2LABA

Solution strucuture of the cbm25-2 of beta/alpha-amylase from paenibacillus polymyxa
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
GGTTNKVTVYYKKGFNSPYIHYRPAGGSWTAAPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYLFSTGTSTYTPGSNGAAGTIRTGAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta/alpha-amylase
publication title A functional and structural analysis of tundem family 25 carbohydrate-binding modules from Paenibacillus polymyxa beta/alpha-amylase
rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 10
structure length 104
sequence length 104
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03423 CBM_25 Carbohydrate binding domain (family 25)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2labA00
2YUZA 32C2B 3BVNA 2V5RA 3L3OA 4YDIL 2XPGB 4CW1A 1QLFB 4JRYB 3T0AA 1WITA 2Z31D 3E8UL 3C60D 4PRNA 3TO2A 2VAJA 2AK4A 4JKKA 1P7QD 1VERA 3TO4D 3V5KB 4BQ8A 3GSWA 4EKXA 2ATPA 4KZDH 1UC6A 1GOFA 1UM4H 4L3CA 2VXQL 1XR8A 2HVJB 3R8QA 2CKBL 3EOTH 3OBAA 3QWRD 1LP9A 4M48H 5I15L 2JCCB 1VGKA 3QO1B 4EBQL 3FFCA 5C8JA 1UM6L 1T1XB 2FGWH 4WUKH 2JJTA 7FABH 1XF2A 4OZIE 1KNOB 1YUHB 1MJUL 4LCCA 5EIVA 1JPSH 5ID0B 2PKDA 2JJUA 5DJ8A 4UT7L 2VLKE 1MCJA 3T8XB 1CFNB 2ICWB 1BP3B 1N7ML 5FO8B 5IB5B 2X4PA 3HUJA 2BVOA 1G1CA 4XNZB 2ZNXA 1R5WB 4AIZB 1QRND 5TE7H 3OL2A 1IC5H 2H9GB 2HKHH 2FX9H 2A6KB 5ABDE 1MAMH 4XAKD 3FCTB 2J12B 4Q9CA 5DD5L 3MRMA 3MRFB 2HFFB 4NFCA 2AI0H 1KYOK 2ILLA 2DQIH 5GS0H 1E4JA 4ZG1A 2ARWA 1B9ZA 4UINL 1YEFH 5CEXB 4P9HH 4PJ5D 2YK1H 4I18A 4K8RC 4U0QB 3RWJB 1T2QL 3HI6L 5BW7A 1WICA 3P4MA 3ARDD 1S8DB 4U1NA 4NN6B 2BOCA 3R0NA 4JQVA 1X6LA 3B5HA 5JW3H 2E6QA 1UZ6F 5E2VL 2R9HC 3F5WA 1NAML 3BZEB 4FABH 2FEEI 4HKBB 3F65A 5F21B 1KOAA 2NY0B 1LEKB 3SKJL 5FV2A 1FN4A 4OQTL 4EI6B 5JW4M 1S7WA 1OTTD 5I2IB 4LU5H 3FFDA 4ETYA 2BFVH 3CMGA 1M1SA 3DV6A 2GKIA 2W0KA 1NC4D 1FYHB 5TH2A 4ETQB 3LHPH 1AE6L 5AYQA 4M00A 4WFFD 3ME0A 4XPFH 3LRHA 3ABZA 5DT1H 1K8IB 5TF1L 1CK0L 5I19L 1G9NL 5E8OB 2BNRD 2YXFA 4HPOH 3W81A 4KH2A 5IJVB 1OW0A 5LCVL 4RMSA 3H3PH 3MXWL 3GJFH 1PLGH 3UEZA 1DQTA 2W0LA 4GW5B 4YIQA 1CD1A 3ARWA 2PW1A 2Q76B 2IQAB 5AZ2L 4D0DA 1JFQL 4ODXB 4EXKA 1N6UA 5GS2H 3MJ7B 3GSUB 2WV3A 1R3JA 1PKQB 1J0HA 2X89A 1G7HB 3BN9D 5FYKE 4DGIL 4MA7H 1AO7B 4ZXBA 2XFXA 4G42B 5D9SA 4FQIH 2A83B 5JIIA 2BSSB 4IOSD 3OWEA 1CTNA 3O3EB 1QLRB 5BMFL 4A6YL 1SY6L 2DM7A 2H32B 4N9GB 4Y4FC 4WFGD 4AY0A 3E2HC 3D3VB 3EOYG 3VMOA 1A4JA 5HYFA 2EYTB 1TVBB 4QRRD 1JZ3A 4X6BA 2JF1A 1VFBA 1CFVL 1BEYH 4WEMB 5C08D 3T1FB 3C6LB 5E9DE 1MIEL 4KZEH 3TZVC 1J10A 2JKXA 4CU7A 4K9EC 3LAFA 4NCC1 1JPFA 1BLNA 2QSCL 4Q6IC 2CR3A 2DOCA 5DJCA 3ARGD 2R23A 3KYKH 2R0ZL 4PJIA 3WXWL 1CXIA 5I1GL 3T0XA 4AEFA 4NO3B 5FM5O 3BMWA 3QIBB 3BO8A 1AH1A 1J9CT 3OB0H 1BQHG 1XF3A 1M7XA 2DJ4A 3QO0A 5D7KE 2VJXA 3CMOH 1NDGA 3MYJB 1U93A 4PJGE 3UTZB 3GSQA 1G7JA 1KT2A 2NY3D 4P46A 1GIGL 5KZCD 2AKRA 4KJWC 5SWZB 5HVWA 3O2WL 1BZ9B 2R4SL 1Q94A 3KPOB 1T0PB 5L9DH 2C3VA 2GCYA 5LAXB 3HTLX 5HYIA 5I8EA 4P5TD 4HFWB 5IG7A 3RUGF 1U6AL 3GMNA 1FORL 2BVYA 4Z7UA 2MCPH 5F7WC 2FHCA 4LQFL 3NPSC 3VCLB 1FSKC 3CDCA 5K59E 4UDUB 1FNHA 5IB3B 1V05A 1FNEB 2OTWB 3O4OC 5JQ6H 5DDHA 1F90H 2D0FA 2VLRA 1P4LA 2P5EB 4PJEF 4O02L 3V8OA 3ZE2E 4EZMA 4ZUUB 3W39B 2BJML 5FDWB 4ODWA 1F11B 3S5LB 4RZCB 1U3ZA 1CICA 4PGDB 1AFVH 1BFTA 2WNGA 1R24A 1LEIA 1MHEB 1KV3A 4JRYE 4NC2B 3BWAB 3VW3L 1WGOA 2CLVB 4TNWK 1S7RA 5IMMB 1BQUA 3BUYA 2MHAA 2A1WH 2AK1H 4XMKH 3UAJC 1IFHH 1KN4H 4J4PC 4KRPC 1S7UA 2VN7A 3FT3A 1RZGB 2EYSA 4J7RA 3STBA 2JK5A 1AQKL 5GGSB 5IMKB 2CDEB 4KJQC 4Z7UF 1JRHL 2R2EA 3VXUB 1MJ7L 1XIWA 1GOHA 2D31A 4RFNC 3WFCH 4X6CA 4AG4H 1JHTB 4MDJB 4LF3A 4KKCC 2NZIA 3VFSB 3TN0B 1CBVL 5HI3D 1T3FB 5EPMB 4BZ1H 1GAFL 4ZUTB 4HIHB 1MLBA 4M9PA 5F3BA 2R1WB 2BXZA 4PP2A 1CI5A 1NUGA 1YYLL 3AROA 4UZGA 3WIIH 1UT9A 4HUXB 1IM3B 2EICA 2NCMA 4YE4L 5BOPA 4WENB 1CFSB 1FG2A 2HMIC 2MMXA 3REWB 5INDA 1GGUA 4BSJA 4XNUH 1WAAA 3KWWB 4TVPL 3C08L 3ULUF 5E03A 5CBAB 2HWZH 4OCWH 5ETUA 4K3DH 4P3DA 1CDUA 3V0WL 1C16A 4ZFGH 5LJYH 3EFDL 3NOIA 3QQ4B 3UDWA 5K33A 3QRGH 3LRSB 5IIEB 3MUHL 4OM0L 1RZ8B 4H5SB 3PWLA 1RMFL 4X6CF 3WIFB 5GRWA 3UTTD 3CXDH 4HS6A 2WANA 2PCPA 4KUCD 2FECI 5I8OL 1QQDB 2N4IA 4ZFOL 4WHTA 1D9KC 2AV1B 2XA8L 5IROA 4HLZG 1Y18A 5FUZH 4DGYH 5GS0D 5J11C 1CGSL 3LKQB 3JSSA 3SDDD 4KQ3H 4L29B 4HSQA 1HYSD 1OF2A 1T6WA 2HKFL 3RWHA 2YPLE 1FCCA 1JF1A 4B41A 4G6KH 3NCEB 4ZQKB 4OIIL 3QHZH 5H94B 4Y89A 4XP6H 3PNWB 2R56L 1TENA 3QXTA 5HYJA 4R8WH 4YDLB 2DKUA 3BGMB 4MA8H 4PRID 5TFSH 3DVGB 4P5MB 4JPKL 5DA0B 2QQKL 1UWEH 3GJEA 4NRXA 3HNSH 3VFMA 1GC1H 4JZOA 3WBDA 1T83A 5FCUH 5FYLL 3CU7A 4G9FD 2V9QA 5HPMB 1OM3H 2CK0L 3BFOA 4GT7A 5FYLE 4NQVA 4LQ1A 4M43H 5MP6L 3JWNC 4NM4L 4IRJC 5D72H 1H15A 1PKQE 3N1QC 3CPLA 5CJQL 4CMHC 3OTTA 3SKNA 1AO7E 4NQEA 5HYSG 1LO3H 4G6ML 4P2QA 1E4KC 3X12A 4UUJA 3JTTA 3EO0B 4BFIB 5IB4A 4LVHC 5HYEA 1L7IL 4HH8A 4OM1L 3AAZA 5B39A 1I7ZA 4X4XA 4L3AA 3D3VE 5D7IF 4O51B 5EBWA 3BAEH 4RISH 1RIUH 3TGXA 1SEQH 4GBXC 3OKDA 4ODVL 3PDOB 3NFNA 1KENH 4JPWH 2PR4L 3U0TB 5D6CB 3O41A 3L7EB 5H37H 2W65B 5I16A 2NY5C 5BV7C 4ISVB 3TA3B 3P4NB 2W60A 1G7LB 3MODL 2UUDK 4O2FA 5C0NC 3IFNH 4KC3B 2EEAA 4Y4HD 2A6DB 1D5MB 3FO2A 1JZ4A 2VXUH 2OL3B 4XMLH 2D0HA 3QWOA 3MACL 1C5CL 2H3NA 2ADIB 4KHXH 4M6NL 2P42B 5J7CC 3MA9L 2AABL 1UXSA 2GFBA 3TJHD 5IFHH 3D18B 3VFWA 5SWZE 4KVNL 4V2BA 1JF5A 2B8OT 1QNZL 2C7UA 1EJOL 4JN2B 5EC2A 4C4KT 3DBXA 2XICA 4JN1H 4WEBL 5GGSY 2VDMH 2F15A 2VZSA 4HIIA 4CL7A 5HJ3A 3GHEL 1VA9A 2QQLL 3TIDA 3AREC 2OMNA 1UB6A 5A3IC 4ZUVA 1NUFA 1N4XH 4GLRI 1S78D 3GI8H 2BERA 1T2JA 5I74B 2QSVA 1HHIA 3EYOB 2NY4D 1G9MC 5DJ6B 1P6FA 3EHBC 3QPXH 5HVHC 3RX8A 3SJVB 2DF3A 2EKSA 4XHQA 2P5EE 3HI5L 4DKAA 1IQWL 4NQDA 3FTGB 4GRLD 5F9OL 5GSVA 5ALBL 3CH8A 5GJSL 1BFVH 1VPOH 3ZTNL 1KG0B 4IRSA 3G6DH 4MJ5B 2VDNL 1JHKL 2R1XB 5F7EH 3C8HA 2XWTA 3SDAD 3BIAX 3O3AA 1CF8L 1R6VA 5MI0C 1R0AL 4OZIF 4PB9H 2VIRA 1JWUB 2PTTA 3BH8B 4QGYA 3QHFH 5K9OB 1FFPA 2N56A 1YNTB 4ENEC 4D2NA 1AIFB 5BRZD 2E7LA 1WBYB 3SKMB 2GSIB 4Y5XA 2WP3O 4L4VA 4ONHB 3VXUE 4N90D 4F37F 3V7MA 1J1OL 2DBLH 4HK0A 4NQSA 1FZKA 2ERJC 4OQTA 4DEPB 3DRQA 2COQA 2D7NA 1DQLH 4WWKB 2A77H 5CP3H 5IB2B 3DHJA 4TSBL 3JWDL 4MD4A 1TVDA 5DRZB 2BNUB 3BP5A 4HKZA 3QIUB 5FHBH 5EOTB 4Y8DC 3TNMB 2DRUA 3LSOB 1RJYB 4O9HL 3BZDA 1HSBA 1WK0A 3KJ6L 3P9LB 5CWSA 5JW4N 3L5HA 1DVFD 5DJDA 3RWEA 3FB5A 2P46B 3LKPA 2X4NB 4DZBA 5CP7B 2IAND 3WJLA 5BXFB 4OSUH 1YPZA 3K81A 4C58B 1LQSR 1TZHB 2F5AL 2UZIL 2DKSA 4GKSA 3KPMA 2C4XA 2JJWA 4WHYH 4BSVA 1A6UH 5C9JB 2FX8L 4JFEB 1INEH 4R6UA 3RKPA 3UC0L 1XZ0B 2HFEB 1CXLA 1J7VR 1NFIB 4J3VA 3PWVA 3NAAL 4A6YA 4JG0H 3AB0C 1ZHKA 2RCSL 4PYHA 3MLVL 1NCBH 3ARBB 3P9MA 4XC3H 5D7JD 5F96L 3RNKB 5IESL 1VENA 1H5BA 1OAXH 3VG9B 5T1LB 1UCBL 2HRPH 2NYYD 4RGNB 2HVKA 1R3IH 3QI9B 3VXSA 1IAOB 4R4NC 1LK3H 3OKNB 1SJHB 3AY4C 4JFZL 3UYRL 1J0JA 2VDRH 4NO5A 4YWGL 3J7HA 5J1AA 4ODSH 2WM0A 4R97B 2YA2A 4XCCH 3I75A 5FAAA 3H9HB 3O6FA 2H2PC 4R4BA 4U6YB 4FNLL 2LE9A 1FZOA 1YPZF 5CILH 5J9PA 3BZ4A 1U8JB 4LOUC 4N0YH 3BIKA 3BEVA 1WIUA 3DXAA 2X9XA 1SBSL 3DVFA 1VESA 2HJKA 3VXTB 3MV8D 5ADOL 1ORQA 4QCIB 3OB8A 4FQ2H 1TJIL 2CMRL 1HOCA 2CGRH 1P4IH 4OUOA 3FQUB 4HS3A 5DURB 1HQ4A 4I13B 43C9B 3BXNB 1X5YA 4PJ7B 2XTJE 5LXGL 2F54E 1J05B 2GAZA 5D5MA 3WHXB 2G2RB 4TQEH 1ZS8A 1P2CB 4DVRL 1RUPL 5FB8B 2PYEB 1JL8A 3FQNB 5KW9H 3LS4H 3ZDYE 4G8FB 3GDBA 4KY1L 1NC2B 5ECJE 2V5TA 1QBLL 4ZPVB 2IH3B 3O8XC 4XBEL 3MLWL 5HI5C 4RRPA 3RPIB 2JB5H 1A1NB 3WE6A 3VXMD 2RHEA 4K94H 4Y16B 1MCWW 4XPBL 1FHGA 2YRLA 4NN7B 4OLYH 2EDTA 4PJGF 3RVVC 1YEDA 1QLFA 5D70H 3MV9B 1LWRA 1TPXB 5IB1A 3W9EA 3X3FH 1BECA 3SO3C 2BSRA 5I1EL 4UOW0 3D85B 1KJ2B 4JY5H 4QHLB 2OL3L 5E7BA 4YHYC 4PJ9C 1I9JH 5DJ2B 1T7WA 3TWCH 3B9KC 4HJGB 3HE7B 5M95B 4ERSH 1I7UB 2JCCA 1OB1B 2Q3ZA 4KDTA 3NABH 1RPQA 5F9WB 5DMIL 1YECL 4M6OH 4L9LB 4QRPB 1X5AA 1T1XA 1G84A 3U9PH 1K5NB 1RK1A 2N7AA 1BQHB 2H1PL 4NT6B 2WINB 2EIEA 5EZOL 3ZE2F 5DGRA 3TT3H 3AXLB 5FF6B 5E2TH 3WNPA 4YX2H 1CFNA 3CFBB 1BD2D 3O2DL 4JHWL 1TNMA 5IB5A 4HCRA 4LASL 1R5WA 4AIZA 5IVNA 4TPRH 4WW1A 2Q86B 3RY6C 4UTAH 2N7BA 5IW3A 4LP5A 5BO1L 2D2OA 2YD5A 3PL6D 3FN9A 4JANB 2HFFA 4PRAB 2AEPL 3PV6A 3HB3C 2JCCF 4PB0L 4IMKC 2BVEA 2QEJA 3KGRA 1ZLWK 4L5FH 3DX8B 3UBXA 1XCTA 4HAFA 4J3OC 4RFEB 5JHDA 4LSUL 1S8DA 3F7VB 4MB5A 5BS0D 3TT1L 5AAMA 1AC0A 1X5IA 2CRZA 5I6XC 2AJSH 1ZVYA 2ITCB 3VXOA 4EI5D 4ZFOA 5B3NA 4FQXC 2IPKB 2UVEA 4XZUA 1LO5B 1V3JA 3NTCL 5ID1B 1HHJA 4HIXH 5I0DA 2B4CC 4Z0BL 5H8DA 2Y9RT 2EZ0D 2FH6A 3U1SH 1HXMA 4Z78B 2IPTH 1ETZA 2H26B 1NUNB 2Y6SD 2PW2A 3BEWB 2IMNA 1IC1A 5AZEH 2ZUQC 4OUUB 3TVMD 2P5WD 3GMQA 4PRHE 5E8OA 2G5BB 2Z31C 2WBJA 1DLHB 5IJVA 1FNGB 3C60C 1VACB 1MCSA 5I1CH 4GW5A 1RUQH 2ADFH 2B1AH 4OLVL 4J23A 3ULVH 1XAUA 2IQAA 4ODXA 3I6KB 3MRRA 4QO1A 1G7HA 2NW2B 1U3HD 4N0FA 3TM6A 2WQRA 3UTSD 2BSSA 2OR9L 3FQXB 4NO0B 3QZWA 3EDDA 3OAZH 4PTUB 3P4LA 1IGTB 2H32A 3SGEI 4N1HB 2AJVL 4M5ZH 1F58H 1FYTB 1BJMA 5LKNA 2Y07H 2Z8WC 2FIKB 1W8OA 2OMBA 4OGAD 3OKEA 4POUB 5HHMB 5DI8B 4JB9H 3C6LA 1JYNA 4RGNE 1K2DA 4QOKA 2CUMA 4IRJA 1Q0XL 5ILTH 3L3DB 3SE3C 1BIHA 5MEND 4FFVD 4M8VA 3RJDA 3I02B 5J1SC 3SOBH 5E70A 2JIXB 4U1GC 5HDOA 3QIWB 1FFOB 2VDKH 1F3JB 3HN3A 1QSEB 4NO3A 4Y5YB 5DFTA 2I9LA 3FQRA 2F58H 3Q6FB 3QIBA 2GJ6E 3NA9L 4OFDA 5E6ZA 4RIRA 3MYJA 5GRYA 3UTZA 5EO0B 2OTUA 4LPYA 5DD3L 1MREL 4D0BA 1W0YT 3TV3H 3FRPA 4N8VG 4M7ZC 4L1HA 3KPOA 2QADD 5F7FA 4ZODA 1ZHNA 3ARDC 5L2KB 1KEMH 1FP5A 3ZLQC 5E8PB 1BQLL 4PJ7E 5KVEH 3VFOB 4FHBD 1PQZB 3MNVB 4OLUH 1KELL 5DMKA 5C0AA 1QR4A 4HX1B 4BFBD 1INDL 2PYEE 2EDQA 1OTTC 5JNYB 5IB3A 2OTWA 4TUKL 3ROLB 3WHE1 1DQDL 1FIGL 1MRFH 2EDFA 4FRWA 4F7CB 2LV4A 3W39A 1PW3A 2WW8A 1QFHA 5HYSB 5GGTH 1XGQA 1F11A 4XGZB 2A6IA 4PGDA 5GIRB 3TH4T 1QBML 3TFKC 3AREA 2NW3B 3UTQA 3BWAA 3WFDL 2EH8H 3MV9E 4LSSL 2NXZD 4AZ8A 3KYNB 3CVHA 4V1DE 4XP4L 1KJ2L 1L9NA 5DZLA 4PJXB 3E6HB 4PR5B 2OR7A 1OAKH 5KTEL 1TZGL 1DBMH 4WHDA 3TESA 3LCYA 3BN9C 5CD5D 1JNHB 5CJ8A 5D2NC 5MHSE 1WCBA 1BVKB 5IMKA 4I1NB 3EO9H 1S5HA 3A6OA 2X4UB 4LIQL 1F00I 4H1LG 4HWZB 3Q2CA 2VLJD 5DUPH 1P7KB 1IAIH 1OARL 4AM0A 4PJBB 1DEDA 4KTDL 3TN0A 3IFPB 1OAUH 5IWLC 1T3FA 5EPMA 4HUMB 5ISZA 4P59H 4YHZH 3QXDB 3LQZA 4K3EH 4C59B 5TQ0H 3GSVB 4PY7A 5KAQG 1KGCE 4MAYB 3BN3B 3REWA 3ARGC 3IU4L 5SX4I 4GAJH 4MNQB 4N5ED 3RGVD 1EFXA 3KWWA 4JEGB 4KKAD 4OIBA 2YMXH 4X8XA 2YA1A 1I3UA 4PG2C 2VSCA 2W07A 4S1SL 5C2UB 3NFSL 5I66A 5IIEA 4NZRH 3FJTA 2ARJA 4EDWH 5F7NC 2NY3C 3GKWH 4H5SA 3QNYB 1FNLA 4MCYA 1D5XB 3UZQA 4K7PH 3LY6A 5DRXB 1N59B 4U1SB 3L6FB 4Y1AE 1KTLB 3LN4A 5JPMB 2AV1A 3VGGA 2YXMA 1HEZB 2VWEE 2C3WA 3NN8A 2AJXH 1KCSH 5BQ7A 2E7HA 5I73C 3X3GH 4L29A 3UPRB 2DAVA 1IGFH 2VZVA 3GIZH 4S1QL 2HFGL 2H8PA 3MRIA 4S0TD 5E6YA 2E6PA 2ZJSH 1K9TA 1KCUL 2JELH 4DWHA 2R2BB 5C09E 1E4XH 1SQ2N 4PJHE 3HI1B 5H94A 3PNWA 4YHKL 4JKPH 1GCFA 4OD2B 1MEXL 3RDTD 3PV7A 1YN7B 3IGAB 4PREA 3DVGA 4OCYL 5D8JH 5K93A 4P5MA 2A9ML 4ZO8A 3ARFB 3ARSA 1JNLL 2KZ1B 4Y4FB 6CGTA 4JFDA 3VRLE 5IBTH 2J6EH 1F4AA 2FJFA 4GG8B 1NAKL 1VFAB 1TQBC 2F53D 3D39A 2I25N 1S7TB 2F5BH 4AEIL 3MLSL 1ZGLB 3S4SA 4I0PD 1OLLA 3EO0A 1FYTE 2D03L 4OF0A 2DLHA 3ULVD 1TCRB 4ESKA 3S3PA 1QKZH 4DAGH 5HI3C 4JHAH 4NM8L 4NQTA 1AGCA 4J3UA 1NCUA 3O4LB 3DGCR 2DDQH 3U0TA 4G43A 3CAFA 3VGFA 3GO1L 1RFDH 2KL6A 3B5GA 3L7EA 2EE3A 4TSAH 4ISVA 4RMVA 3P4NA 1G7LA 1KPVB 5I1AA 1QSEE 1AGEB 2XQYK 2A6DA 5DWUL 2A74B 2QV2A 5L0QB 1MI5B 3VDAA 1VHPA 4XCNA 1V3KA 2ITDB 4NC1E 5J12C 1RIVH 2IBGA 2WUCH 2OS7A 3RIAF 3ZDYF 2NX5E 2Y1VA 3NPSB 4UQ3A 1FSKB 3U0PB 8FABB 1G6RB 1WBXA 5D1QB 1A21A 4K3GA 1S9VB 1NCAL 5FYJL 2DQFB 4FZEL 5D1XD 1JYXA 4OZFA 4LARH 3WXVL 4HGWA 5FYJE 3GNMH 4G8GA 3ZT7A 4X5XB 4PJ9A 2DQGL 2BCKA 5IMOB 1A7QL 4WV1C 5D71L 5GS0C 1EHAA 4ONOA 3RZWA 5DGQA 5L7XH 2LVEA 3O2DA 3PWPD 3GBML 1HYSC 1O7VA 3EYOA 4L3EB 2ZCHL 3TNNB 2CLRA 2X41A 4P9HC 3SJVA 3N1GC 1OPGL 3P2TA 1FL5B 1NCTA 2APTA 5FV1L 4U6XA 3DVNA 2MNUA 3P30L 3T09A 4ZAKD 3UZEA 3OB0K 3G6AB 1HXYB 5I1IH 1FV1B 3B43A 5HGAB 2UZYB 3OXRA 3QDGA 2ZOLA 3T0VA 3WUWG 1MJ8H 4XWOD 4RFNB 2W1NA 3HZKB 1OP5H 2FL5A 1NGPL 1FVCA 3BH8A 3R1GL 3CFEA 4APQB 1E6JH 3I50L 1YNTA 4NP4H 4JO2L 2DQDL 5F6HI 2D4DA 1WBYA 2GSIA 1T7ZA 4DQOL 3OAUL 4JM2B 1BAFH 1BJ8A 4D9QD 4XPGL 5E2UH 2KZWA 3MPCA 2XI9A 3VXRA 1RU9H 1T1WB 2V2WA 1MVUA 1LDSA 2FLBT 5JDSB 4QHKI 3WN5C 1TTUA 3KXFA 1MIMH 1RHHB 3CGTA 4JLRB 4PJBE 2FEEL 2ZCLL 1DDHB 2WWKO 2BNUA 3IDGB 1FZMB 3MOAL 3NCBB 5EOTA 5D1ZB 1RJYA 2AW2A 2YD8A 4G7YL 2MPAH 4FQXA 1JPTL 4K8RL 4YAQA 5F7UA 4XVUD 3MBED 4MDIA 1CLYL 2YS4A 1DEEB 1N5YL 3CK0L 1VKXB 1NGQH 3ZDXE 5FO7A 4Y4HC 1HKLL 4NZUH 5DRNA 4HUVA 5T3XE 1A1OB 1TZHA 2X9WA 3STLA 4LCIL 3N1MC 4XPTH 5E56A 1IKFH 4U1LB 1YNKL 1J1PH 3FO0L 4JFEA 3OPZH 4JPVH 4F8TA 4TYUA 1IC7H 1AXSB 8CGTA 2OQJB 5TE4L 4FFZL 4JDZA 3GMOB 1P7QA 3TO4A 4IRZH 5GRUL 1IEHA 1NGXB 2M1KA 3RNKA 3SE4A 5T1LA 4GXVH 1U91B 1CLOH 3QI9A 4M9OA 4XNYH 4DUWA 5F72S 3VD5A 4NBZB 3MLRL 1S78C 4KI1A 3OKNA 1NCWH 5EU3B 2WSKA 5C07D 1SJHA 1BM3H 4BK4A 3TEUA 2NY4C 1WBZA 3FO9B 3GSXA 4Y2OA 2C3GA 4WUUD 3HG1D 1LO4H 3H9HA 3MRHA 4JQXA 1GGIL 4U6YA 4Z7VB 2DMBA 2Y36H 1HWHB 2Q1EA 5CEZL 1KBGH 1XF5B 1U8JA 4YR6B 5C9KA 4CMHB 1NCCL 1NCNA 2PTVA 2NTFB 5CEZE 1QVOA 3SDAC 4PP1D 2O5ZL 4UNUA 3Q0HA 3ZMRA 1QRNA 3W2DH 1MNUH 3FAWA 1R5VB 1ZA3A 5DQ9B 1CDHA 3V5DA 2M26A 3OGOE 43C9A 3BXNA 4GBXB 1J05A 2ZKHH 4LGPB 3WHXA 2G2RA 1SYSB 3PP4H 4R26L 1P2CA 1UADC 3TJEH 3Q5TA 5FB8A 3QUXD 1BOGB 2X4RA 3O6LL 4ZDHB 5J56B 3FONB 5D7LE 2E6JA 2G60L 4XB8A 4EVNB 1WFNA 4Y16A 3QEGL 3OG4B 4D9LL 3DMMD 1B88A 4LGSB 5KSBB 2GJZB 3C8KB 3UP1A 5HHQB 1II4E 2CDFA 4BH7B 4ELMA 1MCKA 2VZUA 3G5YB 1ZWIB 5AUMA 5MERB 1DVFC 2IBZX 4TTDD 1OGAD 3PQYB 4JHBA 5TDPB 4OF3A 1MFCL 5DJ2A 1MI5E 1CXHA 1OWRM 4PJ7F 4OD3H 3RWGB 5C0BB 1EJ6A 4PJAB 1I7UA 3NIDE 1HWGB 4JFFA 4NJAL 5I9QB 1G6RL 3AS0A 4QRPA 2CSPA 2BNRA 3C9NA 3L7FB 4X80H 2WINA 4BUHA 2A6JB 3AXLA 3QQ3B 5D7JC 1IGJA 3JUYA 1KPRB 4QWWD 2P24B 1M7IB 2NYYC 2Y7QA 2BY0A 3CFBA 5DLMH 5F6HJ 5EU6D 5E6ID 4LSRL 5D2NA 5C7XL 4OFVA 1B0GB 5MI0B 1Q8MA 1CCZA 3MLTB 4NNPH 5L6YL 5EWIH 1NLBH 4QHKJ 2YPVH 3MR9B 3VRJA 2NNAA 4JANA 1F6FB 2VITB 2WIIA 35C8L 4C55A 1U8PB 4WDIA 1CLZH 4PFEA 1I7TB 1MSPA 4LRNH 4GAFB 3PWJA 4IOIA 4RFEA 3GBNH 1H8OA 3F7VA 3IDJB 1WZLA 3ESUF 2IBZY 4JKMA 3M1BA 2ESVD 3MJ8B 4CU8A 1DBBL 3RZCB 5FGBC 1FGNH 1ZVSB 1IM9B 4YHLH 4PG2A 2IPKA 4MD5A 1C5DB 1LO5A 2Q8AL 5KVGL 4Y5VA 4BELD 2FECL 2HT3C 5F89B 1FDLL 1GC1C 4JQIH 4X7SL 3RVUC 1RZIB 2JB6B 3PWUB 1DUZB 1T6VN 3TYGH 1X3DA 2J8UB 1JUFB 3V0VA 2RR3A 4H1LB 2XN9D 5HXMA 4OUUA 4P5TA 1OLZA 1EAJA 1BJ1J 4AMKL 2VXTL 1DLHA 1FNGA 1VADA 3FN0H 1L9MA 4H8WL 5TQ2H 1J8HA 1D7FA 5CJ5A 5FKAA 4PG9B 3I6KA 4QRSB 5IW6B 1MFNA 2YPKB 1S7XB 3BQUD 3LEVH 3FQXA 3UJJH 2AJYL 1QRKA 4JO1L 4LSDA 3KLAB 4GS7B 2V2TB 3L3KB 1OAZH 1P1ZB 3FAXA 5DQJA 2GJJA 1DFBL 3ARRA 4BZ2H 3QAZC 2FIKA 2OSLB 1KTDA 1C5BL 2BVPB 2A9NH 4FFYH 5A2KH 1A6AB 2OZ4L 5GSRA 3VG0H 5DZOA 3QEQB 2ORBH 2DQCL 5GGVY 3L5XL 4DUVA 3BPOC 3I02A 3C09B 3H9ZA 5ICZB 2JIXA 1REIA 4MS8D 2V7NB 3QIWA 3D9AH 1FFOA 3ZYIA 1F3JA 4Y5YA 1ERNA 5CCKL 6FABL 3VRLF 1QYGL 1IGCL 3ILQD 4Z7VE 5ENWA 1FCGA 3PL6C 3QUZB 1MFBL 5IKCB 1UZ8A 3V6ZB 2Q3AA 5CSGA 5EO0A 4L4TB 1Q0YL 3VH8A 4O5LL 3THML 1M6OB 3O8XB 3O9WB 2VL5A 4Y2DB 4OGXL 4XVJL 1U2CA 2IGFL 5IEKB 5L2KA 1QSFE 4JRXD 3MFFB 3VFOA 5E1AB 3L3IB 4CRPA 1RURL 2CPCA 4EI5C 4HX1A 1S3KH 5A2FA 5HGDA 3KPSD 4QXUH 2FX7H 5GGVL 3HRPA 5DSCB 2GTZA 2V9RA 3N85L 3T4AA 3LOWA 2EXYD 1V7NH 3SO3B 4KGJA 3IETB 1KC5H 2MJWA 3V52H 5EB9A 1INQB 3ROLA 4DJMA 1U8IB 1K8DB 3UTTA 1BMGA 4YHYB 2EZ0C 4PJDE 4EOWH 4MGXA 4NKIH 5HYSA 2UWEB 1U8OA 4XGZA 3RIFF 1UWGH 2XQYG 2Y6SC 2RAMA 4KROD 5GIRA 5C0EB 2AK4D 5KSBE 1A6WL 1F02I 3U2SA 1OVZA 3LS5L 3MRGA 2NW3A 3IVKB 2GK0B 4G6JH 3SDDA 1OTSD 3KYNA 4PJXA 4O2EA 4GG6B 2I24N 3IS0X 3PQYE 2NY6B 3AM8A 5CSBA 5DTFB 2B0SH 3VFRB 1QACA 1NGYA 1CE6A 3FFCD 1JNHA 2EC9T 2FJGB 4PRBA 1U3HC 1G9ML 4ZPTA 1QFPA 2X4UA 3KR3H 2V5SA 4PRIA 4E0RB 2E7BA 3D25B 1Z3GH 3NACH 4LDLB 4MLSA 4I0KA 2MKLC 4G9FA 3IFPA 1CT8B 3U0WH 4OGAC 1ZHLB 2J3SA 4JGJA 4GMSH 1QBBA 3WFHB 4TRPL 2ADJA 3AS1A 2FD6L 3HE6A 1IGMH 4Q9QH 1I9IL 3VE0A 4NQCB 4MAYA 5DK2B 3D2UB 4M1GH 3PXHA 4KV5E 4PJXF 4DKEH 5H2BA 4MNQA 3F7PC 5C0IB 1FFNB 4HZLB 3C5ZD 4F7TA 2V17H 3QUMB 3RBGA 1EO5A 3W0WE 1G7PB 1RUML 4HFUH 3OZ9L 5FOBA 4MZ3A 3QNZB 2R4RH 3MX0A 3RX5A 4ODHH 5DC9B 4PTTB 5DUML 5T1MB 1F6LL 4FTVE 3QDAA 1ZTXH 5EU7C 3QNYA 1ZGLM 1AP2B 4S0SD 3SDCB 4HF5L 4OZGB 5KOMC 5DRXA 1N59A 5GGQL 2QADC 4PJBF 1IVLA 3L6FA 3AFLA 2D0GA 3RL2B 3JTSA 2ENYA 1UH2A 3QDMB 2BNQA 1X44A 3RAJH 1CR9H 1HEZA 2ZUQB 2RFXB 1ZHBB 3OJ2C 5FHAL 5C0RH 4MMXC 1KTRL 3D5OF 4M02A 3UPRA 1DUYB 4WY7L 5JZ7D 1FJ1A 2NPLX 5HDBE 4J6RL 1EMTL 5LG1A 4W4OA 1D6VL 1QA9A 4FQLH 4E41A 3U46A 3ZDXF 3HI1A 4FQQB 5AG8A 1PSKH 3KYMB 4YJZL 2J8UE 4OD2A 5CZVH 2Q6WB 1G7MB 1JYWA 2VN4A 3RY4A 1S7QA 3X11A 3IGAA 3PGCA 3M8OH 4MQXD 2Y06L 3ARFA 3F58L 1OAYL 2NXZC 2VRAA 1N3NB 3B9AA 1KIRB 1XGTB 1MPAH 2NY2D 2X89D 3BRGC 4DN4H 1P4BH 1RIHL 1HHKA 1JVKA 4ZXBD 3V7AE 1MH5A 4K94C 4E42A 4OFPA 4QRUA 1K85A 1VFAA 3QBTB 4YXKH 4G7VL 4GRLA 3T2PA 5CD5C 1W8NA 1CU4L 1A7OL 1FG9C 1YN6A 1G7IB 3S36L 2J4WL 2WMPA 1YQ2A 5GISH 4U3XA 5IF0B 3HPLA 3GB7A 4L8SB 4N0UB 2A2QT 2EDYA 1TCRA 4XI5D 1SMAA 4X9IA 4XT1C 2BSTA 3KNBB 1LDPL 1YEJH 2I07B 3WEXB 2F8OA 1HHHB 5I15H 5IV2B 3QEQE 3O4LA 3ZKXB 3K2MC 3WDIA 3QISA 1JWSB 2CK2A 4NUJB 2OCFD 3V5HA 2ZSWA 4OBRA 3DROB 2XYCA 5B3JF 2D7OA 1MJUH 4C57C 1EEZA 3GM8A 2APWA 3EZ8A 4UT7H 4N5EC 3ARDB 1AGEA 4HWBA 4U49A 2XZAL 3RGVC 2C4FT 2EXWD 2CRMA 4KKAC 3O11A 3QFJA 4FXGB 4OFKA 3INUL 3ILPB 2ITDA 4P46D 7CGTA 1AHWC 5EUKA 4RWYL 1MUJB 1NKOA 1HN1A 4CN6A 1G6RA 2EC9U 5D1QA 3GSOB 4FG6D 1A7PL 3CC5A 2IG2H 5DD5H 3RFZC 1DVFA 3SY0B 4MLIA 1NC4B 5ESQA 1MQ8A 1L0YA 1HQRB 4JFPA 1BGXL 3BW9A 3GMRB 1ND0B 1KIPB 4HUKB 1FNSL 1QFUH 1LO0L 3DYMA 2VLRD 2W59A 4L3EA 3WDHA 3TNNA 3HI6H 2FSEB 5DRWB 1QTYT 1JTTA 5CJXC 4ODTL 1CICD 4L1DA 1FL5A 5HDLA 1GZQA 2CH8A 2O5XL 1OT2A 3FMGH 5E2VH 3G04B 4QF1A 4C56E 3G6AA 3NIDF 4P23B 1Q9OB 3CUPA 1T0NB 2FYYB 1P84K 4IHOB 4OQTH 4H25A 5HGAA 4CNIB 3RA7L 1WFTA 3ULUD 2WBWB 2XTLA 3HZYA 4GG6E 3WHE0 4NUGH 2B20A 3UJIL 4QRRB 1P9MA 4APQA 3IJSA 4GQ9L 5F70A 3ULSB 4WVRA 5DQDH 1QZ1A 2W38A 4NIKB 1LD9B 4JM2A 4Z7OE 5C70A 4FQHA 4I0PC 5LCVH 4LVOC 2ICCA 4XAWL 1T1WA 5D4QA 3ARGB 3GGWB 3V4PL 5KSAD 5DHVA 5TPWL 2G9HB 3U7WL 3L3JB 1RHHA 3ULVC 1DBAL 5CLTA 1FZMA 3EKCA 3HC3H 4P3CH 4DGIH 4O4YH 5D1ZA 4NZJA 1KTKE 2D7QA 2VABB 5BMFH 4A6YH 1PG7X 4LLVA 5HHOE 4ZD3L 2QR0A 1FBIL 3GIVA 1UFUA 3QUML 1KLUA 1MCLA 1ZT4A 3HC0B 4POZD 5HGBB 1DEEA 1MHCA 1RZJH 1AY1H 1MCOL 3NZ8A 4LKXA 4BSWB 5A16B 3JVGC 3VFNB 3GMMB 3VXMA 1MIEH 3O45B 1UWXH 2X2YA 4XP9H 3MRLB 4MX7B 1WLHA 2QSCH 3PJSB 4U1LA 4YPGA 5F93C 5JO5B 5I73B 5DJXA 2OQJA 5I1GH 5D1XC 2D9QB 4OZGE 2FHBA 1EAPA 1VGEH 1Y6KR 2GTWA 5IK3A 1U91A 3A6BL 5EO1B 5HDQL 2UYLB 5ICYA 3ZSSA 5EU3A 1GIGH 2YRZA 4U31A 3O2WH 2R4SH 1F4XL 3FO9A 2FEDD 4G5ZH 3T0EB 4U0RC 5I1DB 2QQNH 1A0QL 2XQBH 3MFGB 5EG6C 2F19H 5EN2B 5HYJD 3MUGB 1X5HA 5CHNB 4WI3A 1TJHL 4CVZB 4JJHA 1DSFH 4OD1L 2IADB 1PYWB 4PYGA 1TQBB 1EVUA 1XF5A 4JREC 4ZAKC 1KCRL 2GYSA 1FORH 4KRNA 4LQFH 1ONQB 1F2QA 1I1CA 2LAAA 4Z7QF 4XWOC 4TNWF 4Z77B 5J06A 1MELA 4H20H 1N0XL 1T5XA 3SCMB 4KAQL 1R5VA 4WW2C 4O02H 1I1AA 5DQ9A 1UENA 4FZ8L 4I77H 3G5ZA 4AL8H 4DZ8B 5HSFA 2HAZA 4NQED 2VE6B 2E8ZA 3IDMB 1NBZB 4P2QD 2VDQL 1U0QA 1YEIL 5DHXB 4U7MA 4G9DA 3VW3H 3LEXB 4UTBH 5EC1B 3S34H 4ZDHA 4XVSH 3UTPD 1HINL 2DLFL 3BZFB 2WIMA 3ES6B 4KJYB 5DJZB 4FMKA 4XAKE 4ACPA 2A0LD 2YEZA 3MRCA 3I9GL 4OZHB 4Z7VF 4UT6H 1N6QH 2L4OA 4JGMA 2GJZA 1DLFL 5MEQA 1NL0H 1H0DB 1JRHH 4GW4A 1MJ7H 3WL9B 2OJEB 3G5YA 3CVIL 2BHUA 4XVUC 1ZWIA 5E2JA 3MBEC 1U8MA 1PG7L 4PJ5E 2P43B 4HC1L 4A2MA 5MERA 5DEGA 1XGRB 3CFJB 3F62A 5TDPA 1CBVH 3Q5YA 1AXTL 4HCRH 1BZ7B 3R0MA 1T20B 5A43C 3QULB 5C0BA 4PJAA 3VU2A 1QEWB 1YYLH 4NC0B 4YE4H 3ZZ1A 1JWMB 1SJEB 4LCUB 4NQXA 3TVMA 5INCA 1P5VA 2P5WA 1EHLL 4MQ7A 1X5LA 3L7FA 4XC1L 2VLKD 5EZLA 2DTML 4TVPH 2XT1B 5J6HB 3V4UL 1YEEH 5CKAA 4PJDF 1FNAA 2BY2A 1KPRA 2XZQH 1A3RL 3BGFC 1KCKA 2DQTL 3PIQA 3QRFM 5KSBF 2ZSVA 3L1OH 4N8VA 3DUUA 4L8CB 1UJ3A 2KQNA 4M7JL 1EEQA 2IFFH 5ACLA 1B0GA 3ALPA 3BP6A 4I3GA 3FQWB 2R8SL 4NQDD 4XCYB 2AV7B 3MLTA 1FL3B 3OX8A 5I8OH 1MF2L 3EYVB 1MCPL 4IRSD 3DX9B 2WZPD 4AEEA 4NFDA 4MWFB 4LLMB 4UILL 4NCC2 4JPIA 4XWGL 1FAKT 4PJAF 2DIBA 4RGOL 5C71A 2Y25A 5BVPH 4TSCH 5TDOB 1AGBB 1U8PA 2DWDA 4RGMC 2HKFH 1NCDH 3Q48A 4PP1C 4BQCA 5MENA 2FGZA 3HS0B 4I48B 3S3SA 3NCJH 3I2CL 4UDTB 3WN5B 3MO1A 4WFGE 3JV6B 4QRRE 5D93C 3IDJA 1U36A 2OJZL 3KDMA 4M6ML 5TF0A 3RZCA 3JV5A 5C08E 4U4BA 1D6EA 5IVZB 4PJFA 1J0YA 4JPKH 3U6RB 2QQKH 1ES0B 3G5XB 4LCWA 3QUXC 4Y4KA 1T89A 2CXGA 3LKRB 4Z95L 4YZFE 2XY1A 4KPHL 5ITBL 1DJSA 4YFEA 1KSRA 2HG5B 3RVWD 5D6DC 1DUZA 3DARA 1BFOA 1Q9KB 2ZZUT 3WLBB 1E4XI 4NM4H 1JUFA 3BT2L 1ACYH 3DMMC 3WS6A 1UYWL 5CJQH 1NSNH 4H1LA 3SGDH 4NKDB 2H32H 5T5NG 4G6MH 3LD8C 3KPRB 3RP1A 3EJZD 3TCXA 1L7IH 2OK0L 1EHNA 3NA4A 2DLIA 4TTDC 4PG9A 3FHAA 4OB5L 1YMMB 2BX5A 4ODVH 5IW6A 2YPKA 1S7XA 5I8CB 43CAB 4NKQB 2E27L 2QTEA 2PR4H 4F9LA 4NWTL 4ZO7A 1IAKB 5DR5L 1JK8B 1IBGL 4YEEA 1KJMB 5HDBF 3MODH 3EIFA 4RSVA 2Z9TA 3L3KA 1B2WL 1P1ZA 1IILE 4M7KH 3C2SA 3LEYH 3U7YH 3VXSD 5E9DD 2ZG2A 4HK3J 3QCVH 3U9UB 4C4KO 1KN2L 2ID5A 1PX3A 4WFEE 4IS6A 2J88H 2VQ1B 2J8UF 5T33H 3MACH 1C5CH 2EEBA 4QWWC 4M93C 3AU1A 5ANME 3FOMB 4F3FA 2AJUL 5IHUL 4NBYB 5E6IC 3SDAB 2AABH 2NY5H 3IS1X 4P2RA 3DSFH 5ICZA 4KVNH 3P0YL 2VDPL 4MNGB 2V7NA 3O6FD 1XCQB 3L5WB 4U2ZA 2E8YA 3T0EE 1F4WH 1QNZH 1U9KA 3REVA 4D8PA 4HMEA 4CVUA 4WEBH 3P77B 4H88H 4N0CD 3DXAD 1A6ZB 5KAQF 2YD4A 3SKOB 1QFWI 3FZUD 2ZUXA 4L4TA 1M7DB 4YO0B 1B90A 3OKKB 2ICEA 1MCRA 4KZDL 1UM4L 4Y2DA 4F58H 3V6OA 5FA3A 3HI5H 1JI2A 2YR3A 1IQWH 3EOTL 4R7NA 1CIUA 5GJSH 1ZANH 3ZTNH 4M48L 1CFTB 2VDNH 1I85C 5E1AA 1JHKH 3L3IA 3CVHH 5C0CA 1U58B 5ACMA 4OZ4B 3L3HB 1E4WH 2FGWL 4WUKL 7FABL 5DSCA 1R0AH 3WMSA 4DN3H 4YXHH 1XT5A 3WUZA 1ODAA 3IETA 1INQA 4MXVE 5E95B 3O3UN 4JDTL 3TYFB 4UB0H 3CZFB 4RNRA 1LMKA 2IANB 3QNXB 3WJJA 2UWEA 1JZ6A 5HD8D 4G8IB 3EUUA 5C0EA 4LSTL 2GK0A 2C1OA 3QEUB 3TCLB 2HKHL 5LGJB 3VFGL 1AKJB 2GHWB 3T4YB 4ZSOB 2VC2H 5I76B 4EUPA 4LSQH 5ESVB 3QXUA 3O3BB 4D3CL 3VGDA 4TSBH 2AXGA 1KLFA 3LIZL 5DTFA 3VFRA 2DQIL 5GS0L 1IT9L 2CDGA 5AD0A 3BQUC 5DJ0A 1WVZA 4RMWA 4WCYL 1YEFL 3RDTA 1Z9OA 2YK1L 4R3SB 3QB7C 5SX5H 4E0RA 1CXKA 3QCTL 4HPYH 5KN5A 4WNQA 4R7DB 3VMPA 1CT8A 1HHGB 1ZHLA 5IFJB 2MCG1 3MGTB 3X13B 3MUZ1 2P1YA 1NFDA 3NH7L 1LK2A 3QDJB 2IAMB 1YEGH 4HV8B 1WZKA 2FX8H 1S9YA 3UC0H 3DGGB 1GGTA 4NQCA 5DK2A 3D2UA 2IF7A 2ZPKL 4MS8C 4GG6F 2RCSH 3MLVH 4HQQH 4TVPD 3DRTB 1JHLH 4P0DA 5F96H 4HZLA 5IESH 4XPFL 1UCBH 1BX2B 1C1EH 4F2MB 3ILQC 5DT1L 3ZDZE 1XGUB 1YEKH 3I6LD 3QNZA 1LE9B 2R69L 4LDEB 2Q8BH 3OGCB 3ET9F 1PLGL 4JFZH 3BKCH 1G0YR 4ZOAA 3DYPA 3RWFB 4Z76A 5IBUG 2DQJL 4FNLH 2PXYA 4FFWD 5HY9A 3ZHDA 3GI9H 3RL2A 1ZLUH 1K3IA 2NY0D 3MRPB 3QDMA 4LVNC 3WUWA 5EUOE 2HLAA 9CGTA 1BBDL 2RFXA 1AGFB 1SBSH 1NBYB 4I3SL 4AEHL 2VDLL 3BKML 4I2XE 2VXSL 4KMTH 2P48B 4M7LT 2EXYC 1TJIH 5J6GB 1I1YA 1BEYL 1U8HB 4RDQG 3FB6B 3DVIA 5D1XA 3PHSA 5HHXL 4JJ5B 5IMLB 3DUSB 1G7MA 2WBJD 4Q7DA 4U7KA 3NZHL 4KROC 3S35X 1N2RA 1EEUA 1KJ3L 4QTIH 1MLCB 2YD6A 4B50A 1RD6A 1QBLH 4XBEH 4P2CG 4ZTPH 3KYKL 2PETA 5IEHA 5FYLD 3OKOB 4WI8A 4YDKH 2D3VA 1XGTA 1A9EB 4OZGF 4FQJH 3QAZB 1YDPA 4HWEL 4OCLC 2AQ2A 1AO7D 3CMOL 4XPBH 4BKLB 3SQOH 1YYMH 1DQQB 1BD2B 1KF9B 5JR1H 1HH9B 2GK2A 4LSPL 3ESVF 2JJTC 3D3VD 4J8RB 4F57H 5JPNB 4LCCC 1G7IA 2Z35B 3DV4B 1X5FA 2IQ9H 5IF0A 1SJXA 4AQ1B 4N0UA 3C6LD 4X6EA 1ORSB 3EDKA 3S3JA 5LGHL 4KHTL 3KNBA 2XKUA 1HHHA 2DM2A 3DX6A 2CQVA 2MCPL 4U6HB 1YECH 5DMIH 3MRJB 3SDYL 1RAMA 4YLQT 5DJAA 4CMMB 3OXSA 4OZFH 5JHLL 5JQ6L 4KGLA 1ADQL 2H1PH 4I3RL 3VFUB 3OQ3B 3QIBD 5EZOH 1GVIA 1MVFA 4ZS7H 3C5ZC 4XVTL 2IFGA 5F88B 4ZFZB 1J0IA 1AFVL 4WO4A 3O2DH 1HDMA 4JHWH 5BRZE 3ILPA 4LASH 4EI5B 1Z6JT 4W68A 1ULVA 4I18C 4N90E 5BW7C 4JZNB 5JXAH 2HLFD 3O6KL 1MWAA 5C0DA 1IFHL 1KN4L 4JQVC 2D7TH 5ADPL 3IJHB 3SY0A 5MEOB 2AJ3B 4N9OB 5C0AD 1YC7A 3CXHJ 1JGUH 3JBG7 2AEPH 5HVGB 4XPAL 3GMRA 1ND0A 3U7AA 3CLEH 1KIPA 4Z6AT 3WFCL 4NYLB 3B5TA 1P53A 4PBWD 5JZ7C 3TPUA 4LSUH 2FSEA 2RQ8A 3QA3B 5DRWA 4X98B 4BZ1L 3LH2H 3CSPA 2IANE 4PRPB 2VOTA 2EDNA 3WIIL 5DHYB 3PP3K 1FE8H 4I5BB 4P23A 1Q9OA 1T0NA 2FYYA 1U3HB 4PRDB 4QHNB 4CNIA 3UTSB 4BA8A 2BDNH 2ZUWA 3S35L 2MQ0A 4MQXC 3CSGA 4XNUL 2IMMA 4Z0BH 1HILB 1A9BA 1DQMH 2HWZL 4K3DL 2L7JA 2NY2C 4B53A 4M7LL 5LVEA 2EYRB 4ZXBC 1GHFH 3ULSA 3UJTL 4NHCH 3KPTA 1SYVB 5E94B 1U8LB 2FRGP 1P5UA 4XCEA 3MV7B 1TLKA 2DQHH 2CRIA 4J2XA 1ED3A 3GGWA 4KTEL 3TN0D 2ZUTA 4EJ1C 2G9HA 3U36B 5B8CB 3EGSA 5ISZD 3OJDA 4XI5C 3A6CH 4NPYB 1MCHA 4DGYL 2Z4QA 1GOGA 1AI1L 3TP4A 2GUOB 2VABA 3IRPX 3FO1A 2AJVH 1JGEB 4W70A 3DWTA 4JR9L 3MV8E 1MCNA 3HC0A 3Q6GL 4GKOA 5HGBA 1QUNA 4XP6L 4F7EB 2QADB 5I75B 3WD5L 3P9WB 4R8WL 3BDBA 3GMMA 5F7KC 5TFSL 4LL9A 1Q0XH 4MX7A 5C2BL 4P46C 1Z5LB 3PJSA 4Y0GA 4HWUA 4LEXL 4DTGH 4HUUA 4LLDA 2V9TA 3GBLA 3IJYA 1B0RA 5FCUL 2ZOKA 4YZFF 4JFXA 5LGKA 1N8ZB 3MBXH 3BPNB 3UO1H 3LQAH 4L9DA 5D72L 4PJCE 1ZT7B 2DD8L 1YY8B 1JBJA 2W9EL 3BP4B 5EO1A 2UYLA 4OCRH 4XB7A 4RX4A 1G7QB 3C5JB 3WIHA 5GRJL 4JFQB 4WI4A 1QO3A 1CL7I 3BAEL 5CZXD 2PO6B 4LCYA 4RQQB 2XZCL 1SEQL 5CHNA 4HBCH 1CICC 1BQLH 3IKKA 1KENL 4JPWL 1INDH 1AJ7L 4NRYA 4YFLI 4YBHA 3S96B 3ROOB 4TUKH 2BZDA 1Z0MA 4Z77A 2VLJB 3SCMA 1X5KA 3IFNL 5DUBB 1DBKL 4LP4A 4NN5C 2VXUL 2BRQA 3D39D 2QKIB 4XMLL 4TVSa 3IDMA 1RJCA 5TGBB 1NBZA 2FR4B 4KHXL 4LMQI 4RMRA 1XIWC 1BD2E 2B1HH 3LEXA 4Y8AA 4HUWB 1UXWA 1A7NH 4U1HA 1V7ML 2HN7A 3BZFA 3ES6A 4KJYA 4OJFL 5D2LE 1TZGH 1I8MB 1UQSB 2P7TB 5DJZA 4JN1L 3RGVB 2VDML 4MSWA 4YQXH 2OXGA 4OZHA 1N4XL 3HLAB 3GI8L 1CD9B 4RBPK 4LIQH 3WL9A 2YOCA 3H0TB 5CSZB 3IFOB 5AWNH 5KG9B 3QPXL 3MCLL 1SMOA 2J8OA 4NBXB 1XGRA 1BFVL 3G6DL 5CBEB 4X6FB 3UDWC 4CVWA 5BS0E 3RIFK 4QY8B 4BM7A 1QEWA 4JVPA 3O3DA 4YNYA 4UBDD 2XN9A 3G6JB 3WDJA 3MCKB 4LCUA 4OI8A 4DGVL 4X83A 2XWJB 3IU4H 4U1MB 4PB9L 3LPGA 4OV5A 3QHFL 4MXVF 5IROC 5J6HA 3DJ9A 3TLRA 5GRZA 3PABB 4OZHF 1MRDH 3S97C 4WJ5A 3S9DB 4S1SH 2I27N 5M94B 4LLUA 4DW2H 3BQUA 3Q5OA 1KB5A 4L8CA 2AJZB 2DBLL 3SJVD 1NLDL 3GRWA 1T5WA 4E5XA 5IW1A 2QHLA 3CFDB 4X6DB 1VB9A 2YSSB 2E9WA 2M8XA 3FQWA 1EHXA 4XCYA 2FEDC 5SWSB 4U1KA 3EYVA 4UOJA 4KUCF 4MWFA 5FHBL 3EYUL 4M8QA 3H3KA 5HYQB 3QDGD 4KU1A 1C08A 3LRGA 3O6MH 4L8DB 1F4HA 1T83C 4I0PB 3IDXL 4G8EA 3UTSE 2HFGH 4QHMA 1ZT1B 3VI4E 2DWEB 3HS0A 4I48A 5DD6A 4XNXL 4UDTA 1EO8L 1JNJA 1JP5A 4OLZL 4RA3A 5I71C 3BE1L 2BY1A 1T22B 4YHKH 4CADB 4DOHE 4HHAB 3M17B 4KKLD 4K23L 4WU5A 3VXRD 2ADGA 4MZ2A 4OCYH 3RBSA 3ZKMD 1JZ8A 1INEL 3U6RA 2A9MH 3G5XA 3VXQB 3MV7E 1JNLH 4WWKD 2XNAB 5IVXE 2IBBA 4H0GA 4HKXB 3RI5K 3ZL4H 3F7RA 1VFMA 1NCBL 3DNKA 2I9TB 3QIUD 1RJLB 2BXYA 1QPPA 2VH5H 4DCQA 1FVEA 2A0LC 5F97E 1NAKH 1R3IL 3ZDZF 3IAQA 2J1KA 4JY4A 1FVDB 2SEBA 1MHPH 3G08B 4W6XB 4FXLA 3KPRA 3RTQB 3PGDB 2VDRL 3WSQH 1LGVA 2Q7NA 4XCCL 5EU7E 4QHUB 4YK4C 3JWOH 2P4AB 4RAVA 3V2AR 4P4RA 4X0KB 3B6SB 5CILL 1VEPA 1YMMA 3MOQA 1WJ3A 4NM8H 5DK0A 4GW1B 2ZG1A 1WZ1L 2Q7YB 3VWJA 4HJJH 4JFED 3MUJA 5I8CA 3MSPA 2DN7A 43CAA 5KVDH 2X7LB 3T0BA 1IAKA 3GO1H 4NSKB 1KJMA 1AD9B 2X1WL 4XH2B 5F7DA 4FQ2L 2A38A 2CGRL 3JXAA 4U0RB 4HIJA 1P4IL 5T1LD 3RRQA 4F7MB 4RGND 3TBYA 3GUTB 3QI9D 2CIKA 3FRUB 2Z91A 3GFUA 3U9UA 2VQ1A 4YUEH 5I30H 3F7YA 4I4WB 1T0MB 3LS4L 5F9AC 2K3TA 3B8SA 2LABA 4I8DA 2OP4H 5IBUB 4HXBH 3WFBH 4UIKH 4M61B 4ZUWB 3L5IA 2FJHA 2JB5L 4FZEH 4MNGA 3L5WA 5IFAH 2BVTA 4WW2B 4X7FC 5GGRA 4LHQB 3VXPB 1KXVC 1LVEA 1P6AB 1ADQA 1I3GL 4K94L 4QXGH 1R5IA 1R3LB 3P77A 4IRSC 4AK1A 2DQGH 2NMSA 5F7MC 4J1UB 2BVQA 5CKGA 3SKOA 12E8L 3CH1A 1IEAA 1RUKH 3GBMH 1ZXQA 5I1KH 5SWQA 4TUJB 3OKKA 4Z0XB 5IOPA 1E28B 2UY6A 1P7HL 2VLJE 2AXFA 1OPGH 2VISA 3WLWD 3T3ME 3RVTD 5KS9B 3KHOA 3SGJA 1I9JL 5C0FA 1M05B 2E7LC 1PJ9A 3P30H 2AEQL 3C5ZA 4ERSL 4Y5XC 3NABL 3DYOA 1NC2D 4OZ4A 3L3HA 2DLTA 3U9PL 4JO3L 4KWUA 2MKWA 2EIDA 5GJTL 1UVQA 5JOEA 1T21B 1ZA6B 2XY2A 4Y16D 4YDJB 4CN1A 3QFDA 2PYFB 4OT1H 1TITA 3RVWC 3I50H 3FN3A 5IM7B 3CZFA 1DP0A 4JO2H 4LKCB 4Z7WE 3MV9D 4TUOB 4DQOH 2X1QA 2AQ1A 4F80A 1B0WA 4TPRL 2YPLB 1OP3H 3EJZC 3H9SB 3KPPB 3D85D 3QEUA 3TCLA 4NNYA 5LGJA 5CD3B 4UTAL 3SPVB 4ZSOA 3WJLC 5ESVA 1J8KA 2ZCLH 1EIBA 3H7BB 5FK9B 3HE7D 3MOAH 4JFFD 3VA2C 4P57A 3BGFB 1W72A 4QRPD 1NMCC 4L5FL 3G6JE 2NY1C 2C1PA 2GT9B 1JPGA 1O5DT 1RHFA 1GYAA 3HC4H 1NEZG 2HH0H 4AT6A 1RZFL 1W0VA 3C2AL 1H5BC 2DYPB 4QXTA 5FYKL 3R06B 5E4EC 1FC1A 1RZJC 4CKVX 4FP8L 3WYRA 3X13A 1J0KA 1WFUA 4LCIH 2F74B 3QDJA 2IAMA 4L4JA 4P2OA 5K9JL 3KPLA 1KIQB 1UACL 4OTXL 4X6DE 3QXAB 4NO2A 5GRUH 3O6FC 5SWSE 4HGKC 1A2YB 1C7TA 2VR5A 5FYKU 1T04A 2IPTL 1OSZB 1BX2A 3P11H 2AQ3A 4NZTH 4F2MA 2KPNA 2OYPA 4PGBB 3RUGA 1ZLVH 2BC4B 1T4KB 3V8CA 4QYOA 4JY6B 2F53E 3Q1SH 1MFAL 3TBTB 4YHIA 4QTHA 1X5GA 1XEDA 4N1CA 3GMLA 5I1CL 1RUQL 1RZ7H 1T66D 2ADFL 2D9CA 4MNHB 2B1AL 1LEGB 4PJEA 5IT2L 2BOBA 3O2VH 2YN3A 4IOFD 3F7QA 2G75B 3ULVE 3IDYC 1OAQL 5I0ZA 2E9JA 1NCCH 4WWID 3WS3B 1A14H 1L0XA 1AGFA 3LD8B 5IHZB 1NBYA 2B39A 3V9FA 4G3YH 1T03L 2O5ZH 3NGBB 4M5ZL 5E5MB 3H8NA 3LN5B 2Y07L 4R90H 3S6CA 1RSFA 5J6GA 1MCDA 1IQDB 4Q58C 1U8HA 1C8PA 3FB6A 5F8RC 3QG6B 4JJ5A 1E27B 3S98A 5IMLA 3DUSA 4R26H 1T7YA 3DURB 5HD8C 4LNVA 4J3SA 5BZDB 4X4MA 4Y19B 3SOBL 1J8HD 4FQCH 4TN9A 4Q9RH 1EEYA 3T0WA 3OKOA 5M7QA 2VDKL 4LBEA 1YQVH 3NCYP 2F8VA 2G60H 4UT9H 1I3VA 4R4FL 3QEGH 4KDTC 1WC7A 2CLZB 1I8IB 4MJIB 4BKLA 1DQQA 5KBNC 1H3PL 2CUHA 1H3WM 1HH9A 3HAEA 2IWGA 5CMAB 4J8RA 1FYTD 4HXAL 3QQ9D 3PWPE 2VB5A 4HWBH 2YD7A 3CSYB 3DV4A 1MHHB 3CDGB 5HHMD 1F6AB 1KEML 4R2GD 5KVEL 3AMKA 3MRNA 1ORSA 2EH7H 1VEMA 4KKNA 4HG4J 5EBLB 1OSPH 3MRQB 1G6RH 5FDYA 4U6HA 2JIXD 3BWUC 4KXZI 2J8HA 3QIWD 1RULH 4XNQB 1JRHI 4F7PB 1QSED 3M45A 2ZNWA 2CO7B 3IT8D 1TQCB 4HKJB 2ATKA 1CS6A 2X05A 5KSAA 4ZFZA 3UCRA 4NKMA 2FB4H 1JZ2A 5FGSA 2EH8L 5HGHB 2H6PA 2O61B 4D9QE 5KSVB 5FECA 3PWNB 3C6SB 4P2YA 5DS8B 1IZKA 2XV6B 5L2KD 3ECBB 5J3HD 4NN6C 5L6YH 1K4DA 3FB7A 1KEGL 4JFYB 5KS9E 3IJHA 5MEOA 1DBML 2AJ3A 5F1IB 4FFWC 3MRDB 5DO2D 4K3HA 4ZUSB 1Q38A 5AEAA 2NY0C 3ARZA 2CIIB 4S1RL 3SDXB 3G5VB 1B6DA 3UBXI 4W6WB 4NDMB 4HZAA 4NYLA 4K2UH 4LLQA 5DUPL 5E8EB 1QPXA 1OTUD 5GQBA 1NGZB 3BP7B 4D0CA 3U30B 3MNWB 3MRKB 1E0OB 4X98A 4ZNEE 5AYUH 5E00B 2EO9A 5F7YC 2R0KL 4PRPA 4P59L 4YHZL 4K3EL 4FXKB 3F6IA 2WBJC 1NDMB 4YH6A 2P8LB 4QHNA 2Q8AH 5KVGH 2MTPA 4QGTA 5DHVH 2NR6D 1FAIL 1WWCA 3H9SE 3NCFB 3CJJA 4GAJL 4X7SH 5D7IA 4EN3B 2FATL 2DLGA 3K0WA 2FLRT 5F9JA 3IKCB 3V6FA 2WLYA 1PZ5B 4HDIB 1FRGL 2ED8A 4RFOL 4X99B 5EIIB 4BH8A 4P9MH 4NZRL 1SYVA 5DVLA 5E94A 2VXTH 3V95A 4IJ3B 3OJMB 1U8LA 3GKWL 5DXWA 1B3JA 3VJ6A 5C07E 3MV7A 4H8WH 2DS4A 3OHXB 3WO4B 4WI5A 3D69A 4DK3A 1CD8A 2CO6B 1A1MB 3N0PB 4C83B 3HR6A 5B8CA 3C6LC 4GAGL 4WUUE 4R96A 5FGCE 3HG1E 2XTJB 4ORGB 2LAGB 2F54B 2NLJB 3HE6D 4NGHH 1DN0B 2DB8A 3HZVA 1MJJB 1KCSL 4WI9A 5DMYA 4MAYD 3X3GL 2GUOA 5KSUA 2AJYH 4JO1H 3SGDI 1S7SB 4B0MM 4UAOC 4MNQD 2ZJSL 3VI4F 2JELL 3UYOD 4N8PA 3RGHA 1E4XL 1Q1JH 2VDOH 3K4AA 3QIBC 3MRBA 1CQYA 1C12B 4MD0B 4KI5E 2AP2A 1C5BH 3BSZL 2AAVA 3IDNB 1SVCP 1EGJL 4JKPL 1K4CB 4U1JB 2FO4B 5JA8B 3C5SB 3AVEA 3L5XH 1Z5LA 4P99A 3RL1B 4CN4A 2X4TB 2X4QA 4XX1E 4E9LA 1FZJB 1IGYB 2B2XH 2HLFC 2NXYD 4U7SA 1N8ZA 5SX5K 1HKFA 5IBTL 1QYGH 2BNQD 1OGTB 4LHUG 1IGCH 3BVNB 3L3OB 5FO9A 1S9XA 1ZT7A 1OCWH 4CW1B 1YY8A 4MJ6A 2CKBA 5L2JA 3UX9B 4HMCA 4ZTOL 1Q0YH 3C5JA 5EO9B 3GSWB 5ACZA 1T1YB 3T0DA 2ATPB 4AIXA 4E41D 5ITFA 4JFQA 4OGXH 4OZIA 1KLGA 4L3CB 4Q2ZB 3T3PE 5EU4A 1PAMA 4GKNA 2PO6A 1QKZL 2VLKA 1OGAE 4RQQA 2B5IB 1LP9B 4GUPB 4JHAL 3N50A 1VFUA 2YBRB 4UV4H 3DX7A 3CZJA 2EE2A 3ARFD 5C8JB 4IIQA 2BMKB 4TSAL 4XNMB 4Y4FD 4Y19E 3S96A 3TBSA 3ARYA 5C86A 3N85H 3S88L 5CLWA 1XF2B 3FT4A 5E4IA 5DJ8B 2EDOA 5FUOH 5JORA 3QH3B 4CDGC 2VLMD 1CGYA 1QFWL 2X4PB 3HUJB 4MJIE 1RIVL 1ZK9A 5EU6E 2VUYA 4HUWA 4JVWA 1X4YA 4N0RA 2EDHA 2GY5A 1BIIA 2HJFB 3TN0C 1A64A 2KDGA 2VXVH 4LARL 5LBSL 1UQSA 3GNML 4ZOEA 1Y0LB 5J8OA 3O4LD 5FIEA 3MTRA 1L7TH 3NCYS 2HTKC 3HLAA 4JO4L 1BF2A 1KPUA 1XGPA 1TZIB 3VWKB 1NAMA 3CFKB 1B4JH 4HIEB 4MXWH 2R2HB 3K2UH 3B9VA 3H0TA 4I18B 4X8JA 5KG9A 4KVCL 2OXHA 3OAYH 2BOCB 4YDVB 1MI5D 2X9YA 1J1XH 3QFJD 4IDJH 3F5WB 4P4KA 5T5NF 4QRQA 2ESVE 5CBEA 4X6FA 1TCMA 1FN4B 4OKVA 5I1IL 3SGKC 2XG5A 4PRHB 4R0LA 3IAGC 5D1QD 1MJ8L 1JTOA 3PHOA 3TPKA 2NQCA 5C0GA 1XR9A 1IARB 3OR7B 5JOPE 3W11D 1G0DA 3PDDA 1E6JL 1EFQA 1FGVL 2EE9A 4NP4L 3T77A 25C8H 1RUMH 2E9BA 3T1WA 1BAFL 4P5KA 1F8TL 2G5RA 3Q3GA 4L3ED 4L8BB 3RVXD 3SDXE 2DJSA 4YIQB 3U4EB 1CD1B 3CFDA 1SY6A 1UKSA 2YSSA 3LQMA 4F33B 4HF5H 1TETH 1R3JB 2NY2B 1CFQA 4YDLC 3TIEB 4ZXBB 2XFXB 4J3TA 5E9DA 4XCFH 5D9SB 1EX0A 4LFHG 4L8DA 3G6JF 4QEGA 3L5JA 4RAHA 4KKCD 2DWEA 4X6BB 4APQD 5DD1H 1I4FA 2FHFA 4H1LH 2GJ6B 1MRCH 3QYCA 3ZTJG 4JM2D 2O26U 3M17A 3N1FC 4PJGA 1BLNB 4JPVL 1J1PL 5DJCB 3GSRB 2Y06H 3F58H 1U95B 1L0QA 4P49A 4PJIB 3I85A 2XNAA 4K71C 4X6DF 4HKXA 1SBBA 1YJDH 5JTWA 2ZCKH 3BO8B 1XF3B 2I9TA 1XF1A 1RIHH 4NZDA 5D1ZD 4GXVL 1NDGB 1CLOL 4XNYL 1U93B 4PY8I 1F42A 1KT2B 1NCWL 1NEZB 3G08A 1CU4H 4P46B 2NZ9C 1A7OH 2AKRB 1NMAL 1JN6B 2ZP0T 3RTQA 5EBMB 3PGDA 2J4WH 4MMZC 4HH9B 2X4OB 4JZJB 2VQUA 3EW3B 1IGIH 1LO4L 4U6TA 5I8EB 2VQTA 5K9KA 2Y36L 5CJOL 1KBGL 4GKZB 1LDPH 32C2A 3GMNB 2Q7YA 4G80B 2XPGA 4JRXE 4NJ9L 1H3XA 4JRYA 3K80A 4M1CD 4TOYH 4YGAB 3KPSE 1YY9D 4V1DB 4ZO9A 3V5KA 2VSDA 5A2IH 2VLRB 3WNMA 1FFQA 3F6LA 1WWBX 4ODWB 2E9IA 2HVJA 2W9LA 3QJHB 4EQ2A 3VD7A 1JGVH 1U8KB 2YA0A 3MC0A 4HMDA 1LEIB 3TJEL 4CJ0A 5IQ7H 4I4WA 5I74C 3VFPB 5KVFL 2YKLL 1RZKL 4Z18A 2AK4E 3SO5A 3EYFB 2K9UA 3QO1A 3C87A 5K59F 1S7RB 4ZUWA 4M61A 5E2WH 2MHAB 1CE1H 1KNOA 1YUHA 5ID0A 1R3LA 3T8XA 1LP9E 2ICWA 5EORH 5FFLA 3I6GB 2JK5B 4J1UA 5DMGD 5FO8A 1BGXH 2MOVA 1XIWB 3FFCE 4ORZC 1E6OL 1FNSH 1EXUB 1DL7L 1IC4H 3U4BL 3QUYB 1I1AD 2H9GA 2A6KA 4GMTH 5I1LB 3FCTA 1WT5A 5IJKA 1UZ6E 2O5XH 5F3BB 3MRFA 3HUJE 3AGVA 2ZG3A 4KKLC 5BJTB 3ZKMC 4M1DH 4DEPC 3RA7H 5CEXA 4EUPH 1T80A 3ALXA 2LU7A 4H26B 2DM4A 4X80L 2K7PA 1T21A 3RWJA 3CU1A 4PJ8B 1YEHH 3UJIH 4WW2F 4F15C 1FPTL 4Y1AB 5GS1B 3QIUC 4GQ9H 3T08A 1LE5B 1EA9C 3BZEA 4HKBA 4TUOA 3PDGA 3QEHB 1LEKA 4EI6A 1CWVA 5I2IA 2YPLA 1Z9SA 1GH7A 4HS6B 4RDQF 3V4PH 3PQYD 3HNVL 5EWIL 5TPWH 1NLBL 3SPVA 2DQUL 2YPVL 5C09B 3U7WH 3BRFA 5EOCH 4PJHB 2ED7A 5KS9F 5C0BD 1X7QB 3EOAB 4XTRD 3H7BA 4ETQA 4RMTA 1K8IA 1EZVX 4HULB 1OF2B 3MLUL 3RWHB 1JF1B 2GT9A 2HFTA 4LRNL 2VKWA 3TO4C 3D0VB 3DI3B 4ZD3H 3GBNL 2X09A 3SE4C 2Q76A 2VKXA 4URTB 3VG9C 1MCOH 1XH3B 1XGYL 3BPLC 3QI9C 3MJ7A 3GSUA 1PKQA 2Q20A 4YHLL 2P45B 1QR1B 1AO7A 2F74A 3GJEB 4G42A 2A83A 4NRXB 3O3EA 3VFMB 1QLRA 1EO7A 2HTLD 2I5YH 3RX7A 3VGAB 4XP5H 4LLYB 5GRVL 2Y4SA 4N9GA 3OF6A 3BISA 3D3VA 2ZUYA 4JQXC 3EDEA 4NQVB 2EYTA 4PS4H 1TVBA 3TYGL 5I71B 1ZVHA 3MLYH 4AH2B 1WISA 3T1FA 3LQAC 5DC0A 3SKNB 4NQEB 1I7RB 4JHZA 1EGJA 1T4KA 1J5OH 4PY8J 2GITB 4JY6A 4KJPD 4JAMB 3TBTA 3FN0L 5IB4B 2I26N 4GXUM 3OSKA 1UM5L 3AAZB 1I7ZB 4UOW1 1QFWM 1F4XH 1QLEL 4MNHA 4ODBD 5EBWB 1EBAA 4X9HA 3LDBB 3WLWC 3RZCD 3RVTC 4EQ3A 2G75A 1IM9D 2GSGB 3H2WA 4LCWD 1KCRH 4Y4KD 3LVEA 3O41B 4M5YL 3WS3A 3W5MA 2NX5B 2Z92B 5IHZA 1AQDB 1EZVY 5E5MA 4PJIE 3PGFL 5SWZA 3A67H 4O2FB 1BZ9A 4KAQH 4BZ2L 1G9EA 3O0RH 4YK4B 4FZ8H 4K07A 3HMWH 4Y16C 1IQDA 4KI5F 5LAXA 3QWOB 4FFYL 4HFWA 1MY7A 2H3NB 3VG0L 1E27A 2BSED 4YEFA 1YEIH 2ORBL 5EIQA 4QNPE 1UXSB 5BZDA 2GFBB 1H8SA 2R15A 3I3EA 3VCLA 1CL7L 3VFWB 2EDDA 4UDUA 1T7VA 1FNEA 2DMKA 2O93L 3D9AL 1J88A 4MA3B 5EC2B 3DBXB 3WCYA 3CX5J 2P5EA 5TJWK 1WUNT 4OGYL 1BOYA 4HIIB 4ZUUA 1C7SA 2ARJQ 3TIDB 5FDWA 3VDCA 4ZUVB 3S5LA 1N6VA 4RZCA 5F9WC 5IGXH 2CLZA 4Z7UE 4L9LC 1MHEA 5F7LB 2X42A 1HHIB 1S5IL 3W82A 5CMAA 3BDYL 2D7MA 3RQ3A 3S37X 2CLVA 3WNLA 2EKSB 3ZKQD 3CSYA 4ALAH 1PG7H 2VLRE 5IMMA 1KB9K 1A3LH 3T3PF 3VRIB 5GSVB 1AXTH 4G6FB 4LOUD 3QEQD 1U42A 4YHPB 4U2YA 1RZGA 4S1DD 4LMQE 3O3AB 4P2RD 5GGSA 5EBLA 3UPAA 4TULH 2CDEA 1SM3L 3VXUA 1MWAH 5EFIB 4XNQA 4ZOBA 1V7NL 1PX4A 1KC5L 2VIRB 4LHUB 3V52L 3SBWA 4HS8H 3IXTB 1JHTA 4MDJA 3V4UH 5L88H 3T04D 3VFSA 4AIOA 3QUZD 3BJ91 1A3RH 4JGUA 1UWGL 4ZUTA 4HIHA 3NFPB 1CDCA 4L4TD 1OL0A 4L4VB 4PLKD 2R1WA 4X9BA 1NQBA 3V7AG 4HUXA 1IM3A 5HGHA 3O8XD 3O9WD 4HK0B 1IZJA 4M7JH 4PD4J 4Y2DD 5EU5B 4X6CE 4OAWB 3DRQB 1CFSA 3HNTH 4JG1H 5IVOA 3PWNA 4FA8A 3KS0J 2R8SH 1T66C 1MCPH 4MD4B 4JFYA 5CBAA 1RK0B 2B0SL 3BP5B 4IOFC 4MJ2A 5F1IA 5C0CD 3MRDA 3RVVD 2VWEC 4UILH 3WNKA 1HSBB 4XWGH 4RGOH 2WLZA 3QQ4A 4Y5VC 4GO6B 3LRSA 1PY4A 1A7RL 2CIIA 3KR3L 3G5VA 3MLXL 5CWSB 5GZND 4NDMA 5SX4H 3SGKA 1RZ8A 5DJDB 4BQ6A 3WIFA 1WAAE 3RWEB 3FB5B 1NGZA 3BP7A 3NACL 3MNWA 1K6QH 3B8YA 1TTGA 1QQDA 3MRKA 2OJZH 3KPMB 4GKSB 4M6MH 4P5TC 4OLXH 4BSVB 2IH1B 1D5ZB 3IDIB 4WHCA 1EH9A 5ERWB 1IGML 3LKQA 3IXAB 4Q9QL 5T1DH 1NDMA 4QT5B 1KCLA 2P8LA 1JF6A 2NY1B 2EDKA 1ZHKB 4BQBA 4KPHH 2NY6D 4EN3A 4ZQKA 3P9MB 4X7DC 3QSKB 1G0XA 2FIRT 1FLRH 3VXSB 5E4EB 2R4RL 3LMJH 1R3HB 3BGMA 4ODHL 5EIIA 3V4VL 4NO5B 4NOBA 3SDXF 5J1AB 4LAQL 3GHBH 2R0LL 3I75B 3E2HB 2DBJA 5HPMA 3O6FB 3UTOA 1I9EA 3S37L 1FZOB 3JWOC 3L95B 5J9PB 1I8LA 4ORGA 4R2GC 5HYJE 2F54A 3RAJL 3BEVB 1CR9L 4X7TB 5DA4A 1I9RH 3TZVB 4NWTH 4NQCD 5DR5H 3D2UD 4HK3N 1CXEA 4Q6IB 2AXJA 3QIWC 1FLTX 4BFIA 5D7LB 4Y5YC 3MQIA 1B2WH 1HOCB 3E6FB 4HS3B 4O51A 3B9DA 1C12A 1PSKL 4MD0A 3IDNA 2GAZB 5D5MB 4BUGA 5CZVL 1ZS8B 3EJJX 4KK6D 4GRWH 3WIHH 1K4CA 4NQEE 3PDOA 4P2QE 5IHUH 2DI7A 1IRAY 5D6CA 2PN5A 3RWCB 5IHLB 3RL1A 2W65A 3SDCD 1PBYA 3P0YH 2VDPH 1IKNA 3TA3A 4NOFA 3WE6B 2OTPA 2PXYD 3GJFK 1FZJA 1KJVB 3UTPE 5J3HC 1IGYA 4B5EA 4DN4L 1P4BL 3QDMD 4YXLL 1D5MA 1OGTA 1PG7W 2OL3A 4YXKL 5DO2C 4JKWA 1YEDB 5F1OB 1JGLH 2ADIA 5IB1B 1F45A 3W9EB 5EO9A 5DD0L 1T1YA 2BSRB 4MAUL 3D18A 5GISL 3QG7H 4YGVB 3O4OB 4OLWH 2VZ3A 1OTUC 5B38G 4Q2ZA 2OX5A 3SE8L 4JN2A 1QHPA 4GUPA 5F1NB 2YBRA 1YEJL 5C6TH 2Z8SA 3SDDC 2BMKA 2H41A 1ZLVK 1RK1B 2J5LC 4XNMA 2EDEA 2NR6C 5DJ6A 3WNOA 3QUKB 5EA0L 5FYJU 3AM8C 3DHMA 3IFLH 3EOBB 4JDTH 3QH3A 3FTGA 4KRPB 4HT1H 3IRZA 1CGXA 5HPOA 2KH2B 1KG0A 4U33A 4MJ5A 3G9VA 2R1XA 4Z7NE 1EV2E 1YMHB 1U3YA 3C8DA 4LSTH 4WW1B 2R0WH 3VFGH 5TE6L 2IG2L 3D48R 4PGCB 5CGYD 2HJFA 1JWUA 1CZ8H 1U41A 4NQDE 4D3CH 5K9OA 3QP3A 1WV7T 3LIZH 1Y0LA 1LP9F 2Q87A 1AIFA 1IT9H 3PV6B 3HE6C 1V3MA 3SKMA 3AMLA 3ZE0E 3UBXB 4WCYH 4MAYC 1XCTB 1TZIA 1QFUL 4HIEA 3CFKA 3VWKA 4ONHA 2R2HA 5JLZB 1EERB 2EEDA 5JHDB 3QCTH 4YDVA 1QG3A 4WWKA 3X17A 4O00A 4WO4D 5IB2A 4MVBD 4XXDB 1SVZA 3FMGL 5J1TC 3KVQA 5DRZA 4ZYKB 3VXOB 4ZFOB 3HUJF 1KB5H 3QIUA 3NH7H 3TNMA 3LSOA 4XZUB 3GRWH 3JV0A 4L4VE 5T1KB 4PRHA 1HHJB 2AVGA 3P9LA 1TJGH 2ZPKH 1IE5A 3ARVA 4NUGL 3OR7A 1HXMB 2X4NA 2NXYC 5T3XL 1ETZB 5CP7A 2PW2B 4TTGA 1D9KB 5BXFA 3TFKD 4GAYB 5DQDL 3ELAT 3GMPB 3GMQB 3QT2A 5J11B 2R69H 2WBJB 5C9JA 3BIBX 4L8BA 1RUAH 1XZ0A 2HFEA 3U4EA 3TJHC 1D5IH 2W9DL 2XACC 4W4OC 4C54A 1NFIA 4Z8FH 4F33A 4JFHD 4OF7A 1KB9J 3MRRB 4NCDA 3N9GH 2DQJH 2OBGA 4Q0XH 1X6NA 1YPZE 3ARBA 3BRDA 3K8KA 5FM4A 3HC3L 4P23D 4NWUL 2GI7A 4P3CL 4O4YL 3TIEA 4F9PA 4N0FB 1IAOA 3QZWB 1BBDH 4JFOB 3ZT5A 3ARFC 3GK8H 4I3SH 4AEHH 4GQPH 2VDLH 3BKMH 2VXSH 1P69B 3E3QC 4OBSA 2X70B 4OCXL 3OKEB 4DVBB 1RZJL 1AY1L 5DYOB 1BJ1H 2GJ6A 2DKMA 5HHXH 3VXSE 3VD9A 4GRLC 1K2DB 4QOKB 4IRJB 4XP9L 5JMRA 5I1HL 3NZHH 1KJ3H 5IQ9B 3NCCB 3GSRA 3UXFA 1OT1A 1U95A 4ONGH 4UAOB 3VXTA 4LVHB 4GXUN 4QCIA 4XXCA 5CINL 2I9LB 3FQRB 1OQOA 3ZKSD 1VGEL 4HWEH 4I9WD 4RIRB 3FQUA 5JIKA 1QSFB 3OKYA 4PJ7A 4K9EL 1MFDL 5DJYB 2OTUB 1PY9A 3BD3A 3DXAE 5E7FA 3TBWB 4D0BB 2PYEA 3FQNA 1NEZA 4LSPH 2LQRA 4G8FA 3D87B 1NFKA 1JN6A 3NMEA 5SV4A 5EBMA 1NC2A 2QHRH 5BV7B 4XPHH 4G5ZL 4ZPVA 2IH3A 4HH9A 4LPUA 2X4OA 4JZJA 1ZHNB 2QQNL 2XQBL 3RPIA 1A1NA 2F19L 3BYTA 5L0QC 4PJDB 4LPVA 1RV6X 2EC8A 3DI2B 2R39A 1DSFL 4FN0A 4HGMA 5D5ME 3BYYA 5LGHH 4KHTH 5C0AB 4GKZA 5DMKB 3OKMB 3B3IB 15C8L 4G80A 5B22A 3SDYH 1TFHA 3BKYL 5C6PB 3MV9A 1ACZA 5D1QC 5JHLH 4V1DA 1ADQH 4H20L 4PJIF 4I3RH 1QD0A 3CD4A 4WFED 3D85A 3T2NH 1KJ2A 4I77L 4QHLA 4AL8L 3W11C 4UMGA 4XVTH 1XGQB 3QJHA 2WAHA 2A6IB 4RX4D 4HJGA 1U8KA 3AREB 2L7UA 3HE7A 3UTQB 3CLFH 1OB1A 3VFPA 4QNPF 4UTBL 4CJ1A 3CVHB 3EYFA 4L9LA 3RU8L 3RVXC 3S34L 1PVHA 3T0ED 1A6VL 4XVSL 5JIPA 1K5NA 2N1KA 2GW5A 1BBJB 3O6KH 1BQHA 3QXVA 4NT6A 1WTLA 3ISWA 5HVHB 5LWYH 4RWHA 3QCUH 5ADPH 5FF6A 4UT6L 1N6QL 1WCBB 3I6GA 2JCCE 1NL0L 1S5HB 4XPAH 4YFLF 1DBJH 1EXUA 5JIHA 4D94A 4YHML 2XKSA 1JGDB 3SCMD 3S8WA 3OJVC 3QUYA 4AM0B 3MLPA 1CTOA 1P9MC 2Q86A 4APQC 5I1LA 5B4MD 3UYPA 3DO3A 3W0WB 4HCRL 5LQBH 4OCSH 5ISZB 3LQZB 4PRAA 4YC2C 4JM2C 4PY7B 5BJTA 1LILA 3HMXL 3W5NA 4LSVL 3DX8A 3S35H 4FTVB 2ERJB 4H26A 5I18L 1EFXB 4JRWA 4UIMB 4KUZL 4PJ8A 1YEEL 1LO2H 1W72H 1RJZB 4TVPE 4Y1AA 2XZQL 4M7LH 5GS1A 5I1JL 4G6AD 5D1ZC 2RJMA 3UJTH 1LE5A 1PEWA 5I66B 2ITCA 3L1OL 3MLZL 2ARJB 2CJUL 2O5YL 3I6LE 3QEHA 4U6VL 2IFFL 3QQNA 4MCYB 5ID1A 3BKJL 4KTEH 5JHDE 2QBWA 4H8WC 5C09A 1GGBH 1W0WB 1QSZA 3LN4B 4PJHA 4LEOB 1X7QA 3EOAA 4F8QA 4Z78A 5E08L 2H26A 3BEWA 3NN8B 5BQ7B 1AI1H 5BVPL 4TSCL 1FL6B 3D1MC 5EDXA 1NCDL 3GZKA 2G5BA 2H8PB 3MRIB 1F3RB 4M1CC 3VH8G 2HYMA 3NCJL 1YY9C 1VACA 3D0VA 3DECA 1WAAF 4JR9H 5EZJB 3Q6GH 4S10A 3AB0B 3WD5H 2X4SB 1XH3A 3KPQB 4PREB 2NW2A 1QR1A 4PBXA 5C2BH 4ZOCA 4NO0A 4LEXH 1WEJL 2JJSA 1FH5H 4PTUA 1IGTA 3DLQR 4LLYA 3DO7B 2R29L 2WWMD 4IDLA 5FEBA 1FYTA 3QHTC 4JFDB 1DANT 5HTSA 1HCVA 1N26A 4O2CB 4PJHF 4OLEA 2FJFB 3OAYK 4AH2A 2DD8H 3D39B 1ACYL 4KK8D 5DI8A 2W9EH 1MOEA 1KYOJ 4EDXB 1NSNL 3KG5A 5DMGC 1I7RA 4UV7H 3S4SB 1DZBA 3ZSTA 2GITA 3L3DA 4JAMA 1MAKA 5GRJH 3G9AB 4N8CH 1KFAL 5T3ZH 1I1AC 4K71B 5HHVH 1QSEA 4ONFH 1TDQA 3P0VH 4DKFH 5GS2D 2XZCH 3W9DB 1PKOA 3WKML 4Q97A 1MFEH 3Q6FA 1AGCB 4YHOL