2LAFA

Nmr solution structure of the n-terminal domain of the e. coli lipoprotein bamc
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
GDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNVISAGLDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein 34
publication title Structure of the BamC Two-Domain Protein Obtained by Rosetta with a Limited NMR Data Set.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2011-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.50 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2lafA00
2LAFA 2YH6A 5EKQC 3TGOC
chains in the Genus database with same CATH superfamily
4RYVA 5EKQC 2LAKA 2LPXA 3C0VA 3NQNA 4REHA 2N4AA 4GY9A 4IGYA 4MA6A 4IH2A 3HJFA 5E46A 1XUVA 4JHGA 1LN3A 2I9YA 2KEWA 4IGWA 4BKCA 3Q6AA 4N0GC 4XRWA 3H3RA 5AMWA 3NJOA 1TXCA 2L9PA 1T17A 3GOBA 3F08A 3KLXA 1ZXFA 1UW5A 4REIA 5C9YA 2VNEA 3NJ0A 5JNNA 3GTSA 3PU2A 3KB0A 3K3KA 3DLHA 4C9CA 4REJA 2R55A 3TVRA 2E3NA 3H3SA 4FPWA 2EJXA 3ELIA 3KDJA 4JHIA 4BK6A 2N4BA 4Z3LA 5I9JA 2Z9YA 4IH0A 3GL2A 4IGVA 4JDAA 3HM9A 3NMVA 4OICA 3R6PA 2LGHA 4PSBA 3F73A 1EM2A 3QN1A 3P9VA 3OTLA 4R7KA 4Y31A 4A85A 1FM4A 5JO2A 4QDCA 3H3TA 4A8UA 3UJLA 2FLHA 3KL1A 4JHHA 4MAPA 2MOUA 1BV1A 3KAYA 1JSSA 2M89A 3NMTA 5JO1A 3GTEA 3NEGA 2Z9ZA 3TFZA 4LG5A 2VQ5A 4DS8A 2IL5A 3RT2A 1QMRA 2LF2A 2REZA 3NEFA 4A8VA 2E3SA 4BKDA 4LGAA 4QDFA 3NMPA 2LCGA 4A80A 1XN6A 4JDLA 3P51A 4JHYA 3KB3A 4A86A 3RT0C 2QIMA 4NCAA 4NCBA 1FSKA 1KCMA 2WQLA 2PCSA 3NI8A 2LEQA 2NN5A 3IE5A 2L65A 4LGBA 2D4RA 4WVOA 3GB4A 4E6FA 4A81A 4XRTA 2E3OA 2BK0A 2FFSA 4IGXA 3TL1A 3H3QA 3GL0A 5BRLA 4A88A 3TGOC 4C9IA 2LAFA 2LUZA 3KDIA 2KF2A 2YH6A 2LE1A 4N76A 3Q63A 4QCKA 5E4MA 4IHRA 4BTZA 3W9RA 4C94A 1ICXA 3HVRA 2RESA 3IJTA 4LA7A 3HO1A 1H2OA 3Q64A 3HXMA 3DLBA 1B6FA 1LN1A 4M9WA 4Q0KA 2PSOA 1VJHA 4A83A 2K5GA 4QDFB 3NR4A 3RD6A 1IFVA 2E3MA 3E85A 4DSCA 2LDKA 3JRQB 4B9RA 1LLTA 1Z94A 4N47A 4MNSA 2LIOA 3GKEA 3UIDA 3TVQA 2QPVA 3QSZA 2GKDA 5I8FA 3GGNA 3NJ1A 3KDHA 3NS2A 4BK7A 1BTVA 3P0LA 1LN2A 2KCZA 2RERA 3OQUA 2E3RA 3KAZA 3WG8A 2NS9A 4DSBA 2Q3QA 4M9BA 1XN5A 2M47A 2ZYLA 3CNWA 4QDDA 4A84A 4A8GA 4N41A 2L8OA 3HK2A 3OH8A 3FO5A 5E4BA 3ZVUA 5E4DA 2E3PA 1XDFA 4N3EA 1X53A 1TW0A 3W9KA 1XFSA 3JRSA 3OJIA 4QIPA 4KPYA 3K90A 2A1LA 2KTEA 1T27A 3NMHA 2K7HA 3PUTA 3UQHA 4A87A 1E09A 2E3QA 3NMNA
chains in the Genus database with same CATH topology
4RYVA 5EKQC 2LAKA 2LPXA 3C0VA 3NQNA 4REHA 2N4AA 4GY9A 4IGYA 4MA6A 4IH2A 3HJFA 5E46A 1XUVA 4JHGA 1LN3A 2I9YA 2KEWA 4IGWA 4BKCA 3Q6AA 4N0GC 4XRWA 3H3RA 5AMWA 3NJOA 1TXCA 2L9PA 1T17A 3GOBA 3F08A 3KLXA 1ZXFA 1UW5A 4REIA 5C9YA 2VNEA 3NJ0A 5JNNA 3GTSA 3PU2A 3KB0A 3K3KA 3DLHA 4C9CA 4REJA 2R55A 3TVRA 2E3NA 3H3SA 4FPWA 2EJXA 3ELIA 3KDJA 4JHIA 4BK6A 2N4BA 4Z3LA 5I9JA 2Z9YA 4IH0A 3GL2A 4IGVA 4JDAA 3HM9A 3NMVA 4OICA 3R6PA 2LGHA 4PSBA 3F73A 1EM2A 3QN1A 3P9VA 3OTLA 4R7KA 4Y31A 4A85A 1FM4A 5JO2A 4QDCA 3H3TA 4A8UA 3UJLA 2FLHA 3KL1A 4JHHA 4MAPA 2MOUA 1BV1A 3KAYA 1JSSA 2M89A 3NMTA 5JO1A 3GTEA 3NEGA 2Z9ZA 3TFZA 4LG5A 2VQ5A 4DS8A 2IL5A 3RT2A 1QMRA 2LF2A 2REZA 3NEFA 4A8VA 2E3SA 4BKDA 4LGAA 4QDFA 3NMPA 2LCGA 4A80A 1XN6A 4JDLA 3P51A 4JHYA 3KB3A 4A86A 3RT0C 2QIMA 4NCAA 4NCBA 1FSKA 1KCMA 2WQLA 2PCSA 3NI8A 2LEQA 2NN5A 3IE5A 2L65A 4LGBA 2D4RA 4WVOA 3GB4A 4E6FA 4A81A 4XRTA 2E3OA 2BK0A 2FFSA 4IGXA 3TL1A 3H3QA 3GL0A 5BRLA 4A88A 3TGOC 4C9IA 2LAFA 2LUZA 3KDIA 2KF2A 2YH6A 2LE1A 4N76A 3Q63A 4QCKA 5E4MA 4IHRA 4BTZA 3W9RA 4C94A 1ICXA 3HVRA 2RESA 3IJTA 4LA7A 3HO1A 1H2OA 3Q64A 3HXMA 3DLBA 1B6FA 1LN1A 4M9WA 4Q0KA 2PSOA 1VJHA 4A83A 2K5GA 4QDFB 3NR4A 3RD6A 1IFVA 2E3MA 3E85A 4DSCA 2LDKA 3JRQB 4B9RA 1LLTA 1Z94A 4N47A 4MNSA 2LIOA 3GKEA 3UIDA 3TVQA 2QPVA 3QSZA 2GKDA 5I8FA 3GGNA 3NJ1A 3KDHA 3NS2A 4BK7A 1BTVA 3P0LA 1LN2A 2KCZA 2RERA 3OQUA 2E3RA 3KAZA 3WG8A 2NS9A 4DSBA 2Q3QA 4M9BA 1XN5A 2M47A 2ZYLA 3CNWA 4QDDA 4A84A 4A8GA 4N41A 2L8OA 3HK2A 3OH8A 3FO5A 5E4BA 3ZVUA 5E4DA 2E3PA 1XDFA 4N3EA 1X53A 1TW0A 3W9KA 1XFSA 3JRSA 3OJIA 4QIPA 4KPYA 3K90A 2A1LA 2KTEA 1T27A 3NMHA 2K7HA 3PUTA 3UQHA 4A87A 1E09A 2E3QA 3NMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAF A;  2YH6 A;  5EKQ C;  3TGO C; 
#chains in the Genus database with same CATH topology
 4RYV A;  5EKQ C;  2LAK A;  2LPX A;  3C0V A;  3NQN A;  4REH A;  2N4A A;  4GY9 A;  4IGY A;  4MA6 A;  4IH2 A;  3HJF A;  5E46 A;  1XUV A;  4JHG A;  1LN3 A;  2I9Y A;  2KEW A;  4IGW A;  4BKC A;  3Q6A A;  4N0G C;  4XRW A;  3H3R A;  5AMW A;  3NJO A;  1TXC A;  2L9P A;  1T17 A;  3GOB A;  3F08 A;  3KLX A;  1ZXF A;  1UW5 A;  4REI A;  5C9Y A;  2VNE A;  3NJ0 A;  5JNN A;  3GTS A;  3PU2 A;  3KB0 A;  3K3K A;  3DLH A;  4C9C A;  4REJ A;  2R55 A;  3TVR A;  2E3N A;  3H3S A;  4FPW A;  2EJX A;  3ELI A;  3KDJ A;  4JHI A;  4BK6 A;  2N4B A;  4Z3L A;  5I9J A;  2Z9Y A;  4IH0 A;  3GL2 A;  4IGV A;  4JDA A;  3HM9 A;  3NMV A;  4OIC A;  3R6P A;  2LGH A;  4PSB A;  3F73 A;  1EM2 A;  3QN1 A;  3P9V A;  3OTL A;  4R7K A;  4Y31 A;  4A85 A;  1FM4 A;  5JO2 A;  4QDC A;  3H3T A;  4A8U A;  3UJL A;  2FLH A;  3KL1 A;  4JHH A;  4MAP A;  2MOU A;  1BV1 A;  3KAY A;  1JSS A;  2M89 A;  3NMT A;  5JO1 A;  3GTE A;  3NEG A;  2Z9Z A;  3TFZ A;  4LG5 A;  2VQ5 A;  4DS8 A;  2IL5 A;  3RT2 A;  1QMR A;  2LF2 A;  2REZ A;  3NEF A;  4A8V A;  2E3S A;  4BKD A;  4LGA A;  4QDF A;  3NMP A;  2LCG A;  4A80 A;  1XN6 A;  4JDL A;  3P51 A;  4JHY A;  3KB3 A;  4A86 A;  3RT0 C;  2QIM A;  4NCA A;  4NCB A;  1FSK A;  1KCM A;  2WQL A;  2PCS A;  3NI8 A;  2LEQ A;  2NN5 A;  3IE5 A;  2L65 A;  4LGB A;  2D4R A;  4WVO A;  3GB4 A;  4E6F A;  4A81 A;  4XRT A;  2E3O A;  2BK0 A;  2FFS A;  4IGX A;  3TL1 A;  3H3Q A;  3GL0 A;  5BRL A;  4A88 A;  3TGO C;  4C9I A;  2LAF A;  2LUZ A;  3KDI A;  2KF2 A;  2YH6 A;  2LE1 A;  4N76 A;  3Q63 A;  4QCK A;  5E4M A;  4IHR A;  4BTZ A;  3W9R A;  4C94 A;  1ICX A;  3HVR A;  2RES A;  3IJT A;  4LA7 A;  3HO1 A;  1H2O A;  3Q64 A;  3HXM A;  3DLB A;  1B6F A;  1LN1 A;  4M9W A;  4Q0K A;  2PSO A;  1VJH A;  4A83 A;  2K5G A;  4QDF B;  3NR4 A;  3RD6 A;  1IFV A;  2E3M A;  3E85 A;  4DSC A;  2LDK A;  3JRQ B;  4B9R A;  1LLT A;  1Z94 A;  4N47 A;  4MNS A;  2LIO A;  3GKE A;  3UID A;  3TVQ A;  2QPV A;  3QSZ A;  2GKD A;  5I8F A;  3GGN A;  3NJ1 A;  3KDH A;  3NS2 A;  4BK7 A;  1BTV A;  3P0L A;  1LN2 A;  2KCZ A;  2RER A;  3OQU A;  2E3R A;  3KAZ A;  3WG8 A;  2NS9 A;  4DSB A;  2Q3Q A;  4M9B A;  1XN5 A;  2M47 A;  2ZYL A;  3CNW A;  4QDD A;  4A84 A;  4A8G A;  4N41 A;  2L8O A;  3HK2 A;  3OH8 A;  3FO5 A;  5E4B A;  3ZVU A;  5E4D A;  2E3P A;  1XDF A;  4N3E A;  1X53 A;  1TW0 A;  3W9K A;  1XFS A;  3JRS A;  3OJI A;  4QIP A;  4KPY A;  3K90 A;  2A1L A;  2KTE A;  1T27 A;  3NMH A;  2K7H A;  3PUT A;  3UQH A;  4A87 A;  1E09 A;  2E3Q A;  3NMN A; 
#chains in the Genus database with same CATH homology
 4RYV A;  5EKQ C;  2LAK A;  2LPX A;  3C0V A;  3NQN A;  4REH A;  2N4A A;  4GY9 A;  4IGY A;  4MA6 A;  4IH2 A;  3HJF A;  5E46 A;  1XUV A;  4JHG A;  1LN3 A;  2I9Y A;  2KEW A;  4IGW A;  4BKC A;  3Q6A A;  4N0G C;  4XRW A;  3H3R A;  5AMW A;  3NJO A;  1TXC A;  2L9P A;  1T17 A;  3GOB A;  3F08 A;  3KLX A;  1ZXF A;  1UW5 A;  4REI A;  5C9Y A;  2VNE A;  3NJ0 A;  5JNN A;  3GTS A;  3PU2 A;  3KB0 A;  3K3K A;  3DLH A;  4C9C A;  4REJ A;  2R55 A;  3TVR A;  2E3N A;  3H3S A;  4FPW A;  2EJX A;  3ELI A;  3KDJ A;  4JHI A;  4BK6 A;  2N4B A;  4Z3L A;  5I9J A;  2Z9Y A;  4IH0 A;  3GL2 A;  4IGV A;  4JDA A;  3HM9 A;  3NMV A;  4OIC A;  3R6P A;  2LGH A;  4PSB A;  3F73 A;  1EM2 A;  3QN1 A;  3P9V A;  3OTL A;  4R7K A;  4Y31 A;  4A85 A;  1FM4 A;  5JO2 A;  4QDC A;  3H3T A;  4A8U A;  3UJL A;  2FLH A;  3KL1 A;  4JHH A;  4MAP A;  2MOU A;  1BV1 A;  3KAY A;  1JSS A;  2M89 A;  3NMT A;  5JO1 A;  3GTE A;  3NEG A;  2Z9Z A;  3TFZ A;  4LG5 A;  2VQ5 A;  4DS8 A;  2IL5 A;  3RT2 A;  1QMR A;  2LF2 A;  2REZ A;  3NEF A;  4A8V A;  2E3S A;  4BKD A;  4LGA A;  4QDF A;  3NMP A;  2LCG A;  4A80 A;  1XN6 A;  4JDL A;  3P51 A;  4JHY A;  3KB3 A;  4A86 A;  3RT0 C;  2QIM A;  4NCA A;  4NCB A;  1FSK A;  1KCM A;  2WQL A;  2PCS A;  3NI8 A;  2LEQ A;  2NN5 A;  3IE5 A;  2L65 A;  4LGB A;  2D4R A;  4WVO A;  3GB4 A;  4E6F A;  4A81 A;  4XRT A;  2E3O A;  2BK0 A;  2FFS A;  4IGX A;  3TL1 A;  3H3Q A;  3GL0 A;  5BRL A;  4A88 A;  3TGO C;  4C9I A;  2LAF A;  2LUZ A;  3KDI A;  2KF2 A;  2YH6 A;  2LE1 A;  4N76 A;  3Q63 A;  4QCK A;  5E4M A;  4IHR A;  4BTZ A;  3W9R A;  4C94 A;  1ICX A;  3HVR A;  2RES A;  3IJT A;  4LA7 A;  3HO1 A;  1H2O A;  3Q64 A;  3HXM A;  3DLB A;  1B6F A;  1LN1 A;  4M9W A;  4Q0K A;  2PSO A;  1VJH A;  4A83 A;  2K5G A;  4QDF B;  3NR4 A;  3RD6 A;  1IFV A;  2E3M A;  3E85 A;  4DSC A;  2LDK A;  3JRQ B;  4B9R A;  1LLT A;  1Z94 A;  4N47 A;  4MNS A;  2LIO A;  3GKE A;  3UID A;  3TVQ A;  2QPV A;  3QSZ A;  2GKD A;  5I8F A;  3GGN A;  3NJ1 A;  3KDH A;  3NS2 A;  4BK7 A;  1BTV A;  3P0L A;  1LN2 A;  2KCZ A;  2RER A;  3OQU A;  2E3R A;  3KAZ A;  3WG8 A;  2NS9 A;  4DSB A;  2Q3Q A;  4M9B A;  1XN5 A;  2M47 A;  2ZYL A;  3CNW A;  4QDD A;  4A84 A;  4A8G A;  4N41 A;  2L8O A;  3HK2 A;  3OH8 A;  3FO5 A;  5E4B A;  3ZVU A;  5E4D A;  2E3P A;  1XDF A;  4N3E A;  1X53 A;  1TW0 A;  3W9K A;  1XFS A;  3JRS A;  3OJI A;  4QIP A;  4KPY A;  3K90 A;  2A1L A;  2KTE A;  1T27 A;  3NMH A;  2K7H A;  3PUT A;  3UQH A;  4A87 A;  1E09 A;  2E3Q A;  3NMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...