2LAFA

Nmr solution structure of the n-terminal domain of the e. coli lipoprotein bamc
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
b'GDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNVISAGLDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein 34
publication title Structure of the BamC Two-Domain Protein Obtained by Rosetta with a Limited NMR Data Set.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2011-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.50 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2lafA00
2YH6A 3TGOC 2LAFA 5EKQC
chains in the Genus database with same CATH superfamily
1BTVA 3IE5A 4QDFB 3R6PA 2LEQA 4JHIA 1Z94A 3WG8A 1XN5A 3GL2A 1VJHA 3UQHA 2N4BA 3K3KA 3KL1A 1EM2A 2E3SA 2Z9ZA 4N0GC 4REIA 4N47A 2LE1A 4MAPA 1TW0A 3QSZA 4XRWA 1XN6A 2N4AA 1FM4A 4DSBA 2L8OA 3CNWA 2YH6A 3W9RA 4XRTA 3RT0C 3QN1A 2NN5A 3TFZA 3NQNA 2EJXA 5E46A 4QCKA 3RD6A 3IJTA 4A86A 5JNNA 3TGOC 3HO1A 3UJLA 2FLHA 2Q3QA 2KCZA 3KAYA 4WVOA 5I9JA 4A8GA 3F08A 3GTEA 3H3QA 3Q63A 4A80A 3GOBA 1E09A 2NS9A 5AMWA 3NMPA 4BK7A 4QIPA 4JHGA 3P0LA 5E4MA 1X53A 4MA6A 4Y31A 4A8UA 2M47A 3TVRA 3NEGA 4NCAA 3Q64A 1XDFA 3ZVUA 4IH0A 2VQ5A 4M9BA 2ZYLA 2QIMA 3JRQB 2R55A 3P9VA 3KDHA 5I8FA 4JHHA 3DLHA 4E6FA 3TL1A 4IH2A 2E3QA 4LA7A 4M9WA 2LF2A 4BKCA 3HM9A 2KF2A 3C0VA 3HXMA 2FFSA 3H3SA 3NJ0A 4IGXA 3NMNA 3NJOA 2LUZA 2RESA 5EKQC 2LGHA 1UW5A 3PU2A 1TXCA 2E3PA 4A83A 4BKDA 2KTEA 2VNEA 4QDCA 1LN3A 1QMRA 3H3RA 4B9RA 3W9KA 2QPVA 1IFVA 4Q0KA 2BK0A 2WQLA 3KAZA 4REJA 4Z3LA 4BK6A 2GKDA 2E3OA 4PSBA 3NS2A 1T17A 2I9YA 4N41A 3HVRA 2LAKA 4IGWA 4REHA 3F73A 4FPWA 3HJFA 1XUVA 4A87A 3GKEA 4DS8A 2REZA 4QDDA 2LIOA 3NMTA 2L9PA 2A1LA 2K5GA 2PCSA 3TVQA 2L65A 4N3EA 1XFSA 4QDFA 4A81A 4IGYA 4LGAA 3FO5A 3DLBA 2E3MA 3NI8A 4RYVA 3KDIA 3NEFA 4BTZA 2E3RA 1ZXFA 2LPXA 4IGVA 3RT2A 4KPYA 3KB0A 4N76A 1LN1A 3OQUA 2K7HA 2KEWA 3GB4A 2Z9YA 3GGNA 3KB3A 3NJ1A 1KCMA 3OJIA 5E4BA 2MOUA 4DSCA 3GTSA 4GY9A 4JDLA 2IL5A 4A8VA 4MNSA 3P51A 2LCGA 1LN2A 3KDJA 3Q6AA 1LLTA 3H3TA 4A85A 3GL0A 3OTLA 2D4RA 3NMHA 3K90A 4C9CA 3OH8A 2LAFA 2LDKA 4JHYA 4LGBA 5JO2A 4IHRA 3E85A 1BV1A 2RERA 5E4DA 2E3NA 4JDAA 1ICXA 4NCBA 3HK2A 4A88A 2PSOA 2M89A 3KLXA 1B6FA 1JSSA 4R7KA 5JO1A 1T27A 3NMVA 4C9IA 1H2OA 1FSKA 3NR4A 4OICA 4C94A 3PUTA 3JRSA 4A84A 3UIDA 4LG5A 5BRLA 5C9YA 3ELIA
chains in the Genus database with same CATH topology
1BTVA 3IE5A 4QDFB 3R6PA 2LEQA 4JHIA 1Z94A 3WG8A 1XN5A 3GL2A 1VJHA 3UQHA 2N4BA 3K3KA 3KL1A 1EM2A 2E3SA 2Z9ZA 4N0GC 4REIA 4N47A 2LE1A 4MAPA 1TW0A 3QSZA 4XRWA 1XN6A 2N4AA 1FM4A 4DSBA 2L8OA 3CNWA 2YH6A 3W9RA 4XRTA 3RT0C 3QN1A 2NN5A 3TFZA 3NQNA 2EJXA 5E46A 4QCKA 3RD6A 3IJTA 4A86A 5JNNA 3TGOC 3HO1A 3UJLA 2FLHA 2Q3QA 2KCZA 3KAYA 4WVOA 5I9JA 4A8GA 3F08A 3GTEA 3H3QA 3Q63A 4A80A 3GOBA 1E09A 2NS9A 5AMWA 3NMPA 4BK7A 4QIPA 4JHGA 3P0LA 5E4MA 1X53A 4MA6A 4Y31A 4A8UA 2M47A 3TVRA 3NEGA 4NCAA 3Q64A 1XDFA 3ZVUA 4IH0A 2VQ5A 4M9BA 2ZYLA 2QIMA 3JRQB 2R55A 3P9VA 3KDHA 5I8FA 4JHHA 3DLHA 4E6FA 3TL1A 4IH2A 2E3QA 4LA7A 4M9WA 2LF2A 4BKCA 3HM9A 2KF2A 3C0VA 3HXMA 2FFSA 3H3SA 3NJ0A 4IGXA 3NMNA 3NJOA 2LUZA 2RESA 5EKQC 2LGHA 1UW5A 3PU2A 1TXCA 2E3PA 4A83A 4BKDA 2KTEA 2VNEA 4QDCA 1LN3A 1QMRA 3H3RA 4B9RA 3W9KA 2QPVA 1IFVA 4Q0KA 2BK0A 2WQLA 3KAZA 4REJA 4Z3LA 4BK6A 2GKDA 2E3OA 4PSBA 3NS2A 1T17A 2I9YA 4N41A 3HVRA 2LAKA 4IGWA 4REHA 3F73A 4FPWA 3HJFA 1XUVA 4A87A 3GKEA 4DS8A 2REZA 4QDDA 2LIOA 3NMTA 2L9PA 2A1LA 2K5GA 2PCSA 3TVQA 2L65A 4N3EA 1XFSA 4QDFA 4A81A 4IGYA 4LGAA 3FO5A 3DLBA 2E3MA 3NI8A 4RYVA 3KDIA 3NEFA 4BTZA 2E3RA 1ZXFA 2LPXA 4IGVA 3RT2A 4KPYA 3KB0A 4N76A 1LN1A 3OQUA 2K7HA 2KEWA 3GB4A 2Z9YA 3GGNA 3KB3A 3NJ1A 1KCMA 3OJIA 5E4BA 2MOUA 4DSCA 3GTSA 4GY9A 4JDLA 2IL5A 4A8VA 4MNSA 3P51A 2LCGA 1LN2A 3KDJA 3Q6AA 1LLTA 3H3TA 4A85A 3GL0A 3OTLA 2D4RA 3NMHA 3K90A 4C9CA 3OH8A 2LAFA 2LDKA 4JHYA 4LGBA 5JO2A 4IHRA 3E85A 1BV1A 2RERA 5E4DA 2E3NA 4JDAA 1ICXA 4NCBA 3HK2A 4A88A 2PSOA 2M89A 3KLXA 1B6FA 1JSSA 4R7KA 5JO1A 1T27A 3NMVA 4C9IA 1H2OA 1FSKA 3NR4A 4OICA 4C94A 3PUTA 3JRSA 4A84A 3UIDA 4LG5A 5BRLA 5C9YA 3ELIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YH6 A;  3TGO C;  2LAF A;  5EKQ C; 
#chains in the Genus database with same CATH topology
 1BTV A;  3IE5 A;  4QDF B;  3R6P A;  2LEQ A;  4JHI A;  1Z94 A;  3WG8 A;  1XN5 A;  3GL2 A;  1VJH A;  3UQH A;  2N4B A;  3K3K A;  3KL1 A;  1EM2 A;  2E3S A;  2Z9Z A;  4N0G C;  4REI A;  4N47 A;  2LE1 A;  4MAP A;  1TW0 A;  3QSZ A;  4XRW A;  1XN6 A;  2N4A A;  1FM4 A;  4DSB A;  2L8O A;  3CNW A;  2YH6 A;  3W9R A;  4XRT A;  3RT0 C;  3QN1 A;  2NN5 A;  3TFZ A;  3NQN A;  2EJX A;  5E46 A;  4QCK A;  3RD6 A;  3IJT A;  4A86 A;  5JNN A;  3TGO C;  3HO1 A;  3UJL A;  2FLH A;  2Q3Q A;  2KCZ A;  3KAY A;  4WVO A;  5I9J A;  4A8G A;  3F08 A;  3GTE A;  3H3Q A;  3Q63 A;  4A80 A;  3GOB A;  1E09 A;  2NS9 A;  5AMW A;  3NMP A;  4BK7 A;  4QIP A;  4JHG A;  3P0L A;  5E4M A;  1X53 A;  4MA6 A;  4Y31 A;  4A8U A;  2M47 A;  3TVR A;  3NEG A;  4NCA A;  3Q64 A;  1XDF A;  3ZVU A;  4IH0 A;  2VQ5 A;  4M9B A;  2ZYL A;  2QIM A;  3JRQ B;  2R55 A;  3P9V A;  3KDH A;  5I8F A;  4JHH A;  3DLH A;  4E6F A;  3TL1 A;  4IH2 A;  2E3Q A;  4LA7 A;  4M9W A;  2LF2 A;  4BKC A;  3HM9 A;  2KF2 A;  3C0V A;  3HXM A;  2FFS A;  3H3S A;  3NJ0 A;  4IGX A;  3NMN A;  3NJO A;  2LUZ A;  2RES A;  5EKQ C;  2LGH A;  1UW5 A;  3PU2 A;  1TXC A;  2E3P A;  4A83 A;  4BKD A;  2KTE A;  2VNE A;  4QDC A;  1LN3 A;  1QMR A;  3H3R A;  4B9R A;  3W9K A;  2QPV A;  1IFV A;  4Q0K A;  2BK0 A;  2WQL A;  3KAZ A;  4REJ A;  4Z3L A;  4BK6 A;  2GKD A;  2E3O A;  4PSB A;  3NS2 A;  1T17 A;  2I9Y A;  4N41 A;  3HVR A;  2LAK A;  4IGW A;  4REH A;  3F73 A;  4FPW A;  3HJF A;  1XUV A;  4A87 A;  3GKE A;  4DS8 A;  2REZ A;  4QDD A;  2LIO A;  3NMT A;  2L9P A;  2A1L A;  2K5G A;  2PCS A;  3TVQ A;  2L65 A;  4N3E A;  1XFS A;  4QDF A;  4A81 A;  4IGY A;  4LGA A;  3FO5 A;  3DLB A;  2E3M A;  3NI8 A;  4RYV A;  3KDI A;  3NEF A;  4BTZ A;  2E3R A;  1ZXF A;  2LPX A;  4IGV A;  3RT2 A;  4KPY A;  3KB0 A;  4N76 A;  1LN1 A;  3OQU A;  2K7H A;  2KEW A;  3GB4 A;  2Z9Y A;  3GGN A;  3KB3 A;  3NJ1 A;  1KCM A;  3OJI A;  5E4B A;  2MOU A;  4DSC A;  3GTS A;  4GY9 A;  4JDL A;  2IL5 A;  4A8V A;  4MNS A;  3P51 A;  2LCG A;  1LN2 A;  3KDJ A;  3Q6A A;  1LLT A;  3H3T A;  4A85 A;  3GL0 A;  3OTL A;  2D4R A;  3NMH A;  3K90 A;  4C9C A;  3OH8 A;  2LAF A;  2LDK A;  4JHY A;  4LGB A;  5JO2 A;  4IHR A;  3E85 A;  1BV1 A;  2RER A;  5E4D A;  2E3N A;  4JDA A;  1ICX A;  4NCB A;  3HK2 A;  4A88 A;  2PSO A;  2M89 A;  3KLX A;  1B6F A;  1JSS A;  4R7K A;  5JO1 A;  1T27 A;  3NMV A;  4C9I A;  1H2O A;  1FSK A;  3NR4 A;  4OIC A;  4C94 A;  3PUT A;  3JRS A;  4A84 A;  3UID A;  4LG5 A;  5BRL A;  5C9Y A;  3ELI A; 
#chains in the Genus database with same CATH homology
 1BTV A;  3IE5 A;  4QDF B;  3R6P A;  2LEQ A;  4JHI A;  1Z94 A;  3WG8 A;  1XN5 A;  3GL2 A;  1VJH A;  3UQH A;  2N4B A;  3K3K A;  3KL1 A;  1EM2 A;  2E3S A;  2Z9Z A;  4N0G C;  4REI A;  4N47 A;  2LE1 A;  4MAP A;  1TW0 A;  3QSZ A;  4XRW A;  1XN6 A;  2N4A A;  1FM4 A;  4DSB A;  2L8O A;  3CNW A;  2YH6 A;  3W9R A;  4XRT A;  3RT0 C;  3QN1 A;  2NN5 A;  3TFZ A;  3NQN A;  2EJX A;  5E46 A;  4QCK A;  3RD6 A;  3IJT A;  4A86 A;  5JNN A;  3TGO C;  3HO1 A;  3UJL A;  2FLH A;  2Q3Q A;  2KCZ A;  3KAY A;  4WVO A;  5I9J A;  4A8G A;  3F08 A;  3GTE A;  3H3Q A;  3Q63 A;  4A80 A;  3GOB A;  1E09 A;  2NS9 A;  5AMW A;  3NMP A;  4BK7 A;  4QIP A;  4JHG A;  3P0L A;  5E4M A;  1X53 A;  4MA6 A;  4Y31 A;  4A8U A;  2M47 A;  3TVR A;  3NEG A;  4NCA A;  3Q64 A;  1XDF A;  3ZVU A;  4IH0 A;  2VQ5 A;  4M9B A;  2ZYL A;  2QIM A;  3JRQ B;  2R55 A;  3P9V A;  3KDH A;  5I8F A;  4JHH A;  3DLH A;  4E6F A;  3TL1 A;  4IH2 A;  2E3Q A;  4LA7 A;  4M9W A;  2LF2 A;  4BKC A;  3HM9 A;  2KF2 A;  3C0V A;  3HXM A;  2FFS A;  3H3S A;  3NJ0 A;  4IGX A;  3NMN A;  3NJO A;  2LUZ A;  2RES A;  5EKQ C;  2LGH A;  1UW5 A;  3PU2 A;  1TXC A;  2E3P A;  4A83 A;  4BKD A;  2KTE A;  2VNE A;  4QDC A;  1LN3 A;  1QMR A;  3H3R A;  4B9R A;  3W9K A;  2QPV A;  1IFV A;  4Q0K A;  2BK0 A;  2WQL A;  3KAZ A;  4REJ A;  4Z3L A;  4BK6 A;  2GKD A;  2E3O A;  4PSB A;  3NS2 A;  1T17 A;  2I9Y A;  4N41 A;  3HVR A;  2LAK A;  4IGW A;  4REH A;  3F73 A;  4FPW A;  3HJF A;  1XUV A;  4A87 A;  3GKE A;  4DS8 A;  2REZ A;  4QDD A;  2LIO A;  3NMT A;  2L9P A;  2A1L A;  2K5G A;  2PCS A;  3TVQ A;  2L65 A;  4N3E A;  1XFS A;  4QDF A;  4A81 A;  4IGY A;  4LGA A;  3FO5 A;  3DLB A;  2E3M A;  3NI8 A;  4RYV A;  3KDI A;  3NEF A;  4BTZ A;  2E3R A;  1ZXF A;  2LPX A;  4IGV A;  3RT2 A;  4KPY A;  3KB0 A;  4N76 A;  1LN1 A;  3OQU A;  2K7H A;  2KEW A;  3GB4 A;  2Z9Y A;  3GGN A;  3KB3 A;  3NJ1 A;  1KCM A;  3OJI A;  5E4B A;  2MOU A;  4DSC A;  3GTS A;  4GY9 A;  4JDL A;  2IL5 A;  4A8V A;  4MNS A;  3P51 A;  2LCG A;  1LN2 A;  3KDJ A;  3Q6A A;  1LLT A;  3H3T A;  4A85 A;  3GL0 A;  3OTL A;  2D4R A;  3NMH A;  3K90 A;  4C9C A;  3OH8 A;  2LAF A;  2LDK A;  4JHY A;  4LGB A;  5JO2 A;  4IHR A;  3E85 A;  1BV1 A;  2RER A;  5E4D A;  2E3N A;  4JDA A;  1ICX A;  4NCB A;  3HK2 A;  4A88 A;  2PSO A;  2M89 A;  3KLX A;  1B6F A;  1JSS A;  4R7K A;  5JO1 A;  1T27 A;  3NMV A;  4C9I A;  1H2O A;  1FSK A;  3NR4 A;  4OIC A;  4C94 A;  3PUT A;  3JRS A;  4A84 A;  3UID A;  4LG5 A;  5BRL A;  5C9Y A;  3ELI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...