2LABA

Solution strucuture of the cbm25-2 of beta/alpha-amylase from paenibacillus polymyxa
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
b'GGTTNKVTVYYKKGFNSPYIHYRPAGGSWTAAPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYLFSTGTSTYTPGSNGAAGTIRTGAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta/alpha-amylase
publication title A functional and structural analysis of tundem family 25 carbohydrate-binding modules from Paenibacillus polymyxa beta/alpha-amylase
rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 10
structure length 104
sequence length 104
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03423 CBM_25 Carbohydrate binding domain (family 25)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2labA00
3RQ3A 5F7DA 1FE8H 1QKZH 2R29H 1I7ZB 4HKJA 1KFAH 4Z7OF 1N5YH 4IIQC 5BXFA 1ZANL 1XFPA 3D2UA 4KWUA 3U30C 1F4WH 2R8SH 1EV2E 4NM8L 5EUOF 4UOW1 1Q9KA 3UDWC 1MIML 5BRZA 4MB5A 4MNGA 3QRGH 4NN5B 3X17A 5DI8A 1UJTA 4WIQA 1WC7B 4K7PY 4Y5YC 3ARXA 1CU4L 4GRLC 4KJPC 4QRUB 2Z31D 5CLWA 1MEXH 4E41A 3VGHA 4JHBA 4OIIL 4GAGH 3GRWH 1OF2B 4WI2A 5J7CC 4YHMH 5GHWL 1ONQA 4PY8I 1VACA 3GJEB 4XPTH 1TCMA 4PB0H 2CH8A 1R0AL 1J8HD 4ETQB 3AREA 1S7RB 5CJQH 3AS0A 1RZFH 1SYSB 5K59E 1UKSA 4JKPH 3MOAH 5DJ8A 2D7OA 3V2AR 4PYGA 5LAXB 4F9PA 2G75B 4K55A 3CUPA 4M7JL 2WK2A 1TVHB 4JZOA 3MV9A 4IIQB 2XTJE 4E5XA 2N7BA 1M7XA 3U30B 1UM6L 4JFEA 1AD9A 2UZXB 1LD9A 4HF5H 3EBAA 4AT6A 4HUUB 2OTUA 3LQMA 3WHE0 1CT8B 3C8HA 3LKQA 5D7IB 2W9EH 4R4FL 4Y5YB 1J0IA 1IGJA 5BV7C 2PW1A 4OBRA 4GRLB 4M1CD 4HBCL 5F89B 5IB2A 5FB8A 2AERT 4ZQKA 4ODSL 1A1NB 5C0RL 5I73C 2APBA 3O6KL 2ZSWA 1J1PL 4G5ZL 1MRDL 5E9DD 5JO5B 2J88H 5J3HC 4YHNB 3U9UA 1CDBA 3HE7A 3Q6FB 4Y16D 4G6ML 4XMPH 1B0WA 1LWRA 3V4VL 2AGJH 3MRIB 5TE7H 3BEVB 3VCLA 4NC2B 1E4KC 1H0DB 3T1FA 2HRPH 4XHJC 5JDSA 4P48A 1BOGA 1NCDL 4WUUA 4PP2B 4R4NC 4YPGB 1G1CA 5CMAA 3G6JF 2AK1L 2APWA 1E27B 3IDXL 1UCBL 1NLBH 4YUEH 4MD4B 4TN9A 5A2FA 1NCBL 4QT5A 1AGBA 3HNSH 1MVUA 3VXSB 4X7DC 3RVXC 4NHCH 1FFPA 5I1KH 1EAPB 2GK2A 2AJZA 1JRHL 1S9VB 1U58B 4P3DA 4K7FB 5BV7B 4MXVF 4M5ZL 3I3BA 4M9OA 4PJXF 3MXVL 4DN4H 8FABB 1JWUB 5IGXH 2J6EL 3AS3A 5L8JB 5DT1H 3W2DH 2OR7A 2ZNWA 4ZTOH 3O6LH 4PLJC 3SKUD 5I73B 5EZOL 1UH3A 4P3CH 4K9EC 2A83A 3FHQA 4M1DL 1QLFB 2P5EE 3P9MB 3MA7B 3FRPG 4WI9A 4I8DA 4RFOH 2F19H 3VRIB 2NZ9D 3MLUH 1UXSA 1WFTA 1E28B 5DJYB 3EZ8A 4XBEH 1HZHL 2C4FT 1B88A 3RNQA 3IF1B 1GGIH 4O2FA 3GBMH 4K3DH 3AREC 3GSUB 1LP9B 5SWZD 1QA9A 1NFIB 3FT4A 1NAMA 4G9FE 1HHHB 4P2OD 4U6XB 5D7JD 3TIEA 4FA8A 2EYRB 1S5IH 1WFOA 1F58H 5LQBH 4J1UA 2AV7A 1S7QB 4AM0A 1Z3GH 3JTSB 4QXWA 5HYFA 4F9PC 4K3HA 5IROA 4L1HA 4HKJB 3TO4D 1I4FA 5BXFB 2L4OA 1G6RL 3CNKA 3MNVA 1AR2A 4KJQC 3MUY1 4KKAD 4YDJA 5HYJB 1XIWA 1Q9KB 4Z7UE 1FVEB 1PQZA 5BRZB 5KTEL 3X3FL 4MNGB 1NEZG 3RL2A 2BSRA 2X5PA 4LKCA 4F37K 5C0ND 5DI8B 2VL4A 1Q72H 1N5AA 1P5VA 4NO0D 3VXUD 1A22B 4PLOB 5IKCA 5EU3B 4XC3H 3OAUH 4KXZI 3HZKA 3CXDH 3QIWB 1ONQB 1GGYA 1C12A 4YDKL 1VACB 3VFUB 2EE3A 2BRRL 3VD4A 4JG0H 3SE9H 3VD7A 5D2LA 1I1CA 5D9SB 5EWIL 3AREB 4D0CA 1DR9A 1B2WH 2NY6D 2VH5H 1KEML 4X9BA 3LS4L 3Q0HA 4L4TE 2VDKL 5IOPA 1KCKA 4WHYH 3TCXA 2EIZA 1RPQA 5T3XH 2VWEC 3CU1A 4BUHA 3CUPB 2O5ZL 2KZWA 4JZOB 4MDIB 2H26B 2ICCA 3I85A 3U48A 5ADOH 4E5XB 3C87A 2HKFL 4MQXC 1AD9B 3LS5L 3VI3F 2KL6A 4D9QE 3UAJC 4AT6B 1A64A 2J8UB 5DRNA 4O2CA 3D18B 1QSED 3LKQB 3R1GH 4JPIA 3SPVA 3DI2B 1IGJB 2AABL 2FEDC 2PW1B 2XKNB 1A21A 1WWCA 3B5GA 2P7TA 3D87B 1BPVA 4BZYA 3LKOA 2H8PA 3K2UL 3THMH 5IB2B 1BOYA 5FB8B 4ZXBD 4IMKA 4ZQKB 1GXEA 2PYEE 5E2WH 5I1EL 1EVTC 4X4XB 2P8LA 2ZSWB 3TNNB 5A2KH 5DVMA 4ODHH 3X14A 1D5XA 3U9UB 4CUCA 1CBVH 3F7PC 2E3VA 3BT2H 4MNQE 1P2CB 1G0XA 3VCLB 5EUOA 4KH2A 3M45A 3O3EA 4CVZA 2E5EA 1IAKA 2DQTL 1ND0A 1JTPA 1LO3L 1BOGB 4WUUB 3QEQD 3EO9L 2R2CA 4JGMA 3KWWB 2UZIH 1IGFH 5IROC 1N7ML 3ARBA 1YEHL 4QT5B 4HPOH 1AGBB 1FJ1A 4UNTA 5DVKA 5INCB 2A6KA 2AJZB 3CK0H 3RDTA 1XIWC 5E7FA 3IVKA 2J5LC 4YIQA 3QUYB 1XGTA 1MFEL 3FQRA 4RMQA 5HHQA 4PGDA 4RAUA 3T1WA 5EO1A 4OT1H 2GJ6A 3QDGE 1ZS8A 2FB4H 3UPAA 2EKJA 3W39A 1I9JL 1LVEA 2A83B 2EC8A 1YC8A 4PJ8D 3UZEA 4PJHF 4NC1C 2Z8SA 1OARH 2OR9H 5B8CB 1RUML 3T0EA 2V7NA 2QL1A 1A47A 3UTZA 4BK5A 2DQGL 2EIBA 1RJLA 1D3CA 4OQTH 3T0VA 1VFUA 1NAMB 3FT4B 3TIEB 2C1OB 3D48R 5KVDH 3ORJA 4J1UB 2AV7B 4YPJA 5IBLC 4BFIA 3DYMA 1JPTL 2BP3A 1NLDH 5GGTH 1EEUA 1YECH 1I4FB 2W0KA 4XP1L 4EOWH 5JW5A 3MNVB 4HLZG 3PGDA 4JDTH 4YDJB 1AR1D 1XIWB 2J5LB 1IZJA 3WXVL 4DK3A 1L7TL 1RJCA 1PQZB 3P0VH 3VXPA 2VXVL 5DUBA 3RL2B 3VFPA 2VUYA 3CVIH 5C6WH 2BSRB 4LKCB 3WS6A 1IQWH 5T1LD 1AQKH 3MJ9L 4UV7H 4ENEC 1N5AB 1HI6A 1QRNE 5IKCB 1A5FH 1QQDA 3VWKA 3HZKB 3VDBA 4IMKC 1Z0MA 4ACPA 3FKUS 2X41A 4HWBA 1AFVL 5D2LB 5HHNB 3KYNB 4D0CB 3B8YA 4S2SA 1UYWH 2N56A 1GHFH 3P2TA 1JPFA 1UWXH 3FN0L 2XICA 1TETL 4L4JA 5IOPB 3HZMA 4RGNB 4PJXA 1NGYB 5FYKH 2EIZB 4NSKB 1A7QH 1BFVH 2CR6A 2KQMA 4YQXL 3DWTA 5CCKL 4PJ5E 2IANB 1UWGL 2IF7A 3E6FA 3ZYIA 4TUJA 1OSPL 3KJ6H 4LSRL 3ARBC 3D6GA 4BQ6A 2VMFA 1BAFH 4YC2C 5DRNB 4YXLL 5CBEA 4O2CB 1DQML 2APXA 1SJVA 4OLUL 4LVOC 3RDTC 4OI7A 4JPIB 3SPVB 2UZYB 1VGKA 5GRUH 1MI5A 1KEGL 3FQXA 5E8DL 3LKOB 2H8PB 4U05A 5EU6A 3VI4E 3D39A 1NFDE 3TT1L 4HFUH 2F5AL 4WFFD 3OMZA 3DGGA 5C1MB 5HI5D 1D5XB 2X4TA 4N68A 3U1SH 1KPVA 1CFVH 5DO2D 4X8JA 3T0EC 4F7EA 1JYXA 2CKBL 5AUMA 2DIBA 4S1SH 5EUOB 3AMKA 3W9EA 4CVZB 1IAKB 4BQBA 1ND0B 4AJ0A 1F45A 3QFJD 1HCFX 5HD8D 2R2HB 3TT3H 4NQDA 1CGXA 4MJ5A 3VMNA 4K94H 4C54A 4FQIH 4MYWB 1CXEA 4JFFA 3V7AG 4X9GA 4Z8FH 2F74A 1MY5A 3ARBB 1VHPA 1OAYL 4KPHL 4PJFA 1FJ1B 3RBGA 1O7SA 4LVOB 3DSFH 4WVRA 2A6KB 2VZVA 3RDTB 4NZUL 3EOTL 2XOTA 4X6EA 3GSNL 4M6NH 1XGTB 3FQRB 4YBHA 2VDML 4P23A 4RAUB 4LGRB 5EO1B 3QHZL 4I3RL 5IHUH 2GJ6B 5K93A 1ZS8B 4HFWA 3W39B 1U8MA 4PBXA 5F6HJ 2DAVA 2DLFL 3VWKC 4C4KT 2E9IA 4YHOH 1F90L 3VG0H 1QHOA 3T0EB 3ARTA 3WS3A 1JL8A 2P43B 2V7NB 1YEIH 4JN2A 3UTZB 1F8TL 2E7CA 2RCSH 2ATPA 5IVXE 2HTKC 4C56E 2XZAH 5ACZB 2ILLA 3ARVA 4C58B 1MRCL 5EB9A 1RUAH 5HVFB 3QEGL 3I6KA 3KLHD 1TVDA 4OIBA 4ZFGH 4HMCA 4OM0L 1IILE 1V3MA 4BFIB 3LMJH 1CD1A 5HHPA 2F8OA 4XMKH 1F00I 1YNKL 4LSVL 3FO0L 4WUKL 2WUBH 5FO7A 2BY3A 3ILPA 3PUCA 3PGDB 5J3HD 2CJUH 1KPRA 1EH9A 2EEDA 3VXPB 4PD4K 3LHPL 4PP1C 5IFHL 5DUBB 3VFPB 2DQHH 3EDEA 1H3GA 4XNQA 1VGEL 2BNRA 4KK5C 3HNTL 3QWQB 4BSWA 2MCG1 2N1KA 1UZ8A 3KG5A 4YX2L 3VGAC 4W6WB 5DMIL 5EOTA 3V6OE 1QQDB 3VWKB 4Z18A 1D5IH 1NMBL 2H9GA 3O2VL 2Y7QA 3DRQB 2MJWA 3VFOA 4OZGE 2AAVA 4M61A 4JQIH 3D2UD 4S2SB 1DBBL 3TPUA 1ACZA 1JPFB 1A3LL 3HZMB 4ZSOB 3HR5A 3CFBB 4POZC 1ZHKA 4PJXB 2C4XA 3QWRA 4GKSA 5ICZA 5TQ0L 1IBGL 5IEHA 4GMTH 4I4WA 1NANI 5L9DH 1DL7L 1KTRL 1MWAL 4HS6A 4NQUA 4G8GB 4P3WA 4EKXA 5C0BD 3E6FB 5JXEA 1Y6NR 4N0FA 4E41D 4TUJB 1WEJL 1ZGLB 3HC3L 4Y1AE 5CBEB 3W81A 3ULUE 4JM4L 1HQ4B 1F3RB 4HKBA 4UT7L 3FRPA 2JTDA 1VGKB 3QWOA 1MI5B 3T8XA 1GOFA 2OL3H 3VGAB 3FQXB 3A67H 2MMXA 1AGCA 2QQLH 4NWTH 4P23C 5IFJA 1JGVL 3RIFF 1G9MC 5GJTH 5T1DH 3BUTA 3D39B 2YD3A 2HG5B 3OQ3B 4Z76A 5T3ZE 2WUCL 3S4SB 4XVUD 2CXKA 3LRSB 3LB6C 2X4TB 3MV9D 4JPKL 5HPMA 4X8JB 3SEPA 4K7PL 4F7EB 2N7AA 4ZTPL 4JFED 1MH5B 4NFCA 3PGCA 1CXIA 3W9EB 5K9OB 1WZ1H 2KBGA 4U4BA 5KSBE 1KENH 1X9QA 4JRYE 1T0PB 5HGBA 2OP4L 4NQDB 5EH1A 5EZLA 4N8VG 1K5NA 1NEZA 4Q0XL 4JFFB 5CEXA 2F74B 3OG6B 3K4AA 3B2UD 3TO2B 3LY6A 3INUH 4PJFB 3WNMA 4NUGL 4MS8C 3HAEH 3HE7D 1P69B 4X6EB 4KHTH 1CE1H 4PRIE 4PJCE 4P23B 1AXTL 4H5SA 4HGKC 4I18A 4EQ2A 4KI5E 1MHHB 4HFWB 3D3VA 4TRPH 1RFDL 1U8MB 4YGAB 4POUB 5SX4I 3MMEA 5GQBA 3ZL4L 4Y19E 1BREA 1W72L 5D6CA 3WS3B 5C0EB 5FAAA 4JN2B 2FR4A 1AI1L 3WE6A 2ATPB 3U4BH 3ZTNL 1F6FB 4NHUA 4O58L 1I9EA 2EDYA 4H25A 1DANT 2F8XC 5FGCB 2ENSA 4QOKE 3I6KB 1XF5A 3ESVF 5IBTL 2J12B 3MUHL 4J3VA 1FCCA 1HDMA 2ZUSA 5HHPB 3OKEB 4AK1A 3IFOA 3CVHH 3S5LA 5FO7B 3ILPB 3WFCL 1KCUH 5F9OL 1JZ6A 1N6QH 2DKSA 3MRLB 4GRWF 4ZNEE 1AGDA 1QFWI 3TJEH 4J6RL 2IJ0C 2MSPA 2XG5A 4LARH 3LPWA 1Q38A 4PJEE 4XNQB 2BNRB 2V9QA 4XPFL 1RU9H 4GXVL 4B7LA 3QIBD 1UZ8B 5H37H 4FFYH 1SEQL 5GRJH 4MWFA 4AEIH 1A9BA 5EOTB 3OKYA 2ARWA 4G9DA 3RKDC 1CGVA 5GGQL 5BVJB 1MCPL 2H9GB 3A6BH 2QHRL 3SE8L 3VFOB 4AENA 1DEEA 1JHKH 4LCIL 3BKJL 4M61B 4JY5L 1CF8L 3T2OA 1GGBH 2J4WL 1XIWD 2X2YA 3I6LD 4ODBD 1OCWH 3GHEH 4Z78A 2EDXA 3OJDA 5F9JB 1MNUH 3BOVA 4ZOAA 3CX5J 1ZHKB 4D0DA 4NZRH 4NO2A 4GKSB 3TEUA 3IFLL 4I4WB 4X98B 1TZIA 4HS6B 2X10A 5T5FL 4N0FB 1OD9A 5DK2A 5JHDE 3BWUC 1JZ7A 4JPVH 2OZ4H 3RAJH 4LLYB 1G7HA 1U8QA 4HKBB 2QKIA 5D7LA 1R6VA 2X1OA 4NFDA 3WJLA 3M8OH 3N9GH 3MX0A 4FTVB 4P2RD 3QWOB 2CLRA 4FQLL 5IFJB 3EGSA 4FQJH 3RNKB 4OCRL 3MRMA 4I18C 4Z76B 1CGTA 1QP1A 4CVXB 2APVA 2ICES 3AXLA 3ZLQC 5D93C 5C8JA 4QRRD 4HIEA 5HPMB 2NY2B 1KC5H 5CJOL 5E8NA 5D6DA 3BHBA 2EZ0C 4TSCH 1UADC 3PGCB 3O2WH 1FIGH 4DN3L 1RZ7L 1X5FA 1MCEA 3HG1A 4XI5C 2NY4C 1T2QH 5FKPB 4NQTA 4JAMA 2EICA 2J3SA 1HHJB 5H37G 3LIZL 3H9SE 1C5DB 5CIPA 4RGMC 1K5NB 1FRGL 1NEZB 3HE6A 2QQNL 5CEXB 5DJXA 5CUSL 3VGDA 3OR7B 1GGTA 3DMMA 4HQQL 1X44A 4MJ6A 2X7LA 4XZUA 4RSVA 4NO3B 4JN1L 1E4XI 3O0RH 1IAOA 2VLRB 5CGMA 1JPSL 3FHAA 5ECJE 2OS7A 4H5SB 1A02N 1LEKA 5I8OL 3DVFA 5TE6H 4I2XA 1OAKH 4X4YA 5AZEH 3TM6A 1FBIH 4W4OA 5D93B 2VLKE 4KQ3H 5D6CB 1CLOL 1LK2A 1IM9D 2EDFA 3EJJX 3GEWB 3O6FD 3ECBB 4KQ4L 2P1YA 1R5IA 4H25B 1LK3H 5JUEL 2UWEE 5I1JL 2M26A 4PJBF 1QFHA 2JCCE 2VDPL 1XF5B 4RGMB 2VLJE 4PJGE 1YDPB 4QF1A 1SVCP 1FO0B 4NZJA 3RIAK 4EXKA 5E6IC 1L0XA 1ORQA 4CMMA 3QZWG 1YEEH 1N59A 4PLKD 1WCQA 3FL7A 3T0ED 1FG2A 2FCBA 2VB5A 4NKIL 3TVMC 5I19L 3GBNH 3DX9A 4NZDA 1BX2B 4NNYB 4P99A 1ZANH 2VXSL 4GRMA 5BQ7A 3WJLC 4XX1E 4KKNA 2NW2A 4NN6C 1A9BB 1T3FA 3V95A 1MIMH 5BS0D 3SDXB 4G9DB 5DXWA 3AU1A 4YHPA 4RMVA 2FEEL 4PV8A 2GY7B 3RKPA 2IAMB 2A73A 4AENB 3BKMH 1DEEB 2OJEA 4M1GH 2MPAH 3QXVA 4OIIH 5D6DC 3U36A 4Z78B 5IHZB 1Q94A 3DROA 3OJDB 5GHWH 3RVTC 4JFDA 5SWSB 2GFBA 4IRSA 1EFXD 1CG9A 1FVDA 3CDCA 4FP8L 1CR9L 1V8HA 3IDGA 3QAZC 4ONFL 5E6IB 2HN7A 3EO1B 5C0JA 4PBVC 1JGUH 3ZE0F 3HE6C 1QSFE 2AS5M 3OTTA 1GRWA 3DSNA 5LVEA 4WGVB 3BZFA 3BIAX 1CGWA 4JFHE 4H0HB 5JQ6L 3QUKA 2XY1A 1RURL 3DMMC 3TVMB 5M94B 1U8QB 5FGSA 2QKIB 2F58L 4F7TA 1BZ9A 2CLRB 2MKWA 1ZGLM 4NRZA 2F9BT 4IMLA 4NN6B 4OLXL 3GM8A 3MRMB 5AYQA 1NGQH 1FVCA 5HBBA 1X5LA 3LN4A 3AXLB 4W4OC 5C8JB 4LLDA 5GGSA 5H2BA 3O11A 4HBCH 4HIEB 4HIXL 3PWUA 2B2XL 5E8NB 2IPKB 2KQNA 3BHBB 4XAKD 4WFEE 3MLVL 3RUGF 4JFYA 3BPLC 4ODSH 4V2CB 5C0RH 4XNXL 2HMIC 1H15A 3M07A 4FFVC 4PP1D 2FGWH 4G5ZH 3VFGL 4MHHI 1GIGH 1MRDH 4J3TA 1A7OL 2HAZA 3HG1B 5E70A 3WXWL 2CD0A 5GS0C 3HFML 4G6MH 3QAZB 3V4VH 2EDEA 5CIPB 2YPVH 1LO4H 1XF4B 5BZWB 1YYLL 3CH8A 3M17A 1LE9A 3BFOA 3HE6B 3QXAB 3NN8A 5LWYL 2X9XA 5EU6D 2P48B 4G6FD 5DJXB 5GRVL 3ARZA 2QSCL 1X5HA 4JO3L 2QSVA 4PY8J 3DMMB 4ONGH 1RUKL 4MJ6B 1NCDH 2X7LB 4P59L 4XZUB 1T2JA 2H2SD 2LU3A 2YA1A 1QD0A 3MUGA 2AK1H 4QHMA 3NAAL 1UWXK 1IAOB 1AO7B 3C6SA 1KTLA 3TP4A 2EDJA 4LEXH 2AJUL 1LEKB 1U8OA 3CZFA 4OLYL 4I2XB 1TITA 1NBYA 5GIRA 1QZ1A 2X40A 4PGCA 4O02L 4D94A 5DFTA 4M5ZH 5GJSL 3WFHA 3MXVH 5IT2H 4BJLA 2J6EH 2PO6A 3QDME 1LK2B 5ETUA 3BPLB 5EZOH 2EE2A 4ZS6D 1I8KA 1R5IB 1ZT4B 1AIFA 3OJVC 1QBBA 4OCWL 1V7NL 4HAFA 5JW4R 1D5ZA 4X7EC 4G42A 3S37L 3R06A 2WWKT 3LZFL 1HZHH 4QF1B 2X4NA 3DX6B 4ZODA 1B3JA 3I2CL 4ESKA 1ORQB 3SO5A 4CMMB 3LB6D 4CU7A 1GJIA 1O5DT 1INEL 4H20L 3V6BR 3Q3GA 5GSVA 4F9LC 5B3NA 2IGFL 2YD2A 3TV3H 3BDXA 3IAGC 1Z5LA 4J23A 3DX9B 1Y6KR 5FHAH 2BNQE 3BW9A 4EUPH 1Q9LB 5HHVL 4GRMB 4UI2A 1G6RH 4ODVL 4HAGA 1DP0A 3FAWA 2NW2B 4P4RA 1G7LA 1NH6A 4XCFL 3X3FH 1V7ML 4OFDA 3UYRH 3AU1B 2IPUG 1WJ3A 5DS8A 5C09E 4PV8B 1EJOL 1ADQA 1IM3B 2AJXH 3KPMA 4OI8A 1U8LB 4N8VA 2OJEB 2DQEL 1ULVA 1NCNA 2J8HA 4JO4L 4KK8D 1DBAH 4U6VL 4WI3A 3U36B 1Q94B 1SQ2N 2VJXA 4JFDB 4M6AA 5T1KD 2VXUH 4H0IA 2DM3A 2GFBB 4U2YA 1CG9B 2HLFD 5A16A 3L1OL 4I77H 3P0YL 5DMKA 2FJGA 5EWIH 1NL0L 3IDGB 3ZO0A 4FXGB 5F3BA 3GSRB 1KEMH 2HN7B 3GHBL 3LS4H 5C0JB 1J1XH 3QUZA 5JHLH 2FX8L 4F33B 3IFNL 4P46A 4MVBD 1D9KA 3VRLE 3WDIA 2XZQL 4EBQL 3WDJA 4RMUA 3SDAA 2QEJA 3P0GB 4XP4L 4HS8H 2O5ZH 1X6NA 2VL5A 4F7TB 2HKFH 2Y5EA 3O2DA 1BZ9B 2K1MA 4MA3A 2DB8A 3WBDA 4CL7A 4NRZB 3LS5H 4HX1A 3HUJE 3ZDXE 2D3VA 3H3BC 3QWRD 1FZKA 1IC7L 2NTFB 1FVCB 2D2OA 3D9AL 3LN4B 4KU1A 4MAYD 3DETC 4JEGB 4LLDB 4ZFZA 2Z91B 5SV3A 3O11B 4CJ0A 4U1GC 3PWUB 4OSUH 2PO6C 5JXED 5L8KB 3MV7B 1WT5A 2XKUA 4KKCC 4QRTA 4JFYB 4MSWA 3SKNA 2DQCL 2VZSA 4GRWB 1H15B 1CZ8H 3BP7A 3DYOA 1ETZA 3SQOL 2XTJC 3P77A 1C7TA 1RUPL 2AJYL 5TF0A 3GSQA 4Z7UA 3EDFA 3NN8B 3ZKND 1CD9B 1YY9C 2OI9C 4PJAE 4HIIA 3RTQD 5JMRA 2X70A 1T89A 2DQTH 3HNVH 4N5EC 3K2MC 1UB5A 2E6QA 1JCKA 5MEPA 3MUGB 4LGSB 4QHMB 3FRUA 1KTLB 1N7MH 3CZFB 1K6QH 1NBYB 2R0ZH 3PQYE 2D9QB 1YUHA 1T0NA 5EN2A 4YXHL 1L0QA 3WFHB 4AH2B 5GZNC 5I17A 2AEQL 2PO6B 2YPKA 1HCVA 3IGAA 5ETUB 2JJSA 2BX5A 1CGUA 4OGZA 5IMKA 2FNBA 1I8KB 2BOCA 3ZHKA 1DBML 1UCTA 2X1XR 4E42A 2XTJB 4OKVA 1AIFB 1RMFH 3H7LA 4FABL 3U7WL 4F7PA 1D5ZB 4M7LL 2VOTA 4HC1A 3R06B 1PD6A 2DQGH 5CJ5A 2WZPD 1CGSH 1G9NL 5IV2A 2IG2L 2OI9B 2X4NB 2MHAA 2V5YA 4IRJA 1J86A 4LCCA 1MLBA 3D3VD 3GI8L 1K8DA 3PGFL 1D9KC 3Q3GB 5GSVB 1VEMA 3SDAC 1Z5LB 2PYEA 5M7QA 5BCAA 4OCNC 5JXAL 1AJ7L 3BW9B 4ODXA 3RUGA 3IXAA 5JIIA 3S36H 3IKKA 4TULH 1BIIA 4XI5D 2NY4D 4J3XA 1RZKC 4ZUWA 4P4RB 3WXVH 4LHJB 5I9QC 1G7LB 1L7TH 3PWNA 1JI2A 2VXVH 5EIIA 5EU7E 1PBYA 5DS8B 3JWOL 2HKHH 2BFVL 4M48H 4MNHA 3KPMB 5MENA 4PRPA 1WT5C 1N2RA 4M02A 1BZQK 4QNPE 3RHWK 3MJ8A 4TQEL 3SDCD 4MXQD 3LKRA 3O4LD 5A16B 1AFVH 1RULL 5DMKB 3GJFA 4UAOC 2FJGB 4ERSH 3T0AA 5F3BB 2KUTA 2BDNL 4RISH 3QG7H 5F72S 2YEZA 1A3RH 1SJEA 1J05A 5DUPH 1JBJA 2I27N 1LQSR 4Q9BA 3DIFA 1T89C 4X0KA 3SDAB 3PHOA 1CFBA 3IRZA 5IWLA 2IQ9L 4P5KA 1QSVA 3TBVA 3GUTA 5FYJL 5FO8A 3F12B 4LSRH 5I9QB 2ZUVA 2O61A 4HX1B 1L7IL 1MCDA 1BM3L 2OZ4A 5F7MC 1HH9B 4WNQA 3RWFA 1FZKB 5K9QI 4OLUH 4OAWA 5L7XL 2VSDA 4P9MH 4WEBL 2F5BH 2VDQH 1YJDL 4XAWL 1DSFH 4NKDA 3CX2A 3NCFB 1KEGH 3ISWA 1C16B 3MTRA 4ELKA 2OTWA 3EYFA 3U2SB 5LG1A 2X1PA 1TJHH 1UM5L 4JCMA 3SKNB 4MSWB 3W11C 2ESVE 1IEHA 3G04A 2F5AH 2DQUL 2JJSC 4LCUA 5T3XD 3UC0L 4OV5A 3BWAA 1K4DA 1QBML 1ETZB 3KPQA 2GCYB 3FQTA 3I50L 1NUFA 3P77B 4UAOB 3SGKA 3QZWA 5D7LD 4GG6E 3MV8E 2NY5C 3AGVA 1IGIL 1RK0A 4Z7UB 1KB5H 3CFIC 4YFDB 3MNZA 4HIIB 5I1IH 3KJ4C 4OF5A 1G7QA 2X70B 3QBTB 4LCCC 3OAYH 2RFXA 3V4UL 3MRCA 1UB5B 1QRNA 5I8CA 3C5SA 2XN9D 4D2NA 5MEPB 2O5XH 4TUKL 3FRUB 5C0CE 3MGTB 4WY7L 1YEFL 2EH8H 3I02A 3C09C 1C8PA 3FB7A 4UB0L 1I3RB 4LF3A 2ADGA 1RHHA 4KY1L 3BSZL 3L3DA 3WD5H 3LRGA 4U33A 1JNNH 1YUHB 1KG0A 1Y18A 5JIPA 4NZUH 1T0NB 4N5UA 5I17B 2VDMH 2EIEA 4L4TB 2W0FA 3IGAB 1JGLL 2HJFA 3DJ9A 3U4EA 4YR6A 2GJJA 5DA0B 1I1AA 2I9LA 2BOCB 4X6CE 4E42B 4M7KL 1M05A 4H8WC 5E94A 5J1AA 2DLFH 4RGOL 1P4LB 2NY0D 4F7PB 5DHYB 2AJSH 1F6AA 1QG3A 5EU5A 4LRIA 3OGCA 1SBBA 2N4IA 3KJ4B 3T4YA 1MLBB 4S1QL 3HB3D 3DO7A 3FTGA 3NPSC 1F4AA 3GNML 4MQTB 1OT1A 3ARRA 1K8DB 3T3MF 2D31A 4PBWD 1NFDA 3MNWB 3C09B 3KYKL 2PYEB 4EJ1C 5IWLC 1TMCB 4MHHG 1YNKH 4LSVH 4RMRA 3FO0H 4ODXB 3IXAB 5JMOC 2XZCL 4G6AD 4PG2A 3N0PB 4UBDC 3K1DA 2IPTL 4XX1G 5E95B 4K71C 4DTGL 3PWNB 3QUXD 3LHPH 4I0PA 3BQUA 5KZCD 5EIIB 5FUZH 5CS7A 2ZJSH 3T2NL 2OTPA 3ZE1F 4MNHB 3BI9X 5FOBA 1BD2E 4YX2H 2YSSB 4JDZB 5DMIH 4NO5A 3MJ8B 3LKRB 4UINL 3S88L 3GJFB 3SGKC 3WIHA 3B2VL 2NXZC 3DHJA 3C8KA 5E8EB 3TLRA 1MCQA 4JJ5A 1RIUH 1W8NA 1SJEB 3DV4B 3NPSB 2EO1A 2JELL 5F96H 1J05B 5JW4Q 3DIFB 5TQ0H 3RY4A 5GGSY 4X0KB 3BEWA 4P5KB 4ZPVA 5DQ9A 3T77A 1DL7H 3LEYH 2CLVA 1YY8B 4B7IA 1WAAF 4JO2L 1KGCE 43C9A 4K71B 4P5TD 5EBLB 2YD4A 1Q9WA 2O61B 2P45B 2DMKA 4IRSD 1JFQL 4WNQB 3RWFB 4JM4H 1MHPH 4HWBL 5IVXA 1UEYA 4UT7H 3MRQB 4OAWB 1NDMA 4C56A 2FL5A 4NKDB 4HKXB 2DLTA 4FFWD 2AI0H 4ELKB 2OTWB 3EYFB 2Q7NA 1GC1C 2WUCH 5FYKD 5BJTA 4S1RH 3G04B 3U6RB 1NCTA 1I1AC 1K4DB 1WISA 4OZIF 3KPQB 4RWHA 1WIOA 3FQTB 1KN2L 3RWGA 2A77L 4RDQF 3QZWB 3AB0C 2NXZB 2JK5A 1T83A 4MX7A 5GRYA 1IL1A 4K7PH 2A9MH 4YHZL 2AEWA 4X80H 2R9HD 5DMGC 1RK0B 3MFFA 3CDFA 1HQRB 4LRIC 4KZDH 2Z92A 3MNZB 3ALWA 1G7QB 4U3XA 1FFRA 1Q1JH 2RFXB 3G6DL 3MRCB 5I8CB 1QRNB 3C5SB 2ZZUT 4P2YA 3WL9A 5D96C 1A1MB 4UTAL 3V6OA 3FFDB 4G8EA 3FB7B 5DA4A 5LBSL 4LF3B 1OOAA 2ADGB 1KT2A 2R0LH 4YDLC 3L3DB 1OW0A 4EN3A 3D1MC 3NBNA 2YMXL 4PG2C 3BUYA 1KG0B 3RVUC 4OZGA 1Y18B 1G7IA 1J9CT 5E6ZA 3TNMA 4LBEA 1EA9C 4I0PC 5I1GL 4UQ2B 2M1KA 2YR3A 2E9JA 2W0FB 2HJFB 4HMEA 3OWEA 3QCTL 4NBZB 3U4EB 1KJ3H 1I1AB 2I9LB 4HH9A 1RFDH 2IBZY 2R1WA 4PJ5B 2AXGA 4HK0A 1M05B 2DD8H 2B20A 3CFCH 4RBPK 4U3CA 3AB0B 3ZL4H 1CVSC 5CZKA 1OSZB 4U6YB 4CU6A 1B90A 1JF1B 4FZEL 1URLA 1F6AB 1GH7A 3EJYD 2J8OA 5EU5B 3IAQA 1H3XA 1AI1H 2G2RA 1EEQA 3L5HA 3ZTNH 1EUUA 3T4YB 3VXRD 5ID1A 4TSBL 2F54E 3LV3A 5B39G 3CFJA 2OM5A 2PN5A 1KELH 3B6SA 5D96B 5IBTH 3NCJL 3KHQA 1ZLWK 1NFDB 4DUVA 3BPOC 2FATH 3MBED 1UM4L 2AJVH 5E1AB 1HYRC 4YDLB 4KROC 3O81A 5EU4A 4NQVA 2ERJC 4MGXA 1R3IL 2X05A 3QA3A 5GZOC 4WI4A 4I0PB 3AMLA 4J6RH 2LABA 2X09A 3VXNA 5KAQF 4YE4L 5KSBA 4JRYA 3LSOA 4GXVH 4KRNA 4N0UE 2NXYC 4N5ED 4XPFH 1BLNA 5DURB 5FOBB 3H9ZA 4ZUVB 3MA9L 4JLRA 2C3HA 1BQSA 2A1WL 3LKNB 3UTSE 4KKLD 4AEHH 1MCPH 1KYOJ 2OSLA 4GXUN 4N0YH 4IRZH 1REIA 3MLZH 1MHCA 4FQCL 3TZVA 3C8KB 4QHUA 1T83C 2R4SH 4NNXA 1U92B 3ARFA 4JJ5B 3C6LA 4WCYL 4HHAA 4PJCA 4F2MA 1KACB 5BOZG 4UZGA 4FZ8H 35C8L 4PPTA 1CLCA 3PG2A 1QKZL 1U8NA 1S9XB 2R29L 1DQLL 3BPOB 4NC0B 1KFAL 4MJIE 4F7MA 1N5YL 5DQ9B 4BH7A 2V17L 3RGVD 1JWMA 2CLVB 4KROB 1F4WL 2HJKA 4NKOA 2R8SL 1A4KB 3V6OC 4HH8A 2ERJB 4Y19A 43C9B 3QRGL 3JUYA 3VFMB 1P4BH 1JPGB 1ZT7A 1OW0C 2NNAA 5DJ6B 4EN3C 1Q9OA 5IVXB 1P7QA 4C56B 1NDMB 1RUQL 2NXYB 1JRHI 1H8NA 1MEXL 5CSZA 2X4PA 3GRWL 3QUZD 3BGMA 4P46D 4YHML 3NFPA 4Q2ZA 1D9KD 5BJTB 1J5OL 1AY1H 2VSCA 3D85B 4P2QA 1D6EA 3RWGB 1W2KT 4OM1L 4FQXA 1JZ8A 1BFOA 2XXCB 3O8XA 1RZFL 4W6YB 2JK5B 1KNOB 2ADJA 4MX7B 1IL1B 5CJOH 4JKPL 4ZNEA 3MOAL 3MFFB 5KSVA 1X5IA 5EZIL 3IJSB 1T4KA 2BHUA 2Z92B 4LRNL 1TIUA 3CSYA 4DN3H 3LKPA 4M43H 4PJEA 4JFXA 5MEOA 3SHSA 4LPUA 2Y9RT 3MLXH 2P5WE 2YUXA 2CIKA 3RWJA 1U0QA 5HYIA 2ZCHL 2CRIA 4HF5L 5ISZE 1X7QA 4X7SL 1KT2B 2VISA 4EN3B 4JZNA 3BUYB 4OZGB 3ULVE 4Z5RA 2R39A 4JN1H 5EIVA 3TNMB 4Z7VF 4LBEB 1A3QA 4RWYL 4XCNB 3ZKQD 2DTSA 2XFXA 4ODTL 5I8OH 4UT6H 3UJIL 1WZLA 3F7QA 3FQWA 4PJIF 1T21A 2VAJA 2YD7A 4HH9B 5F1NA 2R1WB 2AXGB 4HK0B 4XMPL 5JTWA 4LSPL 1PKQA 2AGJL 1YQVL 5MERA 1CLOH 4XNMA 4N8PA 5I15L 5DRWA 5L0QC 2G2RB 5JOEA 4KQ4H 2HRPL 4RRPG 3TZVC 5ID1B 5I1JH 4BSJA 3ARFC 1U93A 3C6LC 3CFJB 1L4IA 1U3HD 2VDPH 5GXBB 1NLBL 2B8OT 1DBKH 4LLUA 4KI5C 5GRZA 2R1XA 2GYSA 5B4MD 2EKSA 1DUYA 3BGAA 5EU4B 4NQVB 3OB8A 3OPZL 1JE6A 4DN4L 3RVVD 4JR9L 3RA7L 3QA3B 5IGXL 4NKQB 3I9GH 1NBZA 5DT1L 5C0GA 2WLYA 4NKIH 3W2DL 3O6LL 5TPWL 2JJTA 3VXNB 1QVOA 4V1DA 4IRJD 5KSBB 4XP6H 4JRYB 1FSKB 1BLNB 4JRXD 2AK4E 4OZIE 3H9SA 1EGJA 2H2PC 2HFFA 3MLUL 1TZGH 4PJ7F 1CQYA 2YD5A 5HI4C 4KMQA 3SCMD 3H6JA 1GGIL 2OSLB 5L0QB 4S0SD 2PKDA 1BMGA 4FQXC 1MHCB 3O8XC 1SBSH 3TZVB 4QHUB 2OR8A 3VFVB 4NNXB 3ARFB 3C6LB 2CKNA 3CJJA 5FYLH 4PRIB 4PJCB 4KUZL 4F2MB 5LQBL 4MCZA 3EDDA 1Z3GL 3UX9B 5CD5C 3N1PC 1U8NB 4FP8H 1CR9H 4F7MB 3IU4L 3D69A 1JHTA 1YMMD 1C5BL 3QISA 5IBUG 4BH7B 1JWMB 1A4JA 5MEND 2HJKB 3F58H 3H7BA 1X4ZA 3QSKB 3P4OA 4PRPD 3HN3A 4FQ2L 4Y19B 2Q20A 2P47B 3SGDI 5JQ6H 2Z0BA 1EDQA 4OLWH 3MRRA 5CP3H 1ZT7B 2NNAB 3QXDA 1N3NA 1BWMA 1Q9OB 4Y0GA 1Q72L 3S9DB 5B3JF 4J2XA 1P7QB 1MAMH 5I76A 2UWEA 3BZ4A 4WJ5A 4XC3L 3V6FA 4PJDF 1MJJA 3OAUL 2JCCA 4QOKB 2X4PB 3HR6A 3CXDL 2EDWA 2VLJA 2B5IC 4W81A 4PJGA 3NFPB 4Q2ZB 3UZVB 5GS1C 3W9DA 1RSFA 4P2QB 1D6EB 4A6YA 4APQD 2G5BB 4DFHA 4WI6A 4FQXB 1BFOB 2VH5L 4UV4H 3O8XB 3B9KD 2ADJB 2V5MA 4UBDD 1UFUA 3MLVH 3FT2A 5KSVB 1T4KB 1B6DA 2YD9A 4BKLA 4OCMC 3VFGH 1F3DJ 3LKPB 2FHFA 4PJEB 1A7OH 4JFXB 5MEOB 3DXAE 2CIKB 1XR8A 4OTXH 1KB5A 1PW3A 4QHNA 5LWYH 1OTUC 1ZSDA 5DFVD 1X7QB 1G7MA 2I07A 4JO3H 5I18L 2F53A 3T4AA 1FYTA 1RUKH 3R1GL 4JZNB 5JPMA 2ZPKH 4ORZC 4DGIH 4J3SA 2VLLA 5CGYD 3HTLX 1A2YA 3DOSA 3NAAH 1MRFH 2KDGA 4LCYA 3THML 3UMTA 4CRPA 2XFXB 2JJTC 2B5IB 5E2WL 4L3EE 4X9HA 4OLYH 2EEBA 5GS1B 3FQWB 4OLEA 5HXMA 5F1NB 4O02H 3S6CA 3DX8A 1MF2H 3RVWD 1VERA 1OGAA 1J7VR 2AQ2A 1ZV5A 1P6FA 3GIZL 4LQFL 2DF3A 1QSFA 4WFHE 4HKZA 4X83A 4PS4H 3HLAB 5MERB 5JHDB 2WWKO 1GGCL 5DYOB 5E2JA 4ELME 4DWHA 4NCC2 3FFCD 4XNUH 1ED3A 5MEQA 1U93B 3VXTA 3BO8A 4OCWH 2NPLX 5F1KC 5AD0B 2A6IA 3CLFH 5IM7B 3OXRA 2UZIL 1SM3H 3MLPA 5DSCA 4LLUB 4XP5H 4Z7WF 2I25N 2QQQA 3H3KA 2R1XB 4NP4H 5HVWA 2EKSB 4CW1B 1DUYB 1CDUA 3CK0L 5CZVL 5DZNA 1NUGA 3GMMA 3LOWA 1A6PA 3K81A 5BV7H 4EIGB 1EMTL 2C7UA 5E1HB 2OYPA 5DEZA 1IT9H 1NBZB 5C0GB 4OT1L 1FH5L 3S97C 4HEPG 2AEIT 5HHVH 1T66C 3OAYK 3PV6A 4ODVH 5KS9F 3WFDH 1EO7A 3KAAA 4XPHH 5DJ0B 5ENWA 5I1LB 5JR1H 1J0KA 1AGEA 3H9SB 1OARL 2V9TA 5J9PA 5MP6L 5EC1A 3O3DA 4RZCA 2RIKA 1EJOH 1GPOL 3GKWH 3C2AH 2DQEH 1RJZA 4U6VH 4S1DD 1KIQA 3MYJA 5KVDL 3SE3A 4MCZB 2FECL 5EOCJ 3BQUD 4Z7VA 1NLDL 5GGTL 3MRGA 1JHTB 1YECL 2WWMC 4NCC1 1T1XA 4M62L 4IOIA 1A4JB 4K8RC 2Y4SA 3H7BB 3UYPA 4HCRA 3P4OB 1DQQA 1NSNH 4KHXL 3IFNH 2A0LD 1HNGA 2VLKB 3P0VL 5E8PA 3QDMA 3NIDF 1N6UA 4ZAKA 1HHIA 2XZQH 3CVIL 5C08A 1KLUA 2W60A 4XP4H 3QXDB 1AQKL 4UV7L 3F8UB 4TYUA 4K9EH 2UWEB 5HYQA 3BZ4B 4WJ5B 4YBQC 3V6FB 4YK4C 1MJJB 2JCCB 1S9YA 2D0FA 2HYMA 1BJ8A 5BZDB 2VLJB 1EEYA 3VWJD 4PJGB 1INDH 5I1HL 3NCMA 4NBYB 1KLGB 3NH7H 1IC7H 3W9DB 5I0DA 3GMPA 3BDBA 1SHMA 3MSPA 1UKTA 1J8HE 5D1XB 3D9AH 1TVBA 4A6YB 1TTFA 5B39A 1LGVA 4XBGA 1UYWL 4W6XB 3K74B 4UILL 1T5XA 3RWDB 3QQNA 5GZOD 3QXTA 2QHLA 4HIJA 4WV1B 5FYKL 1EBPA 1A7QL 2HFGL 1UT9A 4NKMA 4M3JA 1RUPH 4O9HH 4OCLC 2AJYH 4UU9A 2BVUA 1XR8B 1GYAA 3EFFA 1FYHB 3BRDA 3MLTB 4QHKI 3KJ6L 4QHNB 3RJDA 2NCMA 1UVQA 2ID5A 2APFA 1BAFL 1G7MB 1NC4D 4PRAB 2I07B 2NY3C 1FP5A 4X8XA 4PJ7A 3ZKMC 5JPMB 1MCFA 4QXUL 1DVFC 3D25A 1CICA 3HI6L 2VLLB 1EZVX 1INQB 3BH9B 4HJ0C 4YH6A 1A2YB 2VDOL 4L3CA 4YK4B 4LCYB 5J11C 4OUOA 2DBLL 1HKLH 1ZTXH 3EZJB 1Z6JT 2DLGA 4WENB 3QYCA 5E9DE 4DUXA 4LHQB 5JIKA 5CSBA 3U1SL 4YXHH 1CFVL 1CI5A 2NX5D 3UO1L 4G8IA 3MRFA 4M5YH 2IMNA 1QSFB 4HKZB 3OKNA 4S1SL 5B22A 2COQA 4FQHB 2H41A 3JSSA 4YEEA 1NKRA 3TT3L 4LCWD 1ED3B 1K3ZA 1H8SA 2EYTA 1S9WA 3BO8B 3VXTB 3SE3C 3U7WH 2A6IB 4FQIL 4Z8FL 3OXRB 2BXZA 1FC1A 2CDFA 5DSCB 3HUJA 4PJDA 3V7MA 4LHUG 2IQAA 5DD5H 1ZMYA 3V5DA 3KPRA 5IIEA 1SY6A 4Q6IA 4HW6A 5DQJB 2NY3B 3ROLA 3DSFL 5L88H 3IDIA 3GI8H 4M6NL 5C6TL 1DVFB 3WFZA 2C7UB 3PGFH 2YD8A 4ZAKC 4Z7QF 4QXTA 2HT3D 4WO4D 3U82B 2ADFL 4ONHA 3S35H 5JXAH 1QNZH 3JV0A 1FAKT 4HS3A 5F7EL 3PV6B 3JWNC 1QFWM 5ENWB 1WBXA 1AGEB 1TENA 4YHOL 4YJZL 5H35A 4JRWA 5K9KB 3VG0L 1FNGA 2O26U 2IBBA 1YEIL 3O3DB 4RZCB 2ED9A 4CKVX 4PJAA 2RCSL 2BFVH 4NQEA 2DYPA 1U9KA 2XZAL 5SWZE 1E4WL 1TNNA 1RJZB 1NAMH 2XQBL 5T1MA 3SOBL 4ZFGL 1WZMA 3QDHA 5D7IF 4M9PA 4X4ZA 3B3IA 4YDIL 3BGFC 4Z7VB 3QHTC 3QO0A 3WFEH 3MRGB 2NW3A 4U49A 3PQYA 1T1XB 4U1IA 5EC2A 4IOIB 1CIDA 1QRKA 2ITCB 3NA9L 1DQQB 1EAJA 4P4KA 4DGVL 5E8PB 1EHNA 4R2GD 3QDMB 4H26A 4ZAKB 1HHIB 4EEEA 5C08B 1KLUB 1YEDA 1IAMA 1ADQL 3PDOB 3VXUE 1P6AB 1K8IA 1PKOA 4XPAL 1CICC 1X5AA 5SV4A 5FYJH 5HYQB 4YEFA 1QLEL 4OGXL 4RAHA 3S3JA 2X4SB 4NT6A 3L3HA 5HDBF 4MZ3A 1L7IH 2HLAA 1D5IL 1S78C 1OP3H 1JGEB 1H5BA 1MREL 1PG7W 5EA0H 3VFNB 2R0WH 1TVBB 5B39B 4Z7WA 4L4VA 3T3PF 4JQIL 4XBGB 3C60A 1HSBA 3NCBB 1T5XB 3F5WA 1UM5H 2FRGP 4U1MA 4NM4L 4HIJB 2NR6C 2FIKA 3BGFB 2BNQB 3P4NA 3I50H 4UT9H 5L9DL 5IMOA 4MZ2A 4UU9B 2E6JA 1KCLA 5C0IA 3EFFB 1IGIH 3O2DL 1G7PB 5KG9A 2XZZA 5KS9A 3UPCA 3ELAT 1BECA 2XYCA 5DVLA 1UVQB 2LVEA 1R24A 2QADD 3PV7A 5C09B 1F97A 1QSEE 5HHMB 5D7KD 4P2QD 1R5VB 3ROOB 2ARJB 4AYFA 4UIMA 3BZDA 3D25B 1CICB 3O8XD 3VXMD 3L6FB 2QQLL 3O41A 4NWTL 2KZ1B 1YEFH 4L3CB 5GJTL 2EDTA 4UB0H 2X89D 2VC2L 1WBZA 3NCEB 5EPMB 1FLTX 3TC9A 1YNLH 3VJ6B 3E8UL 1S7UA 1VEPA 5DK3A 2PTUA 3MRFB 2DMCA 3OKNB 4K3JL 4J7RA 3GGWA 1CCZA 2H1PH 4LSQH 3PP3H 4Z77A 5C9KA 1WZ1L 4M7KH 4Z0BL 3R8BB 2EYTB 1S9WB 3B9VA 4U1KA 4TVPH 2CDFB 2GTZA 3HUJB 5IMLB 1JNLH 2V5TA 2IQAB 4Q6YA 3IDUA 2D03L 1JNJA 3V5DB 1TQCB 2B4CC 2MFNA 3ROLB 4S1QH 5DLML 3S96B 4KHTL 3IDIB 4X5XA 4EI5B 3GNMH 2DQFA 4P4KC 2DI8A 2R2BA 4TSAL 4GQ9H 4LPCA 2IWGA 4X7FC 3KYKH 4YWGH 2PXYA 3L3GA 1Z9MA 3UZQA 4ONHB 1T7WA 1MCCA 4HS3B 2VITA 4TRPL 5DC0A 2XZCH 3O3AA 2CK2A 5JIHA 4GG6A 2YRZA 2IPTH 3MV8A 3TJHD 1WBXB 2Y6SC 2Q3ZA 3HMXA 4DTGH 1JHLH 3J7HA 1FNGB 3H3PL 3F7RA 2NYYD 3H42H 4HC1L 4LL9A 5C0AA 3RJQB 1OTUD 4PJAB 1H5BC 3NZHL 4BSVA 4NQEB 2DYPB 5TF1H 1LILA 3U4BL 3GK8H 2GT9A 4OFYA 5JA9A 3KPOA 3C60C 3Q2CA 1DZBA 4JY4A 5T1MB 1TQBC 2J8UF 1A6WL 1LNUA 4HGMA 4QY8A 3EYUL 3NCYS 4TNVF 2GITB 2XIDA 3B3IB 2VZUA 4LKXA 4DKFH 1XR9A 4NGHL 3QO0B 3IDMA 4MMZC 3B2VH 1P84K 3PQYB 4GH7B 4V1DD 3MC0A 4U1IB 3T0WA 3WSQL 1KCUL 1B4JH 2WBJD 2JELH 4P4KB 1F3JA 1QYGH 5EU7C 4H26B 1I7ZA 4OZHE 4LOUC 1YEDB 4OQ1A 2YPLD 4B53A 3BMVA 1XCQA 3MRBB 3MRJA 4AEIL 2IC2A 4H8WL 4JO2H 3QP3A 2IFGA 4NT6B 3L3HB 1WK0A 2HLAB 3A6BL 5D1QA 2PUQT 4HWBH 5TJWK 2ZSVA 3ILQC 3VGEA 2ZOLA 4Z7NF 4Z7WB 5BMFH 2D7TL 1GGBL 3C60B 5AG8A 2WINA 1I1RA 3MUZ1 1HSBB 1OCWL 1TQBB 1YN7A 2RR3A 2MOVA 4Z6AT 4U1MB 4KJWD 5C3TA 4QWWC 4NZRL 2FIKB 3OAZH 5DHXB 1S7RA 3TPKA 2A77H 1OLZA 5C9JA 5IMOB 4FFZH 4G6JL 4GS7C 5CINH 4YHZH 5C0IB 5KG9B 3CSPA 4LIQE 5ITFB 1X5YA 3PWPD 2P24A 1R24B 2OZ4L 2ZUUA 1RD6A 3CPLA 4NOBA 4P9HC 3PL6A 3RAJL 5BO1H 1RK1B 2AXHA 1TVHA 1DUZA 2YD1A 5I2IA 2YKLL 1I3VA 3M8OL 3N9GL 2CDGA 3O41B 3VH8G 4ZFOA 3STZB 1W0WB 5EDXA 4HUUA 5LBSH 2PXYC 1CDGA 1WBZB 2Y1VA 5HDOA 3T2QA 4ETYA 3GSWA 4CDGC 1HK6A 4WFFE 3VFSA 2I26N 2K9UA 1WSST 4JHZA 2YMXH 3UP1A 1OL0A 4OBSA 4XWOC 1X6LA 5F89A 4QCIA 1KC5L 5I1GH 5T33H 3PHSA 3ZE2F 4TSCL 4WDIA 1A1NA 3GGWB 3QIUC 1FIGL 3BKCH 3VFWA 5D4QA 4Z77B 2FEEI 5IBUB 1DFBL 3IJYA 2F53D 3QFJE 5T5NG 1FYTD 2BMKA 4BQ8A 5GS3A 3ARDC 1AHWA 1YPZE 5ALCL 3MRIA 2VE6A 5J13C 4FZEH 4GS7B 4FMKA 1GGUA 1MELA 3HA0A 3X12A 2GTZB 1ZLVH 4D9RD 5IVZA 4HK3N 2YRLA 1MCHA 3ZDYE 4TSBH 4TNWF 1OWWA 3MREB 3CFEA 4X5XB 1OGAD 1AKJA 1BHGA 1QFUH 2R2BB 1MAJA 3BXNA 4PJ9B 4MD4A 4K2UH 5GPRA 3B4NA 1G9MH 1UM4H 2ESVB 4QRPD 3WV0A 2X4RB 2PXYB 3L3GB 1GC1L 3VXSA 1E6JL 1OAKL 5IUSA 2VITB 4QGTA 1FAIH 1U58A 4K7FA 5HHXH 4GG6B 3MV8B 5FECB 3SN6N 3L3KA 4CDHA 1MAKA 3VA2C 3OL2A 4I9WD 5D1QC 3QIUB 4YDVA 4BSVB 1QFOA 3HC0A 4ALAL 3OR6A 4KK9C 3KPOB 3P9MA 4U1HA 25C8L 3MA7A 4OCYH 1NBVL 2NY1C 2IADA 5FYKU 3X11A 3MA9H 4JY4B 3R0MA 3VRIA 1LNUB 1VPOL 2YWZA 3ARDB 2PTVA 2YXMA 3CFKA 4GOSA 1WUNT 4WEMB 5IEKB 3S4SG 3IDMB 5HGAA 3CDGB 3EDKA 1YEEL 4PB9L 35C8H 1F3JB 3JTSA 5GGVH 4OF6A 4Y4HD 3GBNL 3PL6C 1DQLH 1DTUA 2HJLB 2A74A 2V17H 1LP9E 4LLQB 5JDJA 4ZS7L 4X6CB 1XCQB 5HYJA 3MRJB 2V2WA 4F3FA 2VIRA 1FVEA 4GLRH 1LO0L 4URTB 1GOHA 4JREC 4UTBH 5D1QB 1NC2B 1VDGA 3CH1A 2ZSVB 3WIHL 1JZ5A 1RUQH 2GAZB 3BKML 2ZOLB 4DK6A 4M1GL 2MPAL 5A1AA 5EU3A 1K4CA 2F54A 4R97B 5CILL 1CLZL 2NY1B 2WINB 1NGPL 1YN7B 3QIWA 4LHUA 2ZCLL 3VFUA 2EC9U 3TCLA 1J5OH 5D1ZD 5JLZB 4NNPH 4QKXB 5C08D 5D9SA 3VGFA 1IQDB 3NIFF 1HILA 4WHDA 2BVQA 5JOFA 4WWKA 4OM1H 2PYFB 5C9JB 4N0CC 1AHWC 5C0BE 3V5HA 1RIHH 1JGUL 4E41E 2QSQA 4OJFL 2P4AB 5EZIH 1MLCA 4XMLL 3ARGD 5E08H 3EIFA 2X6MA 3B5TA 5FF6A 4LRNH 2ZG1A 2P24B 4HGWA 2VZ1A 3CPLB 3PL6B 1N6VA 1MJUL 4MDIA 2H26A 1DUZB 3IYLW 1NFKA 3SKMA 4DAGH 1BD2B 3GSXA 5I2IB 3U46A 2CDGB 3NVQA 3ZDZF 2ZCHH 3MCKB 3SJVA 4ZFOB 3KS0H 1PZ5B 3UTSA 2J8UA 4X7SH 1S7SB 3GSWB 3VFSB 1NGQL 2YD6A 3D18A 4JREB 1LDSA 1S5HB 4BH8A 3MV9E 2XKNA 1BVZA 1QOKA 2Z8WC 4Y2DA 1C7SA 1YEGH 4HZAA 2NY7H 4QCIB 4WI8A 4JFEE 4RWYH 2P42B 5J6GA 4WDIB 4ODTH 2VR4A 4X4XA 3UJIH 3TNNA 2FGWL 3C5ZD 3VFWB 2EDRA 1B9ZA 4OLZH 1GIGL 5L6YL 3C9NB 3IJYB 5HHMD 4PTUA 3P4MA 2VQUA 2BMKB 3GMRA 3SKJL 2IH1A 1WITA 4OLVH 1AHWB 4LSPH 3U4AA 2YPVL 1LO4L 1YQVH 2VE6B 3R4DA 1P2CA 5T5NF 1JMZA 4KI1A 5I15H 3X12B 3KXFD 3FJTA 5IJVA 3VA6A 3TN0A 5IVZB 2DOCA 4ONGL 1UZ6E 2XWBA 1H3TA 3QUMA 4LASL 3DVIA 3CFEB 3KWWA 1EX0A 4X7CC 4WWID 1AKJB 2Y07L 3BJLA 2EXYC 3BXNB 2L7JA 4LEXL 3W5MA 5JW3L 1KBGL 1HE7A 1ERNA 2NR6D 3LH2H 4LNVA 3OXSA 5INCA 4TTGA 1E6OH 4WTZA 4K7PX 3QUYA 3KYOB 3OPZH 4JR9H 3RA7H 5IT2L 3L3KB 3IAPA 1L6ZA 3KPSA 4YHIA 1RZJC 3OBAA 5TPWH 5I0ZA 4FQ1L 4JFPB 4WI7A 2DQJH 2HA1A 2DM2A 3SGJC 3X3GH 4YDVB 3HC0B 3QG6B 4QEGA 3KPRD 1T7ZA 1L9MA 3OR6B 2B1HH 2K7PA 4RNRA 4U1HB 3S98A 1OTSD 1YYMH 2YUVA 2IADB 5ALBH 1OM3L 4X99B 1XH3A 4R7DB 3X11B 5B8CA 3QIWC 4QYOA 9CGTA 5KVGL 3U0PA 2IFFH 3CFKB 4Q58C 5ISZA 1MCNA 2VXQH 4EDWL 4X6DE 3VD5A 1FO0H 3EYQD 5HGAB 4WWKC 1T1YA 2EECA 4JG1L 1R5WA 2C1OA 3EJZC 4GSDH 3G5VA 4KUZH 4UNVA 4BM7A 2DQIL 3NACL 4KTDH 3TV3L 6CGTA 3QQ9C 5FHAL 3IU4H 2A74B 4NQED 1C5BH 2DYPD 1J87A 4LP4A 2OQJB 4XB7A 1T7YA 1IMHC 3I3DA 1JJUA 2V2WB 3OJ2C 4F3FB 2VIRB 4FQ2H 3VU2A 5AYUH 1EXUA 3A0OA 3UYRL 4HUWA 4BZ1H 1IAII 3WUWB 3BJ91 2AJXL 4JVWA 3CH1B 4NQCD 2JB6A 4MLSA 1UACH 3QPXH 4PG9A 4Y2DC 4L8CB 1DBAL 1K4CB 2F54B 5DFWH 5HVHC 3I6LE 4OF0A 3EHBC 4PJFF 4LHUB 5CHNA 4K3GA 2JJVA 2MQCA 2VXUL 3OHXB 3TCLB 4QO1A 2P8PB 4I77L 1A1OB 5HHNA 3KYNA 3WHXA 1HILB 1ZHBA 2BVQB 5JOFB 1CS6A 4WWKB 3U7YH 3V5HB 4OFKA 4X4ME 1J1XL 5JHLL 1U3ZA 3NIGE 2VZ3A 4Y4FD 1WQVT 1MLCB 3Q5OA 3TN0C 1RZ8A 1NGYA 4NSKA 5FF6B 4OV6F 4F57H 4HGWB 1IZKA 2G60L 5D2LE 4HS8L 5LXGL 2IANA 3J8F7 4JKMA 4N1HB 3SKMB 5KJRL 4N0UB 3GSXB 4L4VD 5HHOA 4CMHC 4P2RE 2AK4A 1CWVA 2SEBA 3C60D 3U46B 3SJVB 3UTSB 4KMTH 3L95B 5TDPA 5I18H 3MACH 1YEKH 3NFSH 4BH8B 3H9HA 3QUYC 4QRRE 5CEZH 5E56A 4HSQA 4Y2DB 4OSUL 5HVHB 1UG9A 5J6GB 1UA6L 5JORA 2DBJA 5FGBA 4J3UA 3I3EA 3MJ7A 1CZ8L 2YHGA 3CC5A 2GY5A 3MJ9A 3PXJA 4MJIB 4IS6B 5IQ9A 4HLZH 4PTUB 3P4MB 4P2CG 3T65A 2X9WA 4EI6A 3WHE1 3GMRB 5B8CC 2IH1B 1ZVYA 1N0LA 4LQFH 3GIZH 4LDEB 5CIPH 2VKXA 3HHRB 1Z9SA 1GGCH 1CXHA 5IJVB 4Q7DA 3TN0B 2HT2D 1RIVL 3HNVL 2XWJB 2XWBB 3ULVC 5CAYB 2R2HA 1PSKH 3QUMB 4Z7OE 5E4EB 4CMHB 1B4RA 4LDOB 4NPYB 4FG6D 3H0TA 3T0XA 5EUOE 2DDQH 4H0GA 4R7NB 2HTLD 1K6QL 3BP6B 3BH8A 3V4PL 3F62A 2R0ZL 4QWWD 2EDHA 1IGTA 1YC7A 3OXSB 1M7IA 5CZVH 4M8QA 4AMKL 5HGDA 1EMTH 4JHWH 3GSVA 3CLEH 3KPSB 4LQ1A 4YHIB 3UTTD 1FH5H 1S7TA 3LPGA 3IFPA 5K9JL 3QQ3A 1XGPB 3U79A 3DXAA 4RNRB 3TYGH 1XF1A 1RMFL 2P5WB 5IFAL 3HPLB 3RWIA 5C0DA 1XH3B 3KPTA 5GS0H 4YFEA 4QYOB 5HI3C 5MP6H 3U0PB 4XTRD 5ISZB 4TPRL 3DUUA 3TA3D 1CGSL 3FONB 1GPOH 3N50A 4M93C 5ACZA 1T1YB 1ZXQA 1T1WA 5HJ3A 4U1SA 4HG4K 1R5WB 3BYYA 3VH8A 4Q97A 3QRFM 4NIKB 3G5VB 1CQKA 2CKBA 2I60L 4RGNC 1FL6A 4XWOD 1I7TA 5C0AD 1A6AA 3PP3K 4JQVA 2EDBA 4M62H 4OFYD 4HBQA 3S36L 5C3LD 4TULL 3QDJD 2O5YL 5B38B 1TLKA 3RU8L 4QTHA 1OAUL 4KHXH 3QJHB 5C07D 1EGJL 3FB6A 5BS0E 1EXUB 4X6BA 4RAVA 1OAXH 4WU7A 3FZUD 5ILTH 4HUWB 2HKHL 4M48L 2OK0H 2FZ3A 4ELMA 2JB6B 4NZTL 5DD6A 3WO3B 5AG9A 5ADPL 4PG9B 1RJYB 4GBXD 1NMAL 5ANME 1QTYT 2VUOA 4HZLA 5FYLD 3MRHA 4OGAD 4IOFC 5FGBC 5I1HH 5CHNB 3NPZB 1KIUA 1CDCA 1HOCA 2AXJA 3IJHB 3DRQA 3WHXB 1MCOH 1HXMA 1ZHBB 2C3GA 4ERSL 5ICXA 4XCYA 3PWLB 4M93B 4R26H 3CIQA 1KB9K 3QG7L 1QACA 3HMWL 4RISL 3NZ8A 4UILH 1A3RL 4ZSOA 5DUPL 3CFBA 1BBJB 3BIKA 1RZ8B 3G6JE 2HFGH 2A38A 1CD8A 2PF6A 5E00A 1X3DA 4G8GA 4XWGH 5HHOB 1FORL 2AK4B 2SEBB 2NY1D 1A0QL 5CJXA 2EXWC 1BGXH 1ZGLA 2YA2A 4MXVE 2W07A 2GTWA 5CD3A 4U1NA 4PJXE 5TDPB 1HQ4A 2BERA 3NTCH 4R6UA 2H3NB 3ARPA 3H9HB 4P9ML 5A3ID 4QXUH 1ZEAH 2F5BL 2VDQL 3KNBA 5FDWB 1DSFL 3HI6H 3KR3H 2VDOH 4XAKE 5JORB 1DDHA 1TJHL 2HG5A 3GI9H 2DBLH 4Q74A 4JFZH 3S4SA 3NCCB 2EDNA 3LRSA 3MJ7B 4GRWH 3CC5B 5TDNA 5KOVC 5IQ9B 1A9EA 4LSUH 5I66A 4PGBB 3T65B 1BQLL 4EI6B 1U8IB 5DEFA 5EBGA 3UO1H 4K8RL 5F1IB 1MH5A 1KB5L 2JLLA 5EU6E 1N4XL 5I1IL 5K9OA 2VZTA 4U7KA 4GT7A 1JYWA 1V3KA 4OCSL 3SDXF 4I3SL 4GRLD 4KJPD 1KSRA 4BQCA 2O5XL 3GDBA 2DJSA 5FM8A 3H0TB 4UOJA 2EH8L 2VABA 4P5MB 1JTTA 4LPWA 4JDVB 3HKFA 4JQVC 3TO2A 1K3IA 3OAZK 3BH8B 1CFNA 3WD5L 4TTDC 1J8HA 1IGTB 1JNNL 1LE5A 1M7IB 4GMSL 2E7LA 4M8QB 5HGDB 5C6TH 3TYFB 3GSVB 2KPNA 1IEBA 3TFKC 4YAQB 3CFDA 2ADFH 4QHKJ 4PJFE 1S7TB 1Q0YH 5I6XC 5J89A 5F7LB 1MHHA 3IFPB 5F7EH 1VA9A 4JB9H 3QQ3B 3DXAB 2E6PA 1I9RL 3RWIB 5C0DB 3DARA 2AJSL 1AKJD 5C0EA 2DL9A 5DD1H 1U8HA 3DUUB 3DTXA 4D3CH 1YA5A 3VXSD 4C57C 1E4WH 2C4FU 3MRDA 1T1WB 5HJ3B 4U1SB 2XQBH 3VH8B 3NABL 3SOBH 4DQOH 1A7PH 4G3YH 4LSTH 2LAAA 2CKBB 2E7MA 1Q0XL 1FL6B 3DRTA 4YDIH 1FFNA 3UXFA 4DKEL 5JNYA 1I7TB 3OKEA 4L3EB 3REWA 1A6AB 3VI3E 1MCSA 4LSSL 5E9DA 4K07A 3L3JA 4B41A 3MRLA 2Y72A 4QTHB 3NA9H 5CJXC 4DGVH 4QXGL 1J88A 5E6YA 3FB6B 4X6BB 4RAVB 4WU7B 5FUZL 3N1GC 5IR1B 2ZJSL 2FZ3B 4ELMB 1ADQH 5I6XB 5LGKA 4BZ2L 5DD6B 4OI9A 4XPAH 4XHJD 2CUHA 3GSNB 4KXZH 4HWEL 4HZLB 4R4ND 1QLEH 1ZT1A 3MRHB 4OGXH 3S37X 5D7SH 1TTUA 4NJ9H 5BVJA 4KDVA 1HOCB 4B50A 3QNYA 1MREH 3U9PL 4V2BA 3G5XA 1HXMB 3RVXD 5ICXB 4XCYB 2MKLC 5HYJD 3T09A 3GKZA 2B0SL 3NZ8B 1RIUL 5F9JA 5FUOL 5BRZD 5F96L 1QPPA 2JIXA 4NM4H 3BIKB 4YZFF 4HWUA 4PLJD 2DI9A 4X98A 2Y36H 5TE4H 3LEYL 5E00B 2IH3A 2GKIA 1TNMA 1CE6B 3O2DH 1RZKH 3QIWD 2XQYK 5CZXC 2GTWB 5CD3B 4U1NB 2LU4A 2F8VA 4LLYA 1HIMH 5DGQA 1MHPL 1S9KC 3ARED 5SWZA 2E7LC 3KNBB 2QSTA 4FTVA 4P2OA 5D7JA 2AI0L 3C08H 2VC2H 3RNKA 1DDHB 2J1KA 4PJHE 4LLAA 4S1RL 1W0YT 3KPNA 3O3UN 2OXGA 3RX5A 4RX4A 3TO4A 4CVXA 1MJ7H 1PZUB 3E8UH 5TDNB 1V3JA 4GW1A 1A9EB 5D5MF 5I66B 1OPGH 3F7YA 4KJQD 5DEFB 1KXVC 4HUVA 2A9ML 4X80L 4EVNB 3SJVD 4K3JH 4JM2F 4KZDL 1CXLA 4WHTA 1Q1JL 5FKPA 4Z0BH 3VXUA 4M1CC 1BF8A 5FUCE 4GQPH 2Z31B 1A6TA 1HHJA 4Y2DD 1C5DA 3PDDA 1RZGA 3K1KC 5F7KC 4KV5F 1BBDL 5JZ7C 3EHBD 2VABB 1EK3A 4LLMA 3OR7A 4WFGD 3RFZC 1NCCL 5AZ2L 2R0LL 2D03H 4UDTA 4YO0A 1CFNB 1G1YA 1J8HB 2C9AA 1MWAB 1LE5B 2H32A 3W0WE 5DLMH 4NO3A 4TSAH 2R2EA 2VLRA 1IEBB 3V0WL 1NJ9A 3CFDB 1CK0L 3SE4A 3IB4A 1ZHNA 1KJ3L 4DZBA 4H88L 2WBKA 1FHGA 3CFCL 2DD8L 4WUUD 4HWZA 1JNHA 2CO6B 5LCVH 1PG7L 3H3PH 4MQXD 2NY5H 2BVOB 5GGRA 3KGRA 4HC1H 4NN7B 3PABB 1U8HB 1R3JA 3UAJD 3DTXB 3NZHH 4JVPA 3ECBA 5KANI 3MV01 4G80A 2WSKA 1ZA3B 2UYLA 3D3VE 2HVKA 2E8ZA 3MRDB 2LE9A 4C83A 2FEDD 4N90D 1A6WH 3QUYD 2ORBH 5IQ7L 3EYUH 1KELL 2AJ3B 1CL7L 2ZG2A 1YEJH 3KPSD 3DRTB 3OX8A 1YDPA 3F6IA 1FFNB 3L7FA 2FATL 4ZXBA 5JNYB 2OCFD 4NGHH 2AJVL 1FO0A 2PTTA 4TOYH 3REWB 2YC1A 1FGNL 5DDHA 5E9DB 1WGOA 3WSQH 3BD4A 1ZVHA 3L3JB 5GISH 1RZIA 2MTPA 4Y8AA 2NZ9C 4G7YH 4HEME 4LGPB 5HGGS 3QB7C 3MLWH 3BE1H 1BX2A 2VLMD 4RMTA 1U8KA 4QHLA 4NNYA 4OZFB 5C86A 2FSEA 3VMPA 5JW4N 5GRXG 4P2OC 5D7JC 4IJ3C 2DWEA 4H8WH 3C2SA 1ZT1B 3WIIH 3G6AB 1SJHA 3SDXA 4AEHL 1T5WA 4LPTA 3O4LE 3TO4C 3DBXB 4N0YL 2BSSA 4Y5XC 3QNYB 3RZWA 2IAMA 3GJFH 4IRZL 3G5XB 3MLZL 4KKBC 4KKAC 3MBXL 2D7TH 1PX4A 2R4SL 3MV11 2NY2C 3CX5K 3DECA 3KYMA 1H3PH 3UTPD 5IHZA 1W72B 2LTQC 1M1SA 4FZ8L 5SWSA 2JIXB 2O93L 3S35X 5C0NC 4OKDA 1C5CH 3BESR 4MJ4A 1BVLB 5K59F 5E6IA 3EO1A 4HUXA 1KIRB 5FYJD 2IH3B 4XH2A 4G6JH 5KVEL 3AM8A 2G5RA 3SQBA 1GAFH 1P4BL 4K23L 3DUHA 4IHOA 3TVMA 2JB5L 4ZNCD 3R8QA 3RY5A 2NY6C 1VFOA 4DVRL 5SWZB 4U7SA 2YKLH 4FMFA 4P2OB 5D7JB 1LEGA 4IJ3B 1WWWX 3FO9A 5D70L 3SE4C 5D2NE 4RGND 5T3XE 5IBLD 3QXUA 3KPNB 1QBLL 5HY9B 1AY1L 1WZKA 3TO4B 1DN2A 1T03H 4GW1B 4Y5XB 3WEXA 5D7LE 2IAND 1I7UA 2Q8AH 3F7YB 5HHOD 1HN1A 4HUVB 1WIUA 2IPKA 4ZUTA 4M6MH 3MJ6A 2LTQB 4R0LA 3KPLA 3WFBH 2K7QA 2LAGB 4WHTB 1KJMB 3RWHA 2HWZH 1BJMA 4M43L 4OZHA 1DFBH 3GB7A 2PCPA 3MCLH 4UOW0 5I74C 3KPPB 1N64L 4NO0B 3VXUB 3MLXL 4ENED 4MMXC 2XN9E 1QLRA 3IETA 4ZD3H 1A6TB 2FJHA 1S7VA 1XF4A 5ALCH 5BZWA 1RZGB 4R96B 1P84J 3QXAA 4ZXBC 3N1QC 5AAWA 4LLMB 3VD3A 5D71H 2E9WA 4UDTB 4YO0B 1L6XA 4HWNA 2H32B 4L29A 2NY6B 4ODWB 4AL8H 5EBWB 4J4PA 1AD0A 5F8RC 3PJSB 1AO7A 2R2EB 2EDOA 1NJ9B 1XGRB 3LQAC 4UT6L 1GC1H 4BK4A 3IDJB 1E6JH 1ZHNB 4OUUB 4LK4A 1OWRM 1WWBX 4DZBB 1IEAA 4AG4L 4HWZB 1HKFA 4YXKL 3TBWA 3W82A 1MVFA 1JNHB 3EYSH 1OD7A 4TVPD 5GGRB 4LU5H 2KH2B 1BJ1J 3ARBD 1ZA6A 1R3JB 5FGRA 2IAMC 4ALAH 1QSEB 3FT3A 3BKYH 4G80B 2QQKH 2UYLB 1ZT4A 4F8TA 2HVKB 1CGYA 4P9HL 4WW2B 3VG9B 25C8H 3HS0A 3RDTD 1NBVH 5I74B 3PIQA 4C83B 1FLRL 1VPOH 3MOBH 3SDYL 1XEDA 4QLRA 2BVPB 1DBKL 4ZXBB 3OX8B 3L7FB 3V52H 2PTTB 2GJ6D 4JCLA 3DX6A 3IKCA 2YC1B 5DDHB 3SGEH 1DBJL 3Q1SH 1ZLSH 4PB9H 1RZIB 1B0GA 5D5MA 3AM8C 3P73A 5CSGA 5KSUB 3HMXL 5DJAA 3BZEA 3VFTA 3I9GL 2B7DT 3DX7A 4F15C 4RIRB 1VKXA 1U8KB 4QHLB 2VN4A 1Q9LA 4JM2A 5F70A 1GL4B 1MY7A 2FSEB 4XP6L 4Z7UF 3QFJA 4ZS7H 5MHSD 3L7EB 2CMRH 2DWEB 3T08A 2YXFA 3MODL 1MFCH 1SJHB 1LO0H 1TZGL 2B39A 3QNXA 1X4XA 1T5WB 5KN5A 1J1OL 3FO1A 1IM3A 2BSSB 5DZLA 1TJGH 3S34H 3WIHH 1U8LA 1ZGLP 1SBSL 2W59A 3F65A 1NGXA 1NBQA 3CXHK 5CILH 1CLZH 4XXDA 5FYLL 1DCLA 3KYMB 4ZFFA 4GXUM 1NGPH 4MCYB 5I8EB 4R0LC 4KTYA 2ZCLH 3Q6GH 1FN4B 1PDKA 3TFKD 1T7VA 4FXGA 4PJ8B 3GSRA 4LLWA 4HUXB 3F58L 5SWQA 3V7AE 4XH2B 3UPRA 4F33A 5L2KA 5TFSL 1AGFA 4OJFH 1JVKA 3VWKD 1P9MA 4XCEA 4XMLH 3LEVH 4F9LA 4IHOB 4OLWL 4BELD 4F15B 5F88B 3RIFK 1MJUH 1MAML 2HTKD 4J4PC 5IB1B 1LEGB 2W91A 5DK0B 3FO9B 1E4JA 2VDLL 2ZKHL 5FYKE 2NTFA 1WVZA 3ARSA 1Y6MR 4ZDHA 3WEXB 2Z91A 1I7UB 5DEGA 4UV4L 4G8GD 3MV7A 4N9OB 3BD3A 1BEYH 3NMEA 4ZUTB 4R0LB 3KPLB 4C59B 1PJ9A 3RWHB 3L5WA 4OZHB 5T1LB 3GB7B 5L6YH 1OP5H 2PCPB 1D7FA 1A6VH 1E0OB 4KK5D 3SKJH 1QLRB 3IETB 2FJHB 1S7VB 1MI5D 4OTXL 5JPNB 4ZFOL 3D39D 2CLZA 3LEXA 2FECI 4GRWE 2Q76A 3PHQA 5HI5C 4LFHG 1FNAA 2XT1B 3CZJA 5IHLB 2ZPKL 4LASH 4DGIL 1K9TA 4L29B 5DO2C 1I8LC 2W38A 3EOAA 5CGTA 3S3SA 1AD0B 2Y07H 1MRFL 3CCHA 2IALA 1SYVB 5JW3H 4JM2C 1KBGH 1HNFA 4POZD 4LVHB 1J0ZA 4OCXL 5HD8C 2YK1H 5SX4H 2EYSA 3ULSA 1IEAB 3WIFA 1C1EH 1MF2L 4PGEA 2FBJH 4NQDD 4CVWA 3TBWB 1MOEA 3HCVA 5C0BA 3WNPA 4AH2A 1G7JA 2D9CA 4Y2OA 4JFFD 2HH0H 4PS4L 4E0RB 4FQ1H 2R0KH 1ZA6B 5CZXD 3ULUH 3FT3B 3VXRE 4XNUL 5F9WC 3HS0B 1MJ8L 3LPFA 5GGVY 3PIQB 1OM3H 5I16A 4ZO8A 3ZHDA 3CLFL 5KVGH 3I6GA 1DANU 1Z9LA 1SM3L 4P23D 4EDWH 4XP5L 4KVNL 5T3ZH 5ESAA 2FX9H 2DTMH 3EOBB 5CBAA 2AVGA 5A2IH 4NP4L 5F7WC 3IKCB 4JG1H 5BV7L 4H1LG 1B0GB 5D5MB 1P9MC 3P73B 3C5JB 1QFWH 1I3GH 5DJAB 4I1NB 3VFTB 3BZEB 1IT9L 4N8CH 1HSAA 2DQIH 3NACH 4ISVA 3DX7B 3O4OC 2XQYG 1VKXB 4FRWA 4JM2B 3ZZ1A 3EYOA 3QFJB 3WFDL 3ZTJG 4XPHL 5JR1L 3KLHC 2AEPL 1Y0LA 3ZKSD 1YPZB 4NYLA 4X6FA 5DHVA 5BW7C 3QNXB 5JZ7D 5KN5B 1WV7T 1NCAH 5IB5B 3FO1B 1EHAA 3GKWL 4I0CC 1NGZA 1IJ9A 3C2AL 3IS1X 4M6OH 1NGXB 4MS8D 5F9WB 5GS2D 3B9DA 4XXDB 1NDGA 3I75A 5GSRA 4ZFFB 3G5YA 5GGUA 3VXOB 1II4E 1P7HL 3OKOB 1GCFA 2BNRD 1KJ2A 3OZ9H 4LLWB 2GIYA 4Z0XB 5SWQB 2VDNL 4QRSA 1NSNL 3UPRB 5L2KB 1AGFB 2HFEA 1I7RA 4XCEB 2HT4C 2OMBA 2CO7B 5KANG 1RZJL 2G60H 2CRZA 3O4OB 5LXGH 2Q3AA 5I1AB 2P5EA 4K9EL 3EAKA 5KJRH 2DKMA 4BFGA 3F12A 3RI5F 1F4XL 3IS0X 4LPXA 1INDL 1MFAH 4XBPB 2JIXD 4PREA 3NH7L 1HH9A 4X6DA 3VE0A 5HVGB 4ZDHB 2MCPH 1FDLL 3PE9A 4G9FA 5DEGB 3VI4F 1NFDF 1C16A 1SEBA 3U2SA 5J1SC 1QEWA 1UA6H 1T1ZA 2ZG3A 4PJBE 2FD6H 1B6UA 2VKWA 3L5WB 2GCYA 1WFNA 3QH3A 4O9HL 3QIBA 3FB5A 4FTVD 2UUDH 4UIKH 3GFUA 4O00A 2PW2A 2GI7A 3SBWA 1X5JA 4XVUC 5F7DB 2AP2A 2CLZB 3LEXB 3LN5A 3RKDD 1RIVH 2Q76B 2W92A 4RX4D 3PHQB 2ED7A 5GGRY 3D2UB 4AIZA 1E4XH 4KKBD 4GAJH 3EOAB 5C0FA 3DYPA 3K8KA 2NY2D 4B5EA 3MGTA 4QTIH 3CCHB 1I3RA 1BQUA 1HKLL 3OKDA 1ZTXL 2IALB 3V4PH 1QR1A 3QCVH 1MFBL 2EYSB 3ULSB 3QJFA 3WIFB 5IESL 4PGEB 4AMKH 3HCVB 5C0BB 5HYEA 1MQ8A 1G7JB 4X4MA 2WANA 4E41B 4M5YL 4L4TA 3B2UC 4MDJA 1A7NH 2P44B 4XT1C 1QO3A 3VGBA 2C3VA 1ZKAA 2FJFA 5K9JH 3E2HC 5DVOA 4JO1L 3HE7C 3MLRH 1DN0A 5J8OA 3P9LA 5IFAH 1P4LA 3QUML 4P2RA 5I16B 5ACLA 5DD3L 2AQ3A 2F15A 5DHYA 1I9IL 2B1AH 3I6GB 4JE4B 3TESA 2VLRD 5IVXF 3FB8A 4LEOA 4TPRH 1S3KL 5DJ8B 2EDKA 3ZE0E 1D6VL 5ESAB 5DD5L 2ENYA 3ZT6A 4PFEA 2VAAA 5CBAB 1H8OA 1JTOA 2CIIA 4OGYH 1MPAH 3MV9B 5E5RB 4QRRA 5L88L 5F6IC 1GZPA 5DGRA 2I60H 4JFEB 2XA8H 1LD9B 3MNWA 1G9NC 4I3GA 5IMMA 1I1YA 1HSAB 2EZ0D 4ISVB 3ABZA 2OTUB 3K4DA 1A6UH 3S35L 1QNZL 3EYOB 2O5YH 3QHFL 3S5LG 3OGOE 4JRXE 3RU8H 1OAUH 1Y0LB 2W9DL 4MNQA 1F3DH 4NYLB 1EGJH 4X6FB 5DHVB 5ITBH 4HXAH 5DWUH 3RUGE 4NZTH 1NGZB 3LDBC 5ADPH 3E2HB 4U6HA 1NMAH 3HE7B 4GFTB 1LO2H 5DZOA 1JV5A 2YSSA 1NAML 4JDZA 3ULVL 1NDGB 3I75B 5GSRB 4R3SA 5FXCH 3G5YB 5GGUB 3JWOC 4OZGF 4FS0A 3WFEL 1YMME 1FZOA 1KJ2B 3T1FB 3QIBC 5JDSB 5E8EA 5MENE 2R69L 3HMWH 1TJIL 4PRPE 1FNSL 5KBNC 5CMAB 4QRSB 4Y7MA 3DV4A 5F6IB 3SBWC 4J3WA 2HFEB 1MQKL 3TIDA 1I7RB 4DCQA 1HHKA 4DGYL 4NRYA 5HTSA 1IM9A 5IB3A 3AC0A 5A40E 2E8YA 3O6FA 3QDGA 1J0HA 1MVUB 2BY0A 2IAMD 1FFPB 1YY8A 2P5EB 1XT5A 4HK3J 4P3DB 5EIQA 1FORH 5EG6C 1A0QH 3BYTA 3ULUF 1FGVH 4KK6C 5EBLA 4NWUH 2L0DA 3V8OA 2X1QA 5SWSD 2Y23A 4PREB 4X6DB 4WHYG 1OVZA 2YZ8A 1RV6X 3ETBF 5I71C 3VE0B 3UJTL 5EA0L 3MRQA 2R0WL 4A6YH 3GO1L 3JV6A 1AXIB 3LDBB 3GMNA 4HKXA 4L9DA 4G9FB 4HD9A 5E6ID 1F4YH 4HJGA 2L7UA 1SEBB 2H45A 1XZ0A 1QEWB 1IFHL 1UXSB 1T1ZB 3U6RA 3TVMD 1OTTC 3RNQB 4O2FB 1YJDC 4G43A 5CKAA 4UT9L 4MD5A 1BQLH 3QH3B 1JWSA 3QIBB 1QA9B 3FB5B 3L5JA 4K8RH 2X42A 2PW2B 1HQRA 1CFSA 5BS0A 1N4XH 1EEZA 4AM0B 4HG4J 5KSBF 2D4DA 1DJSA 3LN5B 1KCVH 1TZHA 3KVQA 3GJFK 5LGHH 2YN3A 4OCSH 5CEZD 5ANMA 4I3SH 4AIZB 1A1MA 2QV2A 5C0FB 4OIAA 3FFDA 5K33A 1RI8A 5DF0A 4F80A 4W68A 5EUKA 3ARUA 1EFXA 3OKDB 3RVTD 1YNLL 1QR1B 5F97E 2Z9TA 5I71B 4HJJH 3HG1D 4PJCF 4GMSH 3QJFB 5EOCH 3MRKA 4C4KO 4UQ2A 3NCYP 4KI5F 3HE6D 2RBLA 3E0GA 4MDJB 2H1PL 3K80A 1C12B 1QO3B 3G6JA 4LSQL 4XB8A 1ZVSA 2C3VB 2FJFB 1VENA 3BN3B 3DMMD 3FFCE 1CXFA 4PJ5A 1CD0A 4F58H 1OAZL 1DN0B 3LKSA 3U0TA 4ZG1A 3P9LB 4POYA 3WKNA 1I9RH 5E2TL 2R56H 4P2RB 4J4PD 1OSZA 4U6YA 4L8DA 1FZMA 1JF1A 4TVPL 1AO7D 1KCSL 4XHQA 3FB8B 4LEOB 1UENA 1J0YA 1KB9J 3MO1A 1JNLL 2EE6A 1VSCA 2VAAB 2LU7A 3MRNA 1P7KA 2CIIB 1OHQA 2PR4H 4QRRB 3TGXA 3NABH 2CUIA 1GZPB 3STBA 5BVPL 1Q0XH 4YBLC 1VEOA 4GQ9L 2JJUA 4DKEH 4XVJH 5IMMB 1I1YB 3O6FC 4YWGL 5E1AA 2XI9A 4LSSH 2HMID 2EDDA 4FFVD 5JOPE 2BVTA 2BSED 5FHBH 2C1PA 5GS0D 2P7TB 4G8FA 1BIHA 1JHLL 4MNQB 1MCKA 4QXGH 4PJEF 2EH7L 3H42L 1N26A 4XP9H 5TF1L 4GAFB 2P8LB 4GW4A 3GK8L 4BZ2H 3MZTA 5IK3A 3X14B 3L3IA 4U0QB 4U6HB 4PLKC 2BHZA 4ZUVA 1JV5B 4HWEH 1TPXC 5ICYA 2XA3A 2VERN 1IC5L 3LKNA 4R3SB 2XG4A 3WO4C 4AQOA