2LA4A

Nmr structure of the c-terminal rrm domain of poly(u) binding 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
GSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear and cytoplasmic polyadenylated RNA-binding protein P
publication title Pub1p C-terminal RRM domain interacts with Tif4631p through a conserved region neighbouring the Pab1p binding site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 18
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2la4A00
1WG5A 4TLQA 2DHSA 2U1AA 2CPFA 2MSTA 2MKJA 5IM0A 5LJ3Y 1VQ8S 2KM8B 2E5IA 4V19X 1HD1A 3S6EA 4QQBA 3NS6A 3US5A 2YH1A 2CQ4A 3CCUS 1FNXH 1X5PA 2EK1A 1KOHA 3S01A 1WF0A 2DNGA 1SJ3P 3MUMP 1Q81T 2KYXA 2M8HA 1NJIT 2JRSA 2QA4S 2XB2D 1VBZA 1VC5A 2M70A 2DNMA 2MQOA 3CC2S 2JVRA 2A3JA 1M5KC 1YTYA 3NS5A 5IFMA 3BS9A 3MUVP 1WHXA 2SXLA 2DGQA 2DIVA 4QPTA 3MI7X 2DNOA 1WHVA 2MKIA 2DH7A 2MKSA 1U1RA 2DHAA 2KG1A 1WEXA 2MZSA 4IUFA 2LKZA 2XS7A 5HO4A 2KG0A 1WHYA 5DDRC 4LIRA 3IRWP 1FJ7A 2CQPA 3CCLS 1A9NB 1WF1A 1U1KA 1N52B 3D2WA 5GADU 2N7CA 3CCSS 2MQPA 4TU7A 1DBDA 4YUDA 1P1TA 2I2YA 5JVGQ 2JVOA 3U1MA 1KQSR 4Z2XA 1VBYA 1B7FA 2LA6A 2CQIA 3MXHP 4YB1P 2AD9A 2MQQA 2N3OA 3MURP 2MJUA 2MGZB 2M7SA 4YOEA 2MHNA 1YHQS 2PE8A 1DRZA 1XN9A 2DK2A 3L3CA 3DXBA 1H2UX 3G9CA 1FXLA 3MDFA 1U2FA 5D78A 2RS2A 1VC0A 2CPXA 3CC7S 3U1LA 1U1PA 3N9UC 3SXLA 5FJ4A 1X5SA 2CQ1A 4P6QA 1VQ7S 2MMYA 1ZZNA 1WEZA 1SJFA 2RS8A 2M4MA 2CQBA 2MQMA 2CQ0A 5EN1A 5GAHU 4CH1A 3FEYB 2MYFA 5DDOC 1VQPS 5LSOA 2HGMA 2ADBA 2QFJA 4QU7A 2DNHA 2J0SD 2MKHA 2VONA 4C4WA 1KC8T 1RK8A 4LJMA 1R8HA 2LXIA 3LQVA 2RT3A 1WG1A 1X4HA 1DHMA 1WTBA 1YWXA 1K73T 2YKAA 1N8RT 3HHNB 4W92B 2D3OR 2HVZA 4UQTA 4ZKAA 2QEXS 2J0QD 3SDEA 2I38A 3CMAS 1HA1A 2DHXA 2L08A 4LMZA 1VC6A 2FC8A 3RW6A 2DNZA 3ULHA 1D9AA 3NNHA 1VQMS 5H1SV 1UFWA 3CXCR 1X4AA 2LCWA 1FJEB 3BEGB 2GHPA 2HGLA 2PEHA 1PGZA 3G71S 2LEBA 2KI2A 1VQLS 1S79A 3VAGA 1U1NA 1X4BA 2M52A 2UP1A 2CQHA 3CCRS 1U6BA 2CQDA 2DNNA 1Q86T 2FHOB 5DM7Q 2OTLS 2ERRA 4PKDB 3CULA 2DH8A 3Q2TC 2BZ2A 2DO4A 3UCGA 4TU8A 1NO8A 1X5OA 1CVJA 2HGNA 3G8TA 2AYMA 2F9DA 2U2FA 2KT5A 4ERDA 3VALA 1U1LA 3G8SA 2MZTA 1VQ5S 2DGSA 4BS2A 2E5HA 1UAWA 2WBRA 3SMZA 2MJNA 3EX7B 4WF9Q 1YJWS 4CIOA 3CC4S 4WFAQ 2J76E 4FXVA 2CQ2A 3G96A 2L9WA 1WI6A 2DNYA 2E44A 4IOCQ 2DGVA 2EK6A 1UW4A 2XSFA 1JJ2R 2X1BA 4FXWA 2F3JA 1M90T 2XNQA 2YTCA 3VAMA 4ED5A 1SJRA 3P6YC 3CUNA 1K9MT 2OIHA 1ZZFA 3JB9k 2VOOA 2DNPA 3HI9A 3CCQS 1U1MA 1G2EA 1FHTA 3J7YU 2NLWA 3P49B 3R1HA 1JJHA 2MQNA 3CCJS 1HL6A 4WCEQ 2KN4A 2DIUA 2CQCA 4W90B 2RQ4A 1L3KA 2CPDA 1OIAA 3TP2A 1U1QA 3RW7A 5GMKa 5DETA 3V4MA 3NMRA 1DZ5A 1UP1A 1VQOS 3S7RA 2MKKA 2CQ3A 2DB1A 1R8PA 2DGUA 2HYIB 3R27A 2DISA 4IO9Q 5CYJA 2K8GA 1SXLA 1D8ZA 2RVJA 5DDPC 2DNLA 1QVFR 2MY7A 3G6ES 3P5TL 3VF0B 2D9PA 2LEAA 2G4BA 3IWNC 1FO1A 2O3DA 2AYEA 1W2BR 2XS2A 2FC9A 4PRFA 2LMIA 3LPYA 3H2VE 2E5JA 2RNEA 2CPJA 3UCUP 2HZCA 2MZJA 4OZ1A 2X1AA 2DNKA 3CCMS 3PIOQ 3UD3P 5GVQA 3CTRA 2AYGA 2F9JA 2DNRA 4PR6A 2MKCA 3UWTA 3I55S 2MPUA 2DGXA 4CH0S 1WELA 1P27B 2DO0A 2K3KA 1PO6A 3VAFA 1FJCA 1KD1T 1OO0B 3VAIA 2AYBA 3B4MA 3CCES 2D9OA 1X5TA 3ZZZA 2FY1A 1A7GE 1URNA 1RKJA 2MB0B 1OWXA 3P3DA 3G4SS 2YWKA 2GO9A 2VODA 3CD6S 2V94A 4IOAQ 2M9KA 2DITA 2LQ5A 4WFBQ 4F02A 2CQGA 2FPHX 2CPZA 5ITHA 3BO4A 4WKRA 2G0CA 2MQLA 4C0OC 1N88A 3EGNA 5HL7Q 1VQKS 3NNCA 2MXYA 2ADCA 2MY8A 2B0GA 2LA4A 2LYVA 1WG4A 2M8DB 3SDEB 2KXHA 1N54B 1F9FA 1SJQA 5MLCV 1X0FA 5CA5A 2G1DA 5LXRA 5LSLA 2DNQA 1X4GA 5LJ5Y 2DHGA 4Y00A 2N3LA 3DLLQ 2KU7A 1VQNS 4OZ0A 3VAJA 1S72S 2KHCA 1WEYA 2XS5A 2X1FA 1H6KX 2DGOA 3K0JA 1VQ6S 2MGZA 2ZJQQ 1U1OA 3MOJB 2KRRA 1WWHA 1X4CA 2OSRA 3S8SA 5IM0B 2YH0A 1KOOA 1WI8A 1YITS 1H2TZ 2L41A 4M5DB 4J5OA 3MD3A 1X4FA 2KXFA 3OW2R 2CPYA 2DGTA 4TU9A 3J7ZT 2J8AA 1NU4A 1Q82T 1VQ4S 2OJ3A 3THPA 2VOPA 2KRBA 2KVIA 3H2UB 4RU2A 4WIIA 2X1GA 2KH9A 3CMES 4U67Q 2NZ4A 2MZRA 2JX2A 2OTJS 1QM9A 3CCVS 1JJ4A 2M2BA 3UD4P 1FT8A 5CXTA 3B4DA 1VBXA 5DDQC 1Q7YT 5IQQA 3CF5Q 1X4EA 3PIPQ 4F25A 1YI2S 5LXYA 1M5VC 4F26A 2MZQA 1WF2A 2XNRA 2RU3A 3MUTP 1WHWA 2DGWA 1M1KT 3I56S 3VAKA 1AUDA 2KFYA 5GAEU 4UY8T 2CPEA 4CQ1A 1HD0A 3MD1A 2CPHA 4WFNQ 5GAGU 3TYTA 2E5GA 3THTA 3BO2A 2N82B 3VAHA 1K8AT 2M88A 3BO3A 2Q79A 2RRAA 4Y0FA 1YIJS 2BOPA 5D77A 3CPWR 3EGZA 1VQ9S 2EVZA 3UCZP 2ZJPQ 2M0GB 4EGLA 1SJ4P 2JWNA 1H2VZ 2OSQA 2LECA 2RUGA 1QVGR 1X4DA 4C7QA 3UE2A 2KM8C 5DM6Q 1YJ9S 3NNAA 4QU6A 3ZZYA 1IQTA 3R1LA 2LXUA 2CJKA 5JVHQ 2KXNB 1JMTA 3Q2SC 3FEXB 2ZJRQ 2MZ1A 2MSSA 2DH9A 1M5OC 4A8XA 3TO8A 1M5PC 2CPIA 1U6FA 5BJRA 1OPIA 2RQCA 1O0PA 1ZH5A 1BY9A 1YJNS 2RRBA
chains in the Genus database with same CATH superfamily
4PWDB 2DRBA 4AL5A 4GKKF 2V6AA 3T1YF 4ECVA 1ZAXA 1TL4A 2CZ4A 2HRTA 1SC3B 5LJ3Y 5HMXA 3W5XA 2YPZA 4HDHA 3GCXP 5L9NA 2MQ8A 4KV8B 1VHFA 3QO9B 1AROP 1XC9A 3MI7X 3CCZA 3MR2A 5IC6B 2DHAA 3MAAA 2KG1A 5E0OA 2KG0A 3VQTA 5LMUF 1A9NB 2PDAA 1U1KA 2CADA 2C3PA 3DLGA 2AP6A 1DBDA 2WRMA 4JB8B 3X3UA 3MXHP 3C46A 4P71A 2LQJA 5M2RA 2MJUA 2XTJP 3EZOA 4Q8FA 1FXLA 1DJ0A 3QAEA 4LQ3A 1Y0HA 4M5NA 4HVZA 2C42A 1TKXA 2RS8A 2MQMA 1UJ4A 4ELTA 3R5BA 3B54A 1RAJA 1RAIB 4ZLPA 4EBEA 1TP7A 1RA7A 2Y0BB 3CO0P 1BE4A 1VR6A 4UT4A 2WB4A 1TAUA 1N36F 4R0EA 3CJRA 1X4AA 1T8EA 3KUGA 2GHPA 1LKZA 3BH7B 3VGSA 1X7VA 1L3VA 2UXCJ 4OYPA 1NPRA 2FHOB 3CIZA 1NEEA 1SI9A 2OFHX 4IFVB 4ECXA 4M5MA 3IN5A 2K1RA 3EICA 5C24B 4JI6J 2MZTA 2KFNA 1HR0F 2XCAA 1T05B 2DY9A 3KK3B 2CJ9A 4M5JA 4JI0J 2UU9J 4FBTA 4FXVA 2IA0A 2L9WA 3MAHA 4IOCQ 5KT4A 1SH3A 1M90T 1MWQA 4OHWA 4F50A 3SIPB 2EXUA 3NXZA 1U1MA 3GE9A 1VIXA 3JYTB 3L95X 1S9EB 1S4EA 3BYRA 4KPCA 4M5LA 1FVSA 4LFAJ 3NGDA 1U1QA 1GXLA 1UJ5A 3DLJA 4C0BA 3R2CJ 4OYZA 1R8PA 3LH2S 4GC6A 1EHWA 2K8GA 1MMNA 1HBUB 2LEAA 1CJUB 4B3MF 1NKCA 3A1YG 2LMIA 2CPJA 4YP3A 1EQMA 4OZ1A 1NHUA 1R0AA 3MF5A 1LEOA 3IFEA 5EUHA 3M6UA 3LAKA 1WKJA 2R7RA 3RAMA 1SC6A 3W9HA 1H38A 1PO6A 1OO0B 1CC7A 1PAUB 3M05A 2RF2A 2G0IA 3KUHA 3P3DA 3D1OA 4WTOB 5HATA 2V94A 4I6AA 5J2QB 4O4GA 2CPZA 4KGMA 3TZXA 5HL7Q 4NA3A 3NNCA 3P5BP 2RD5C 1WG4A 2DBBA 4OI2A 2ZH6A 1IBLJ 3D66A 3NGUA 1X4GA 4PWWA 4JI4F 2UUWA 2CJBA 1VCTA 2HHQA 1H72C 4KY3A 3K8VA 3I31A 1W7WA 2HZAA 4ED2A 3SSSA 1T03B 5LOQA 2GQ2A 1HHSA 1YITS 2HVDA 2H5JB 1EETB 3OXGA 3NEKA 2OKQA 4PG4A 1HBNA 2GMHA 3GJTB 2QYCA 3BDEA 2XMTA 3HVWA 1NDCA 4DX6A 3BV8A 4NRUA 4JI8F 1IKVA 1QM9A 2G9OA 2G1HA 1FT8A 3MR3A 3QPIA 5J2MA 2WONB 4K4UA 1FDNA 3MUTP 1WHWA 4B3OA 3GIRA 4ZN1A 4ZPDA 3DCAA 2A6OA 3H5UA 2CPEA 4RWWA 4WE1A 2W9AA 1G1XA 4NYOA 3M6WA 2N82B 2PA8D 4YDXA 3PW4A 2J7UA 2BOPA 4J37A 1FRJA 3KFWX 2O66A 2EFNA 3D6MB 4YQWA 1RLCL 3GV5B 2AJQA 3QNWB 2BVZA 4E2FB 3TRGA 4N5SA 2HQDA 3DNCA 2GGPB 2ZE2A 4GO7X 5SZTA 2CPFA 1F0XA 2K7KA 1FNXH 2AIRB 2KYXA 1HBMB 4DJBA 3BGUA 4UOGA 5T7LB 3DYAA 4H4MA 3CVKA 5HQ8A 4H4KC 2D7SA 1U1RA 4KH0B 4PXEA 1YG0A 4K2JA 4JI7F 2OHDA 4IYQA 4MIWA 2VC0A 1UTAA 2R7QA 2HLTA 5ETVA 2HSEB 2XMKA 3H40A 3K5NA 4HACA 2F8MA 4J9OA 4NLWA 2MQQA 4K50A 1NBEB 1JLCA 2W9CB 2MGZB 5AXNA 4JI2F 2MHNA 2R2TA 2VASA 5FDLB 1S1UB 2DK2A 3MDFA 1TL7B 1U1PA 3DC2A 1ZM3A 5F8LA 2ZH1A 4EEYA 1SJFA 2M4MA 5CYQB 3CEDA 2XLKA 5DDOC 2DNHA 2B9XA 4CYUA 2GCFA 2HVIA 1CQNA 4DL7A 4J9RA 4UQTA 4NL5A 2IM2A 3DM2B 1UWBA 4RW7B 5L46A 5H1SV 2Z2MA 3K59A 4TLRA 1N33J 1YQHA 3C14A 9RUBA 1PGZA 4FVMA 1XNRF 4B17A 1VQLS 3T5LA 3AJ1A 3QIPA 1U1NA 3ZNUA 1RHQB 3OR1B 4M5DA 4F2RA 4CP5A 4OX9J 4RBVA 1FERA 4YR0A 4C3KA 4DSIA 1NO8A 1X5OA 1RHJB 2AYMA 3W63A 1C0UA 4GMKA 1VISA 2E5HA 2VQEF 1PG5B 2OUGA 1T3OA 2QSFA 1CS4B 3TVYA 2DNYA 2DGVA 4ZS6A 4CLKA 4H54A 4PXDA 2O5DA 4E0DA 4KBIA 4MK8A 4RW8B 4DPWA 2XG8A 2B7CB 1KRPA 1YJ7A 3UD5A 1G3OA 4QWBA 2VBYA 1FHTA 2RRNA 2H54B 3J7YU 5DQGA 1RT5A 3C16B 1D3WA 3K7RA 2DIUA 1L3KA 5L9XA 2JH3A 4X4QA 5SUHA 1XR5A 5DETA 3M2VB 1UP1A 1QTNB 3PHEA 3S7RA 1RHUB 3NLCA 2LFVA 1QSLA 3RBEA 4DLEA 3C3LA 2DNLA 4DQRA 4QIEA 2VHGA 5KFGA 2FVSA 4C8ZA 1KQGB 3LPYA 3ILJA 3UCUP 2HZCA 2ZZTA 2MZJA 3JQMA 3CCMS 3BF4A 4XDCA 4K0KF 3NGRA 3CJSA 3LP2B 2V34A 1NAQA 3ZZZA 5C5JA 2Q1LA 3TUZC 5B7WA 1AFIA 2M9KA 5DG8A 1ACMB 2HHHJ 4LT6A 4D3HA 4RNOA 3SCLE 4ZIVA 2KXHA 2BBEA 5CA5A 5LXRA 4TY8A 4Y00A 4MYUA 4LUBA 5DZ6A 2W25A 1TK8A 2Y8YA 3MEEB 1NHKL 3K2YA 4L75A 3MCOA 5A0YB 4J5OA 3HZGA 1QAJA 5C7PA 2DGTA 2EFOA 2W2PP 3THPA 2YKMA 2G0JA 1EX8A 3KDOA 4DCJB 4DR7J 3H2UB 5HAOA 4TQRA 4MJKA 2IC3A 3W7BA 4B9TA 3T1AA 3QZ8A 3CMES 1LK7A 3NWRA 2MZRA 1R8AA 2OPSA 4I64A 1SUQB 5A8KB 2GAGC 4M8LA 1WORA 4KGXB 1FDDA 4G1IA 3EXYA 3CF5Q 1FWPA 4Y2MA 3HSGA 4ZIWA 1S1TB 4LF9J 2BQRA 2F4VJ 3SI8A 1M1KT 3OJUA 1XNQF 1AW0A 2CPHA 4XPEA 1GX6A 2QMXA 1C4CA 3GQCA 5GAGI 4TKTA 2JWNA 4C2MA 4DV7F 1U47A 4LBPA 2PMZD 1ZETA 4DFKA 2HAIA 3NNAA 2ZUAA 3OSPA 4A8FA 4IRDA 2LXUA 5A8RA 3LPEA 4AXIA 3UNGC 3G6YA 2W7OA 3HLUA 2B9EA 2XMVA 1NK8A 2CPIA 3ITHB 1WF0A 3ZTQA 2BW7A 2ZBCA 4DL3A 4F4AA 4DCOB 5HBMB 2JLEA 4OZNA 1P6TA 3ZTRA 1VQ8S 2QA4G 4V19X 4KR0B 3NS6A 2WVCA 2EC0A 3MUMP 4DX7A 2M8HA 1SL2A 1S7HA 2JVRA 1M5KC 2XULA 5K14A 4NZ7A 3MUVP 3BQ2A 3KK2B 3RBDA 2GNKA 3HSDA 3M7VA 4WK1A 2DNOA 2JEJA 1KN6A 2CZVC 2DH7A 2QSWA 1RTZA 1HNVA 4IR1A 4YHHF 3CCLS 5CQGA 4DR5J 3M1VA 1RAFB 1JLQA 4DSFA 4ZP7A 1V5IB 1NM2A 4Z7CA 3U1MA 3U1NA 1RTJA 1BLUA 2EFVA 5KG0A 3D9BA 2BJEA 1HQEB 2J6SA 2HWTA 3HSJA 1HMVB 3BGFA 1VLYA 4K4SA 3LA0A 3KLEB 1B0VA 2HGMA 3SYZA 1S77D 4RW4B 2QGFB 2WVDA 2HVHA 4KO0B 3D0GE 4F8RA 1DHMA 4ZP8A 1WTBA 3IS9A 1DQ9A 3MEGA 4ES1A 3ONQA 3CWJA 4I1TA 3RW6A 3PO5A 1B64A 1D9AA 2YKQA 4DV5F 3DLEB 3SV3A 5IOLA 2IMOA 3BEGB 2HK3A 4IO1A 3VAGA 3DLBA 4JI3J 1TKDA 4J9MA 3UVJB 2WVEA 2BM1A 3AOBA 2VG7A 3HFZB 1BC6A 4C3LA 2B4OA 1UZHA 3V5RA 2CIMA 1QY7A 1OSDA 1IN0A 3CJKA 1C1CA 2JFKA 2V9WA 1FCAA 1BXNA 2ZKUA 4RWXA 5A8WB 2KB2A 2EK6A 3UNYA 5IQ6A 4KAIA 1Q16B 4O3RA 4DUYJ 3VAMA 2UXCF 1T02A 5B08A 3A12A 4F4ZA 2C22A 3ENAA 1G2EA 4QYZJ 1F6TA 3IR6B 3LGMA 2FZKB 8RUCA 2EKYA 3C6UA 4ZHRB 3KLFA 4PYDA 4JI6F 3NGSA 2GVDA 5F8HA 1RI7A 3TZZA 1NRKA 5KFYA 3L4BC 3KDNA 2VFUA 1RAAB 3FRZA 1RWMB 2HKEA 2O3DA 2YNGA 2ZNYA 1B3TA 3M6XA 4KHRA 3PW0A 1S9FA 3H25A 4ZVTB 2KHDA 2E1RA 2HBYB 1C1BB 4FYYB 3D67A 4CLWA 4ZPCA 2FVCA 4CH0S 4LFAF 2DO0A 1A6LA 1RT2B 1AFJA 2RH3A 3VAFA 3ISND 4NMLA 4H4OB 4IDKA 1A7GE 3MR5A 3M8PB 2GO9A 4J9PA 2VU5A 4DL5A 4G1PA 1G6BA 4ECRA 2HWHA 3OV7A 1S6QA 3MAQA 2MY8A 2B4VA 3RU0A 2F8EX 3CJ3A 1X0FA 2IJRA 1S57A 2LDIA 1XEZA 1S72S 3MM8A 3C2PA 4H4KA 4EI2A 1XMOJ 4CNYA 1FF2A 5E5NA 3V6DA 3AHPA 5RUBA 1Q1KA 4PABA 3ET6B 4ZK7M 2YNFB 1NU4A 3NP5A 4DV4J 4F3MA 2GC8A 5J2NB 5E33A 2D74B 3RB6A 2D3O1 2NZ4A 1IBLF 1ZPWX 2DXEA 1UA0A 1BQNB 4DZ6A 2E5LJ 1WF2A 4UZCA 4B9UA 2ZH3A 2J6UA 4HTJA 2I0XA 2YXLA 3IAS9 3O6QA 1MN7A 2VQFJ 5GAEI 3LP1A 3TAMB 1IKXB 3EZ5A 5B0CA 1DTTB 4IQXA 1LWCA 2Z30B 4WZQA 5I4MA 4EGLA 3SFGA 2OELA 4KIAA 3H8YA 1J5OA 3KK1A 4NI2B 1LW2B 1YBAA 3QSYB 3KJVA 3D7SB 3MPDA 3CJ8A 4FBUA 5KT2A 2X3DA 3ISZA 3GFZA 5L8RC 4DG1B 1M5PC 4YR3A 2QLWA 1F9EB 1YJNS 1FI4A 1AUSL 2B43A 5F8GA 5F0UA 1VOMA 1E6YA 1KR4A 5KFCA 2I8EA 1IKYA 4XPCA 2R7WA 2QLFB 3KTQA 5K8OA 3BR9A 4PG8A 4OHYA 4BBYA 3CC2S 3EUNA 1XQIA 3BS9A 2C3UA 2DRDA 1ZM2A 2V9KA 1SL0A 4C97A 4I6WA 2MKIA 1N34J 3KLVA 3SCKE 3PJXA 1S1XB 3Q24A 5HP1A 5HROB 1FD8A 4M5KA 4JOUA 3A8JA 2VFVA 1VK8A 2JVOA 1KQSR 4F0KA 4JYAJ 1HW9A 1VBYA 1Q78A 3D0HE 3MMAB 2CQIA 1RT7A 4PUOB 1UFLA 3ICLA 1VJWA 4TN2A 1XN9A 4ANCA 2QFIA 3OD2A 1X5SA 3WQPA 3D1HA 4MKBA 4ZVOB 2BJ1A 2EFPA 2YKNA 1EIYB 1KHWA 2VONA 2HHVA 4ELUA 1URRA 1RT6B 1RK8A 3MM5A 2OPQB 1S5ZA 2YKAA 2CKWA 1XWLA 2QG9B 5BYQA 1RWNB 3D5MA 4YY3J 1FKAF 3OL9A 3MM9A 1Z2LA 3CXCR 5B0DA 2VJUA 4NASA 2XO7A 2HFOA 1AA1B 2CQHA 5J1NA 3J7A1 3E2EA 5E3CA 2JL9A 2VC1A 3CE8A 1HNZJ 4FPRA 3HFKA 3MTKA 5D4LA 4ZVEA 1RTIB 3DDKA 3MMJA 5J1EA 2Z2LA 1S7IA 2HW3A 5DJBA 4RX6A 1U1LA 2R3VA 3HK2A 4DR1J 2AV5A 1LXJA 2JEGA 1JLAB 2C2DA 3RR7A 1QLNA 1N33F 2LQ8A 4X4RA 2XSFA 2BW2A 2NREA 1BGXT 3V2UC 4HHJA 4DSJA 5K8MA 4ZPTR 3QJJA 2LEPA 1IVZA 1SVDA 4KC5A 3JSRA 2JHEA 4F7VA 4B3SF 1VQYA 3LW5C 4ALZA 3MAAB 4DR6F 4DZDA 1S10A 1NZAA 3VR1A 4HKQA 3B8HA 3J7Z5 4OMFG 3M8YA 4LRCA 5EX0A 4WYLA 3DLGB 1HKAA 1SXLA 5ADZA 3O2IA 3U27A 4NZ0A 4NLOA 3G6ES 4B3RJ 2IVMA 4USHA 3H5YA 4I69A 2J7WA 1W2BR 3O44A 3GFXA 1AZSB 4B9NA 1TKTA 1Y3JA 3GYGA 3BKFA 4NLXA 5AXLA 4LF4F 2LQ9A 1TKXB 3B4MA 1TUVA 3CMQA 4DLGA 3ZZOA 1OWXA 1N5TA 3M30A 5K8NA 1N5SA 3CCTA 2KVQE 5KFHA 4RR5A 3PFOA 2E9ZA 2J9DA 3TANA 3GG1A 3LUYA 4Y28C 1ITPA 3PEHA 3W9IA 2GQCA 4UOCA 4MIBA 4ECSA 2YH0A 5CYMB 3MMCA 2VDHA 4ZVGA 2A18A 1F1BB 7FDRA 4TU9A 2HHHF 3EYZA 1GH8A 4K59A 2KH9A 5THWA 2K1RB 3CCVS 5DG9A 1YGYA 1B7YB 3UD4P 1CJUA 1HWLA 4WFYA 3EMTA 5B0FA 1UVLA 2F63A 3I56S 4UTGA 3A8IA 4CQ1A 1TFWA 5C25A 2CJXB 2OEMA 2Q79A 2VPYB 3M9OB 2P2CB 4LRFA 1RT1A 1MSWD 2WVBA 3MPWA 3BQ1A 2ZNZA 3KG1A 5EWGA 2ZD1A 2HHWA 3NGTA 4WBFA 4J91A 4DSKA 1F2HA 2FJWA 4NWBA 2I5JA 2UV8A 4LF9F 2F4VF 4A8XA 1ZH5A 4A46A 4IQMA 2KYZA 1TK5A 5D4PA 5KFZA 4YMEA 1X9MA 4O0NA 4JV1A 3HHEA 2YH1A 3CCUS 1R0AB 4NLSA 2NSBA 3H4BA 4M94A 5K20B 5HMZA 1FVQA 1UCNA 2Y3YA 2A10A 3K58A 2JZ5A 3EGVA 2DGQA 1LWXA 1ICEB 1OMSA 5KFOA 2XQCA 4LFCJ 4NLGA 1RWXB 3PW2A 1O51A 4P7VA 3CJTA 3QWPA 2R2UA 2QYGA 2YX4A 4USWA 5DLGA 2BOAA 3FSXA 3D2WA 2R8JA 2CNKB 1UVIA 4USIA 2VPXB 2PA3A 3Q8UA 4Z2XA 2KJWA 3GV7B 2CZ9A 1UJ6A 5ETLA 1XR6A 1KVKA 1UEVA 3GIIA 4GRSA 4A8WA 1H2UX 2IJFA 5F41A 3G9CA 3KUEA 3NOCA 4P6QA 2UVWA 2RILA 3AJ2A 1HBNB 4ZVPB 2OPRA 3EDQB 2CQBA 3K89A 4OHXA 4CLLA 2J9DE 3R5AA 4OI4A 2HQIA 1IKVB 2QE5A 5KFTA 3LQVA 2EFGA 4I2QB 4A48A 3AJDA 2GVZA 3H90A 1TMJA 5J2MB 4ZKAA 2B4UA 3LALA 2X3GA 3DLHA 4BDPA 3FSIA 5H9EJ 1LOUA 4WE1B 2IYIA 1EQ0A 4NYPA 2N7YA 1R0CB 3R97A 2LP4A 5T7LA 1SC1B 3I4PA 3G71S 1N0VC 5E7OB 1V6HA 1LWEB 3HT3A 2RJZA 1UEUA 1GXUA 3C15A 3BM7A 3DMJA 2RIJA 2RKIA 3W8PA 1K1SA 4C98A 5ETTA 2PIIA 4ED7A 3G8QA 2HZVA 4X2BA 3HJVA 4WFZA 3SZ2A 1Y00A 5IWAJ 4O3QA 5KTQA 3GYXB 3T9ZA 2ZH8A 4BWMA 3DYAB 4MKVA 1JJHA 4H4MB 1LQ9A 5BYRA 3PKYA 4WCEQ 4XDDA 4I68A 1RDRA 3RW7A 3D3BJ 1NUEA 5F8IA 2D3ZA 3L9ZA 4K4ZA 3HJFA 3K5PA 1G7CB 2QLBB 2FLOA 4X4VA 1HFEL 4DUYF 3CDBA 3EXCX 4HACB 2AYEA 3KLHA 1RU2A 2GJFA 4K4TA 2YPYA 2X1AA 1JLCB 3B78A 5G4DA 2XWYA 1XBWA 3CDAA 5GVQA 5E3AA 3OJSA 4DR4J 4BC7A 5AJ3J 3GIKA 3FCVA 3VAIA 4K2XA 2D9OA 3AOCA 3FBBA 2MB0B 4YN3B 3I0RA 1GMWA 1KTQA 4USTA 4AFFA 4CYUB 1LK5A 2LQ5A 4CLYA 4E98A 2BA9A 5DO2A 2ADCA 3DRYA 2XZTB 3BN4A 5MLCV 1F9HA 4B9LA 1UWBB 2DHGA 1QE1A 4C11A 4ED0A 4KYZA 3FBFA 2DGOA 4CO3A 3HHLD 3H59A 2XZWA 3C14B 1VQ6S 2ZWPA 4JP8A 2KRRA 5IM0B 3D6FB 3V6JA 2IDLA 2V50A 3V6KA 4LF1A 4DV0J 1HPZB 4M5DB 4X62J 2HS3A 2ZZNA 3D54A 3ZZTA 1RISA 3NKYA 4RU9A 1JJ4A 1C0UB 4QWAA 2IRXA 3B4DA 4O3SA 4F26A 4OFZA 4OI6A 1HI8A 1XMOF 2F1FA 2C2NA 1GXTA 5ETSA 2IYGA 3KG4A 1P9QC 5AE1A 1HQ2A 2AMCB 3JQKA 4DV4F 3UCZP 1D9FA 2GHVC 1RT5B 4O23A 1IQTA 2OFGX 2CNLB 4PCQA 3FBEA 2E5LF 3Q2SC 3Q89A 3PO4A 3HD1A 2FVPA 1T9VA 3HKWA 3TO8A 1OPIA 3U02A 3I55S 4EYHB 6FD1A 4ZPBA 2E1PA 2VQFF 1T94A 4OLOA 1UKUA 4OZJA 4GKJJ 2HFNA 1FDBA 3EVMA 4C9DA 1GMUA 2DNMA 1MWZA 2V5HG 2H5EA 1REGX 2A2DA 4X4UA 2IVFB 5A8KA 3N79A 2LKZA 5A76A 4ETZA 1F2GA 1R3NA 3FVYA 3GG0A 1VDHA 2MQPA 4PZVA 1CJTA 2BEFA 2OD6A 2Q3PA 3T9NA 2X51A 3G6XA 5EGYA 1TTHB 5AT1B 3TX8A 1JK9B 3P4UB 1RAEB 2RS2A 1N34F 3NCQA 5ETNA 1GAOA 2AHOB 2YKMB 4NMXA 3FEYB 1VQPS 2QFJA 2P9EA 2YWEA 4FYVB 4LJMA 4MKYA 3ZXWA 5HBMA 2OPSB 5EWEA 3M8QA 3HXMA 4JYAF 4W92B 4Y65A 4FF4A 4NXNJ 2GZOA 4A8OA 2L08A 4LMZA 4K8RA 2FC8A 1SB6A 3ULHA 3A3NB 3NNHA 2C28A 5KFUA 3QIDA 1ZAVA 3IM9A 3OTOJ 2LCWA 5LMNJ 2HHSA 1WC4A 3VV2B 3D4JA 4QZVB 5D15A 1RAHB 1EZZB 4NLPA 3DN9A 2M52A 3OVBA 2HQ3A 4QR1A 4OIXA 2FB0A 1RT3B 2QL7B 4PKDB 2ZH7A 4GVLA 1Y4ZB 2ZEJA 5L38A 4CLSA 1TFYA 2CXEA 2BKNA 2HGNA 3ZZRA 1PYSB 5KG3A 4YY3F 3DGPA 2QZ8A 4U96A 2UUBJ 1RHKB 3HDSA 4BS2A 1FJGF 4ED1A 3SMZA 1WNEA 2UVVA 2FDNA 4WP8A 1HQEA 2V8DA 1UW4A 2YKOA 3UFCX 2W7PA 2R7TA 2XI2A 2AWZA 1WTFA 4ZDNA 1HNZF 3G2XA 1YZ6A 4ZVFA 3V4IA 3R7NB 1T11A 1YRUA 4URQU 5K14B 3RZAA 3TJ9A 4KPYA 2RQ4A 4CRJA 2EFQA 4DR1F 1SC4B 2UVRA 5KOXA 2CQ3A 4LBHA 3M1VB 1JLQB 3O3LA 3IAM9 1FFWB 2V8VA 4AL6A 4NEZA 3AODA 1RTJB 1BWEA 2UXBJ 3DRPB 2R7OA 3SCIE 3H20A 2V0NA 3HHDA 3PIOQ 4Y6IA 2DEIA 1NXIA 2DNRA 4XAKA 3UWTA 2J0XA 5KFXA 2MPUA 4LRBA 2DGXA 3HVAA 2M3DA 3WIUA 2YNIA 3OTCA 1R8BA 3W61A 2ASYA 2G2OA 4NLUA 4RBTA 2R8IA 2ASLA 4TY9A 1Q79A 5KFMA 2H51B 2DR6A 5KFDA 3QRQA 4B3RF 4FPIA 4HT5A 3IS9B 5A8WA 3MEGB 3R5DA 4FF2A 2IFXA 5DGAA 3M8ZA 1Q7LB 3NAHA 3VAJA 5IZHA 1YJVA 3ZFVA 4QYZK 4Q0BB 5D0EA 1WWHA 2WBMA 1H2TZ 4O44A 2OP5A 4U6PA 2VG7B 2C2ZB 2EBGA 2PD1A 3IA0A 2E9TA 2QC3A 4QIFA 2JX2A 3P45B 3WX8A 4DR2J 5KFVA 3JAMU 3CJKB 5E41A 2W8LA 1RJJA 2XNRA 4YB7A 3FUYA 2KFYA 3RYLA 3TR5A 1HHTP 2ZFHA 4RO0A 3MM7A 5KFBA 4P9SA 1QDUB 1SJ4P 4NRTA 5KFPA 3DFEA 1YJ9S 5AXKA 4QU6A 3ZZYA 3C6UB 4KRWA 2XSJA 2GVDB 2C3YA 2QL9B 2MZ1A 5D4OA 1M5OC 4ES2A 3TQ1A 2RRBA 3QLHA 4DV1J 3Q8YA 2LVWA 3A3OB 3KG0A 4ZCLA 3DRSA 4K5RA 1TUGB 2YNGB 3US5A 4JI5J 1X5PA 3ET6A 3X1LB 1IBKF 3M9NB 1S4FA 1X60A 4QPTA 2HQFA 4IG0A 4LR9A 4IDKB 5KFRA 1EP4A 3TA2A 2E1MC 3QT5A 4DFMA 2ALYB 5ETOA 2BANA 2VJVA 3TA1A 1S6QB 1SIZA 1ZYQA 3BR8A 4C8MA 3MEDA 5C42A 3GB0A 4FS2A 5GADI 5B0EA 2BRLA 4Z7YA 4DV6F 2N3OA 4DI6A 4OV6A 2A2CA 3JXOA 3J7AN 4D3GA 1FA0A 3ILLA 1GX5A 4NE9C 4LFCF 4J9SA 2GW8A 4QJVA 3SXLA 4YB6A 2MMYA 2VG5B 4QR0A 2YWGA 4DG1A 2XLJA 2YY3A 5LSOA 4QU7A 4JV5J 4KT0C 4OJ3A 3Q8SB 5EHHA 5HQLA 5D3GA 3FZBA 2YNHA 1Y3KA 2Z8QA 1TK0A 3PACA 5HK4A 4ZITA 3PX4A 2E7WA 1UFWA 3GJQB 2XCPA 1IJEB 2NSCA 4AXJA 1RE1B 1KKHA 3LP1B 2XHWA 3JAMY 1LWCB 1U6BA 4TYBA 1J5OB 4DV2J 3KK1B 1DQ8A 4F67A 1OS5A 2OGUA 5HVGA 3CULA 5I3UA 2DH8A 3D3CJ 3Q22A 3KJVB 2DO4A 1I94J 2F8HA 4P72A 1H3DA 3CJ2A 2U2FA 5KFEA 3UPFA 1UEKA 5I3PA 4LFBJ 3OL7A 3IMQJ 1E6YB 2XYGB 4WU3A 4DF4A 3FNNA 3I5BA 3QGGA 5KFNA 1IKYB 2DCLA 5HJYA 1K9MT 1IR0A 4ENOA 2KKHA 3PM9A 3UDLA 2VH7A 1FFGB 1A0OB 1KS2A 2NLWA 3OXLA 1B4SA 3R1HA 4FF3A 2YWFA 1CC8A 2E9RX 2OPQA 3DOMA 1HARA 3GFHA 3TZWA 4WXWA 5IWAF 1RKIA 2Y1LB 3CDEA 4R0JA 1I5OB 4N76A 4LF8J 1MROA 1RT7B 1GMWD 4OYXA 1HWJA 1V3RA 4QPXA 3DI6A 3CTRA 2FVRA 4URGA 3HF5A 2HAFA 4U8YA 4EZ6A 3HKZD 1YRTA 1HYSA 4ED4A 3CCES 2K2PA 4WKYA 5DZ7A 3GONA 2YKNB 4A4JA 1NNDA 2BJDA 3MM5B 4WKRA 2QLXA 2G0CA 3TAQA 3IGVA 4ICLB 2LA4A 1RABB 5KFLA 4F4XA 1CPZA 3OVAA 1JB0C 2N3LA 2CJYB 2ZDPA 2FHKA 3MM9B 1ZTTA 2QMWA 1LW0A 4I2PA 5AJ3F 4M5HA 3IWLA 3UW1A 1WOPA 2AQ4A 2AX1A 2GAHC 3RTVA 1RZMA 2ZOMA 3WC0A 3J7ZT 1Q82T 3FCWA 4ID5A 2KVIA 5I3QA 3RRHA 2HRYA 5J1EB 1RSCA 3HULA 1HWIA 4KGKA 2Z56B 1AT1B 2QJ3A 4C8KA 4YEAA 3PXGa 1KQFB 4MK9A 2DR9A 4A8YA 3QATA 1KSPA 1M5VC 1AZSA 2A0FB 2IIHA 2HHUA 2E1AA 3OHBA 4NLQA 2Q66A 1KEKA 3POTA 2FY8A 4L3KA 3HVRA 5GAGU 4DV0F 4P2MA 2HFUA 4X62F 1QD1A 3D6HB 3UDCA 4DS4A 3UN3A 1QJHA 4PXBA 1Z1ZA 3R9LA 1H2VZ 2OSQA 2AW0A 1YX2A 3VQSA 1HNIA 4C7QA 1JNZB 4DL0C 5F0WA 2ZH4A 2E1CA 4J9QA 4EZ9A 5JVHQ 5L1KA 4L73A 2NS1B 4CLPA 3SFUA 3WX4A 2BX6A 2AU0A 2LU1A 4DUZF 3H5XA 1NK5A 1RT4A 2I9SA 1DARA 1NPPA 2UUTA 5CYMA 4QQBA 5BXIA 1TKTB 2FJVA 2IDEA 4IFYA 1ZM4A 3OL8A 3NBPA 4PG5A 4S0MA 2AT1B 5C2CA 1FKOB 1CJKA 2RMLA 1QAXA 1QAIA 2AJ4A 1KWMA 3K5LA 3JSMB 4IUFA 3M30B 4Q45A 3N6NA 4FKYA 1N52B 3UDVA 1UA1A 4ZCIA 3OLAA 3RB3A 3K17A 2AD9A 1D1UA 4YOEA 2EC2A 3MMCB 2ATLA 3N9UC 3T1YJ 2RHQB 1BHNA 2W1BA 4Y3CA 2KL8A 3PR5B 5DLFA 1S0OA 4CH1A 3I0SA 1ZS6A 2MYFA 5CZVA 2Y0SD 2MKHA 1FK9A 2JNJA 1X8DA 3AD7C 4F2SA 3IRXB 1TMMA 4NPOA 3CCWA 3M8WA 1JLEA 1N8RT 3ZTSA 2L48A 2KDOA 1SKSA 1ELOA 2E7XA 2Z58B 4HI1A 5C2GA 4LIWA 2IA6A 1U45A 5C25B 2HRUA 1SKRA 3NAIA 4U9RA 2ZC3A 1RT1B 3QZ7A 1N6QA 3KYLA 2ZD1B 4YS2A 2VKRA 3MFIA 1NSPA 1R0BG 2I5JB 2NXEA 4NXNF 3OXFA 3QBCA 2QMUB 3EX7B 2WK4A 3OL6A 4WF9Q 3DLKA 3OTOF 5LMNF 4CIOA 2J76E 3FMBA 3CIMA 3PFEA 4G1QA 4O3OA 1NDKA 3KKFA 4LREA 4KKOA 3M2UA 3TUJC 4QR2A 5CCLA 4BHQA 1EJ7L 4DR3J 2I1RA 3GFYA 1M1GA 3JTNA 3P49B 2PMWA 1H0HB 3HZEA 1RB0A 3EVOA 4I2QA 4PG7A 2W8KA 5FIIA 2GV1A 3R6LB 4NX9A 3W62A 1IR1A 5H9EK 2HYIB 4OHVA 4PQAA 2RDJA 2WOMA 4CO2A 4DQPA 4R5PB 2R7UA 1LWEA 1NDLA 3FKBA 2E5JA 3PDNA 1VRUA 2DNKA 2AF6A 4L76A 4Q44A 3UD3P 1Z2ZA 1HR0J 2FHMA 1Z4UA 3CSKA 3BBBA 4Y2KA 1TZ0A 2LDYA 1LFPA 4FYWB 2FYXA 1NHVA 2OPRB 4Q8EA 3KJFB 1O5JA 3KNGA 4IOAQ 2NCKL 4LF5F 1VQKS 1UVMA 2GVZB 3RRGA 2CDRB 3AXMA 4XIUA 2UXBF 3PZPA 2CVEA 1VRTA 1NK9A 3QGPA 2B9WA 1U09A 2JJ4D 2B8PA 4OYOA 4XO0A 4DFPA 1KP6A 2IPOB 2KT3A 1S0VA 3WBZA 1VFJA 3W66A 3W8GA 3C15B 3DMJB 4CI0B 4B3MJ 4FYXB 4WJBA 2RKIB 1WC6A 2NPFA 3AA9A 4MH8A 2FUG9 2M2BA 3HVTA 3HD2A 1VBXA 5DDQC 5A6WA 1ZA2B 1N4LA 2RU3A 3GP9A 3BBCA 5IT9U 5GAEU 3RAQA 3TUPA 3MD1A 2E29A 3KLGA 4NYZA 1S1WA 1ZM9A 1K8AT 1YJTA 2RRAA 1LV5A 1FWLA 2OMLA 5KG5A 5CHCB 2PGCA 1X9WA 2GIFA 1UMJA 4JI4J 4UOFA 4ECQA 4DR2F 5BR8F 2WTFA 3NGKA 1LXNA 4F4WA 3W2VA 4OJGA 4LRDA 5BJRA 1FE4A 3KMQA 1PAEX 3OUYA 4C6AA 1N5YB 5IM0A 3KLHB 1VJQA 3U7JA 1XMQJ 5J2PA 1NK6A 1WKKA 1HPZA 2AEJA 2JRSA 4OYAA 1FD2A 4A8MP 4X4NA 2IM1A 4CT8A 5JMNA 5F9LA 5IFMA 3CD5A 3CT9A 3HT0A 1TR0A 3JQJA 1NK4A 3AFGA 3I0RB 4DU7A 2FZCB 3TNVA 5B0BA 1B0TA 2DRAA 5HO4A 2HFVA 4NXMF 4LIRA 3IRWP 1FJ7A 1FE0A 4DV1F 4ZVHA 4LF6J 2N7CA 3F56A 4TU7A 1EKSA 2BABA 1UW9A 4JI5F 2XMWA 1QE1B 3FEZA 1NMEB 4C11B 4F4KA 4N7TA 4YB1P 2POKA 3JS9A 1RACB 1FRXA 4B08A 3LP0A 1TV6B 1HHQA 2V8HA 4FP9A 3R3TA 2EBEA 2NUUG 3FFIA 4NLVA 2CQ0A 1WC3A 4XTTA 5D4NA 2GA7A 4P2XA 5E3RA 1I6JA 1MLAA 2ZH9A 5GAHI 3PTWA 1X4HA 4O4RA 1K73T 3I9V9 1O6XA 3AH6A 2L9NA 4DBQA 2R7VA 3Q0AA 1VQMS 4EU0A 4JI7J 1FWKA 1RU1A 3OTBA 4N47A 3MPYA 2HGLA 3OHAA 1X9SA 3I5CA 1U24A 2JEFA 3OPKA 1RGVA 8ATCB 1Q86T 1UVNA 5IT9Y 4I0WA 3M32B 3ISNC 2C2RA 4I7FA 4GC7A 2VPZB 2F9DA 4L74A 2GFFA 4ZVUB 2VF3A 1UAWA 1IM4A 2MJNA 2ZM6F 4B3TJ 3A8EA 3AT1B 2XWXA 4DL4A 2BKPA 3VCDA 2YTCA 4OJ1A 4DV2F 4OJHA 1ZZFA 2BE9B 4DX5A 4DWIA 3K8WA 5HVFA 2J9CA 3LO3A 1I94F 2DR5A 3ZTOA 1UZDA 1FRMA 2CNOB 4W90B 1DTQA 2CPDA 4CO0A 1K0TA 2O1PA 1CLFA 3RBXA 2V4JB 3PY8A 3ENQA 5D8HB 2D9PA 1CJTB 1FXRA 2DYAA 2BR0A 3VGUA 3T1HF 1RT3A 4X4SA 2VQEJ 1MN9A 3UO0A 4K4VA 1Y7PA 1VQSA 2K3KA 1FJCA 4PQUA 2FY1A 1FFSB 1URNA 2PI5A 3G4SS 5M2PA 2Y1JA 1YJUA 5IT0A 2MQLA 1WDTA 3M8QB 4USUA 2VFSA 1HWKA 4LF8F 1IKWA 5KFFA 5JXSA 1W25A 2XLIA 2M8DB 3HHKA 1SJQA 5LSLA 5LJ5Y 5CD4H 4QWEA 1U8WA 4AT1B 4OZ0A 3MWBA 3EGWB 3VVTA 2HURA 4BC9A 3MOJB 2OSRA 1U7LA 4AE5A 2R2SA 3DDNA 4LRAA 3VVUA 1MMDA 2KXFA 2FQQB 4GVBB 4KB7A 2V2VA 3B82A 2FJEB 3MFHA 3AQOA 3J80U 2ZWOA 3EPGA 4UW2A 2B4PA 3W5YA 3DGPB 1YDLA 5KT5A 1E6VB 2VPWB 1X4EA 1EARA 2AJFE 3DRPA 3AD8C 2H4WB 4ILLA 2PT0A 3VAKA 1BQXA 5LM7E 1HD0A 2E5GA 3VAHA 2D3UA 4Y0FA 1JWWA 4UUXA 4OZ3A 4ILRA 3V4IB 2XY6A 1WDDA 3NG8A 3EM1A 2KM8C 1NPKA 4ILMA 2KXNB 3FZ2A 1HLWA 1L3SA 1VK3A 1M5SA 3L7OA 1NKBA 1HQUA 3BREA 2R9LA 2IBOA 3FQLA 2OEKA 3IBCB 1KFDA 1GMVA 1TL1A 3OLBA 4Q0BA 2BJ9A 3PRBA 1Q95G 3S6EA 2VDIA 4LSZB 3S01A 4JV0A 2DNGA 3WC2A 1R31A 3WHIA 1VBZA 1VC5A 2MQOA 4USMA 3G6VA 3LWLA 2SXLA 2YNIB 2NXNA 3IG1A 2M5YA 1WHVA 1R27B 5CAAA 1BMQB 2PMHA 4MT1A 3NCRA 5AE2A 4P7TA 5DDRC 2IM3A 5I42A 3VHQA 1F5CA 3DOKA 5T41A 4IG3A 1ZPVA 1K0VA 3KLIA 4EYIB 1Y11A 3ADAC 1CJVA 4RJVA 5EDWA 4ITSA 3T41A 3FGVA 3KMSA 4Q5VA 3MURP 2M7SA 2HEKA 2HVEA 3DXBA 1H7WA 2CPXA 1D8YA 2BMBA 4O44B 1KQKA 5DQHA 2UXDJ 4DX8H 4RNFA 4JI0F 1K1QA 2UU9F 1W2IA 3MM6A 4E8UA 1K44A 4UUWA 1T9UA 4OZ2A 2LXIA 5KG4A 2XMMA 2JC1A 3CMAS 1PILA 4FKXA 1RUSA 1HNWJ 3J80Y 1JKHA 3DU6A 3KXDA 3MM7B 3IGNA 1SL1A 3R8YA 1S1VA 1S97A 2QA2A 2OTLS 1Y10A 4C3MA 4O0IA 3C66A 3MOZA 3TARA 2XSJB 4ER8A 4WWSA 4X66J 3SEOA 3G8SA 3OFEA 1SKWA 3QLHB 2B56A 4IH6A 3DRSB 2CG8A 3DGVA 2JC0A 5K9FA 2X1BA 4CO4A 2XNQA 1X0PA 1IWAA 2B8QA 2OIHA 4O3PA 2VOOA 2GMJA 2VG5A 3HI9A 4K4WA 3QT8A 4ZJQA 3A4TA 4DV5J 3F0NA 4IG0B 5A2QU 1EP4B 3QGIA 5KFWA 3TP2A 3V4MA 3N6MA 2VG6A 1Y5LB 2FJBB 1IWGA 2BANB 4U8VA 4NA1A 4FXDA 3MEDB 2Y1RI 5C42B 3CD7A 4J9UE 3ZZPA 5DDPC 4HH0A 5ETRA 3VF0B 2CUYA 2ZBIA 4DR3F 1FTRA 2W2MP 1VS3A 5DGBA 4DSLA 2MKCA 2ZBQA 3ZZUA 1F5BA 3Q8RB 4IH7A 2QLJB 3N6LA 3PKMA 4LVOP 3BKUA 2VZ9A 1U0SA 2B5JB 5JJBA 2IBKA 3CD6S 4BCAA 5ITHA 5D3GB 2IAJA 2YNHB 3EGNA 3CW2C 4OX7A 2MXYA 4M95A 4DPUA 1SV5B 2UV8G 1TELA 2AX0A 2MHEA 5JUMA 2DPJA 1WSVA 1WEYA 3O5TB 1TKZA 4G3IA 3Q23A 2NYHA 3MCSA 2DTJA 3S8SA 4UF4A 3E51A 1KOOA 2JFDA 2JSXA 2ZKTA 3CJ0A 4G65A 5I3UB 1SH0A 4N77A 3LTOA 1U25A 2R4FA 3NL0A 1EKRA 5HMWA 1TL3A 2IVYA 1FKPA 2AJ0A 5IQQA 4F0MA 4OYMA 2P5VA 2IMWP 5LT5A 1VHIA 3CDWA 1SIWB 3M8RA 2VIHA 4WFNQ 1NSQA 2M88A 1Q8LA 1VQ9S 3I5AA 1FNOA 1RHRB 1QVGR 1NSAA 5KG2A 1FX2A 3EZUA 4KFBA 4OI0A 2W2OP 3R1LA 2OPPA 4ICLA 2DY1A 4JBCA 4MK7A 3DOMB 1HWUA 3ZO7A 1RQ0A 2C3OA 4DFJA 1S76D 2IM0A 1KLMA 5A2QY 3RBZA 4FDFA 2BKOA 2CNNB 2FTRA 2XEXA 3MZIA 1J5EJ 1MROB 3HX9A 1XR7A 1DQAA 2F40A 3DI6B 1YSJA 4JI1J 4NOHA 4LQ9A 2M70A 1HYSB 2DIVA 2G2YA 2ABYA 2YBVA 2MKSA 2BUNA 1PIEA 3OBIA 1AB8A 3MR7A 1N32J 2CQPA 4LF7J 1XMQF 1HI1A 5HLFB 5KG1A 2RUSA 3CJ4A 3RRKA 2FLLA 2I2YA 5JVGQ 3TWZA 1B7FA 1LW0B 4U7UD 4OX9F 4I2PB 2VFTA 3HSZA 3OFFA 2GS8A 4DN9A 2FJDB 3BGRA 5D78A 3CC7S 3QT7A 1TVRB 2P6TA 3PNIA 4LF6F 3LGHA 2MLXA 1S48A 1Q5VA 2RHSB 4ID5B 2ADBA 3H98A 3K5MA 4C4WA 4DL6A 1NDPA 1R8HA 3QMQA 4WU2A 3SCJE 4CH7A 3E3XA 4B9SA 2VV5A 3POTB 4ZPVR 5AXMA 4B9VA 5F8MA 1RCOB 1GK8A 2LEBA 1FKOA 2ROGA 1C4AA 3CJ5A 4ZPWR 5HMYA 3JSMA 2HQCA 6AT1B 1HNIB 2HMIB 1RA6A 4TQSA 3TI0A 3EWGA 2J7KA 4OX8A 3IXQA 3Q83A 3CDUA 5HANA 4HH1A 3MR6A 1S6OA 2HNZB 5ETQA 3G8TA 4RW9A 4OI3A 4K7QA 1OQ3A 4F0HA 3I82A 4DOZA 2AJ2A 1Y5NB 1RT4B 1YK9A 3SSQA 4QIGA 3TW0A 1Q8KA 3SQGA 5KT7A 1RTDA 1SJRA 4IFYB 3P6YC 3HHLC 3CUNA 3NBPB 4LSNA 3KHLA 2KFZA 1BD6A 2KZZA 1CJKB 3BSCA 2MQNA 3IRXA 1HL6A 4LSLA 3TAPA 4RNHA 1BWVA 4JUZA 2ZOGA 4DL2A 2COLA 1NH8A 1ULRA 3H0PA 3BQ0A 1DZ5A 1KNZA 4B3TF 1N48A 3CGIA 2DB1A 2L3MA 2FHJA 2DISA 1D8ZA 3CD0A 1F60B 4A8SA 4RUCA 4V1Ak 4DR7F 1U0HA 4MFBA 2ILZA 3CB4A 2HNYA 4PR6A 2B3TB 1KLNA 2AGPA 1P27B 5GMDA 5D0RA 2D1CA 4HT7A 1BQMA 1R6YA 2BM0A 3I0SB 1X31C 2CRLA 3PYDA 5IS2A 4ECYA 4N41A 1FK9B 4WFBQ 5FD1A 1JLEB 3VWSA 2FJAB 4DCPB 1IM6A 4C48A 1WJ9A 3MMBB 3GR1A 4F36A 4B3SJ 2BE7D 4P75A 2QN6B 4DR6J 3DLLQ 3ENVA 4J9VA 1IBMJ 5J1PA 4IR9A 1N56A 1U26A 4CLFA 1CBKA 2B6AA 1LFWA 2JEIA 4U7CA 2FLNA 4OHZA 3PYFA 4GO5X 1N6QB 4BLGA 3OW2R 3QFWA 1RWKB 3OT9A 2VOPA 2XMAA 4HR2A 1ZBTA 2CDQA 1SQEA 3DHXA 4U67Q 4W98A 1N5VA 5D0HA 1Q4RA 4F04B 2XM3A 4LF4J 3D68A 4R5PA 5LXYA 3DLKB 5KG7A 3BH6B 3WZ0A 5MAOA 1OY6A 3VGVA 1QUPA 4G1QB 3BGOP 3W3SA 1T9TA 3R5GA 1TU0B 2WW8A 4KKOB 3TYTA 3THTA 3M2UB 3HMJG 1V3SA 3DXSX 4MKAA 1NJWA 4DR5F 4AUKA 1PBUA 2ZVIA 1X4DA 2BDPA 2E66A 5DM6Q 2R2RA 2OLWA 2HS4A 4F3OA 2YX1A 3PYEA 4Y2AA 4CM0A 1XJWB 1PCAA 3TEGA 1U6FA 2BXJA 2RQCA 1RAOA 2RQMA 1BY9A 2AGOA 1JIHA 2XY5A 2WOMB 5F9NA 1S0MA 1ZOTA 5IV3A 2P6SA 4QWDA 1VRUB 3FC9A 1H73A 1QTMA 1T7PA 1JX4A 4CTAA 2QA4S 1G4CA 2HWIA 2FGOA 5F3ZA 3TVKA 1VRQC 3GCWP 1WD6A 3W64A 1LWFA 4DN0A 4NLDA 2XS7A 3BZQA 1WHYA 2RDIA 2DPIA 1PC5A 1WF1A 3OFHA 5GADU 1YRXA 3QAUA 4JI3F 3SQOP 4YFUA 2PN6A 1VRTB 2OO4A 4IRCA 4YR2A 3T5JA 3PR4A 2YKPA 3BSAA 1I3OB 1JXLA 3M9MB 1FRIA 2VFRA 4QCLA 3TQEA 2P8IA 2PE8A 3T19A 3TJAA 4Y2IA 3KOAA 4J9KA 1JLBA 2CQ1A 1FXDA 1T9WA 4DF8A 1KC8T 1XK8A 1OYEA 1EAYC 1WG1A 4MAKA 3Q8QB 3HVTB 1IXKA 3N5FA 1N5YA 1PYOB 2V67A 3SDEA 1Q8IA 2CFXA 2I38A 4ED8A 1JLGA 4BWJA 2Z4PA 3RR8A 2DNZA 3AA8A 4P74A 5KAKA 1PJ7A 1PYTA 3KLGB 4ECTA 4EK2A 1UETA 1S1WB 1MU2A 3PW5A 3IP0A 1S79A 1UL3A 2UXDF 3BBFA 2UP1A 3CCRS 3C8YA 2QA1A 7FD1A 3MEKA 1KBRA 2IJNA 3Q2TC 1J27A 2YX7A 2AZ1A 2BZ2A 3UCGA 2ROEA 3MGJA 5HQMA 1RAGB 3VZIA 3GYNA 1JLFB 4ERDA 2PO4A 2OEJA 3W2VB 1HNWF 5CABA 2WBRA 4RW6A 4WZMA 3OUYB 3Q8VA 2HNDA 2E44A 1TV6A 4I56A 4ZJOA 1YJRA 5J2PB 3VTIA 4G6VB 3UQSA 2F3JA 1NK7A 2EG1A 1FDAA 2J6TA 2GQQA 1OPZA 5IV4A 4CM2A 3GIMA 3JTOA 4WFXA 1OQ6A 1T0TV 2CQCA 4X66F 4HTIA 1FX4A 3NMRA 2GIQA 4JV2A 3OVSA 4KHMA 4WTYA 4IO9Q 2BJ7A 3IR7B 4O3NA 3M8SA 5BYSA 4PRFA 3H2VE 4FF1A 1DURA 3LP0B 3P96A 2R42A 1FRLA 2F9JA 3M32A 4UY85 6FDRA 4R8UA 3C19A 3FFIB 2VD3A 1Q0NA 2XY7A 3NRBA 1OYDA 4YB5A 3OTDA 1FESA 3HO1A 4F02A 2AZ3A 2FPHX 3MECA 4C0OC 3L7PA 4KHPJ 3OTEA 1FNMA 2B0GA 1PBAA 1PJ5A 1N54B 2RSQA 1APSA 3DRRA 3T6JA 1VQNS 4PPZA 1H74A 2X1FA 4EO8A 3Q86A 4J7CA 1HNXJ 1SJ1A 1OSCA 2RQKA 5B09A 1VMBA 1RXOB 4OL8A 4RLEA 1VQ4S 2L9DA 2MTLA 2KRBA 3DDIA 3V81A 3LOUA 1V9OA 4WPAA 4I7FB 3UN2A 1PKUA 3ENWA 2V4JA 3S1TA 2ALZA 1NZ8A 4OYBA 5L39A 3TEHB 1QUVA 5HVHA 2IRUA 1QSSA 2R7SA 2R8HA 2DGWA 1RWVB 2HFZA 4CT9A 2XC9A 4NCGA 3SBMA 5G0RB 1RHMB 4RL1A 1HIYA 1R8CA 4X4TA 5E2QA 1YIJS 5D77A 3EGZA 4PWUA 4OV1A 4DU8A 4Q7AA 5HSPA 1NSKL 3UE2A 1DTQB 1RTHA 3B6BA 3K57A 3DRXA 3FEXB 3M2RA 2LQBA 3SV4A 4CO5A 1DY3A 1NK0A 2ROPA 1FTCA 2ACMA 1VBKA 5IC4B 2BQ3A 4QYRA 4QBUA 1Q8BA 2E5IA 3A13A 4KTQA 1OJ4A 4IKAA 4NA2A 2X7IA 4L3NA 4GVBA 1REVA 4CLZA 3BSOA 4CWBA 4J90A 2CVIA 1MWYA 3EDRB 1WHXA 4PQUB 1I51B 1S9GB 2BE2A 1WEXA 2MZSA 1E6VA 2PC6A 1CULA 1ZAWA 3HHLA 1U02A 2RU9A 1IKWB 1HW8A 3TVZA 1UPPA 3IM8A 1J5EF 3W60A 3G82A 4JI1F 2ZHOA 3GJSB 3DOLA 4X65J 3W2WA 3OR2A 1YHQS 4NZ6A 1T95A 1S49A 1VC0A 2N4CA 4RNMA 1O8BA 1S6PA 5CCMA 4CLUA 1WEZA 1Y9OA 5GMEA 4N8NA 5HJXA 1N32F 4J9LA 3E01A 4LF7F 3GSDA 1RBAA 1JXVA 2VKZG 4I4BA 4PPDA 2W9BB 2RT3A 1YWXA 2H4YB 2HVZA 4QW9A 1QSYA 3QSIA 3TA0A 3PJ9A 3WIVA 3H7HB 5L1JA 4K4YA 3LWMA 2DCUB 3BPSP 3A3PB 3BPDA 2ZZMA 3DHWC 4PAAA 4M63A 4X64J 1TAQA 2OD4A 1DLOA 4ZLNA 3QYYA 2ZH5A 5KFIA 4QW8A 5ETKA 4ZVQB 3THVA 1F5AA 4EWTA 4TU8A 3I96A 3JSYA 3UR0A 2ZBRA 1HQUB 2ZBPA 3VALA 2HLUA 4DV3J 1TL1B 2HHPA 1YJWS 1RBLA 2QX0A 2ASDA 4ED3A 4RUHA 1SKUB 2NPIA 2APOA 5LL6d 2FZGB 3C6TB 1VYAA 2J5AA 1Q53A 3DU5A 1OY9A 1IUJA 2FHJD 2C1EB 3GMGA 2Y9HA 2UUAJ 1C0TA 1EB0A 2H1YA 3IG1B 3AY0A 1FRHA 4KSEB 2CWXA 4LBIA 2V2ZA 2C3MA 3J7YI 5GMKa 4ED6A 2HBQB 1HBOA 5I42B 3A8KA 3DOKB 4IG3B 2H9ZA 3R27A 4LR8A 2HG4A 3KLIB 2Z2YB 3GPAA 2XGPA 4PWDA 2NUHA 1CJVB 3W9JA 1UVJA 3MTJA 2G4BA 4EO6A 2FC9A 2A6MA 2EWHA 5ETMA 2XHCA 2RNEA 1KTVA 4EMDA 2JDJA 4F3QA 3TX0A 4KV8A 3I4HX 3HCXA 1FJGJ 2H5IB 3QO9A 2AYBA 2BYCA 1X5TA 4L72B 2GIRA 4LF2A 3MM6B 1Q5YA 1VGYA 3LGNA 3BO4A 5H9FJ 1N88A 3UDEA 2P9CA 3I87A 1F9FA 4AQYJ 3PV8A 4WP9A 5A6PA 3RUBL 4CNZA 3GU0A 4CDIA 4EBDA 3D0IE 1JKHB 4RUBA 3GLJA 1UPMB 4A47A 2JLGA 4ZMMA 3GTYX 4DQSA 2NR0A 3ILIA 4X84A 1S1VB 1MMLA 4M5GA 2XYHB 2QRRA 2H3EB 3RG6A 3T5KA 3MCMA 5DRKA 3WDOA 2C2MB 3I9ZA 2HHTA 1N5QA 3AB2B 1IBMF 4UQGA 4ATNA 4Y2CA 3NCPA 2W4DA 2BACA 3AD9C 4FN5A 4PEOA 2RE1A 3GV8B 3ELHA 3NS7B 3R5JB 2Z2ZA 3LAMA 4C8LA 1M0SA 4UZBA 2NXCA 2B5JA 3E8OA 2HQGA 1WSRA 3J81j 1GTEA 4Q43A 1NJZA 2ZOFA 4OQJA 4IFVA 1SV5A 3VGTA 4USVA 1JMTA 2VG6B 3TZYA 4TVAB 2CA9A 2ZJRQ 4ETXA 1F3FA 2CG4A 2MSSA 2DH9A 3OSNA 5C24A 1T05A 2IHR1 3KK3A 1WG5A 2HBZB 2MSTA 2MKJA 2MLYA 3D6TB 4IH5A 3ZNJ1 1KOHA 2F7VA 3PEJA 1GNKA 2QIFA 2K3IA 1VLOA 4HL9A 4DQQA 2JOQA 1NJXA 1P8GA 1YTYA 2V63A 4PYAA 3JYTA 4DPYA 1RADB 1S9EA 1XTZA 4B02A 3L09A 5T14A 2FVQA 2BJ3A 1KDNA 2YQ1A 5KFSA 1U4BA 3I32A 5DQIA 2IAJB 3BYPA 4ZVSB 4EUVA 2VA2A 4IRKA 4FNIA 1HBUA 1CG2A 1P1TA 1RBOB 2J9EA 2QO3A 3BSNA 4MIAA 4C8YA 5LSRA 4P10A 1BUXA 4URSA 1DAXA 1XIQA 4KGVB 2K7JA 1TKZB 4TXSA 4NLTA 5F8JA 4CLTA 3F41A 1VQ7S 2VICA 3F44A 3P8BB 5EN1A 5GAHU 2J0SD 1WC1A 5KFKA 1IBKJ 2WSCC 5J2QA 2CWKA 3NMAA 1TL3B 1FKPB 4P52A 2AEFA 3HHNB 4X4OA 2J0QD 2DHXA 4KE5A 1YZ7A 3QWUA 1WC0A 3W1YC 1RP5A 1D9DA 5DG7A 2NZCA 4EBCA 2PSZA 2PEHA 2V8PA 4ZPAA 5L1IA 1JXEA 1XMBA 1ZTWA 1T03A 2QV6A 1EETA 2WB1D 4QOTA 1GEHA 2DNNA 5DM7Q 4WIQA 4DPXA 4ECUA 1H7XA 4KFBB 4DV6J 2UUCJ 2OPPB 3GWCA 2GHWA 1CVJA 2YWHA 1T3NA 5HLFA 2FJXA 2LLZA 3MPUB 1S0NA 2ZVSA 2RF2B 5K8PA 1UFKA 1Y5IB 4DR4F 2WONA 2NXJA 1KLMB 4O4GB 2MKYA 2ZDOA 4DMZA 4J9NA 1JJ2R 3QFHA 4P2FA 4C0HA 1GQEA 3LANA 2EPIA 1S99A 2V4RA 1TVRA 5KG6A 2OI2A 3CCQS 4WK3A 4ZCKA 1U2CA 3BGLA 3CCJS 4Q2MA 2KN4A 2AGQA 2ZC4A 4ELVA 2B9YA 1CSJA 3ILOA 1VQOS 2MKKA 1L3UA 2OH2A 3R7SB 1FEEA 1KVJA 5CYJA 1VIOA 2GGPA 3JTPA 5U47A 3FDSA 1QVFR 3H42A 3LF0A 4B3OB 3FSYA 1GTHA 2HMIA 1D09B 1HBMA 3ETOA 3BGRB 2O01C 2UVUA 2V68A 1SQFA 2HNZA 5L1LA 2Q43A 4TNOA 4KQZA 2YWKA 3PRDA 2VODA 2DXFA 2DITA 4I6YA 1U48A 2G2ZA 2W2NP 2MLZA 4USKA 2Y8WA 5HI7A 2WVFA 1W26A 4Z37A 4MYTA 4DSEA 2LYVA 2PEBA 4U7UK 1TQLA 1H98A 2G1DA 3PX0A 1B70B 2KU7A 3R5CA 3N01A 2HHXA 2ZE2B 3HPOA 1OY8A 2W9CA 2MGZA 1U1OA 2IY5B 5FDLA 1S1UA 1TL7A 1WI8A 4HHHA 2BV3A 2HIQA 3MD3A 4HDGA 5CD4A 2J8AA 2XI3A 5CYQA 4OLPA 3SSRA 4OYIA 4WIIA 2X1GA 3KJNB 1SQGA 4KHPF 3UN5A 3W65A 2FD2A 1KVIA 5CH7B 4RW9B 1M1HA 4GKJF 5E3QA 1Q7YT 3PIPQ 1YI2S 2W24A 2N4DA 1GFWB 3DM2A 2ZHAA 1HNXF 4RW7A 1KHVA 5KFJA 3SQGB 1RTDB 3BO2A 4GKKJ 3BO3A 4U95A 3CPWR 4LSNB 4NEYA 1NCLA 2ZJPQ 1B99A 2M0GB 2O67A 3OR1A 2PI4A 2LECA 3QJLA 3CJQA 4L6V3 2R7XA 1UWAA 3KHRA 4LR7A 2GX8A 1T9XA 4LSLB 4XK8C 1RCXB 3MCNA 2J0WA 2RDDA 3MMBA 2W2QP 4ZLJA 4RBUA 3RB0A 4HYKA 1PC4A 2PFDA 3GR0A 5LMUJ 2DHSA 3BJYA 2U1AA 1CS4A 3NOGA 2KM8B 4RZRA 4ZP9A 1HD1A 1U0HB 4RW8A 4MFBB 2AKWB 4PXCA 3O1LA 2HNYB 1U8SA 2HFSA 2OMOA 3H5SA 1IJFB 2XGQA 2MDAA 2A3JA 1ROFA 3NS5A 3JSBA 3RB4A 3C16A 3G87A 3PW7A 4LVNP 2ASJA 1D0EA 3QIPB 1BQMB 2ILYA 1NLKL 4C8NA 1L3TA 2E7VA 3ZC4A 3M2VA 3FQKA 1L5UA 3CNQP 3T5HA 2Q6CA 2RB7A 4YUDA 3AAWB 2V2QA 2C2KB 2LA6A 3VZHA 3FCHA 4ZJLA 4MTPA 5F8NA 4HEA9 2B6AB 4DUZJ 4FS1A 1N36J 1DRZA 2WCXA 1U2FA 3KJQB 2KTQA 2Z0GA 2UUBF 3LP2A 2YQ3A 4OZLA 1ZZNA 5K5MA 2Z57B 1JQGA 3DKDA 3TOQA 1S59A 2GJ2A 2C2EA 3QGHA 1UVKA 1R7IA 2FIUA 1K47A 1YVFA 2KT2A 2D3OR 1PJ6A 2W4PA 4FZVA 4ZVRB 4RUAA 4X65F 2NXUA 4DEZA 3MEEA 2ACYA 4MMOA 4N8OA 1X4BA 4ZOSA 4P2SA 5A0YA 2PFFB 3MPVA 2ERRA 3BKTA 4ANDA 1WOSA 2Q6BA 3K5OA 3MHYA 2KT5A 3ETMA 2BQUA 3D1QA 4QIWD 1SUQA 1B0PA 4HI2A 2DGSA 3HM9A 1RWWB 1M5HA 1S1TA 3CC4S 4WFAQ 3UI3A 3G96A 1KFSA 4X64F 4WXOA 4TY8B 2XMUA 2CYYA 2WHOA 5DS7A 1I1GA 3W5ZA 4CTAB 2EEYA 1V3ZA 5ETPA 3HFVA 1R89A 2W4CA 2MEWA 2F4FA 1LWFB 2KJVA 4DV3F 1S6UA 1OIAA 1WKLA 4NLRA 2DT9A 2C2OB 2HS0A 3V6HA 4R25A 2OAUA 2DGUA 3EE3A 1ZA1B 4ZCMA 2HIYA 2IC3B 1RWUA 3ITHA 4Y34A 1F3VA 2J8SA 1RWOB 2RVJA 1AXQA 2MY7A 3O8WA 3IWNC 3QJPA 3GJRB 3L7UA 2UUAF 2AYGA 3G86A 5D6GA 2CAJA 1RYRA 4TYAA 1WELA 4K5SA 3KK2A 1KD1T 3IBWA 1JLBB 3KWMA 2EKNA 4Q2LA 1JLFA 5E3PA 3J81U 1R6VA 5KFAA 1XERA 1NB7A 1SCJB 4ZN3A 2CQGA 9ATCB 5A8RB 1IQZA 2QT7A 3SDEB 4JI8J 3FK4A 1JLGB 4NCBA 2DNQA 4FNHA 2DD8S 4RNNA 2KHCA 1H6KX 1T9YA 3PHTA 1MU2B 3CO9A 4QWCA 1X4CA 1U2RA 2D69A 3FMWA 1NH7A 3AOAA 2L41A 1HMVA 2W01A 4DUTA 2CPYA 5IT4A 3R7BB 2OJ3A 4PG6A 4F4YA 3KLEA 4RW4A 2F65A 1KONA 2XBPA 1CEZA 4KO0A 4FYDA 1RWPB 2KO1A 4AQYF 3RAXA 5CXTA 3PCOB 1HNVB 4RW6B 4WP3A 2DHHA 1AUDA 4AD6A 2HNDB 4UY8T 2NQPA 3DLEA 4M5IA 4OYWA 5B0AA 1V5VA 2F5GA 3FRYA 4LF5J 2FLPA 4NCAA 2HBRB 3PVXA 2K06A 4RPFA 8AT1B 1YBTA 4KJIA 1YKWA 2VL1A 3UVJA 4DQIA 2QTWA 2EI5A 1RYSA 2V2KA 2RAQA 2GMLA 1J2VA 4ZA1A 4UOHA 2VB6A 1P9YA 3T6BA 2WSFC 2ZITA 3GZ7A 2ZH2A 4EFAC 4TLQA 2WW4A 3BB5A 3N5BA 1YBUA 2AJ1A 2CQ4A 4K4XA 2EK1A 1SJ3P 4W4MA 4JV5F 1Q81T 3BDPA 1NJIT 2XB2D 2HK2A 1C2PA 2R8KA 2VA3A 3AXKA 4R8UB 2JLFA 4JI2J 4ZHRA 2WSEC 2I6WA 3KHHA 3MECB 3PRVA 3KHGA 3CCSS 3PG9A 4V19J 2DEJA 5G0RA 3GSIA 2AEMA 4ID8A 1MNEA 1PSDA 3DRRB 5KT3A 5BR8J 3J81Y 2A1BA 1C1CB 3M4XA 1U49A 5FLXU 1R43A 2XYPB 2WAQD 1C1BA 3L3CA 3FJ2A 4ZP6A 3U1LA 3I6PA 1RT2A 5FJ4A 3OFGA 1XNRJ 4H4OA 4LFBF 3V81B 3M8PA 3NWGA 3IBFB 2WZ1A 2GJIA 2VBZA 2ZUGA 3GILA 3KLFB 4OX6A 1SH2A 3T3FA 2QL5B 4NLYA 2QEXS 3EPIA 1WUUA 4X4PA 7AT1B 1HA1A 1TUWA 5F3TA 1VC6A 1U6ZA 2XZDB 4NXMJ 4NCGB 1FJEB 4ECWA 2G13A 2KI2A 2VUGA 1NJYA 1S9GA 2BRKA 2CQDA 4FVCA 1HI0P 2YNFA 4IOBA 5J2NA 1QAYA 1VI7A 2B7BB 3PJWA 1FEHA 3OQ2A 1RTHB 4CCHA 1IR2A 3M2RB 1WACA 2DR7A 4ZLLA 3GIJA 3QQCD 1VQ5S 1BQNA 4M1KA 2W7AA 3QT6A 4RKUC 5EX3A 3IO1A 2P9GA 2CQ2A 2KZMA 1GT8A 1WI6A 4ECZA 2BJ8A 2XO6A 2ZHBA 4FXWA 3FBCA 4ED5A 4A8QA 2NYIA 2CJQA 1YLXA 3TAMA 1MW7A 1IKXA 5IXUA 2YWWA 1DTTA 2DNPA 3MM8B 2DVIA 1REVB 2UUCF 4K0KJ 2YVSA 4NI2A 3V6DB 1LW2A 2VBWA 2W9BA 2R8GA 3UR3C 1WOOA 1MG7A 3PYGA 2BE2B 2CJAA 1SBRA 4A8KA 1SPBP 2DKOB 1CULB 1IBCB 4DHVA 3HHLB 3TUIC 4HLBA 3N4WA 1NB2A 3EJMA 1P1LA 3QRRA 3IWXA 2IRYA 2H65B 2EG2A 3P5TL 3R6GB 4USJC 3RJMB 1FO1A 3RGIA 3G82B 2XS2A 4AL7A 3N0VA 4ES3A 3DOLB 3H4DA 3W2WB 3OR2B 3TJ8A 2EW9A 3IR5B 2ZM6J 3QRPA 1TL5A 1DFDA 3HP6A 3D28A 2UZAA 1S6PB 4KGZB 5HN0A 2B51A 1RKJA 3AQPA 2DR8A 3E01B 4CO1A 5FLXY 4P73A 1S1XA 2DJWA 3ZZ0A 2D41A 4N56A 1N0UA 5HROA 4KH1B 4I67A 2ATCB 3PX6A 2DXDA 5B0GA 3C6TA 1S12A 3N28A 3MMAA 2VBXA 5CZXA 2XS5A 4PUOA 3K0JA 2XMJA 2ZJQQ 1XNQJ 1DLOB 1X4FA 4B9MA 4DV7J 3BN7A 4RU2A 1CQMA 4AYBD 3T1HJ 3NY0A 4C8OA 2V8GA 3F73A 4YDDB 1RT6A 3EVWA 2OTJS 4ANEA 2V69A 5AE3A 1AYEA 3ZTPA 1JNRB 2YQ0A 1NKEA 4DPOA 4F25A 4WYWA 4DDFA 2MZQA 3R2DJ 5HP1B 2HPUA 5D0GA 3H2LA 4QIVA 4OI1A 5KOWA 4OZ5A 5EWFA 2Y1IA 2GO8A 1JJCB 4HHUA 2EVZA 4DS5A 3AB4B 2FGCA 4CZCA 5KT6A 2RUGA 1LNQA 3KNAA 1C0TB 4DXLA 1FRKA 5H9FK 4DPTA 1RLDA 5KFQA 3Q8PB 2CJKA 1RTIA 1HBOB 5M2UA 2LU2A 1WC5A 2V4QA 3M6VA 1O0PA 3IC1A 2H48B 2LXFA 1JLAA 3JB9k 4YHHJ
chains in the Genus database with same CATH topology
5D4PA 4PWDB 2DRBA 4AL5A 5KFZA 3OUYA 4GKKF 3T1YF 4ECVA 1ZAXA 1TL4A 2BQ3A 1N5YB 2CZ4A 4YMEA 4QYRA 5IM0A 4QBUA 3U7JA 3KLHB 5LJ3Y 1X9MA 4JV1A 5HMXA 1Q8BA 3HHEA 4HDHA 5J2PA 2E5IA 5L9NA 4KTQA 1NK6A 2YH1A 4IKAA 3CCUS 1HPZA 4NLSA 1R0AB 2NSBA 3H4BA 4M94A 4NA2A 4KV8B 4L3NA 5HMZA 2JRSA 1FVQA 1VHFA 1FD2A 1REVA 3QO9B 4A8MP 2IM1A 4CT8A 4X4NA 5F9LA 3BSOA 2A10A 2CVIA 5IFMA 3CD5A 1MWYA 3CT9A 1AROP 3K58A 1TR0A 1WHXA 1XC9A 2JZ5A 2DGQA 4PQUB 3MI7X 3CCZA 5KFOA 1NK4A 1S9GB 3MR2A 4NLGA 3PW2A 3I0RB 2BE2A 2DHAA 5B0BA 1O51A 1WEXA 3TNVA 2KG1A 1B0TA 2MZSA 1E6VA 4P7VA 2PC6A 5E0OA 2DRAA 5HO4A 2KG0A 4NXMF 3QWPA 2R2UA 4LIRA 1ZAWA 3IRWP 3VQTA 1FJ7A 1FE0A 4DV1F 2YX4A 4ZVHA 5LMUF 2PDAA 5DLGA 1U1KA 1A9NB 3FSXA 3D2WA 2C3PA 3HHLA 2N7CA 2RU9A 3DLGA 1IKWB 1HW8A 2AP6A 3F56A 3TVZA 2R8JA 4TU7A 1DBDA 2BABA 1J5EF 1UVIA 4USIA 2VPXB 4JI5F 2WRMA 2XMWA 1QE1B 2PA3A 3FEZA 4Z2XA 3X3UA 4C11B 4F4KA 2KJWA 3GV7B 4JI1F 3MXHP 3C46A 2ZHOA 4YB1P 1UJ6A 2POKA 1XR6A 2LQJA 1UEVA 3DOLA 5M2RA 1FRXA 2MJUA 3GIIA 3W2WA 4B08A 3LP0A 3OR2A 1TV6B 1YHQS 4A8WA 4NZ6A 2V8HA 1H2UX 2IJFA 5F41A 4Q8FA 3G9CA 1T95A 1DJ0A 1S49A 1FXLA 1VC0A 3QAEA 4LQ3A 1Y0HA 2N4CA 4FP9A 3R3TA 4HVZA 2C42A 1TKXA 4RNMA 4P6QA 2UVWA 1O8BA 1S6PA 5CCMA 2RILA 3AJ2A 1WEZA 1Y9OA 2EBEA 2NUUG 2RS8A 1HBNB 3FFIA 4N8NA 4NLVA 2OPRA 1N32F 4J9LA 2CQBA 2MQMA 2CQ0A 3E01A 4OHXA 5D4NA 2GA7A 1UJ4A 3GSDA 3R5BA 4ELTA 4LF7F 1RAJA 2J9DE 4ZLPA 3R5AA 4OI4A 2HQIA 5E3RA 1I6JA 2VKZG 4I4BA 2ZH9A 4PPDA 1IKVB 2QE5A 5KFTA 2W9BB 4EBEA 5GAHI 1TP7A 3LQVA 2EFGA 2RT3A 4I2QB 1RA7A 1X4HA 4O4RA 4A48A 1K73T 1YWXA 3I9V9 2HVZA 5J2MB 4QW9A 4ZKAA 3AH6A 2L9NA 1QSYA 2B4UA 3LALA 2WB4A 4DBQA 2X3GA 3TA0A 3DLHA 4BDPA 1TAUA 3FSIA 5H9EJ 2R7VA 1LOUA 3Q0AA 1VQMS 4EU0A 5L1JA 4K4YA 4WE1B 1N36F 4R0EA 2IYIA 3LWMA 1X4AA 2DCUB 3OTBA 4NYPA 4N47A 2N7YA 1T8EA 3MPYA 5T7LA 2GHPA 2ZZMA 1LKZA 2HGLA 3DHWC 3OHAA 3I4PA 3G71S 1X9SA 1N0VC 4M63A 5E7OB 1V6HA 3I5CA 1U24A 1LWEB 3HT3A 2JEFA 2RJZA 1UEUA 3OPKA 1TAQA 1X7VA 1GXUA 1L3VA 2OD4A 1DLOA 1RGVA 1Q86T 1UVNA 3BM7A 3DMJA 5IT9Y 2FHOB 3QYYA 2ZH5A 4I0WA 5KFIA 4QW8A 3M32B 3ISNC 3CIZA 2C2RA 3THVA 1NEEA 2RIJA 1SI9A 2OFHX 1F5AA 4EWTA 4TU8A 4IFVB 4ECXA 2RKIA 3I96A 4I7FA 4GC7A 3IN5A 2VPZB 3JSYA 3UR0A 1HQUB 2F9DA 2K1RA 2GFFA 1K1SA 4C98A 2HLUA 3VALA 5C24B 2MZTA 2KFNA 1TL1B 1HR0F 2XCAA 1T05B 2PIIA 1UAWA 3KK3B 3G8QA 4ED7A 4X2BA 1IM4A 2HHPA 2CJ9A 2MJNA 2ZM6F 1YJWS 2ASDA 4ED3A 4FBTA 3A8EA 4WFZA 4FXVA 4RUHA 2IA0A 2L9WA 2XWXA 3SZ2A 1Y00A 3MAHA 4DL4A 4IOCQ 4O3QA 5KT4A 5KTQA 3VCDA 1SH3A 3GYXB 1M90T 2YTCA 4OHWA 2NPIA 3T9ZA 4F50A 4OJ1A 4DV2F 2APOA 5LL6d 2ZH8A 4OJHA 1ZZFA 3C6TB 2J5AA 1Q53A 4BWMA 3DU5A 4DWIA 3K8WA 1U1MA 1IUJA 2FHJD 3GMGA 2J9CA 3LO3A 3GE9A 1VIXA 1C0TA 1I94F 3DYAB 3JYTB 3IG1B 2DR5A 3AY0A 3L95X 1JJHA 1S9EB 1FRHA 4H4MB 4KSEB 1LQ9A 5BYRA 1FRMA 3PKYA 4WCEQ 4W90B 2C3MA 1FVSA 4XDDA 3J7YI 3NGDA 4I68A 1DTQA 2CPDA 1RDRA 1U1QA 3RW7A 5GMKa 4ED6A 4CO0A 1GXLA 1UJ5A 1HBOA 5I42B 3DLJA 5F8IA 2D3ZA 4C0BA 1K0TA 1R8PA 3DOKB 2O1PA 4IG3B 2H9ZA 3R27A 4K4ZA 3LH2S 4GC6A 1CLFA 3HJFA 2HG4A 3K5PA 2K8GA 1G7CB 3KLIB 1MMNA 2FLOA 1HBUB 2V4JB 2XGPA 1HFEL 2NUHA 4DUYF 4PWDA 4X4VA 3CDBA 3EXCX 1UVJA 3PY8A 3ENQA 5D8HB 3MTJA 2D9PA 2LEAA 2G4BA 4EO6A 2AYEA 3KLHA 1NKCA 4B3MF 2FC9A 2EWHA 3A1YG 4K4TA 2LMIA 1FXRA 2RNEA 2CPJA 4YP3A 1KTVA 4OZ1A 2X1AA 2JDJA 4F3QA 1NHUA 2BR0A 1R0AA 3MF5A 1JLCB 3B78A 5G4DA 2XWYA 3T1HF 1XBWA 3IFEA 3CDAA 4KV8A 1RT3A 3M6UA 5E3AA 5EUHA 5GVQA 3I4HX 4X4SA 3LAKA 3OJSA 2R7RA 3QO9A 4BC7A 4K4VA 3RAMA 1SC6A 1Y7PA 1VQSA 1H38A 2K3KA 1FJCA 1PO6A 1OO0B 3GIKA 3VAIA 1CC7A 4K2XA 2AYBA 2BYCA 4PQUA 2D9OA 1X5TA 2FY1A 4L72B 2GIRA 1URNA 2PI5A 2MB0B 3I0RA 3M05A 2RF2A 3P3DA 3G4SS 1KTQA 3D1OA 3MM6B 4AFFA 2V94A 5M2PA 2Y1JA 1LK5A 1YJUA 2LQ5A 5IT0A 1VGYA 4I6AA 3LGNA 4O4GA 3BO4A 2CPZA 5J2QB 5H9FJ 4E98A 2MQLA 2BA9A 1N88A 3M8QB 4KGMA 5HL7Q 4NA3A 2VFSA 1HWKA 3NNCA 5DO2A 2ADCA 4LF8F 1IKWA 5KFFA 2P9CA 3DRYA 5JXSA 1W25A 2XLIA 3I87A 2RD5C 1WG4A 2DBBA 2M8DB 3BN4A 3HHKA 1F9FA 1SJQA 4OI2A 5MLCV 2ZH6A 5LSLA 3PV8A 4B9LA 1X4GA 5LJ5Y 5CD4H 1UWBB 2DHGA 5A6PA 4QWEA 4JI4F 1QE1A 2UUWA 2CJBA 4CNZA 4C11A 4OZ0A 3MWBA 4ED0A 2HHQA 2DGOA 3EGWB 4CO3A 4EBDA 3HHLD 3K8VA 3H59A 2XZWA 3I31A 3D0IE 1JKHB 4BC9A 1VQ6S 4A47A 2JLGA 3MOJB 2KRRA 4ZMMA 4DQSA 2NR0A 2OSRA 5IM0B 4ED2A 3SSSA 1U7LA 4AE5A 3V6JA 4X84A 1T03B 2R2SA 3DDNA 1S1VB 2GQ2A 1HHSA 3V6KA 1YITS 1EETB 1HPZB 1MMDA 4M5DB 1MMLA 2KXFA 3OXGA 2QRRA 2OKQA 4PG4A 1HBNA 2GMHA 4KB7A 3B82A 2FJEB 3MFHA 3AQOA 2QYCA 3T5KA 2HS3A 2XMTA 3BDEA 3HVWA 2ZZNA 3D54A 5DRKA 3EPGA 3WDOA 4UW2A 4NRUA 3ZZTA 1RISA 2B4PA 1IKVA 4JI8F 3NKYA 1QM9A 4RU9A 2G9OA 1JJ4A 3I9ZA 1C0UB 1FT8A 2IRXA 3B4DA 5KT5A 4QWAA 4O3SA 2HHTA 1E6VB 3MR3A 3QPIA 2VPWB 1N5QA 5J2MA 1X4EA 2WONB 2AJFE 3AB2B 4F26A 1IBMF 4OFZA 3DRPA 4K4UA 1FDNA 4OI6A 1HI8A 4ATNA 4Y2CA