 3RJPA 2OV7A 3MFKA 1POGA 1BI1A 3K4MA 4RAFA 5K7ZA 3T8RA 5JVGF 1LKXA 1UG2A 3NRVA 2X1CA 4AD9A 2VBXA 4G6DA 3I59B 3IC7A 2R0QC 3HGGA 2O03A 1IAWA 3BWGA 5EGOB 1NG7A 1FNNA 1PUFB 1KQ0A 3M8JA 1P92A 1KGSA 2ESHA 4KJZA 4RGSA 3ABMH 3KPHA 2VQHA 3LA3A 5H6RA 2ME0A 4BUPA 4CICA 2GQQA 5EEHA 1HSJA 2YUSA 5ILUA 1F9NA 2HZDA 1U8RA 2DOEA 2IGNA 5IYCJ 3D1NI 1B1BA 2ELJA 4OINF 1WFXA 1YRNB 5DM7F 2M0CA 2WA0A 4A93J 3L2QA 1Y0NA 2B7EA 2W84A 1QZEA 2VE9A 2W4SA 4XICA 2ZJRF 2A5YB 2V6EA 1LFPA 1YG2A 2AQFA 5DV5A 1O57A 2COBA 2MABA 3ASNH 3MZYA 3Q0WA 3FHZA 5LRRA 2Y0SN 4E7LA 5FLVA 1WZ2A 4RB1A 4BJ6C 5FO5A 1VQ8I 3TQNA 1SVOA 4FX4A 2CSOA 3HOZJ 3ISPA 3GFIA 4CUGA 4MTDA 4RDUA 2IGMA 3KZIC 1WH7A 1B9MA 4I98B 2RN7A 1MMDA 2L01A 1HDDC 3CUQC 2XKPA 3I55I 3BR1A 1F1ZA 1XSVA 4KICA 4I99C 5IPAA 3N4MA 1UMQA 4WCGA 4M6VA 3L1PA 1E0EA 4XRMA 3OL4A 5HODA 1X3UA 2WB1N 2CV0A 2EV0A 2GIZA 3F8FA 2K9NA 2G7UA 2MD0A 4B48A 2QSFX 4YFNF 3LFKA 3S1RJ 3MKYB 1WJEA 1I27A 2JA7J 4KT5C 3CUOA 3E5XA 3GTMJ 4LIUA 3H5RA 1RUNA 1UFMA 4MQ9F 4HLYA 1QNTA 2K4BA 2DDAA 4YFXF 3K70C 1U2WA 2O8KA 1PJRA 1SMTA 1MW7A 5JVTA 4ITVA 3ABTA 1X4PA 3KP6A 4G94A 1MMSA 4Y7NJ 2EFOA 4FASD 4XRSG 4KIFA 2KIQA 1WJDA 1UHMA 3LSMA 4BE2A 2CWEA 5TRDA 1FT9A 1IJWC 3BZKA 2DA5A 5TGTA 2LC2A 3KYCB 3G1MA 9ANTA 5E3MA 1QO0D 2G7HA 3PNYA 2R7RA 3SZGA 1YHQI 2DFIA 3ML6A 3KETA 2HU9A 1E3PA 3BR6A 2O8XA 4JYKA 3BJ6A 1TL8A 4S0HB 4DZJA 4LD5A 2VKVA 4M6YA 5AIPA 2Y9ZA 4G7ZF 3KX2A 1RIOH 1LUJB 1ODDA 2BE5F 1EKEA 2DA1A 4ZYAA 3HTUA 4E7ZA 4EGYA 3QPSA 4FE4A 2W57A 2FE3A 3BPVA 5IP7J 4LG0A 4ZZLA 3OS2A 3K1MA 3TMOA 1U5TA 4NC6A 3KEQA 4W97A 2M4KA 2Y31A 4U0YA 2EH3A 2VN2A 5CVJA 2D1VA 2JUGA 1DDNA 2KHMA 3CCQI 1X2NA 1TT0A 2LNBA 4H4KC 4BBSJ 3S3NA 4C2MJ 3VYUB 2HVSA 2O0YA 5DTDA 1H0MA 2X1DA 2W1OA 2BW3A 2VC1A 4ESJA 1MGTA 1A35A 5EEAA 3E6DA 5BPIA 3AL0C 3BT9A 2RQPA 4ESFA 3R61A 3I53A 3TP3A 3AG3H 2L7FP 4BHCA 3JRHA 3RI4A 3OYDA 1MSFC 1R1UA 4A3LJ 2IRFG 2C6YA 1RPWA 2HWVA 3F22A 4XMYA 4N4OB 4XRFA 1IUFA 4A0ZA 5H2FC 4QTRA 4PCQA 1XMXA 1R4MB 3FIWA 1QPMA 1S7OA 2YX4A 2HPMA 4IHXA 3OV8A 3S1QJ 1J09A 3CMYA 1ETYA 2HPIA 2Z2SB 4IOCF 3S2DJ 5E1WA 4WXDA 2BYVE 4UHTA 3BR0A 1SFOJ 1X19A 1FYLA 3ERMA 1IRFA 1OQYA 3LMMA 2DT6A 4V19K 3CDHA 3GWZA 3H92A 4LIVA 3A0BC 5LHHA 3G73A 3RQ4A 3KYDB 2ZXWH 4QSHA 3S16J 3IRRA 2R7ZJ 1I6XA 1OKRA 3B73A 3T8TA 2NNNA 1X3ZB 4DYCA 3S17J 5H6QA 1LJ9A 2MLGA 3PO3J 5L3FA 4NDLA 3F0CA 2IJLA 4UVCA 1FSEA 5BOXA 3HB9A 1GDTA 4LJZF 4IPAA 1OFCX 4XOPA 5HDGA 2R7DA 1WJAA 1U8BA 4XLPF 1DUXC 1A31A 1MNDA 2RVCA 3JRIA 3TEDA 1W36D 2Z3YA 1G3SA 2RKHA 2LVSA 3MZ8A 4PJJA 5FJ8J 2W7NA 5J47A 4J19A 1XCVA 2X4HA 4A3KJ 1AKHB 1K6OA 4BY7J 1XGSA 1VQ6I 3K0LA 1YIJI 2HDWA 3DFGA 3HKZN 2PMUA 2CQXA 1S8NA 5HLTA 1T39A 3V7RA 2OCCH 1LVAA 3FISA 1VQLI 1T98A 1VI0A 1YIOA 2XVCA 3V7SA 4RLFA 2V9VA 3OS1A 3LWFA 3DPUA 3CCVI 1GT0C 2K5CA 3M07A 3QAHA 5J4YA 2W82A 1U3EM 3HRMA 4FT8A 5F1RA 1W1WE 1XDUA 3K4JA 3OYEA 4C2UA 3IUOA 2NXNB 1GVDA 1JKPC 2VKHA 1D5YA 4L0ZB 3B6AA 2CMPA 4OAYA 5KVRA 1RRJA 3S2HJ 3HGYA 5GTIC 1JI8A 4ZDPA 2BY2A 2DO7A 2E60A 2Y75A 3GO5A 1SC7A 4CGZA 1QGPA 2XPWA 2DK8A 1FOWA 3KP3A 5D8LB 2M4GA 3OR2C 1B9NA 2WV1A 1QZZA 3ROUA 3CMAI 3R4KA 3CC7I 3GBGA 5J1YA 2W85A 4ENKA 1YS6A 3BG6A 3EUHC 5JFRA 5BQTA 1LDJA 2L4MA 4D7NA 2DMNA 1YOVB 2NNYA 2O7OA 3HPGA 5L3BA 3S1MJ 1EF4A 3J80Z 1YW8A 2E35A 2K3PA 1XB4A 3EQLF 4ANJA 1ETWA 2PLYA 1V5GA 5HOOA 1SD7A 4UB6C 3HKZA 5CJ9A 3A03A 4AU7A 3JRFA 1SEUA 2P5KA 2A07F 5CYVA 4CCKA 3H9GA 4Y4RA 3G71I 3LSIA 1OCRH 3DEEA 2Z5UA 2H27A 2LFBA 5LD2C 3CCLI 4L0YB 3HSFA 1RETA 1ZN2A 4ZDLA 4UB8C 2HTJA 1HQCA 4XLAA 5D8KB 2HDCA 2K9SA 3ZQCA 1OCTC 5M3FJ 2LOOA 3D0SA 1BIAA 2YX7A 1EV7A 1VQMI 3NWSA 4J00A 3M1EA 3SEZA 2K9LA 5FKLA 3A02A 3BZ6A 1S3JA 3ZMUA 1DGRM 2KPMA 3TL4X 2WY7Q 3WHCA 1W36C 3K9TA 2DA4A 2F48A 2JTVA 2KZVA 5CVUA 3CCMI 2EA4A 3L2UA 4EVIA 2DFFA 2ID3A 2IA1A 1N25A 5M5YJ 1TNTA 5KAIC 1ETVA 4ZYHA 2CW8A 3O8GA 5E79C 3TBIA 1MNMC 2L2OA 5JR3A 2IGKA 4PGGA 3OSGA 2BXYA 2CH0A 2JVGA 3FXRA 1VTNC 4DW6A 3OY9A 3SJMA 1BI2A 1R49A 2GXBA 3RIRA 1MMNA 4EJOA 5B66C 3LSRA 4E7SA 1WJBA 1K78A 2NVTJ 2LY2A 4GCVA 4A3DJ 2TCTA 1MBEA 2WAFA 1HKSA 2F5FA 4MQVA 3HOYJ 1SVMA 4V2GA 4BEHA 5HDNA 3IV5A 3M3YJ 4F52A 5GTHC 1GV5A 2EFQA 2M2EA 3NARA 2Q1ZB 3IWFA 3IP4B 3JRGA 5CQGA 2NS0A 1ZR4A 4IQ4A 2E34A 4M73A 4BE0A 1W7PA 4Y15A 2ZXJA 3MMYB 3Q0VA 2FA5A 2X48A 3LAJA 4P1WA 2B9SA 2D5VA 4XKCA 1G2HA 4EJVA 5A2QZ 1K83J 1UHSA 2IW5A 4C2TA 3ZMZA 4HYEA 3O8HA 1NK3P 3FK6A 2R5YB 5EZHA 1QU3A 3HXLA 2XV4S 2L02A 4KMFA 3K1NA 1UELB 3HEFA 3ZMSA 4DQ2A 3QP6A 4KIGA 2ZFUA 2TRTA 2F5DA 2E1MB 1WGXA 2ZNZA 3DBHB 1R6RA 4R1HA 4CYCA 4AC0A 2HI3A 5GAHJ 2M5WA 1LNWA 5GPAA 3GTJJ 2ZBKA 2XHKA 2LR8A 1BOBA 3VWBA 2G0EA 1K79A 5DM6F 2JA6J 3EYYA 3E3VA 3ECOA 1OISA 4WXCA 2PX9A 3HYIA 3FXLA 4LG0B 4B1RA 3HJEA 1TZLA 2VJIA 2V1XA 3VYRB 5J3LA 5FLMJ 2EIMH 5K7FA 3RPQA 1UZCA 3DLAA 3S1NJ 1OMIA 1T6SA 3GCMA 1PVEA 5GP9A 1XN7A 2STWA 3K6GA 5F0FA 3SFIA 4GDFA 2DMUA 3E7LA 4C9YA 1WI9A 1T0FA 2KISA 4YRVA 3RKQA 2XDVA 3ABUA 1SAXA 3GFMA 2OAZA 2XB0X 4E7IA 2F2EA 3LFUA 5DYMA 3OWTA 2P8TA 3TOBA 4Q48A 1V54H 4DIQA 1BC7C 2M0MA 2FXAA 5F0CA 3U21A 2GXGA 2R3SA 2CUZA 1N75A 4MHGA 3K2AA 5LBQA 2ZJQF 2WY8Q 1KU2A 3OYBA 4FE7A 3EPZA 3R60A 4MO7A 4XLNF 1S72I 2A5WA 2D45A 3MQ0A 3DCFA 2MBFA 5DCMA 2OU2A 5AONA 1BC8C 4ZTFA 1BA5A 2VB6A 2K86A 2BVLA 1ZKGA 3QPHA 5EG0B 1FZPB 2Y2ZA 2KIMA 1B8IA 3H9QA 2FUG2 1RESA 3OYLA 1ONVA 1SFEA 2IPQX 2X6YA 1TC3C 3CF2A 5H20A 3CUQB 3NWTA 3JREA 2N8GA 2ZSIB 4CCMA 1ZAOA 5EZGA 4AVZA 2EIKH 3I71A 1IUYA 4BY1J 1LE8B 2A6EF 1MMGA 4UV9A 3TOAA 4UVBA 2KFDA 1R1VA 4CDGA 3BP8A 3KP4A 5CVVA 1MSEC 3COAC 3WU2C 5D5UB 2FEZA 3L00A 1EH8A 1SD5A 4Y3OA 1VQ9I 1BM9A 2E2IJ 3DP7A 1U78A 3BCBA 3CCEI 5K5RA 4M3BA 2Z33A 3FXUA 4YIFA 5EG0A 4RGRA 1W4MA 1HC8A 1WPKA 2NOGA 3OYJA 1B72B 1C0WA 2LBFA 3K70D 2CQKA 3IH4A 1HBXG 2NVYJ 4FHTA 3F21A 2MFZA 4CCJA 1IZ1A 3HG9A 3SHFA 2CUJA 2VBZA 3WHBA 1G8XA 2VKEA 4EV0A 2JSCA 3C3WA 2BY0A 3QRFF 5IT3A 3I58A 5DD4A 4KFCA 1V5FA 1D0YA 2KJBA 2LH9A 1Z3YA 4A6DA 3JTHA 4LITA 2DLLA 1A6QA 1TW3A 2M34A 1J75A 1O4XA 4OMYA 4EATA 2EIJH 2R7UA 3WU1B 2A6HF 4A69C 3ZMTA 2P6TA 3QYBA 4IKFA 1FC3A 4U87A 3KCCA 1AOYA 2XC7A 2OQRA 2DTRA 2JRMA 1FIPA 2BGCA 4F55A 3DPTA 4MIMA 1ZGJA 3DWLE 3GEZA 1SVLA 3M1CA 1ZRCA 4G6QA 1N78A 2W24A 2QKMB 2QGUA 2XF6A 3L7WA 1TWCJ 1DP7P 3CJNA 1I1GA 2J5OA 3TGNA 2CO5A 2VBWA 3GTKJ 4UVAA 4C3HJ 2RC4A 3DTIA 3E97A 1R22A 4E6KG 1AA7A 2MH2A 3RDIA 5D5XB 2CUEA 3DTKA 1CF7B 3I54A 4UUSB 4WXHA 1HDPA 2H94A 2VT3A 3Q5FA 3DBRB 4KN7X 4HF1A 1JKQC 2KKOA 1FOYA 3U1DA 5L3CA 1E2XA 4ENMA 1V5EA 2X6XA 3AG4H 3DEUA 2GLOA 4BXXJ 4Y33A 3I4PA 1JKOC 4PJNA 4DGWB 4RA2A 2QBYA 5FFXA 2M1BA 4PZJA 4RGUA 4LMYA 4B4CA 5LHIA 5C3EJ 3FXJA 1ERDA 3PO2J 3H5NA 5CVRA 5FD6A 1XMAA 2DODA 4I6ZA 1WHUA 2VPRA 1ZLKA 2X6OA 4RBOA 5D4SA 2ZC2A 2QSHX 4UUVA 2CYYA 3ZQFA 1Y8RB 3J80K 4HG2A 2R4GA 2MLKA 3WTZA 1O7FA 1EH7A 2L3DA 1QQIA 3IAM2 2JQ7A 3C2GA 1GVJA 1IXRC 1BBYA 2QKLB 1PDNC 2RQQA 2LG4A 3HPHA 3JTGA 2VOPA 5IOYA 4A5MA 3HOWJ 4HNTA 4BQOA 4NHJA 5F04A 1W5CC 1RR7A 3GTOJ 3FMSA 1QA6A 3C18A 2O6GE 1JUMA 3ABLH 2XGDA 1D5VA 2XROA 4XQFA 5E3OA 3GW2A 2I5UA 1S7AA 1IN8A 3SDGA 1IDYA 4XOTA 3MEXA 5B3SH 2FRHA 5JHFA 4KISA 5CPRB 1BL0A 2F4IA 3E6BA 1TNSA 3HHHA 2UUZA 2JWTA 1G6NA 4GFBA 4G6TB 1OJLA 5C4JJ 3IH3A 3FXOA 1VQPI 1R5HA 3U9GA 2ICWG 2HOAA 5J1UA 1FBSA 4OAZA 5IY5H 2PBIA 1Z9CA 2R7TA 4E7JA 1MZBA 1ACIA 4U0VA 1IRGA 1MJBA 1DPUA 4HEA2 4ZYEA 4I01A 2P4WA 3WE3A 5BMZA 3HL2A 3HDDA 2DXIA 1T38A 3T1BA 5ICGA 3H35A 2XF5A 1CF7A 2ISYA 2VXZA 3PUBA 2LRDA 1JTXA 2K27A 4NQWA 2PMZA 3WTTC 2DQRA 3OR1C 5IP9J 3WTUC 2VPLA 2YPRA 2KRFA 5J8CA 1KONA 3LSKA 2AHQA 2A6TA 3KFWX 3HRSA 1XX5A 4RGXA 1SAUA 2RDPA 5TJJA 2GBYA 3IKVA 3DLLF 2OZUA 5ICCA 2FF4A 4I02A 3ZRGA 2P5VA 1S9HA 2VL8A 2E7WA 2V1NA 3BG7A 4JP0A 4ZJZA 1JKRC 1H88C 4YEJA 3DKYA 3KZYA 4N9HA 4DYQA 3KYLA 5DD8A 1REPC 2DK5A 2CQQA 1I3QJ 3H3UA 5JLXA 3V8JA 2LKPA 2XSJC 2RNJA 4CCNA 5E18F 1G3WA 1YE9A 4TV7A 1PP8F 2BHZA 1HF0A 5D5VB 3SDBA 3GFJA 2ADUA 2CJJA 2GXAA 1FOXA 3OL3A 4BJ5C 4A5NA 4AYBA 4MFDA 1FTZA 2XAFA 1ZGWA 3W2AA 2XSDC 5HLGA 1XG1A 2AXTC 5FRMA 2ZNYA 1FP2A 2H8WA 1KYWA 3BPXA 5GAEJ 3ZQGA 1A04A 2IXSA 4A3EJ 1PUEE 4A3GJ 1RNLA 1Z7UA 2V6CA 4L9TA 2DYSH 2KMUA 2HKOA 5M5XJ 1Q1VA 4BACA 3F23A 1BW6A 3EETA 1J7KA 4QPOA 4B44A 1XS9A 1YTYA 4L5EA 1G3YA 2VUMJ 1KQ8A 4A0XA 1LEAA 5IT9Z 4BAYA 4LLGF 1TW2A 3JSPA 3VYTB 2YS9A 4N9IA 1X1CA 4FX0A 1X3WB 5KAFC 4BXFA 5E17F 5FLXZ 4XSXF 4CHUA 2DCEA 4UY8I 3S93A 2NVUB 4ENNA 1T95A 5L3GA 1WVRA 3E6MA 3DEWA 2H1LA 4IZZA 4Q47A 3CCYA 2YU3A 2MC4A 2ELKA 2Q0OA 4L18B 3CDLA 4D0PA 4WWCA 1P4XA 3F8CA 3OYGA 3BZCA 3CP2A 4JK1X 2A68F 1O3RA 3OYNA 2CS3A 2PG4A 2OPTA 1FP1D 2VASA 2XRLA 2P6SA 1J5YA 3AKZA 4C30A 4XLFA 2XGXA 2IP2A 3A4CA 3QOPA 3BTCA 3MD2A 2HGCA 3RYRA 2PQ8A 1BR4A 2VJ5A 3B6CA 4D5CA 1MDMA 1WJ5A 4E70A 4IHVA 4PUSA 1JT6A 3B02A 1HW2A 2JN6A 1IF1A 3HC7A 1VF9A 2XAQA 2B63J 4LLLA 1W0UA 3WTSC 2OC6A 4I76A 3D5RC 1T2KA 1DU0A 5LGTA 3CO6C 3ERED 2LD5A 3NAUA 1TWGJ 2E5ZA 2GIVA 2EK5A 1W0TA 4CYDA 4IVNA 3RPUD 3BJAA 1J0RA 3VDXA 3KLOA 1H8AC 3M4OJ 3H0GJ 1U5TB 4HV5A 1MD0A 4XL9A 2R7FA 3ZGKA 4F7ZA 2BBYA 3GF2A 3C7JA 1JHFA 5F08A 2BOLA 2LYCA 1UCRA 2G9WA 3GYHX 2HEOA 2FQ3A 3GLLA 4AWXB 1HW1A 5IYBJ 4ZYDA 3OYAA 5LEKA 5FRNA 4HRIA 3H1CA 4IQJA 4EM1A 5FGMA 2KL4A 3ZPLA 3LNQA 3LSPA 1D8JA 1TBXA 2BW3B 3GTGJ 2KDOA 2MA3A 2MD5A 1JGGA 3NQOA 3PQKA 1UAAA 3SEQA 2UWMA 2P7CB 2ZMEA 1FMWA 4NC7A 4D7MA 5J4VA 3I3LA 3EUKL 1FMVA 2MC3A 4HOBA 2KQRA 4HV6A 1X58A 4IRHA 2R7XA 1IGNA 2V1UA 1I50J 2ME6A 2XASA 3DBLB 2PJPA 3KIOA 1ZGAA 5FFZA 3S3OA 1BR2A 1BOAA 3I5UA 1NG6A 5E1XA 1WCMJ 1WJFA 1Z91A 1RZ4A 2QQ9A 2DU9A 2L9VA 4LB6B 4AIHA 4ETSA 4HW0A 2LKXA 4OWRB 4BNCA 1W7PB 2IVMA 1UB9A 4G7HF 1Y0UA 3A01B 3JRBA 3PNVA 2UXXA 3L9FA 4XBFA 1K4SA 4H0EA 4IRIA 1TQMA 2JPCA 4BEHB 1I1SA 4I0BA 1TLHB 5FD5A 4XORA 2R5YA 4D5FA 1V4RA 2JZYA 3CJRB 4YELA 2E2HJ 2GWRA 4KMUX 3ZN1A 2JUCA 2V1DA 3PUFA 4UUSA 1KU9A 1ZHFA 2XB5A 2M3AA 1Z7LA 3FM5A 4GYGA 1KYZA 2HQRA 3G3ZA 1NH3A 1P6RA 5D6EA 2E36A 3BOQA 4DBRA 5HNHA 1H89C 1DP3A 2WADA 3GVAA 3H3ZA 4BYYA 4A3JJ 1KA8A 4XRSA 2ZFWA 3L2VA 4XKVA 1FX7A 3TP0A 4CCLA 1Z1DA 2M87A 3E5UA 4MEYF 5LEJA 3HUGB 2XPUA 4EM2A 3QPTA 1WRJA 2CRGA 2VE8A 3Q0UA 2AXLA 2X85A 4NB5A 3QYEA 1G4DA 1MJAA 1BR1A 4BS9A 2P81A 4XLEA 4B43A 1A6IA 1OLTA 4J01A 1FSHA 3TO9A 1BIBA 3E5QA 4LK1F 2ECBA 4EJWA 3F9KA 1VQOI 1YRNA 2Q2EB 2F5EA 1QPIA 2DA6A 2CW7A 3JCUC 4CCOA 1LPQA 1MBFA 4U7DA 4DJAA 1XGNA 4IO9F 1Z6TA 2R7QA 1MH3A 2LKSA 1LQ1A 2I10A 2DPUA 3A0HC 4NUBA 1R1TA 2AS5F 3HUGA 2KRCA 1FPQA 2VJ4A 2BHYA 3TDZC 3T0YA 4IJAA 3OS0A 3EUHA 4DBQA 3DKWA 1BN5A 1ON2A 5FLXK 2UZKA 2QEXI 3BG9A 5K5QA 1IO2A 2Y0SA 2XAGA 1FYMA 3BCAA 3MWMA 2OCEA 5DS9A 2E19A 2KJCA 1IXSB 4A3FJ 1EJ9A 4BDZA 4HQMA 3CCJI 4RAGA 1X2MA 2RGVA 2DQLA 3OSFA 1ZG3A 1RKWA 4JX5A 3PSFA 4HDVA 1ZG5A 3OIOA 1XMKA 4XKWA 1U6GA 2ISZA 3ZQIA 4EEFG 2PFBA 2B0LA 5M3MJ 4Q4ZF 5B1AH 3R0AA 4HA8A 1Z0XA 4P55A 3GLXA 2L7ZA 2DI3A 4F92B 2ELHA 2L7MP 3MCZA 4M3DA 1R23A 2R7OA 3HBLA 2PJRA 5DUKA 2DN0A 1S5LC 3L2CA 3C2BA 2PEXA 3FXQA 3QOEA 2IAIA 3F8MA 4A12A 2WV0A 4IEJA 3ONQA 4PJLA 3FHNA 3AAFA 3VODA 4HNVA 2L5QA 5IP6A 2LDUA 3HSRA 3QPLA 2L9RA 5A2QK 3P7NA 1BW5A 3J7AO 1K7AA 4ENJA 3VFZA 2LBFB 3WG7H 4IHSA 4IHTA 2QSGX 3G2BA 2A61A 1D1CA 2HKXA 5HVQC 3ECHA 1LDKB 5BNGA 1R7JA 2WC2A 5DDGA 4RM3A 3I0TA 1Y8QB 3ZMVA 1CGPA 3G6EI 1Z67A 2Q2EA 2RNGA 4RLQA 3WODF 4Y52J 1OYIA 4ZTJA 2GOXB 2VLAA 3P9CA 4PFOA 3X2QH 5BS6A 2VC0A 1YW7A 2IS2A 3V4GA 2VIXA 2ZMEC 4KN4X 4HPQA 1R58A 1SFUA 1JJ6C 5FKMA 3HOSA 5J1RA 1R5GA 3HOXJ 5LGNA 4K2EA 4BQAA 1PUFA 2EFWA 1AWCA 4GGGA 2JT1A 2FBHA 1JJ8C 1G3TA 3JAMZ 1ETQA 3T5XA 2BXZA 1JHHA 2QLZA 2RV8A 4HF2A 1X1AA 1JUSA 5EJCA 2P5LC 2R93J 2DTZA 4AUXA
chains in the Genus database with same CATH topology
1UZCA 2DOEA 2KFDA 2K85A 2KISA 2E71A 2KZGA 2L9VA 4FQGA 2CQNA 2B7EA 2DOFA 2KIQA 2LKSA 2DODA 2JUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZC A;  2DOE A;  2KFD A;  2K85 A;  2KIS A;  2E71 A;  2KZG A;  2L9V A;  4FQG A;  2CQN A;  2B7E A;  2DOF A;  2KIQ A;  2LKS A;  2DOD A;  2JUC A; 
#chains in the Genus database with same CATH topology
 5KK1 A;  4ZH4 F;  1FEX A;  2PMZ N;  1D1A A;  4XON A;  2OA4 A;  3F72 A;  1Y6I A;  1ZYR F;  2CUF A;  2STT A;  4L9J A;  2EQR A;  5DCF A;  4O5V A;  4M9S A;  3U1K A;  2Y69 H;  2R7S A;  1J2X A;  2ZO4 A;  4II2 A;  3GZ6 A;  4W1U A;  2EZL A;  2R92 J;  4IL6 C;  3QOD A;  2PJR B;  5FKK A;  3BG3 A;  4U7B A;  1XGM A;  3FMQ A;  3BQZ A;  3H0D A;  2OJE D;  2FML A;  4AIK A;  2IGO A;  3E0J B;  3HOU J;  5LRS A;  4BQN A;  2QQA A;  3M8E A;  3BTJ A;  2QQ8 A;  2NOJ B;  1XDS A;  3LSG A;  4LOC A;  5CVI A;  1JT0 A;  5KNL A;  1OCC H;  2HXI A;  1ZR2 A;  1FJL A;  3I4N J;  2IEK A;  2JA8 J;  1P7I A;  2HNH A;  3I56 I;  1F4K A;  1Q1H A;  2DAO A;  3OIP A;  3ZCO A;  3IRQ A;  2HXO A;  1AHD P;  4PDK A;  2QBY B;  2E1M C;  5D4R A;  1S29 A;  5E8I A;  4EMS A;  5E3L A;  4OIO F;  4QPQ A;  1E3H A;  3BJO A;  1LFB A;  2HR3 A;  4U88 A;  3C2H A;  4HSR A;  2V26 A;  3REO A;  2V79 A;  4XSZ F;  4BQQ A;  3TKY A;  2CQN A;  1Y56 A;  2WTE A;  4EQQ A;  3ZMD A;  4L5I A;  2A05 A;  1LVK A;  2EFP A;  2KP6 A;  2ZXI A;  3LSJ A;  3W6K B;  5ICE A;  3PJR A;  1ZK8 A;  3WGG A;  3AG2 H;  2X1E A;  2XIG A;  3IAS 2;  2IT0 A;  1X1D A;  3GTQ J;  3V8K A;  4UXN A;  1RC9 A;  4CXF A;  3A2K A;  4RAZ A;  1I39 A;  2OUM A;  4HX7 A;  1V55 H;  4X1E A;  4BH9 A;  3DF8 A;  5F1J A;  1AU7 A;  4UNO A;  4G12 A;  1ZLJ A;  1NTC A;  4ZC3 A;  1BI0 A;  1OCZ H;  4FCY A;  1MBK A;  4YG2 F;  2FBI A;  3H3V K;  1MBH A;  5HS9 A;  1J9I A;  2FU4 A;  2OTL I;  2P7V B;  4QIW N;  3IWZ A;  4AM3 A;  5IYD J;  3W6V A;  1ZEL A;  3K2Z A;  4DZP A;  3GX4 X;  3L2W A;  5CKT A;  1XCB A;  2W48 A;  1FOK A;  2VXD A;  1HLV A;  4FET A;  1RUO A;  1GUU A;  2F4O B;  3QU6 A;  1QBJ A;  1GXQ A;  2FJ1 A;  2F4M B;  2LP0 A;  1HXD A;  2NVX J;  5J8F A;  4FIS A;  2VQC A;  2HVQ A;  1JUP A;  3EUA A;  1GHC A;  4G9Y A;  4XK4 A;  2GAU A;  1Z05 A;  1TWF J;  3HTS B;  2KDZ A;  1K4T A;  2F6C A;  1SD6 A;  1XSX A;  2KLO A;  2EBI A;  3DU5 A;  1VQN I;  3DQV C;  1YS7 A;  5LHG A;  2OQG A;  4HX8 A;  5LFA A;  1GXP A;  1MIJ A;  4IRG A;  2DOF A;  3VSK A;  2JA2 A;  4NC8 A;  3JSO A;  1ZH5 A;  2JMW A;  3M9A A;  1I5Z A;  3N05 A;  3O2P E;  3MAJ A;  4G8X A;  5E8G A;  4IOA F;  2HOT A;  1MKM A;  2L9N A;  3Q3S A;  3ULQ B;  1ITY A;  2BVM A;  2VON A;  4AYB N;  2O61 A;  4CSW A;  4RB3 C;  4KDP A;  1XD7 A;  3M7G A;  2ID6 A;  1IN4 A;  3O6B B;  4Z2Y A;  2BEO A;  4M72 A;  2NVQ J;  5C44 J;  4WX9 A;  3OYK A;  5GAD J;  3MKW B;  2K9M A;  3CLO A;  3PFY A;  1OYY A;  1K6Y A;  3I64 A;  2DMP A;  1T33 A;  3WE2 A;  3FKI J;  4LGW A;  4KNY A;  2VOD A;  3I9V 2;  1YJN I;  1EH6 A;  1O7L A;  2Z16 A;  4AID A;  3WGH A;  2VT2 A;  1W7P D;  2XF7 A;  5ILV A;  3DTE A;  3PIO F;  3K4N A;  4S04 A;  1XGO A;  3CZ6 A;  2JVH A;  5KCM A;  2V4J C;  1JTY A;  2LMD A;  4OMZ A;  5DUI A;  2PI0 A;  1D1B A;  3OYH A;  1IV6 A;  2ZJ2 A;  1MDM B;  4IHW A;  1G59 A;  3CC2 I;  3GTP J;  1GLN A;  1OYW A;  4HST A;  1KU7 A;  2F5V A;  4HAM A;  1IRX A;  4F3Q A;  3R6S A;  3KP5 A;  4LK0 F;  1U9O A;  4EGZ A;  1VQ4 I;  2DJI A;  2F5C A;  4CZZ A;  4ZZD A;  1Z77 A;  3VYS B;  2YR2 A;  2CW0 F;  3IH2 A;  4JOM A;  2JPB A;  4GXO A;  3JR9 A;  4N4N B;  4HZF A;  1Z21 A;  3BTL A;  3IHU A;  4LB5 A;  3HHG A;  2LK2 A;  5C4X J;  3JRC A;  2HFH A;  3PNT A;  1P2F A;  2H6C A;  3K1P A;  3LL7 A;  1L3L A;  3LST A;  5EF6 A;  3CD6 I;  2QEN A;  3TDU C;  3LA2 A;  4B3X A;  2VQL A;  4A3M J;  3BQY A;  4EJT A;  1FLI A;  1R71 A;  2CV2 A;  4Y17 A;  4IX7 A;  1BJA A;  1P9Q C;  2K3F A;  3GUD A;  4P9U A;  3S14 J;  3DXJ F;  3F6O A;  4IHY A;  1MMA A;  2XPV A;  2K7L A;  3LQR A;  2EZK A;  2O5R A;  3CJT B;  2X0L A;  1GV2 A;  3PSI A;  2L9S A;  4XLH A;  1D0X A;  1WJC A;  1R00 A;  2DA3 A;  4EM0 B;  3OYI A;  2XAJ A;  1STZ A;  3CF5 F;  1R4N B;  5E1Z B;  5E3N A;  2CGP A;  2OZ6 A;  3IKT A;  3G1O A;  1OR7 A;  1B59 A;  1O3S A;  2DW4 A;  2DJN A;  5GPC A;  4GRI A;  2L4A A;  1UG0 A;  2WAQ N;  1TWA J;  2O3F A;  1R5I D;  1MH4 A;  2DMT A;  1WSU A;  2CG4 A;  4YIR X;  3G1L A;  2CFX A;  2EZH A;  2JSP A;  1XTA A;  4F93 B;  1TWH J;  2QCO A;  3BDD A;  1ZRE A;  1N77 A;  5D6F A;  2W25 A;  3RYP A;  3RSN A;  2EB7 A;  3D5S C;  2JJ7 A;  3A01 A;  5ICF A;  1YYV A;  3OYM A;  1HOM A;  3J81 Z;  4M9Z A;  4MLO A;  1A5J A;  1ENH A;  4CA0 A;  1I3A A;  4S05 A;  1VZ0 A;  2DA2 A;  4U0W A;  1S6L A;  2KRH A;  5BPD A;  2DPD A;  3OIQ A;  1UHW A;  1UJ8 A;  3D5L A;  3RPU A;  5EDN A;  4WK8 F;  1KU3 A;  4BHP A;  3GTL J;  2GA2 A;  4XN3 A;  4BKX A;  1VQK I;  2GOM A;  1YFH A;  2VKD A;  4KYW A;  4CO8 A;  3S15 J;  4OU0 A;  1SAN A;  2NS7 A;  3HOV J;  4OOI A;  2YU9 J;  4UV8 A;  2J5P A;  1BJZ A;  2BY3 A;  2A69 F;  2R5Z B;  3EDP A;  5K7H A;  4P96 A;  3MVP A;  4OIR F;  3ZQL A;  2VQG A;  2HYF A;  2Y48 A;  2DBB A;  1H9G A;  3DV8 A;  3FXK A;  3OMY A;  3UR3 C;  4A3I J;  3OOP A;  3MZH A;  4M3G A;  4RS8 A;  1VND A;  1FYK A;  2ETH A;  2ZXH A;  5HLI A;  3HM5 A;  1ZRD A;  2R7W A;  2FMY A;  1YW9 A;  3PIP F;  4B8X A;  1DQU A;  3CC4 I;  4FQG A;  5TIS C;  1O3Q A;  3S3M A;  3KP7 A;  1ETK A;  4HF0 A;  5FKN A;  3KZZ A;  2Q8K A;  2O9L A;  3O3K A;  2WBM A;  3BR3 A;  4L9N A;  4M71 A;  4XM3 A;  1YJ9 I;  2XUB A;  1KQ9 A;  3W3C A;  3TW7 A;  2L0K A;  2EWN A;  1FBU A;  4RAY A;  2E7X A;  3RKX A;  1L0O C;  1U0J A;  2MYS A;  5AIQ A;  3U2R A;  3ZN0 A;  3WGI A;  1XC5 A;  2Z1D A;  2NYX A;  2E1O A;  3GFL A;  3SXY A;  1VQ7 I;  2VJJ A;  2BV6 A;  4LLN A;  2EFN A;  1TQP A;  3S32 A;  2E1C A;  3PM1 A;  4DYR A;  1FTT A;  1XPX A;  3P9I A;  1LB2 A;  2H6B A;  2QYO A;  1FWZ A;  2CQ7 A;  4JBA A;  5IT9 K;  1J59 A;  2Y9Y A;  3FM3 A;  3AFH A;  2R5Z A;  1P4W A;  4QWQ A;  1S7E A;  1H9T A;  3F6V A;  3Q9V A;  2EIN H;  4OIQ F;  3ZQH A;  1Y1V J;  5B1B H;  4JQF A;  1RKT A;  4MNU A;  3VOE A;  2M45 A;  2MH9 A;  4ZYG A;  3ABK H;  5F64 A;  2UV1 A;  2Y0M A;  2FOW A;  3CJQ B;  4AVP A;  5JHU A;  2QM3 A;  3F8B A;  4ABZ A;  2K85 A;  3KLN A;  3LQQ A;  3FX3 A;  4D1Q A;  4BBR J;  2M7B A;  3VEP A;  1TT5 B;  5HS8 A;  4PJ0 C;  2LY1 A;  3FXM A;  5FB2 A;  4BXU A;  2DA7 A;  2X51 A;  2DT5 A;  1LDD A;  4BGD A;  1QHH D;  4YII A;  2H1K A;  2M9H A;  3OOU A;  2KZG A;  2TDX A;  3VSL A;  1ZRF A;  1TQI A;  2XKO A;  4XKB A;  1IRZ A;  1R36 A;  4HLX A;  2K40 A;  1ZG1 A;  1HCR A;  4E7K A;  2HTS A;  4DNC A;  2XRN A;  3BC8 A;  2EJR A;  1P4A A;  1X1B A;  3V42 A;  1TP4 A;  3QP5 A;  3K4K A;  4I2O A;  3HZJ A;  5L3D A;  5LLQ A;  5K5O A;  2LF8 A;  4V2F A;  4KIB A;  3FF5 A;  3WTX C;  3CO7 C;  1XSD A;  3R0J A;  3BLY A;  2LRE A;  1IC8 A;  2PN6 A;  3I4M J;  2IA0 A;  4DOZ A;  4FTH A;  5CLS A;  1NK2 P;  3AL0 B;  2WWY A;  3FBN B;  4WF2 A;  2LLK A;  1AKH A;  2H09 A;  2EIL H;  1SMY F;  1U5T C;  1DPR A;  3ASO H;  3WTV C;  3CCS I;  2ZKZ A;  3J7Z I;  3G4S I;  1APL C;  4XLC A;  2Z99 A;  4ZDO A;  3HSE A;  3QYF A;  4XNF A;  1MBG A;  1F5T A;  4IF4 A;  2V9P A;  5IOZ A;  2EPF A;  4GYI A;  2FD5 A;  2ZB9 A;  2XAU A;  1OPC A;  1MNE A;  1ORK A;  1LEB A;  2EV6 A;  2DMQ A;  2HQ5 A;  4AIJ A;  2EV5 A;  3CQZ J;  1MJ9 A;  5KHD A;  1YX5 A;  2FSW A;  3TW6 A;  5L3E A;  3PQJ A;  1ON1 A;  4IXA A;  4A3C J;  2FOK A;  2M7A A;  4L9V A;  4O6J A;  1OR7 C;  1Z3X A;  4M3F A;  2IS4 A;  1VFC A;  2EZI A;  1F36 A;  4B3A A;  2QWW A;  3V7C A;  3W2V A;  3KEY A;  2LSO A;  5HDK A;  3A1Y A;  4BE1 A;  1TTY A;  1B4A A;  4BJT A;  2BY1 A;  1FIA A;  2QZ8 A;  4CZC A;  5JLW A;  3HOT A;  1ULY A;  4BDY A;  1YI2 I;  1JGS A;  3H5A A;  4HDU A;  1F43 A;  3K4L A;  3M8F A;  1YQA A;  3GZ5 A;  4JX4 A;  2H8R A;  3ZQ7 A;  3K4B A;  1X1P A;  2UXN A;  4OIP F;  2DT7 B;  2GM4 A;  1OCO H;  3W2W A;  1YIT I;  1T8I A;  3L2R A;  2BZT A;  2HYJ A;  2IS1 A;  5FKO A;  2NAZ A;  4HNU A;  1JXS A;  3FK7 A;  4HQE A;  1W5S A;  3E6C C;  3SZP A;  3S2W A;  4MTE A;  3BR5 A;  4X0G A;  3GME A;  4ON0 A;  4ESB A;  4A2U A;  1Y39 A;  1QZY A;  2FNP A;  5FRO A;  4E7H A;  3BG5 A;  3BRO A;  5E20 A;  4NQW B;  4MFE A;  4Q5S F;  3CDI A;  3MKL A;  1YO5 C;  1Z6R A;  4NBQ A;  4JX6 A;  2HQN A;  4P9F A;  4UUT A;  5F0H A;  2ACJ A;  1SFX A;  4G7O F;  3S8P A;  4M9X A;  2HZT A;  3RZD J;  3K7A J;  2K02 A;  2R7V A;  3OYC A;  2CV1 A;  1RI7 A;  3DU6 A;  1LFU P;  2WAE A;  1D3Y A;  2V9K A;  4M74 A;  4Y13 A;  1IN7 A;  2K4J A;  4LFU A;  1LE8 A;  1SD4 A;  3K4C A;  5ILS A;  2Z9O A;  2OD5 A;  5F27 A;  3JAM K;  3CES A;  3ELK A;  4QLC U;  3WTW C;  3LOC A;  4CH7 A;  2ZME B;  3WU0 A;  2LTP A;  2M8G X;  1V3F A;  2OF7 A;  2QF7 A;  2MGQ A;  3ZR8 X;  2LF7 A;  5M5W J;  2ZJP F;  2L54 A;  3GZN B;  2OTJ I;  1BI3 A;  4F91 B;  1QVU A;  2D2W A;  2K9Q A;  2E5N A;  1YX3 A;  2MG4 A;  2FBK A;  3GXO A;  2FQ4 A;  2ZCW A;  1U9N A;  2P0W A;  3KP2 A;  3F8N A;  2X9D A;  1Y1W J;  1ZQ3 P;  2PMH A;  1B72 A;  1PYV A;  1D0Z A;  4O3M A;  3ZP5 A;  4HX4 A;  3BY6 A;  5HS7 A;  3SZT A;  3F3X A;  1IV8 A;  3LAP A;  3CCU I;  3J7Y J;  1SFK A;  1T56 A;  1IW7 F;  1DGW Y;  2Y30 A;  3TO6 A;  1K78 B;  1IG7 A;  4BL0 B;  5DEQ A;  2AO9 A;  3ZOB A;  4YFK F;  2QUF A;  4I09 A;  3AG1 H;  2KT0 A;  3SYT A;  3BR2 A;  4GO1 A;  2ECC A;  1HKQ A;  4PFP A;  2HYG D;  3VB2 A;  1DU6 A;  1HW5 A;  4HBL A;  4M6X A;  4B47 A;  3QWL A;  3Q9S A;  4KIT B;  3FDY A;  3FMR A;  3RCO A;  1ETO A;  1QRY A;  3PL8 A;  3L09 A;  4I0A A;  1QVT A;  3DPL C;  3JRD A;  1A36 A;  3FKJ A;  3RQI A;  1WI3 A;  2HVR A;  3SQN A;  1M1E B;  5F6F A;  1P7J A;  2JK3 A;  1OCP A;  4MGR A;  2VOO A;  4A6E A;  2YSR A;  4BHB A;  1FBQ A;  3H9J A;  4I7H A;  2DDB A;  1WQ2 A;  2RRE A;  3W6J B;  3RKY A;  1FY7 A;  2A3S A;  3V8L A;  3ESW B;  2GA1 A;  4M3E A;  4LG3 A;  1ETX A;  2M8E A;  3JRA A;  2MW8 A;  5CQE A;  2KIU A;  3IL2 A;  2W00 A;  4RM2 A;  2IA2 A;  1IXC A;  3HRU A;  4C3I J;  1CQT A;  5K1Y A;  1PP7 U;  3PFI A;  1O3T A;  1JE8 A;  1YJW I;  3UNG C;  1ZTR A;  4PSX A;  1D8K A;  3QU3 A;  3FZV A;  4KT6 A;  4CYC B;  5GAG J;  2E71 A;  1EA3 A;  4NNJ A;  3KEO A;  5ED4 A;  2VBY A;  2HQA A;  1K61 A;  4KUM A;  3I59 A;  2XGC A;  4RB0 A;  3CMM A;  2IBD A;  1HKT A;  1W5T A;  1R9T J;  5EGO A;  3N97 A;  2XAH A;  3FWE A;  3P9K A;  3K69 A;  4RB2 C;  3J81 K;  1X4O A;  2NRA C;  2CU7 A;  4C3J J;  3BTI A;  2FNA A;  4ASN A;  1ZAR A;  2D1H A;  2NS8 A;  2HOE A;  3E1S A;  2CFO A;  3OYF A;  2L7K A;  3DKX A;  4Z6Y A;  2DOA A;  1YLF A;  1T0F C;  3CME I;  3VPR A;  2RAE A;  1WH5 A;  2JA5 J;  2WB1 A;  1VQ5 I;  3RTR A;  3J7A Y;  1T08 B;  4B09 A;  5B5E C;  2AQE A;  2MSY A;  5HNF A;  3HIF A;  2V7F A;  4P5O A;  4PGH A;  2COM A;  1IN6 A;  3MN2 A;  4E4H A;  2VI6 A;  2DFH A;  5JI6 A;  3ZXS A;  5J6X A;  2QA4 I;  2DYR H;  1WKM A;  3C1D A;  4A3B J;  3FBI B;  4XR6 A;  4PSW A;  3MKZ A;  4PJM A;  2QVO A;  3CP8 A;  4R8H A;  2QQB A;  2OBP A;  1KZH A;  4N0B A;  4XN0 A;  1HST A;  1E17 A;  4PK4 A;  3TO7 A;  1USS A;  2WAQ A;  4D9J A;  5HLH A;  1I6H J;  4L5J A;  4EJU A;  3JW4 A;  3RZO J;  2HS5 A;  2XGE A;  3WG9 A;  1RR8 C;  3KE2 A;  2M30 A;  3P5J A;  2ESN A;  4BU2 A;  1WWX A;  3CTA A;  1HA8 A;  4X6A J;  4KA4 A;  1QHG A;  3RKW A;  2EA2 A;  5EEG A;  5EYR A;  2LY9 A;  3ZQQ A;  4XID A;  2E1N A;  2HDD A;  5D5W B;  2E2J J;  6PAX A;  3CUQ A;  3SFZ A;  4A0Y A;  3NEU A;  2KIF A;  4MEX F;  2X6W A;  2JRT A;  5J40 A;  5DCM B;  2GZW A;  2HOS A;  4R79 A;  3H36 A;  2IS6 A;  3QQA A;  1MBJ A;  1UST A;  2ZSH B;  5ERI A;  3CCR I;  1E3O C;  3WTY C;  3CLQ A;  4RMN A;  4II3 A;  2DFE A;  3K10 A;  3LA7 A;  3LSH A;  3UKG A;  2FX0 A;  1IDZ A;  5LGU A;  3HRT A;  1B6A A;  1IN5 A;  1NHA A;  2I8D A;  1B8I B;  3EYI A;  3RJP A;  2OV7 A;  3MFK A;  1POG A;  1BI1 A;  3K4M A;  4RAF A;  5K7Z A;  3T8R A;  5JVG F;  1LKX A;  1UG2 A;  3NRV A;  2X1C A;  4AD9 A;  2VBX A;  4G6D A;  3I59 B;  3IC7 A;  2R0Q C;  3HGG A;  2O03 A;  1IAW A;  3BWG A;  5EGO B;  1NG7 A;  1FNN A;  1PUF B;  1KQ0 A;  3M8J A;  1P92 A;  1KGS A;  2ESH A;  4KJZ A;  4RGS A;  3ABM H;  3KPH A;  2VQH A;  3LA3 A;  5H6R A;  2ME0 A;  4BUP A;  4CIC A;  2GQQ A;  5EEH A;  1HSJ A;  2YUS A;  5ILU A;  1F9N A;  2HZD A;  1U8R A;  2DOE A;  2IGN A;  5IYC J;  3D1N I;  1B1B A;  2ELJ A;  4OIN F;  1WFX A;  1YRN B;  5DM7 F;  2M0C A;  2WA0 A;  4A93 J;  3L2Q A;  1Y0N A;  2B7E A;  2W84 A;  1QZE A;  2VE9 A;  2W4S A;  4XIC A;  2ZJR F;  2A5Y B;  2V6E A;  1LFP A;  1YG2 A;  2AQF A;  5DV5 A;  1O57 A;  2COB A;  2MAB A;  3ASN H;  3MZY A;  3Q0W A;  3FHZ A;  5LRR A;  2Y0S N;  4E7L A;  5FLV A;  1WZ2 A;  4RB1 A;  4BJ6 C;  5FO5 A;  1VQ8 I;  3TQN A;  1SVO A;  4FX4 A;  2CSO A;  3HOZ J;  3ISP A;  3GFI A;  4CUG A;  4MTD A;  4RDU A;  2IGM A;  3KZI C;  1WH7 A;  1B9M A;  4I98 B;  2RN7 A;  1MMD A;  2L01 A;  1HDD C;  3CUQ C;  2XKP A;  3I55 I;  3BR1 A;  1F1Z A;  1XSV A;  4KIC A;  4I99 C;  5IPA A;  3N4M A;  1UMQ A;  4WCG A;  4M6V A;  3L1P A;  1E0E A;  4XRM A;  3OL4 A;  5HOD A;  1X3U A;  2WB1 N;  2CV0 A;  2EV0 A;  2GIZ A;  3F8F A;  2K9N A;  2G7U A;  2MD0 A;  4B48 A;  2QSF X;  4YFN F;  3LFK A;  3S1R J;  3MKY B;  1WJE A;  1I27 A;  2JA7 J;  4KT5 C;  3CUO A;  3E5X A;  3GTM J;  4LIU A;  3H5R A;  1RUN A;  1UFM A;  4MQ9 F;  4HLY A;  1QNT A;  2K4B A;  2DDA A;  4YFX F;  3K70 C;  1U2W A;  2O8K A;  1PJR A;  1SMT A;  1MW7 A;  5JVT A;  4ITV A;  3ABT A;  1X4P A;  3KP6 A;  4G94 A;  1MMS A;  4Y7N J;  2EFO A;  4FAS D;  4XRS G;  4KIF A;  2KIQ A;  1WJD A;  1UHM A;  3LSM A;  4BE2 A;  2CWE A;  5TRD A;  1FT9 A;  1IJW C;  3BZK A;  2DA5 A;  5TGT A;  2LC2 A;  3KYC B;  3G1M A;  9ANT A;  5E3M A;  1QO0 D;  2G7H A;  3PNY A;  2R7R A;  3SZG A;  1YHQ I;  2DFI A;  3ML6 A;  3KET A;  2HU9 A;  1E3P A;  3BR6 A;  2O8X A;  4JYK A;  3BJ6 A;  1TL8 A;  4S0H B;  4DZJ A;  4LD5 A;  2VKV A;  4M6Y A;  5AIP A;  2Y9Z A;  4G7Z F;  3KX2 A;  1RIO H;  1LUJ B;  1ODD A;  2BE5 F;  1EKE A;  2DA1 A;  4ZYA A;  3HTU A;  4E7Z A;  4EGY A;  3QPS A;  4FE4 A;  2W57 A;  2FE3 A;  3BPV A;  5IP7 J;  4LG0 A;  4ZZL A;  3OS2 A;  3K1M A;  3TMO A;  1U5T A;  4NC6 A;  3KEQ A;  4W97 A;  2M4K A;  2Y31 A;  4U0Y A;  2EH3 A;  2VN2 A;  5CVJ A;  2D1V A;  2JUG A;  1DDN A;  2KHM A;  3CCQ I;  1X2N A;  1TT0 A;  2LNB A;  4H4K C;  4BBS J;  3S3N A;  4C2M J;  3VYU B;  2HVS A;  2O0Y A;  5DTD A;  1H0M A;  2X1D A;  2W1O A;  2BW3 A;  2VC1 A;  4ESJ A;  1MGT A;  1A35 A;  5EEA A;  3E6D A;  5BPI A;  3AL0 C;  3BT9 A;  2RQP A;  4ESF A;  3R61 A;  3I53 A;  3TP3 A;  3AG3 H;  2L7F P;  4BHC A;  3JRH A;  3RI4 A;  3OYD A;  1MSF C;  1R1U A;  4A3L J;  2IRF G;  2C6Y A;  1RPW A;  2HWV A;  3F22 A;  4XMY A;  4N4O B;  4XRF A;  1IUF A;  4A0Z A;  5H2F C;  4QTR A;  4PCQ A;  1XMX A;  1R4M B;  3FIW A;  1QPM A;  1S7O A;  2YX4 A;  2HPM A;  4IHX A;  3OV8 A;  3S1Q J;  1J09 A;  3CMY A;  1ETY A;  2HPI A;  2Z2S B;  4IOC F;  3S2D J;  5E1W A;  4WXD A;  2BYV E;  4UHT A;  3BR0 A;  1SFO J;  1X19 A;  1FYL A;  3ERM A;  1IRF A;  1OQY A;  3LMM A;  2DT6 A;  4V19 K;  3CDH A;  3GWZ A;  3H92 A;  4LIV A;  3A0B C;  5LHH A;  3G73 A;  3RQ4 A;  3KYD B;  2ZXW H;  4QSH A;  3S16 J;  3IRR A;  2R7Z J;  1I6X A;  1OKR A;  3B73 A;  3T8T A;  2NNN A;  1X3Z B;  4DYC A;  3S17 J;  5H6Q A;  1LJ9 A;  2MLG A;  3PO3 J;  5L3F A;  4NDL A;  3F0C A;  2IJL A;  4UVC A;  1FSE A;  5BOX A;  3HB9 A;  1GDT A;  4LJZ F;  4IPA A;  1OFC X;  4XOP A;  5HDG A;  2R7D A;  1WJA A;  1U8B A;  4XLP F;  1DUX C;  1A31 A;  1MND A;  2RVC A;  3JRI A;  3TED A;  1W36 D;  2Z3Y A;  1G3S A;  2RKH A;  2LVS A;  3MZ8 A;  4PJJ A;  5FJ8 J;  2W7N A;  5J47 A;  4J19 A;  1XCV A;  2X4H A;  4A3K J;  1AKH B;  1K6O A;  4BY7 J;  1XGS A;  1VQ6 I;  3K0L A;  1YIJ I;  2HDW A;  3DFG A;  3HKZ N;  2PMU A;  2CQX A;  1S8N A;  5HLT A;  1T39 A;  3V7R A;  2OCC H;  1LVA A;  3FIS A;  1VQL I;  1T98 A;  1VI0 A;  1YIO A;  2XVC A;  3V7S A;  4RLF A;  2V9V A;  3OS1 A;  3LWF A;  3DPU A;  3CCV I;  1GT0 C;  2K5C A;  3M07 A;  3QAH A;  5J4Y A;  2W82 A;  1U3E M;  3HRM A;  4FT8 A;  5F1R A;  1W1W E;  1XDU A;  3K4J A;  3OYE A;  4C2U A;  3IUO A;  2NXN B;  1GVD A;  1JKP C;  2VKH A;  1D5Y A;  4L0Z B;  3B6A A;  2CMP A;  4OAY A;  5KVR A;  1RRJ A;  3S2H J;  3HGY A;  5GTI C;  1JI8 A;  4ZDP A;  2BY2 A;  2DO7 A;  2E60 A;  2Y75 A;  3GO5 A;  1SC7 A;  4CGZ A;  1QGP A;  2XPW A;  2DK8 A;  1FOW A;  3KP3 A;  5D8L B;  2M4G A;  3OR2 C;  1B9N A;  2WV1 A;  1QZZ A;  3ROU A;  3CMA I;  3R4K A;  3CC7 I;  3GBG A;  5J1Y A;  2W85 A;  4ENK A;  1YS6 A;  3BG6 A;  3EUH C;  5JFR A;  5BQT A;  1LDJ A;  2L4M A;  4D7N A;  2DMN A;  1YOV B;  2NNY A;  2O7O A;  3HPG A;  5L3B A;  3S1M J;  1EF4 A;  3J80 Z;  1YW8 A;  2E35 A;  2K3P A;  1XB4 A;  3EQL F;  4ANJ A;  1ETW A;  2PLY A;  1V5G A;  5HOO A;  1SD7 A;  4UB6 C;  3HKZ A;  5CJ9 A;  3A03 A;  4AU7 A;  3JRF A;  1SEU A;  2P5K A;  2A07 F;  5CYV A;  4CCK A;  3H9G A;  4Y4R A;  3G71 I;  3LSI A;  1OCR H;  3DEE A;  2Z5U A;  2H27 A;  2LFB A;  5LD2 C;  3CCL I;  4L0Y B;  3HSF A;  1RET A;  1ZN2 A;  4ZDL A;  4UB8 C;  2HTJ A;  1HQC A;  4XLA A;  5D8K B;  2HDC A;  2K9S A;  3ZQC A;  1OCT C;  5M3F J;  2LOO A;  3D0S A;  1BIA A;  2YX7 A;  1EV7 A;  1VQM I;  3NWS A;  4J00 A;  3M1E A;  3SEZ A;  2K9L A;  5FKL A;  3A02 A;  3BZ6 A;  1S3J A;  3ZMU A;  1DGR M;  2KPM A;  3TL4 X;  2WY7 Q;  3WHC A;  1W36 C;  3K9T A;  2DA4 A;  2F48 A;  2JTV A;  2KZV A;  5CVU A;  3CCM I;  2EA4 A;  3L2U A;  4EVI A;  2DFF A;  2ID3 A;  2IA1 A;  1N25 A;  5M5Y J;  1TNT A;  5KAI C;  1ETV A;  4ZYH A;  2CW8 A;  3O8G A;  5E79 C;  3TBI A;  1MNM C;  2L2O A;  5JR3 A;  2IGK A;  4PGG A;  3OSG A;  2BXY A;  2CH0 A;  2JVG A;  3FXR A;  1VTN C;  4DW6 A;  3OY9 A;  3SJM A;  1BI2 A;  1R49 A;  2GXB A;  3RIR A;  1MMN A;  4EJO A;  5B66 C;  3LSR A;  4E7S A;  1WJB A;  1K78 A;  2NVT J;  2LY2 A;  4GCV A;  4A3D J;  2TCT A;  1MBE A;  2WAF A;  1HKS A;  2F5F A;  4MQV A;  3HOY J;  1SVM A;  4V2G A;  4BEH A;  5HDN A;  3IV5 A;  3M3Y J;  4F52 A;  5GTH C;  1GV5 A;  2EFQ A;  2M2E A;  3NAR A;  2Q1Z B;  3IWF A;  3IP4 B;  3JRG A;  5CQG A;  2NS0 A;  1ZR4 A;  4IQ4 A;  2E34 A;  4M73 A;  4BE0 A;  1W7P A;  4Y15 A;  2ZXJ A;  3MMY B;  3Q0V A;  2FA5 A;  2X48 A;  3LAJ A;  4P1W A;  2B9S A;  2D5V A;  4XKC A;  1G2H A;  4EJV A;  5A2Q Z;  1K83 J;  1UHS A;  2IW5 A;  4C2T A;  3ZMZ A;  4HYE A;  3O8H A;  1NK3 P;  3FK6 A;  2R5Y B;  5EZH A;  1QU3 A;  3HXL A;  2XV4 S;  2L02 A;  4KMF A;  3K1N A;  1UEL B;  3HEF A;  3ZMS A;  4DQ2 A;  3QP6 A;  4KIG A;  2ZFU A;  2TRT A;  2F5D A;  2E1M B;  1WGX A;  2ZNZ A;  3DBH B;  1R6R A;  4R1H A;  4CYC A;  4AC0 A;  2HI3 A;  5GAH J;  2M5W A;  1LNW A;  5GPA A;  3GTJ J;  2ZBK A;  2XHK A;  2LR8 A;  1BOB A;  3VWB A;  2G0E A;  1K79 A;  5DM6 F;  2JA6 J;  3EYY A;  3E3V A;  3ECO A;  1OIS A;  4WXC A;  2PX9 A;  3HYI A;  3FXL A;  4LG0 B;  4B1R A;  3HJE A;  1TZL A;  2VJI A;  2V1X A;  3VYR B;  5J3L A;  5FLM J;  2EIM H;  5K7F A;  3RPQ A;  1UZC A;  3DLA A;  3S1N J;  1OMI A;  1T6S A;  3GCM A;  1PVE A;  5GP9 A;  1XN7 A;  2STW A;  3K6G A;  5F0F A;  3SFI A;  4GDF A;  2DMU A;  3E7L A;  4C9Y A;  1WI9 A;  1T0F A;  2KIS A;  4YRV A;  3RKQ A;  2XDV A;  3ABU A;  1SAX A;  3GFM A;  2OAZ A;  2XB0 X;  4E7I A;  2F2E A;  3LFU A;  5DYM A;  3OWT A;  2P8T A;  3TOB A;  4Q48 A;  1V54 H;  4DIQ A;  1BC7 C;  2M0M A;  2FXA A;  5F0C A;  3U21 A;  2GXG A;  2R3S A;  2CUZ A;  1N75 A;  4MHG A;  3K2A A;  5LBQ A;  2ZJQ F;  2WY8 Q;  1KU2 A;  3OYB A;  4FE7 A;  3EPZ A;  3R60 A;  4MO7 A;  4XLN F;  1S72 I;  2A5W A;  2D45 A;  3MQ0 A;  3DCF A;  2MBF A;  5DCM A;  2OU2 A;  5AON A;  1BC8 C;  4ZTF A;  1BA5 A;  2VB6 A;  2K86 A;  2BVL A;  1ZKG A;  3QPH A;  5EG0 B;  1FZP B;  2Y2Z A;  2KIM A;  1B8I A;  3H9Q A;  2FUG 2;  1RES A;  3OYL A;  1ONV A;  1SFE A;  2IPQ X;  2X6Y A;  1TC3 C;  3CF2 A;  5H20 A;  3CUQ B;  3NWT A;  3JRE A;  2N8G A;  2ZSI B;  4CCM A;  1ZAO A;  5EZG A;  4AVZ A;  2EIK H;  3I71 A;  1IUY A;  4BY1 J;  1LE8 B;  2A6E F;  1MMG A;  4UV9 A;  3TOA A;  4UVB A;  2KFD A;  1R1V A;  4CDG A;  3BP8 A;  3KP4 A;  5CVV A;  1MSE C;  3COA C;  3WU2 C;  5D5U B;  2FEZ A;  3L00 A;  1EH8 A;  1SD5 A;  4Y3O A;  1VQ9 I;  1BM9 A;  2E2I J;  3DP7 A;  1U78 A;  3BCB A;  3CCE I;  5K5R A;  4M3B A;  2Z33 A;  3FXU A;  4YIF A;  5EG0 A;  4RGR A;  1W4M A;  1HC8 A;  1WPK A;  2NOG A;  3OYJ A;  1B72 B;  1C0W A;  2LBF A;  3K70 D;  2CQK A;  3IH4 A;  1HBX G;  2NVY J;  4FHT A;  3F21 A;  2MFZ A;  4CCJ A;  1IZ1 A;  3HG9 A;  3SHF A;  2CUJ A;  2VBZ A;  3WHB A;  1G8X A;  2VKE A;  4EV0 A;  2JSC A;  3C3W A;  2BY0 A;  3QRF F;  5IT3 A;  3I58 A;  5DD4 A;  4KFC A;  1V5F A;  1D0Y A;  2KJB A;  2LH9 A;  1Z3Y A;  4A6D A;  3JTH A;  4LIT A;  2DLL A;  1A6Q A;  1TW3 A;  2M34 A;  1J75 A;  1O4X A;  4OMY A;  4EAT A;  2EIJ H;  2R7U A;  3WU1 B;  2A6H F;  4A69 C;  3ZMT A;  2P6T A;  3QYB A;  4IKF A;  1FC3 A;  4U87 A;  3KCC A;  1AOY A;  2XC7 A;  2OQR A;  2DTR A;  2JRM A;  1FIP A;  2BGC A;  4F55 A;  3DPT A;  4MIM A;  1ZGJ A;  3DWL E;  3GEZ A;  1SVL A;  3M1C A;  1ZRC A;  4G6Q A;  1N78 A;  2W24 A;  2QKM B;  2QGU A;  2XF6 A;  3L7W A;  1TWC J;  1DP7 P;  3CJN A;  1I1G A;  2J5O A;  3TGN A;  2CO5 A;  2VBW A;  3GTK J;  4UVA A;  4C3H J;  2RC4 A;  3DTI A;  3E97 A;  1R22 A;  4E6K G;  1AA7 A;  2MH2 A;  3RDI A;  5D5X B;  2CUE A;  3DTK A;  1CF7 B;  3I54 A;  4UUS B;  4WXH A;  1HDP A;  2H94 A;  2VT3 A;  3Q5F A;  3DBR B;  4KN7 X;  4HF1 A;  1JKQ C;  2KKO A;  1FOY A;  3U1D A;  5L3C A;  1E2X A;  4ENM A;  1V5E A;  2X6X A;  3AG4 H;  3DEU A;  2GLO A;  4BXX J;  4Y33 A;  3I4P A;  1JKO C;  4PJN A;  4DGW B;  4RA2 A;  2QBY A;  5FFX A;  2M1B A;  4PZJ A;  4RGU A;  4LMY A;  4B4C A;  5LHI A;  5C3E J;  3FXJ A;  1ERD A;  3PO2 J;  3H5N A;  5CVR A;  5FD6 A;  1XMA A;  2DOD A;  4I6Z A;  1WHU A;  2VPR A;  1ZLK A;  2X6O A;  4RBO A;  5D4S A;  2ZC2 A;  2QSH X;  4UUV A;  2CYY A;  3ZQF A;  1Y8R B;  3J80 K;  4HG2 A;  2R4G A;  2MLK A;  3WTZ A;  1O7F A;  1EH7 A;  2L3D A;  1QQI A;  3IAM 2;  2JQ7 A;  3C2G A;  1GVJ A;  1IXR C;  1BBY A;  2QKL B;  1PDN C;  2RQQ A;  2LG4 A;  3HPH A;  3JTG A;  2VOP A;  5IOY A;  4A5M A;  3HOW J;  4HNT A;  4BQO A;  4NHJ A;  5F04 A;  1W5C C;  1RR7 A;  3GTO J;  3FMS A;  1QA6 A;  3C18 A;  2O6G E;  1JUM A;  3ABL H;  2XGD A;  1D5V A;  2XRO A;  4XQF A;  5E3O A;  3GW2 A;  2I5U A;  1S7A A;  1IN8 A;  3SDG A;  1IDY A;  4XOT A;  3MEX A;  5B3S H;  2FRH A;  5JHF A;  4KIS A;  5CPR B;  1BL0 A;  2F4I A;  3E6B A;  1TNS A;  3HHH A;  2UUZ A;  2JWT A;  1G6N A;  4GFB A;  4G6T B;  1OJL A;  5C4J J;  3IH3 A;  3FXO A;  1VQP I;  1R5H A;  3U9G A;  2ICW G;  2HOA A;  5J1U A;  1FBS A;  4OAZ A;  5IY5 H;  2PBI A;  1Z9C A;  2R7T A;  4E7J A;  1MZB A;  1ACI A;  4U0V A;  1IRG A;  1MJB A;  1DPU A;  4HEA 2;  4ZYE A;  4I01 A;  2P4W A;  3WE3 A;  5BMZ A;  3HL2 A;  3HDD A;  2DXI A;  1T38 A;  3T1B A;  5ICG A;  3H35 A;  2XF5 A;  1CF7 A;  2ISY A;  2VXZ A;  3PUB A;  2LRD A;  1JTX A;  2K27 A;  4NQW A;  2PMZ A;  3WTT C;  2DQR A;  3OR1 C;  5IP9 J;  3WTU C;  2VPL A;  2YPR A;  2KRF A;  5J8C A;  1KON A;  3LSK A;  2AHQ A;  2A6T A;  3KFW X;  3HRS A;  1XX5 A;  4RGX A;  1SAU A;  2RDP A;  5TJJ A;  2GBY A;  3IKV A;  3DLL F;  2OZU A;  5ICC A;  2FF4 A;  4I02 A;  3ZRG A;  2P5V A;  1S9H A;  2VL8 A;  2E7W A;  2V1N A;  3BG7 A;  4JP0 A;  4ZJZ A;  1JKR C;  1H88 C;  4YEJ A;  3DKY A;  3KZY A;  4N9H A;  4DYQ A;  3KYL A;  5DD8 A;  1REP C;  2DK5 A;  2CQQ A;  1I3Q J;  3H3U A;  5JLX A;  3V8J A;  2LKP A;  2XSJ C;  2RNJ A;  4CCN A;  5E18 F;  1G3W A;  1YE9 A;  4TV7 A;  1PP8 F;  2BHZ A;  1HF0 A;  5D5V B;  3SDB A;  3GFJ A;  2ADU A;  2CJJ A;  2GXA A;  1FOX A;  3OL3 A;  4BJ5 C;  4A5N A;  4AYB A;  4MFD A;  1FTZ A;  2XAF A;  1ZGW A;  3W2A A;  2XSD C;  5HLG A;  1XG1 A;  2AXT C;  5FRM A;  2ZNY A;  1FP2 A;  2H8W A;  1KYW A;  3BPX A;  5GAE J;  3ZQG A;  1A04 A;  2IXS A;  4A3E J;  1PUE E;  4A3G J;  1RNL A;  1Z7U A;  2V6C A;  4L9T A;  2DYS H;  2KMU A;  2HKO A;  5M5X J;  1Q1V A;  4BAC A;  3F23 A;  1BW6 A;  3EET A;  1J7K A;  4QPO A;  4B44 A;  1XS9 A;  1YTY A;  4L5E A;  1G3Y A;  2VUM J;  1KQ8 A;  4A0X A;  1LEA A;  5IT9 Z;  4BAY A;  4LLG F;  1TW2 A;  3JSP A;  3VYT B;  2YS9 A;  4N9I A;  1X1C A;  4FX0 A;  1X3W B;  5KAF C;  4BXF A;  5E17 F;  5FLX Z;  4XSX F;  4CHU A;  2DCE A;  4UY8 I;  3S93 A;  2NVU B;  4ENN A;  1T95 A;  5L3G A;  1WVR A;  3E6M A;  3DEW A;  2H1L A;  4IZZ A;  4Q47 A;  3CCY A;  2YU3 A;  2MC4 A;  2ELK A;  2Q0O A;  4L18 B;  3CDL A;  4D0P A;  4WWC A;  1P4X A;  3F8C A;  3OYG A;  3BZC A;  3CP2 A;  4JK1 X;  2A68 F;  1O3R A;  3OYN A;  2CS3 A;  2PG4 A;  2OPT A;  1FP1 D;  2VAS A;  2XRL A;  2P6S A;  1J5Y A;  3AKZ A;  4C30 A;  4XLF A;  2XGX A;  2IP2 A;  3A4C A;  3QOP A;  3BTC A;  3MD2 A;  2HGC A;  3RYR A;  2PQ8 A;  1BR4 A;  2VJ5 A;  3B6C A;  4D5C A;  1MDM A;  1WJ5 A;  4E70 A;  4IHV A;  4PUS A;  1JT6 A;  3B02 A;  1HW2 A;  2JN6 A;  1IF1 A;  3HC7 A;  1VF9 A;  2XAQ A;  2B63 J;  4LLL A;  1W0U A;  3WTS C;  2OC6 A;  4I76 A;  3D5R C;  1T2K A;  1DU0 A;  5LGT A;  3CO6 C;  3ERE D;  2LD5 A;  3NAU A;  1TWG J;  2E5Z A;  2GIV A;  2EK5 A;  1W0T A;  4CYD A;  4IVN A;  3RPU D;  3BJA A;  1J0R A;  3VDX A;  3KLO A;  1H8A C;  3M4O J;  3H0G J;  1U5T B;  4HV5 A;  1MD0 A;  4XL9 A;  2R7F A;  3ZGK A;  4F7Z A;  2BBY A;  3GF2 A;  3C7J A;  1JHF A;  5F08 A;  2BOL A;  2LYC A;  1UCR A;  2G9W A;  3GYH X;  2HEO A;  2FQ3 A;  3GLL A;  4AWX B;  1HW1 A;  5IYB J;  4ZYD A;  3OYA A;  5LEK A;  5FRN A;  4HRI A;  3H1C A;  4IQJ A;  4EM1 A;  5FGM A;  2KL4 A;  3ZPL A;  3LNQ A;  3LSP A;  1D8J A;  1TBX A;  2BW3 B;  3GTG J;  2KDO A;  2MA3 A;  2MD5 A;  1JGG A;  3NQO A;  3PQK A;  1UAA A;  3SEQ A;  2UWM A;  2P7C B;  2ZME A;  1FMW A;  4NC7 A;  4D7M A;  5J4V A;  3I3L A;  3EUK L;  1FMV A;  2MC3 A;  4HOB A;  2KQR A;  4HV6 A;  1X58 A;  4IRH A;  2R7X A;  1IGN A;  2V1U A;  1I50 J;  2ME6 A;  2XAS A;  3DBL B;  2PJP A;  3KIO A;  1ZGA A;  5FFZ A;  3S3O A;  1BR2 A;  1BOA A;  3I5U A;  1NG6 A;  5E1X A;  1WCM J;  1WJF A;  1Z91 A;  1RZ4 A;  2QQ9 A;  2DU9 A;  2L9V A;  4LB6 B;  4AIH A;  4ETS A;  4HW0 A;  2LKX A;  4OWR B;  4BNC A;  1W7P B;  2IVM A;  1UB9 A;  4G7H F;  1Y0U A;  3A01 B;  3JRB A;  3PNV A;  2UXX A;  3L9F A;  4XBF A;  1K4S A;  4H0E A;  4IRI A;  1TQM A;  2JPC A;  4BEH B;  1I1S A;  4I0B A;  1TLH B;  5FD5 A;  4XOR A;  2R5Y A;  4D5F A;  1V4R A;  2JZY A;  3CJR B;  4YEL A;  2E2H J;  2GWR A;  4KMU X;  3ZN1 A;  2JUC A;  2V1D A;  3PUF A;  4UUS A;  1KU9 A;  1ZHF A;  2XB5 A;  2M3A A;  1Z7L A;  3FM5 A;  4GYG A;  1KYZ A;  2HQR A;  3G3Z A;  1NH3 A;  1P6R A;  5D6E A;  2E36 A;  3BOQ A;  4DBR A;  5HNH A;  1H89 C;  1DP3 A;  2WAD A;  3GVA A;  3H3Z A;  4BYY A;  4A3J J;  1KA8 A;  4XRS A;  2ZFW A;  3L2V A;  4XKV A;  1FX7 A;  3TP0 A;  4CCL A;  1Z1D A;  2M87 A;  3E5U A;  4MEY F;  5LEJ A;  3HUG B;  2XPU A;  4EM2 A;  3QPT A;  1WRJ A;  2CRG A;  2VE8 A;  3Q0U A;  2AXL A;  2X85 A;  4NB5 A;  3QYE A;  1G4D A;  1MJA A;  1BR1 A;  4BS9 A;  2P81 A;  4XLE A;  4B43 A;  1A6I A;  1OLT A;  4J01 A;  1FSH A;  3TO9 A;  1BIB A;  3E5Q A;  4LK1 F;  2ECB A;  4EJW A;  3F9K A;  1VQO I;  1YRN A;  2Q2E B;  2F5E A;  1QPI A;  2DA6 A;  2CW7 A;  3JCU C;  4CCO A;  1LPQ A;  1MBF A;  4U7D A;  4DJA A;  1XGN A;  4IO9 F;  1Z6T A;  2R7Q A;  1MH3 A;  2LKS A;  1LQ1 A;  2I10 A;  2DPU A;  3A0H C;  4NUB A;  1R1T A;  2AS5 F;  3HUG A;  2KRC A;  1FPQ A;  2VJ4 A;  2BHY A;  3TDZ C;  3T0Y A;  4IJA A;  3OS0 A;  3EUH A;  4DBQ A;  3DKW A;  1BN5 A;  1ON2 A;  5FLX K;  2UZK A;  2QEX I;  3BG9 A;  5K5Q A;  1IO2 A;  2Y0S A;  2XAG A;  1FYM A;  3BCA A;  3MWM A;  2OCE A;  5DS9 A;  2E19 A;  2KJC A;  1IXS B;  4A3F J;  1EJ9 A;  4BDZ A;  4HQM A;  3CCJ I;  4RAG A;  1X2M A;  2RGV A;  2DQL A;  3OSF A;  1ZG3 A;  1RKW A;  4JX5 A;  3PSF A;  4HDV A;  1ZG5 A;  3OIO A;  1XMK A;  4XKW A;  1U6G A;  2ISZ A;  3ZQI A;  4EEF G;  2PFB A;  2B0L A;  5M3M J;  4Q4Z F;  5B1A H;  3R0A A;  4HA8 A;  1Z0X A;  4P55 A;  3GLX A;  2L7Z A;  2DI3 A;  4F92 B;  2ELH A;  2L7M P;  3MCZ A;  4M3D A;  1R23 A;  2R7O A;  3HBL A;  2PJR A;  5DUK A;  2DN0 A;  1S5L C;  3L2C A;  3C2B A;  2PEX A;  3FXQ A;  3QOE A;  2IAI A;  3F8M A;  4A12 A;  2WV0 A;  4IEJ A;  3ONQ A;  4PJL A;  3FHN A;  3AAF A;  3VOD A;  4HNV A;  2L5Q A;  5IP6 A;  2LDU A;  3HSR A;  3QPL A;  2L9R A;  5A2Q K;  3P7N A;  1BW5 A;  3J7A O;  1K7A A;  4ENJ A;  3VFZ A;  2LBF B;  3WG7 H;  4IHS A;  4IHT A;  2QSG X;  3G2B A;  2A61 A;  1D1C A;  2HKX A;  5HVQ C;  3ECH A;  1LDK B;  5BNG A;  1R7J A;  2WC2 A;  5DDG A;  4RM3 A;  3I0T A;  1Y8Q B;  3ZMV A;  1CGP A;  3G6E I;  1Z67 A;  2Q2E A;  2RNG A;  4RLQ A;  3WOD F;  4Y52 J;  1OYI A;  4ZTJ A;  2GOX B;  2VLA A;  3P9C A;  4PFO A;  3X2Q H;  5BS6 A;  2VC0 A;  1YW7 A;  2IS2 A;  3V4G A;  2VIX A;  2ZME C;  4KN4 X;  4HPQ A;  1R58 A;  1SFU A;  1JJ6 C;  5FKM A;  3HOS A;  5J1R A;  1R5G A;  3HOX J;  5LGN A;  4K2E A;  4BQA A;  1PUF A;  2EFW A;  1AWC A;  4GGG A;  2JT1 A;  2FBH A;  1JJ8 C;  1G3T A;  3JAM Z;  1ETQ A;  3T5X A;  2BXZ A;  1JHH A;  2QLZ A;  2RV8 A;  4HF2 A;  1X1A A;  1JUS A;  5EJC A;  2P5L C;  2R93 J;  2DTZ A;  4AUX A; 
#chains in the Genus database with same CATH homology
 1UZC A;  2DOE A;  2KFD A;  2K85 A;  2KIS A;  2E71 A;  2KZG A;  2L9V A;  4FQG A;  2CQN A;  2B7E A;  2DOF A;  2KIQ A;  2LKS A;  2DOD A;  2JUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...