2LAHA

Solution nmr structure of mitotic checkpoint serine/threonine-protein kinase bub1 n-terminal domain from homo sapiens, northeast structural genomics consortium target hr5460a (methods development)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
160
structure length
160
Chain Sequence
MGHHHHHHSHMDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target HR5460A
rcsb
source organism Homo sapiens
molecule tags Cell cycle, apoptosis
molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1
total genus 59
structure length 160
sequence length 160
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lahA00
4A1GA 4AEZC 3SI5A 2LAHA 2WVIA
chains in the Genus database with same CATH superfamily
3SZ7A 3MV2B 2CHZA 1OUVA 3LKUA 2YQ8A 4J0UA 1NA0A 2BEDA 2IF4A 4G11A 2ZGDA 4LEUA 3RSEG 4GMRA 2PZIA 3JCKC 4DX6D 4N39A 4GPMA 2OOEA 5CBOA 2MRIA 1IHGA 5FQ8A 3MKQA 4MLPA 1IQUA 4JA7A 2J4DA 2XRYA 3ZYMA 1ZU2A 5LOZA 4HLEA 1TNBA 4LCTA 4G1TA 3D9JA 4U8VD 3AAAC 1DC2A 3CGHA 3HXFA 4A1GA 3ZN3A 3DSSA 3D3MA 5BUZA 4W9RA 3G2UA 1NI1A 3PZDA 4GAAA 4J8SA 4XI0A 4Q94A 4A63B 1HG5A 3U4TA 3W9GA 3ZUVB 1E7VA 3UTMA 5HS0A 2X6IA 1YA0A 4FP7A 3CVYA 3BUAA 2QYJA 2J08A 2UY1B 1S64A 4B89A 1OT8A 2L6JA 3OTNA 3R7RA 2VTBB 2EINE 2R17C 3PEVB 3NAWA 2KCKA 4I9CA 5HQ8A 2X6KA 1HS6A 3SBTB 3AG1E 1U3CA 2PQRA 3IV0A 5BXOA 3UQ3A 1BI7B 4CGWA 1O5MA 3FEXA 3PREA 4DLQA 1HO8A 4Z68A 2EIJE 3J5PA 4K0RA 3HVEA 4WNGA 4PDXA 3PZ4A 3EIJA 2P9NG 2IOLA 1OWLA 2QFCA 3OXFA 1JUQA 3DXMG 4MKTA 3DPYA 4E6HA 4FHKA 3CVNA 2XEVA 1B89A 4GPKA 2WXJA 3L22A 4LUNU 4F1SA 1NFIE 3DSTA 5CMYA 1OCRE 2EQXA 1FVHA 2IEJA 3R9AB 4AY6A 3K9IA 1LD7A 1Z3XA 4DX1A 3ESKA 3PE4A 2J9QA 5A23A 3IBEA 2WXMA 4Q69A 3GZ2A 3WXXA 3ULYA 2J8SD 4EPZA 2OCCE 3EHQA 5EILA 2YNQA 3ULQA 2AJAA 5JHBA 5C1DA 3RO2A 5G04C 5AJDA 1OWPA 1SW6A 3BG0B 3ZEFA 4ZHBA 3CHRA 2OV8A 1MX4A 2NYJA 2BTDA 2IU1A 5EX0A 1SZAA 1UN8A 1TJFA 3PH0C 2I2OA 4ILHB 2PQNA 4N5CA 1H2TC 2WXFA 2FEZA 3ABME 3RKVA 1N0QA 2V0PA 3U9WA 4JEHA 5T3RA 3C5RA 4WNFA 2A4ZA 2KM4A 3J5QB 1VDYA 2F8YA 2P2CP 4YDWA 4I1AA 3EHMA 1N4SA 5AENA 4P29A 5AYWD 3UM1A 2YHEA 3CV0A 3DSUA 1UJJA 1TR4A 3QWVA 2L0TB 1HZ4A 2XEHA 3FEYA 1OY3D 3L54A 3APFA 1OWNA 5ENSD 3SO8A 5AARA 4B8AA 2VGXA 2WXKA 4V3IA 2IFUA 5KJLA 1O1TA 2C0LA 3JQ1A 4CRWA 3D9HA 4OAUC 4GU5A 1LF8A 2FO7A 4LERA 4F53A 3UM3A 2VSYA 3L9TA 3CVXA 1V54E 3APCA 2ETAA 3QOUA 4N3BA 3AG4E 4GZ5A 3VLDA 5E76A 5D0QD 1ELKA 2H6HA 2XCBA 4U7EB 1FT1A 4AVXA 4JL0A 3ZYQA 4LNUD 3UKUG 2DWZA 3L13A 2QY7A 3G2SA 4BY6A 4A3TA 2KATA 3PUKA 4N5QA 4AJWA 5LFAA 2CHXA 5BV0A 5AQ7A 4JHRA 3DSVA 3QAQA 3X2QE 1WAO1 3KSLA 2NC9A 2VSOE 3CHOA 5KJNA 1SQMA 2DIWA 4X8QA 5G04J 3UI2A 4GZCA 2C2LA 4AM9A 4XKBA 3PZ1A 4UI9K 3S7JA 3TWXA 5FIOA 1SZ9A 3E32A 4ABNA 2CFUA 3NZUA 3MZLB 4XIFA 3CEQA 3Q5MA 4M7CA 2Y0BG 1K1AA 2HYZA 4N3AA 4RG6A 3FH5A 2MYOA 2HM8A 1X81A 4C0MA 3FTYA 4G26A 5CCMA 1KLXA 2YHCA 2X6FA 1G3NB 2P9SG 3MV3B 3ENEA 1TNYA 2DBAA 2FI7A 3LPZA 4O60A 1AP7A 3T5XA 2H6GA 2KCVA 5CCLA 1NP7A 3W9FA 4LSZE 5ENPD 1D8DA 2WXNA 1H6OA 2QC9A 3JXIA 4K5BA 3EHNA 4ANUA 3CSFA 4GTRA 2MOWA 2LNIA 1N94A 3LY9A 3MGBA 3CVUA 5ENRD 3ZFWA 5EKQD 1QBQA 3HYMB 3Q4AB 4B8CB 1NA3A 5EDSA 3SBSA 3G2VA 1TN7A 3JYSA 1OWMA 5KBAA 4HI8A 3ZGQA 1IXVA 4UI9J 1FPPA 3V2OA 3KEAA 2AVPA 2Y4TA 1IKND 2FF4A 3U64A 2VQ2A 5CRVA 3R7QA 3TGOA 2R2LA 4H7XA 1U3DA 4GTTA 4HOTA 2V8SE 2WM9A 3NF1A 5BXUA 2VGYA 3RIBA 3QJZA 4JHKA 3T9KA 3IHVA 4GA2A 1HX8A 4PH4B 1N4RA 3LY7A 3TWWA 1INZA 1E8WA 3LVQE 5CEAA 3FUJA 3VTYA 4MS6A 1FCHA 5ANRA 3V2XA 4FA6A 4K03A 4GCOA 1N95A 3DSXA 2GRQB 4J7WA 2KZTB 4KT6B 2J4BA 3PS6A 3IKOB 2BF0X 2X3MA 4I1OB 5FQ7A 4HOSA 2F37A 4G8KA 3R9MA 3ZIMA 2H6IA 2WXHA 5B1BE 3VLFA 4I1MA 4A1SA 4I2WA 4GMLA 3CVQA 2CFZA 3TAXA 1O1RA 3VLEA 2ONDA 2JEKA 2WXOA 1TEZA 4HOUA 4GTMA 3PNLB 3QK0A 3PEUB 3PNTB 4XZ4A 1IQRA 4RSYA 3RU0A 4EHMA 3E4BA 4L2YA 2KCLA 4C0EA 2DVWA 1MHQA 1JCSA 3UMVA 5AQBA 3Q75A 2BKKB 4BSXA 1YYHA 4Y6WA 1TNZA 3CVLA 3L08A 2IO2C 3LYAA 4U63A 3VTXA 1HG2A 1N52A 4J8FA 2IONA 3ASHA 4GTVA 5ENQD 3E37A 5HKPA 3Q15A 2A5EA 3CVPA 3KAEA 1KZOA 3T8KA 2PM7A 1ZB1A 4ANWA 1O1SA 4GMJA 1BI8B 1TJCA 4ME2A 1UG3A 2EILE 1D9SA 2VGXB 3JXJA 2X38A 2WB2A 3PDNA 2ETCA 3FUHA 5J08A 3DBSA 1EYHA 4MBGA 2XS8A 4ANXA 3IHYA 3EHRA 3FTXA 4YDEA 3UX4A 4HRNA 4FADA 2XZDG 3AS5A 3LY8A 3CVVA 4GTQA 4AY5A 1W3BA 4L23A 1Z5SC 3MYVA 4WNDA 4CDMA 3ZPJA 3ZW3A 2I9CA 3I4GA 3F6QA 4CDRA 2GROB 2XENA 2MHKA 4FC8A 4ILGA 4U0SA 1DCEA 1H6PA 1N4PA 4JB8P 4HNAD 3I5PA 3ZHEA 1E90A 2HR2A 4EBAG 4GA0A 3TWVA 3BEEA 1N0RA 3ABLE 1S70B 5CEDB 2LUHA 3QC1A 3ISMC 3QDNA 2P9IG 3CK7A 2JABA 1ZBPA 1KZPA 3OXLA 5KJMA 4TRQA 3GYZA 2Y4UA 3HDXA 4KYOB 4UWGA 4F6RD 3UM2A 2XGOA 1QQEA 3V30A 3P1UA 4AP2A 4CYMD 1H6KA 1JWFA 1H19A 4G23A 2I1KA 5EIBE 3GW4A 1K1BA 4NACA 3FH8A 5ARGA 5BV1A 4AEZC 1KPSB 3Q78A 4B93B 4I43A 3DEPA 3FUNA 3TWQA 3ZYLA 1LTXA 3L16A 4J8DA 2E0IA 3B95A 5JJTA 3ULEG 4ATGA 5CERB 3O4ZA 5LX8A 3FP3A 4U0ZA 2ZGGA 5DBKA 3RRMB 3G2TA 3LCAA 5KJKA 4JEUA 2E2EA 4CT4A 4J8EA 4JD2G 5FINA 3U66A 5ENTD 1Z6TA 4BTBA 4I6JA 4DX7D 5D0OD 3FUFA 3CQGB 4BX9A 5AIJA 2B6CA 5BNWA 4O6FA 3GZ1A 3TG5A 3NOGD 3I3NA 4GYOA 4UQXA 3TWUA 4U0UA 4AXHA 3CIAA 1E8XA 3T8MA 1U2VG 3BQOA 3AU5A 3ZXSA 4FULA 5FJYA 2KXPC 1UOHA 4A55A 2HE0A 2L9BA 5D2MC 3PZ3A 3ASDA 3E33A 1EPUA 2FBNA 2AXVA 2LAIA 5CBNA 3D9NA 1EF1C 4JHJA 5D66A 3CLJA 1HXIA 4DK5A 3G2WA 2NXPA 1KT1A 4DPRA 1HF8A 4JZYA 4F7AA 4ATZD 5FZSA 2DYRE 1SVXA 3Q79A 2ETBA 3TWSA 1WM5A 3BU8A 3NOCD 5A6CA 4BERA 2IOSA 4G8LA 3LVRE 4HXIA 4EECA 2CG2A 3CKBA 3ZYKA 1K3ZD 1ELWA 2J49A 1TNOA 3JQ0A 4OVUA 4NURA 1Q2ZA 2LXMA 4URKA 5JHAA 1PC2A 4WUYA 2WPVA 4ACKA 4HFGA 2IO3C 5FQ4A 4EZJA 4QQIA 4HOQA 5M72A 3ASFA 2R03A 4OYSA 2CHWA 2ILRA 2I1JA 4KZCA 3S7FA 4NQ0A 3JUEA 4KVMA 1BU9A 4U95D 4WWNA 2GRLA 4L1BA 1IYGA 3E30A 2X6JA 3CKCA 5G2NA 3V79K 4DI4A 5G55A 4D10C 4ILIA 1OXJA 3S7BA 1HFAA 2WXQA 1MYOA 3FWVA 3ZU7B 4RQIA 5FWQA 2JLBA 1MX2A 1S63A 3WG7E 1OCCE 3ASGA 3TWRA 1MJ0A 3ZKJA 4KMOA 2GRNB 2H6FA 2AXUA 3QARA 4RVBA 1YCSB 2UWJG 5ARFA 4XX5A 3UIPC 1OWOA 3SFXA 4DX2A 3NB2A 2GRPB 2XGSA 3D9KA 3FFLA 5EN5D 3MEKA 4CEMA 3LJNA 3CSTA 3E34A 2NSZA 5CRUA 4HRMB 3FTUA 4EZLA 4CDNA 2P9LG 4JA9A 3UKRG 4HRLA 3RAUA 3UPVA 3ASNE 4G2VA 3TXMA 4BTAA 1K8KG 4U8YD 2XHEA 2YINA 2WXIA 1PY1A 3IEGA 1GW6A 3L6AA 1N9AA 1RZ4A 2WQ6A 4LNBA 4YNDA 4BETA 3LXUX 4OAVB 5FZQA 1HU3A 2WMNA 4I9EA 1IHBA 3I4RB 3Q47B 4GCNA 4GZ3A 2AXZA 1SA5A 3AG2E 5KNGA 4FJZA 5FZRA 4ACLA 4HLLA 3UT4A 3ML8A 4HQDA 5AAOA 4FLHA 3LJ3A 2XRZA 4GTSA 3KEZA 3HXEA 3L17A 4F3VA 4I2ZA 2PL2A 4XI9A 3FU6A 1JPLA 2HO1A 4LG6A 2OEWA 5AQAA 3V31A 1UW4B 4DX5D 2WMOA 4GTPA 1KT0A 2QZAA 4TXQA 1TYQG 3B7SA 4WWPA 4BX8A 3TJPA 3MKRA 3CHMA 5EIDA 2XCCA 1MX6A 4UWFA 3UXGA 4QFVA 1MQSA 3B13A 3UT8A 1NZNA 4LRZA 1E96B 2A5UA 3Q49B 1JWGA 3QNKA 2IQCA 3Q7AA 3LS8A 1UN9A 4C9BB 3D9LA 1H2VC 2Q7FA 5EYPF 2EIME 4DLOA 3ZHEB 1JCQA 3T5VA 2WXRA 3CHPA 5JJ6A 4N2QA 5B3SE 2LSVA 1LD8A 3DEOA 3TL5A 3ABKE 3HG0D 3HRAA 3IXEA 4HBDA 3FULA 3LDZA 5HRYA 5G05C 3AJIA 4TUUA 2FULA 4TV3A 3L82A 4JW1A 3S2AA 1V55E 3SGHA 4YVOA 2BKGA 2PNNA 4TXPA 4YDYA 4BWRA 1L5JA 3SF4A 1A5EA 3SD5A 5B1AE 5BPPA 3FUKA 2R59A 1H0AA 2XS1A 4I17A 2AWIA 1DNPA 2XGMA 3HXBA 4YVQC 5ENOD 4UQZA 4CT0A 2LXLA 1RW2A 1FT2A 3EJNA 5G05J 2LSUA 3S7DA 2M63A 4L9PA 2RKKA 3MA5A 4U04A 5J90A 1BPOA 1OCZE 3DWLG 3ZNGA 5LCWC 4EZKA 2GRMA 3UT7A 3APDA 1ELRA 1SA4A 2XEEA 4AIFA 2VGEA 5JJ7A 4GZDA 2UY1A 2XPIA 1Y6IA 4PUCA 3D9PA 3CK9A 4C48B 3B7TA 3Q9UC 2VYIA 3PE3A 2GGFA 2FO1E 3HHMA 4MRUA 1N54A 1DVPA 1XGWA 2XPYA 1QZ2A 3ONKA 4DI3A 3EU5A 3Q73A 4APOA 5BT1A 5IY5E 4ZFHA 4J8YA 2Y69E 1JCRA 1D8EA 3SFZA 4RG9A 4UUCA 2OEVA 3FTSA 4FLBA 1MZCA 5ENNA 2V4LA 5KNHD 3OXGA 3AG3E 5AQ9A 5FT9A 4JVSA 4APFA 3ONLA 4UWHA 4BT9A 3D9OA 2IY0C 2Y1LE 3SQVA 2OVBA 2DZNA 4B0ZA 2DCPA 3CK8A 3FUMA 3MX3A 4TUMA 2Y3AA 4BESA 1HH8A 1BLXB 2I6HA 1YMPA 4EQFA 1FVFA 2RG8A 4UWLA 4UQYA 4XEIG 2OVFA 5E75A 3TG4A 4Y6CA 3N71A 2J09A 1E8ZA 4IULA 4M3OA 3P2BA 2F0YA 3KD7A 4HS2A 3SNXA 4PS7A 3UUXA 1HE8A 1TN6A 4JXTA 4TXRA 5AJLA 3FUDA 4GYYA 3B7RL 4HI9A 2J07A 3RJVA 4ANVA 5LP0A 3C3OA 4UI9C 1EDUA 3FHEA 2VJ8A 1A17A 2P9PG 3O48A 4DRXE 1N4QA 3FU5A 3PUJA 2VSXE 3DRAA 5FQ6A 1S0PA 3UINC 3CR3A 4J6IA 4K5CA 5ANLA 1UJKA 4HB5A 3LEWA 2WXGA 5C2YA 4GB9A 2P58C 2P9UG 5ITZF 2ZIRA 3C98A 2EIKE 4GZ6A 1QNFA 4EBAA 5T4YA 2IJGX 4U8HA 4CCAA 5CMWA 4KBQA 3B7UX 3EIQC 3URZA 3NQPA 2B0OE 3FUIA 1N11A 1WG0A 1WY6A 3FU0A 3ZRHA 5KCMA 4UWKA 4AV7A 3KS2A 4PS3A 2WXPA 2P9KG 2XPZA 3MKQB 4WAFA 3FDHA 3PZ2A 4L7TA 3QKYA 4RLYA 4IN3B 4GTOA 4XE0A 4K5AB 3FTZA 3EUVA 4F1PA 3EU9A 3CQCB 3DXKG 4BT8A 4A3VA 2KZTA 3ASOE 3C3RA 3CHQA 4I6GA 4BSZB 2X6HA 3TXNA 3QB2A 3JUIA 3RO3A 1X5BA 3U3WA 2ZU6B 3DPDA 4YDOA 3SHFA 4PS8A 4Q96A 2ZXWE 3AU4A 5BW8C 5H7PA 4HVBA 3SI5A 3RRUA 3QWPA 1WDYA 3SY2A 4H7YA 3UM0A 4LNGA 2R05A 4IRUA 4GYWA 5EX3A 2C0MA 4FU3A 3NBNB 3FU3A 4AOFA 1E8YA 1OCOE 5LCWJ 2R02A 2R5SA 3B7BA 3BG1B 4WNEA 4HORA 2V4HC 2WQ7A 3Q7FA 3ZVVA 3MCXA 3TWTA 3DSWA 4N2SA 4KXKB 3ML9A 1TNUA 4CGVA 4U96D 5AN8A 3FTVA 3FTWA 4B94A 2KC7A 5CHEE 5DIZA 3HXCA 3NZSA 2V5QC 4JC8A 4FHJA 4NRHB 4BFRA 2LAHA 3RK6A 5KWDA 4N3CA 1TN8A 3FY4A 3HXDA 3Q9NC 1BD8A 2VTBA 2DZOA 2QYUA 2AW6A 1E7UA 3C3QA 2GW1A 2WVIA 4BEPA 3OAWA 3FH7A 4DUIA 1DCQA 4L2LA 3UIOC 1P5QA 2ZISA 4I6EA 4IYPA 4R7LA 4O1OA 2WQHA 3D9IA 5EYLA 3ZXPA 3RRNB 5FTPA 3PVLA 4OVVA 3C72A 1AWCB 2RFAA 3QWWA 3HIZA 4NIKA 5JMND 1PAQA 3GZSA 4XKCA 3EDTB 4FJYA 4CZ2D 3KSQA 3PRZA 4O1PA 3SFYA 5CECB 4DJAA 4KVOA 3AS8A 4WWOA 3FUEA 2V5FA 3HVEB 2DYSE 2CG3A 3ESLA 3CHSA 3MJWA 2RFMA 3D9MA 1QYMA 2F8XK 1NL4A 2XQ0A 2BUGA 2WXLA 1H2UA 3CVWA 2L6BA 5JA4D 2L0IA 4G24A 4U07A 3AS4A 4G25A 5HI7A 2XZTG 5T8IA 2LO6A 5A7DB 1Z3YA 4E85A 2RD0A 2KBXA 2GRRB 2PM6A 2VSNA 4JPSA 1XNFA 4GA1A 1Y8MA 4KZ0A
chains in the Genus database with same CATH topology
3SZ7A 1DVPA 1XGWA 3MV2B 2XPYA 1QZ2A 3ONKA 4DI3A 2CHZA 1OUVA 4A55A 3LKUA 2YQ8A 4APOA 2L9BA 2KCVA 4J0UA 5CCLA 5BT1A 1NP7A 3ASDA 1EPUA 1NA0A 2FBNA 2AXVA 2IF4A 2LAIA 4G11A 4LEUA 3SFZA 3D9NA 1EF1C 4RG9A 2PZIA 4JHJA 3FTSA 3CLJA 4FLBA 1HXIA 3JCKC 2WXNA 4DK5A 5ENNA 4N39A 3G2WA 2OOEA 2V4LA 2NXPA 1KT1A 3OXGA 4DPRA 1HF8A 4JZYA 3EHNA 4ANUA 3CSFA 5FT9A 4F7AA 2MOWA 2MRIA 2LNIA 3LY9A 3MGBA 4JVSA 1IHGA 3CVUA 5FZSA 4APFA 3ONLA 5FQ8A 4UWHA 3ZFWA 5EKQD 4BT9A 3MKQA 3D9OA 4MLPA 1IQUA 4JA7A 1WM5A 2OVBA 2J4DA 2XRYA 3ZYMA 5A6CA 1ZU2A 3HYMB 3Q4AB 4B8CB 2IOSA 1NA3A 5LOZA 4B0ZA 4HLEA 5EDSA 3SBSA 3LVRE 4LCTA 4G1TA 4HXIA 2DCPA 3D9JA 3CK8A 3G2VA 3FUMA 4EECA 2CG2A 3CKBA 3JYSA 3ZYKA 1OWMA 1ELWA 3MX3A 2J49A 3CGHA 3ZGQA 4A1GA 4UI9J 3ZN3A 3JQ0A 2Y3AA 2AVPA 3D3MA 4OVUA 4W9RA 5BUZA 2Y4TA 3G2UA 3PZDA 4NURA 4GAAA 4J8SA 5JHAA 4XI0A 4Q94A 4URKA 1HG5A 1PC2A 2FF4A 3U64A 1HH8A 2I6HA 2VQ2A 4WUYA 3R7QA 3U4TA 2WPVA 3TGOA 1FVFA 2RG8A 4HFGA 4UWLA 4UQYA 4ACKA 4EQFA 1E7VA 4H7XA 2OVFA 5E75A 3TG4A 5FQ4A 1U3DA 4EZJA 4HOTA 4HOQA 2V8SE 4Y6CA 3N71A 5M72A 2J09A 3ASFA 2WM9A 3NF1A 2X6IA 1E8ZA 4OYSA 2CHWA 2VGYA 3RIBA 1YA0A 3QJZA 4IULA 2ILRA 4FP7A 4M3OA 4JHKA 3CVYA 2I1JA 4KZCA 3IHVA 3P2BA 4GA2A 3S7FA 1HX8A 4NQ0A 4PH4B 2J08A 3KD7A 2UY1B 4HS2A 4KVMA 3LY7A 3SNXA 4PS7A 3UUXA 4WWNA 2GRLA 1HE8A 4L1BA 4B89A 1IYGA 1INZA 4JXTA 1E8WA 2L6JA 5AJLA 3OTNA 3LVQE 3FUDA 4GYYA 3B7RL 3R7RA 3RJVA 2J07A 2X6JA 3FUJA 3VTYA 4ANVA 4MS6A 2VTBB 1FCHA 5ANRA 3CKCA 5G2NA 2R17C 5LP0A 4FA6A 4K03A 3PEVB 4DI4A 5G55A 4GCOA 4UI9C 4D10C 2KCKA 1EDUA 4ILIA 3FHEA 3S7BA 1HFAA 2KZTB 2VJ8A 4I9CA 2WXQA 3FWVA 5HQ8A 1A17A 3O48A 3FU5A 3PUJA 2VSXE 2X6KA 1HS6A 4KT6B 3SBTB 2J4BA 5FQ6A 1S0PA 3PS6A 3IKOB 1U3CA 2BF0X 2PQRA 2X3MA 4I1OB 5FQ7A 3CR3A 3IV0A 5FWQA 4J6IA 4HOSA 5ANLA 1UJKA 3UQ3A 4CGWA 2JLBA 3FEXA 3LEWA 2WXGA 3ZIMA 2WXHA 3PREA 3VLFA 5C2YA 4I1MA 4A1SA 4GB9A 4I2WA 4GMLA 2P58C 4DLQA 3CVQA 3ASGA 3C98A 1HO8A 4GZ6A 1QNFA 2CFZA 3TAXA 4EBAA 5T4YA 3VLEA 4K0RA 2IJGX 2ONDA 4U8HA 4CCAA 2JEKA 3HVEA 4WNGA 5CMWA 2WXOA 4KMOA 4PDXA 3EIJA 2AXUA 4KBQA 3QARA 1TEZA 4RVBA 2IOLA 4HOUA 3B7UX 1OWLA 3EIQC 2QFCA 3URZA 3NQPA 3OXFA 1JUQA 3PNLB 3QK0A 4MKTA 3FUIA 2UWJG 5ARFA 4E6HA 1WY6A 4FHKA 3CVNA 4XX5A 2XEVA 1B89A 3FU0A 3PEUB 3PNTB 4GPKA 1OWOA 2WXJA 4XZ4A 3ZRHA 1IQRA 3L22A 4LUNU 4RSYA 5KCMA 3RU0A 4UWKA 4AV7A 3KS2A 2XGSA 4PS3A 2WXPA 3E4BA 4F1SA 4L2YA 2KCLA 3D9KA 3FFLA 3MEKA 4C0EA 4CEMA 5CMYA 2XPZA 3CSTA 2EQXA 2NSZA 3MKQB 4WAFA 3FTUA 3FDHA 1MHQA 4EZLA 4CDNA 1FVHA 4JA9A 3UMVA 3R9AB 4L7TA 4AY6A 3K9IA 4BSXA 3QKYA 4G2VA 3TXMA 3UPVA 4IN3B 4BTAA 1Z3XA 4Y6WA 2XHEA 2YINA 2WXIA 3ESKA 3PE4A 1PY1A 2J9QA 3IEGA 4XE0A 5A23A 3CVLA 1GW6A 3IBEA 2WXMA 4Q69A 3GZ2A 3FTZA 3L08A 3LYAA 3L6AA 4U63A 3WXXA 4EPZA 3VTXA 2WQ6A 2YNQA 4YNDA 3CQCB 3ULQA 5JHBA 1HG2A 4BT8A 1N52A 3LXUX 4J8FA 2IONA 3ASHA 4A3VA 2KZTA 3Q15A 5C1DA 3RO2A 5FZQA 3CVPA 3KAEA 1HU3A 3CHQA 2WMNA 4I9EA 4I6GA 2X6HA 3I4RB 3Q47B 5G04C 4GCNA 4GZ3A 2AXZA 2PM7A 5AJDA 3TXNA 3QB2A 4ANWA 4GMJA 1OWPA 3JUIA 3RO3A 4FJZA 5FZRA 3BG0B 1X5BA 3ZEFA 1TJCA 3U3WA 4ME2A 1UG3A 2ZU6B 3UT4A 3CHRA 3DPDA 4ACLA 3ML8A 3SHFA 2OV8A 4PS8A 4Q96A 4FLHA 3AU4A 5BW8C 3LJ3A 2VGXB 2XRZA 2BTDA 2X38A 3SI5A 3T5XA 3RRUA 3KEZA 4HVBA 3QWPA 2IU1A 2WB2A 3PDNA 5EX0A 3FUHA 1SZAA 5J08A 4H7YA 1UN8A 3L17A 3DBSA 1EYHA 1TJFA 4F3VA 4I2ZA 3PH0C 4ANXA 2PL2A 3IHYA 4XI9A 3FTXA 3FU6A 3UX4A 2I2OA 4FADA 1JPLA 2HO1A 4IRUA 4GYWA 4ILHB 3AS5A 2PQNA 3LY8A 4N5CA 1H2TC 5EX3A 3CVVA 2C0MA 2WXFA 4AY5A 2FEZA 4FU3A 3RKVA 1W3BA 4L23A 3FU3A 4AOFA 1E8YA 1UW4B 2V0PA 3U9WA 5LCWJ 4JEHA 5T3RA 2WMOA 3MYVA 1KT0A 2R5SA 3BG1B 2A4ZA 4WNFA 2KM4A 4WNDA 1VDYA 4WNEA 4CDMA 3B7SA 4HORA 4WWPA 4I1AA 3ZPJA 2WQ7A 4BX8A 3ZW3A 3ZVVA 3TJPA 2I9CA 3MKRA 3CHMA 3I4GA 3EHMA 4CDRA 3MCXA 5AENA 2MHKA 4FC8A 4P29A 2XCCA 5AYWD 4ILGA 4N2SA 2YHEA 3ML9A 4KXKB 4U0SA 3CV0A 4UWFA 1UJJA 3QWVA 3I5PA 4CGVA 2L0TB 1HZ4A 3FTVA 4QFVA 1MQSA 3FEYA 3ZHEA 1E90A 3FTWA 4B94A 3L54A 3APFA 3B13A 1OWNA 3UT8A 1NZNA 2HR2A 4B8AA 2VGXA 4EBAG 2KC7A 2WXKA 4GA0A 5CHEE 5DIZA 3BEEA 4V3IA 2IFUA 4LRZA 1E96B 2A5UA 3NZSA 3Q49B 5KJLA 1JWGA 4JC8A 4FHJA 3QNKA 2C0LA 4NRHB 2IQCA 3JQ1A 3LS8A 1UN9A 4BFRA 4CRWA 2LAHA 3RK6A 4N3CA 4C9BB 3QC1A 3D9LA 1H2VC 2Q7FA 3QDNA 3FY4A 3CK7A 4DLOA 4GU5A 1LF8A 3ZHEB 1ZBPA 2VTBA 2FO7A 3T5VA 2WXRA 3CHPA 4LERA 4F53A 3OXLA 5JJ6A 4N2QA 2VSYA 5KJMA 2AW6A 2LSVA 4TRQA 3GYZA 2Y4UA 1E7UA 3HDXA 2GW1A 4KYOB 4UWGA 3CVXA 3TL5A 2WVIA 3APCA 3QOUA 4N3BA 2XGOA 3OAWA 1QQEA 3FH7A 3P1UA 4AP2A 4GZ5A 4L2LA 3VLDA 5E76A 3FULA 3LDZA 1ELKA 1H6KA 1JWFA 5D0QD 1H19A 4G23A 5G05C 1P5QA 2XCBA 2I1KA 4TUUA 2FULA 4TV3A 4AVXA 4I6EA 4IYPA 4JL0A 4R7LA 4JW1A 3ZYQA 3S2AA 2WQHA 3GW4A 3D9IA 4NACA 3FH8A 5ARGA 3SGHA 5BV1A 4YVOA 3RRNB 4AEZC 3L13A 2QY7A 5FJYA 4BWRA 3G2SA 1L5JA 3SF4A 4BY6A 4A3TA 2KATA 3SD5A 5FTPA 3PUKA 3PVLA 4OVVA 5BPPA 3FUKA 5LFAA 2R59A 3QWWA 4AJWA 2CHXA 4I43A 5BV0A 1H0AA 3FUNA 4JHRA 3QAQA 4I17A 1WAO1 2AWIA 2NC9A 3HIZA 3ZYLA 2VSOE 1DNPA 3L16A 1PAQA 2XGMA 1SQMA 2DIWA 3CHOA 3GZSA 5KJNA 5G04J 4YVQC 4J8DA 4XKCA 3EDTB 2E0IA 4FJYA 4GZCA 2C2LA 3PRZA 5JJTA 4ATGA 3O4ZA 4UQZA 5LX8A 4CT0A 3FP3A 4DJAA 4U0ZA 5DBKA 3RRMB 4AM9A 3EJNA 5G05J 4KVOA 3AS8A 4WWOA 3G2TA 3FUEA 2LSUA 2V5FA 4XKBA 3LCAA 4UI9K 3S7DA 3S7JA 2M63A 1SZ9A 5KJKA 4ABNA 4JEUA 2E2EA 3HVEB 2CFUA 4CT4A 2CG3A 3ESLA 3NZUA 3MZLB 4J8EA 4XIFA 3CHSA 3MJWA 3CEQA 3MA5A 3U66A 4U04A 4BTBA 1Z6TA 3D9MA 3Q5MA 4I6JA 2XQ0A 2BUGA 5D0OD 5J90A 3FUFA 2WXLA 1BPOA 2HYZA 3CQGB 4BX9A 1H2UA 5AIJA 5LCWC 3CVWA 5BNWA 4EZKA 2GRMA 4N3AA 3UT7A 4RG6A 4O6FA 3FH5A 2L0IA 4G24A 3APDA 4U07A 1ELRA 2HM8A 3GZ1A 3AS4A 4C0MA 3FTYA 4G25A 3TG5A 4G26A 4AIFA 5CCMA 5JJ7A 4GZDA 5HI7A 1KLXA 2UY1A 3I3NA 5T8IA 2YHCA 4GYOA 2LO6A 4UQXA 2X6FA 5A7DB 2XPIA 1Z3YA 4E85A 3MV3B 1Y6IA 2RD0A 4PUCA 4U0UA 3ENEA 3CIAA 4AXHA 3D9PA 3CK9A 1E8XA 3B7TA 3T8MA 2VYIA 2PM6A 2VSNA 2DBAA 1XNFA 2FI7A 3PE3A 2GGFA 4JPSA 3AU5A 3LPZA 4GA1A 3ZXSA 1Y8MA 4FULA 3HHMA 4KZ0A 4MRUA 1N54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1G A;  4AEZ C;  3SI5 A;  2LAH A;  2WVI A; 
#chains in the Genus database with same CATH topology
 3SZ7 A;  3MV2 B;  2CHZ A;  1OUV A;  3LKU A;  2YQ8 A;  4J0U A;  1NA0 A;  2BED A;  2IF4 A;  4G11 A;  2ZGD A;  4LEU A;  3RSE G;  4GMR A;  2PZI A;  3JCK C;  4DX6 D;  4N39 A;  4GPM A;  2OOE A;  5CBO A;  2MRI A;  1IHG A;  5FQ8 A;  3MKQ A;  4MLP A;  1IQU A;  4JA7 A;  2J4D A;  2XRY A;  3ZYM A;  1ZU2 A;  5LOZ A;  4HLE A;  1TNB A;  4LCT A;  4G1T A;  3D9J A;  4U8V D;  3AAA C;  1DC2 A;  3CGH A;  3HXF A;  4A1G A;  3ZN3 A;  3DSS A;  3D3M A;  5BUZ A;  4W9R A;  3G2U A;  1NI1 A;  3PZD A;  4GAA A;  4J8S A;  4XI0 A;  4Q94 A;  4A63 B;  1HG5 A;  3U4T A;  3W9G A;  3ZUV B;  1E7V A;  3UTM A;  5HS0 A;  2X6I A;  1YA0 A;  4FP7 A;  3CVY A;  3BUA A;  2QYJ A;  2J08 A;  2UY1 B;  1S64 A;  4B89 A;  1OT8 A;  2L6J A;  3OTN A;  3R7R A;  2VTB B;  2EIN E;  2R17 C;  3PEV B;  3NAW A;  2KCK A;  4I9C A;  5HQ8 A;  2X6K A;  1HS6 A;  3SBT B;  3AG1 E;  1U3C A;  2PQR A;  3IV0 A;  5BXO A;  3UQ3 A;  1BI7 B;  4CGW A;  1O5M A;  3FEX A;  3PRE A;  4DLQ A;  1HO8 A;  4Z68 A;  2EIJ E;  3J5P A;  4K0R A;  3HVE A;  4WNG A;  4PDX A;  3PZ4 A;  3EIJ A;  2P9N G;  2IOL A;  1OWL A;  2QFC A;  3OXF A;  1JUQ A;  3DXM G;  4MKT A;  3DPY A;  4E6H A;  4FHK A;  3CVN A;  2XEV A;  1B89 A;  4GPK A;  2WXJ A;  3L22 A;  4LUN U;  4F1S A;  1NFI E;  3DST A;  5CMY A;  1OCR E;  2EQX A;  1FVH A;  2IEJ A;  3R9A B;  4AY6 A;  3K9I A;  1LD7 A;  1Z3X A;  4DX1 A;  3ESK A;  3PE4 A;  2J9Q A;  5A23 A;  3IBE A;  2WXM A;  4Q69 A;  3GZ2 A;  3WXX A;  3ULY A;  2J8S D;  4EPZ A;  2OCC E;  3EHQ A;  5EIL A;  2YNQ A;  3ULQ A;  2AJA A;  5JHB A;  5C1D A;  3RO2 A;  5G04 C;  5AJD A;  1OWP A;  1SW6 A;  3BG0 B;  3ZEF A;  4ZHB A;  3CHR A;  2OV8 A;  1MX4 A;  2NYJ A;  2BTD A;  2IU1 A;  5EX0 A;  1SZA A;  1UN8 A;  1TJF A;  3PH0 C;  2I2O A;  4ILH B;  2PQN A;  4N5C A;  1H2T C;  2WXF A;  2FEZ A;  3ABM E;  3RKV A;  1N0Q A;  2V0P A;  3U9W A;  4JEH A;  5T3R A;  3C5R A;  4WNF A;  2A4Z A;  2KM4 A;  3J5Q B;  1VDY A;  2F8Y A;  2P2C P;  4YDW A;  4I1A A;  3EHM A;  1N4S A;  5AEN A;  4P29 A;  5AYW D;  3UM1 A;  2YHE A;  3CV0 A;  3DSU A;  1UJJ A;  1TR4 A;  3QWV A;  2L0T B;  1HZ4 A;  2XEH A;  3FEY A;  1OY3 D;  3L54 A;  3APF A;  1OWN A;  5ENS D;  3SO8 A;  5AAR A;  4B8A A;  2VGX A;  2WXK A;  4V3I A;  2IFU A;  5KJL A;  1O1T A;  2C0L A;  3JQ1 A;  4CRW A;  3D9H A;  4OAU C;  4GU5 A;  1LF8 A;  2FO7 A;  4LER A;  4F53 A;  3UM3 A;  2VSY A;  3L9T A;  3CVX A;  1V54 E;  3APC A;  2ETA A;  3QOU A;  4N3B A;  3AG4 E;  4GZ5 A;  3VLD A;  5E76 A;  5D0Q D;  1ELK A;  2H6H A;  2XCB A;  4U7E B;  1FT1 A;  4AVX A;  4JL0 A;  3ZYQ A;  4LNU D;  3UKU G;  2DWZ A;  3L13 A;  2QY7 A;  3G2S A;  4BY6 A;  4A3T A;  2KAT A;  3PUK A;  4N5Q A;  4AJW A;  5LFA A;  2CHX A;  5BV0 A;  5AQ7 A;  4JHR A;  3DSV A;  3QAQ A;  3X2Q E;  1WAO 1;  3KSL A;  2NC9 A;  2VSO E;  3CHO A;  5KJN A;  1SQM A;  2DIW A;  4X8Q A;  5G04 J;  3UI2 A;  4GZC A;  2C2L A;  4AM9 A;  4XKB A;  3PZ1 A;  4UI9 K;  3S7J A;  3TWX A;  5FIO A;  1SZ9 A;  3E32 A;  4ABN A;  2CFU A;  3NZU A;  3MZL B;  4XIF A;  3CEQ A;  3Q5M A;  4M7C A;  2Y0B G;  1K1A A;  2HYZ A;  4N3A A;  4RG6 A;  3FH5 A;  2MYO A;  2HM8 A;  1X81 A;  4C0M A;  3FTY A;  4G26 A;  5CCM A;  1KLX A;  2YHC A;  2X6F A;  1G3N B;  2P9S G;  3MV3 B;  3ENE A;  1TNY A;  2DBA A;  2FI7 A;  3LPZ A;  4O60 A;  1AP7 A;  3T5X A;  2H6G A;  2KCV A;  5CCL A;  1NP7 A;  3W9F A;  4LSZ E;  5ENP D;  1D8D A;  2WXN A;  1H6O A;  2QC9 A;  3JXI A;  4K5B A;  3EHN A;  4ANU A;  3CSF A;  4GTR A;  2MOW A;  2LNI A;  1N94 A;  3LY9 A;  3MGB A;  3CVU A;  5ENR D;  3ZFW A;  5EKQ D;  1QBQ A;  3HYM B;  3Q4A B;  4B8C B;  1NA3 A;  5EDS A;  3SBS A;  3G2V A;  1TN7 A;  3JYS A;  1OWM A;  5KBA A;  4HI8 A;  3ZGQ A;  1IXV A;  4UI9 J;  1FPP A;  3V2O A;  3KEA A;  2AVP A;  2Y4T A;  1IKN D;  2FF4 A;  3U64 A;  2VQ2 A;  5CRV A;  3R7Q A;  3TGO A;  2R2L A;  4H7X A;  1U3D A;  4GTT A;  4HOT A;  2V8S E;  2WM9 A;  3NF1 A;  5BXU A;  2VGY A;  3RIB A;  3QJZ A;  4JHK A;  3T9K A;  3IHV A;  4GA2 A;  1HX8 A;  4PH4 B;  1N4R A;  3LY7 A;  3TWW A;  1INZ A;  1E8W A;  3LVQ E;  5CEA A;  3FUJ A;  3VTY A;  4MS6 A;  1FCH A;  5ANR A;  3V2X A;  4FA6 A;  4K03 A;  4GCO A;  1N95 A;  3DSX A;  2GRQ B;  4J7W A;  2KZT B;  4KT6 B;  2J4B A;  3PS6 A;  3IKO B;  2BF0 X;  2X3M A;  4I1O B;  5FQ7 A;  4HOS A;  2F37 A;  4G8K A;  3R9M A;  3ZIM A;  2H6I A;  2WXH A;  5B1B E;  3VLF A;  4I1M A;  4A1S A;  4I2W A;  4GML A;  3CVQ A;  2CFZ A;  3TAX A;  1O1R A;  3VLE A;  2OND A;  2JEK A;  2WXO A;  1TEZ A;  4HOU A;  4GTM A;  3PNL B;  3QK0 A;  3PEU B;  3PNT B;  4XZ4 A;  1IQR A;  4RSY A;  3RU0 A;  4EHM A;  3E4B A;  4L2Y A;  2KCL A;  4C0E A;  2DVW A;  1MHQ A;  1JCS A;  3UMV A;  5AQB A;  3Q75 A;  2BKK B;  4BSX A;  1YYH A;  4Y6W A;  1TNZ A;  3CVL A;  3L08 A;  2IO2 C;  3LYA A;  4U63 A;  3VTX A;  1HG2 A;  1N52 A;  4J8F A;  2ION A;  3ASH A;  4GTV A;  5ENQ D;  3E37 A;  5HKP A;  3Q15 A;  2A5E A;  3CVP A;  3KAE A;  1KZO A;  3T8K A;  2PM7 A;  1ZB1 A;  4ANW A;  1O1S A;  4GMJ A;  1BI8 B;  1TJC A;  4ME2 A;  1UG3 A;  2EIL E;  1D9S A;  2VGX B;  3JXJ A;  2X38 A;  2WB2 A;  3PDN A;  2ETC A;  3FUH A;  5J08 A;  3DBS A;  1EYH A;  4MBG A;  2XS8 A;  4ANX A;  3IHY A;  3EHR A;  3FTX A;  4YDE A;  3UX4 A;  4HRN A;  4FAD A;  2XZD G;  3AS5 A;  3LY8 A;  3CVV A;  4GTQ A;  4AY5 A;  1W3B A;  4L23 A;  1Z5S C;  3MYV A;  4WND A;  4CDM A;  3ZPJ A;  3ZW3 A;  2I9C A;  3I4G A;  3F6Q A;  4CDR A;  2GRO B;  2XEN A;  2MHK A;  4FC8 A;  4ILG A;  4U0S A;  1DCE A;  1H6P A;  1N4P A;  4JB8 P;  4HNA D;  3I5P A;  3ZHE A;  1E90 A;  2HR2 A;  4EBA G;  4GA0 A;  3TWV A;  3BEE A;  1N0R A;  3ABL E;  1S70 B;  5CED B;  2LUH A;  3QC1 A;  3ISM C;  3QDN A;  2P9I G;  3CK7 A;  2JAB A;  1ZBP A;  1KZP A;  3OXL A;  5KJM A;  4TRQ A;  3GYZ A;  2Y4U A;  3HDX A;  4KYO B;  4UWG A;  4F6R D;  3UM2 A;  2XGO A;  1QQE A;  3V30 A;  3P1U A;  4AP2 A;  4CYM D;  1H6K A;  1JWF A;  1H19 A;  4G23 A;  2I1K A;  5EIB E;  3GW4 A;  1K1B A;  4NAC A;  3FH8 A;  5ARG A;  5BV1 A;  4AEZ C;  1KPS B;  3Q78 A;  4B93 B;  4I43 A;  3DEP A;  3FUN A;  3TWQ A;  3ZYL A;  1LTX A;  3L16 A;  4J8D A;  2E0I A;  3B95 A;  5JJT A;  3ULE G;  4ATG A;  5CER B;  3O4Z A;  5LX8 A;  3FP3 A;  4U0Z A;  2ZGG A;  5DBK A;  3RRM B;  3G2T A;  3LCA A;  5KJK A;  4JEU A;  2E2E A;  4CT4 A;  4J8E A;  4JD2 G;  5FIN A;  3U66 A;  5ENT D;  1Z6T A;  4BTB A;  4I6J A;  4DX7 D;  5D0O D;  3FUF A;  3CQG B;  4BX9 A;  5AIJ A;  2B6C A;  5BNW A;  4O6F A;  3GZ1 A;  3TG5 A;  3NOG D;  3I3N A;  4GYO A;  4UQX A;  3TWU A;  4U0U A;  4AXH A;  3CIA A;  1E8X A;  3T8M A;  1U2V G;  3BQO A;  3AU5 A;  3ZXS A;  4FUL A;  5FJY A;  2KXP C;  1UOH A;  4A55 A;  2HE0 A;  2L9B A;  5D2M C;  3PZ3 A;  3ASD A;  3E33 A;  1EPU A;  2FBN A;  2AXV A;  2LAI A;  5CBN A;  3D9N A;  1EF1 C;  4JHJ A;  5D66 A;  3CLJ A;  1HXI A;  4DK5 A;  3G2W A;  2NXP A;  1KT1 A;  4DPR A;  1HF8 A;  4JZY A;  4F7A A;  4ATZ D;  5FZS A;  2DYR E;  1SVX A;  3Q79 A;  2ETB A;  3TWS A;  1WM5 A;  3BU8 A;  3NOC D;  5A6C A;  4BER A;  2IOS A;  4G8L A;  3LVR E;  4HXI A;  4EEC A;  2CG2 A;  3CKB A;  3ZYK A;  1K3Z D;  1ELW A;  2J49 A;  1TNO A;  3JQ0 A;  4OVU A;  4NUR A;  1Q2Z A;  2LXM A;  4URK A;  5JHA A;  1PC2 A;  4WUY A;  2WPV A;  4ACK A;  4HFG A;  2IO3 C;  5FQ4 A;  4EZJ A;  4QQI A;  4HOQ A;  5M72 A;  3ASF A;  2R03 A;  4OYS A;  2CHW A;  2ILR A;  2I1J A;  4KZC A;  3S7F A;  4NQ0 A;  3JUE A;  4KVM A;  1BU9 A;  4U95 D;  4WWN A;  2GRL A;  4L1B A;  1IYG A;  3E30 A;  2X6J A;  3CKC A;  5G2N A;  3V79 K;  4DI4 A;  5G55 A;  4D10 C;  4ILI A;  1OXJ A;  3S7B A;  1HFA A;  2WXQ A;  1MYO A;  3FWV A;  3ZU7 B;  4RQI A;  5FWQ A;  2JLB A;  1MX2 A;  1S63 A;  3WG7 E;  1OCC E;  3ASG A;  3TWR A;  1MJ0 A;  3ZKJ A;  4KMO A;  2GRN B;  2H6F A;  2AXU A;  3QAR A;  4RVB A;  1YCS B;  2UWJ G;  5ARF A;  4XX5 A;  3UIP C;  1OWO A;  3SFX A;  4DX2 A;  3NB2 A;  2GRP B;  2XGS A;  3D9K A;  3FFL A;  5EN5 D;  3MEK A;  4CEM A;  3LJN A;  3CST A;  3E34 A;  2NSZ A;  5CRU A;  4HRM B;  3FTU A;  4EZL A;  4CDN A;  2P9L G;  4JA9 A;  3UKR G;  4HRL A;  3RAU A;  3UPV A;  3ASN E;  4G2V A;  3TXM A;  4BTA A;  1K8K G;  4U8Y D;  2XHE A;  2YIN A;  2WXI A;  1PY1 A;  3IEG A;  1GW6 A;  3L6A A;  1N9A A;  1RZ4 A;  2WQ6 A;  4LNB A;  4YND A;  4BET A;  3LXU X;  4OAV B;  5FZQ A;  1HU3 A;  2WMN A;  4I9E A;  1IHB A;  3I4R B;  3Q47 B;  4GCN A;  4GZ3 A;  2AXZ A;  1SA5 A;  3AG2 E;  5KNG A;  4FJZ A;  5FZR A;  4ACL A;  4HLL A;  3UT4 A;  3ML8 A;  4HQD A;  5AAO A;  4FLH A;  3LJ3 A;  2XRZ A;  4GTS A;  3KEZ A;  3HXE A;  3L17 A;  4F3V A;  4I2Z A;  2PL2 A;  4XI9 A;  3FU6 A;  1JPL A;  2HO1 A;  4LG6 A;  2OEW A;  5AQA A;  3V31 A;  1UW4 B;  4DX5 D;  2WMO A;  4GTP A;  1KT0 A;  2QZA A;  4TXQ A;  1TYQ G;  3B7S A;  4WWP A;  4BX8 A;  3TJP A;  3MKR A;  3CHM A;  5EID A;  2XCC A;  1MX6 A;  4UWF A;  3UXG A;  4QFV A;  1MQS A;  3B13 A;  3UT8 A;  1NZN A;  4LRZ A;  1E96 B;  2A5U A;  3Q49 B;  1JWG A;  3QNK A;  2IQC A;  3Q7A A;  3LS8 A;  1UN9 A;  4C9B B;  3D9L A;  1H2V C;  2Q7F A;  5EYP F;  2EIM E;  4DLO A;  3ZHE B;  1JCQ A;  3T5V A;  2WXR A;  3CHP A;  5JJ6 A;  4N2Q A;  5B3S E;  2LSV A;  1LD8 A;  3DEO A;  3TL5 A;  3ABK E;  3HG0 D;  3HRA A;  3IXE A;  4HBD A;  3FUL A;  3LDZ A;  5HRY A;  5G05 C;  3AJI A;  4TUU A;  2FUL A;  4TV3 A;  3L82 A;  4JW1 A;  3S2A A;  1V55 E;  3SGH A;  4YVO A;  2BKG A;  2PNN A;  4TXP A;  4YDY A;  4BWR A;  1L5J A;  3SF4 A;  1A5E A;  3SD5 A;  5B1A E;  5BPP A;  3FUK A;  2R59 A;  1H0A A;  2XS1 A;  4I17 A;  2AWI A;  1DNP A;  2XGM A;  3HXB A;  4YVQ C;  5ENO D;  4UQZ A;  4CT0 A;  2LXL A;  1RW2 A;  1FT2 A;  3EJN A;  5G05 J;  2LSU A;  3S7D A;  2M63 A;  4L9P A;  2RKK A;  3MA5 A;  4U04 A;  5J90 A;  1BPO A;  1OCZ E;  3DWL G;  3ZNG A;  5LCW C;  4EZK A;  2GRM A;  3UT7 A;  3APD A;  1ELR A;  1SA4 A;  2XEE A;  4AIF A;  2VGE A;  5JJ7 A;  4GZD A;  2UY1 A;  2XPI A;  1Y6I A;  4PUC A;  3D9P A;  3CK9 A;  4C48 B;  3B7T A;  3Q9U C;  2VYI A;  3PE3 A;  2GGF A;  2FO1 E;  3HHM A;  4MRU A;  1N54 A;  1DVP A;  1XGW A;  2XPY A;  1QZ2 A;  3ONK A;  4DI3 A;  3EU5 A;  3Q73 A;  4APO A;  5BT1 A;  5IY5 E;  4ZFH A;  4J8Y A;  2Y69 E;  1JCR A;  1D8E A;  3SFZ A;  4RG9 A;  4UUC A;  2OEV A;  3FTS A;  4FLB A;  1MZC A;  5ENN A;  2V4L A;  5KNH D;  3OXG A;  3AG3 E;  5AQ9 A;  5FT9 A;  4JVS A;  4APF A;  3ONL A;  4UWH A;  4BT9 A;  3D9O A;  2IY0 C;  2Y1L E;  3SQV A;  2OVB A;  2DZN A;  4B0Z A;  2DCP A;  3CK8 A;  3FUM A;  3MX3 A;  4TUM A;  2Y3A A;  4BES A;  1HH8 A;  1BLX B;  2I6H A;  1YMP A;  4EQF A;  1FVF A;  2RG8 A;  4UWL A;  4UQY A;  4XEI G;  2OVF A;  5E75 A;  3TG4 A;  4Y6C A;  3N71 A;  2J09 A;  1E8Z A;  4IUL A;  4M3O A;  3P2B A;  2F0Y A;  3KD7 A;  4HS2 A;  3SNX A;  4PS7 A;  3UUX A;  1HE8 A;  1TN6 A;  4JXT A;  4TXR A;  5AJL A;  3FUD A;  4GYY A;  3B7R L;  4HI9 A;  2J07 A;  3RJV A;  4ANV A;  5LP0 A;  3C3O A;  4UI9 C;  1EDU A;  3FHE A;  2VJ8 A;  1A17 A;  2P9P G;  3O48 A;  4DRX E;  1N4Q A;  3FU5 A;  3PUJ A;  2VSX E;  3DRA A;  5FQ6 A;  1S0P A;  3UIN C;  3CR3 A;  4J6I A;  4K5C A;  5ANL A;  1UJK A;  4HB5 A;  3LEW A;  2WXG A;  5C2Y A;  4GB9 A;  2P58 C;  2P9U G;  5ITZ F;  2ZIR A;  3C98 A;  2EIK E;  4GZ6 A;  1QNF A;  4EBA A;  5T4Y A;  2IJG X;  4U8H A;  4CCA A;  5CMW A;  4KBQ A;  3B7U X;  3EIQ C;  3URZ A;  3NQP A;  2B0O E;  3FUI A;  1N11 A;  1WG0 A;  1WY6 A;  3FU0 A;  3ZRH A;  5KCM A;  4UWK A;  4AV7 A;  3KS2 A;  4PS3 A;  2WXP A;  2P9K G;  2XPZ A;  3MKQ B;  4WAF A;  3FDH A;  3PZ2 A;  4L7T A;  3QKY A;  4RLY A;  4IN3 B;  4GTO A;  4XE0 A;  4K5A B;  3FTZ A;  3EUV A;  4F1P A;  3EU9 A;  3CQC B;  3DXK G;  4BT8 A;  4A3V A;  2KZT A;  3ASO E;  3C3R A;  3CHQ A;  4I6G A;  4BSZ B;  2X6H A;  3TXN A;  3QB2 A;  3JUI A;  3RO3 A;  1X5B A;  3U3W A;  2ZU6 B;  3DPD A;  4YDO A;  3SHF A;  4PS8 A;  4Q96 A;  2ZXW E;  3AU4 A;  5BW8 C;  5H7P A;  4HVB A;  3SI5 A;  3RRU A;  3QWP A;  1WDY A;  3SY2 A;  4H7Y A;  3UM0 A;  4LNG A;  2R05 A;  4IRU A;  4GYW A;  5EX3 A;  2C0M A;  4FU3 A;  3NBN B;  3FU3 A;  4AOF A;  1E8Y A;  1OCO E;  5LCW J;  2R02 A;  2R5S A;  3B7B A;  3BG1 B;  4WNE A;  4HOR A;  2V4H C;  2WQ7 A;  3Q7F A;  3ZVV A;  3MCX A;  3TWT A;  3DSW A;  4N2S A;  4KXK B;  3ML9 A;  1TNU A;  4CGV A;  4U96 D;  5AN8 A;  3FTV A;  3FTW A;  4B94 A;  2KC7 A;  5CHE E;  5DIZ A;  3HXC A;  3NZS A;  2V5Q C;  4JC8 A;  4FHJ A;  4NRH B;  4BFR A;  2LAH A;  3RK6 A;  5KWD A;  4N3C A;  1TN8 A;  3FY4 A;  3HXD A;  3Q9N C;  1BD8 A;  2VTB A;  2DZO A;  2QYU A;  2AW6 A;  1E7U A;  3C3Q A;  2GW1 A;  2WVI A;  4BEP A;  3OAW A;  3FH7 A;  4DUI A;  1DCQ A;  4L2L A;  3UIO C;  1P5Q A;  2ZIS A;  4I6E A;  4IYP A;  4R7L A;  4O1O A;  2WQH A;  3D9I A;  5EYL A;  3ZXP A;  3RRN B;  5FTP A;  3PVL A;  4OVV A;  3C72 A;  1AWC B;  2RFA A;  3QWW A;  3HIZ A;  4NIK A;  5JMN D;  1PAQ A;  3GZS A;  4XKC A;  3EDT B;  4FJY A;  4CZ2 D;  3KSQ A;  3PRZ A;  4O1P A;  3SFY A;  5CEC B;  4DJA A;  4KVO A;  3AS8 A;  4WWO A;  3FUE A;  2V5F A;  3HVE B;  2DYS E;  2CG3 A;  3ESL A;  3CHS A;  3MJW A;  2RFM A;  3D9M A;  1QYM A;  2F8X K;  1NL4 A;  2XQ0 A;  2BUG A;  2WXL A;  1H2U A;  3CVW A;  2L6B A;  5JA4 D;  2L0I A;  4G24 A;  4U07 A;  3AS4 A;  4G25 A;  5HI7 A;  2XZT G;  5T8I A;  2LO6 A;  5A7D B;  1Z3Y A;  4E85 A;  2RD0 A;  2KBX A;  2GRR B;  2PM6 A;  2VSN A;  4JPS A;  1XNF A;  4GA1 A;  1Y8M A;  4KZ0 A; 
#chains in the Genus database with same CATH homology
 3SZ7 A;  1DVP A;  1XGW A;  3MV2 B;  2XPY A;  1QZ2 A;  3ONK A;  4DI3 A;  2CHZ A;  1OUV A;  4A55 A;  3LKU A;  2YQ8 A;  4APO A;  2L9B A;  2KCV A;  4J0U A;  5CCL A;  5BT1 A;  1NP7 A;  3ASD A;  1EPU A;  1NA0 A;  2FBN A;  2AXV A;  2IF4 A;  2LAI A;  4G11 A;  4LEU A;  3SFZ A;  3D9N A;  1EF1 C;  4RG9 A;  2PZI A;  4JHJ A;  3FTS A;  3CLJ A;  4FLB A;  1HXI A;  3JCK C;  2WXN A;  4DK5 A;  5ENN A;  4N39 A;  3G2W A;  2OOE A;  2V4L A;  2NXP A;  1KT1 A;  3OXG A;  4DPR A;  1HF8 A;  4JZY A;  3EHN A;  4ANU A;  3CSF A;  5FT9 A;  4F7A A;  2MOW A;  2MRI A;  2LNI A;  3LY9 A;  3MGB A;  4JVS A;  1IHG A;  3CVU A;  5FZS A;  4APF A;  3ONL A;  5FQ8 A;  4UWH A;  3ZFW A;  5EKQ D;  4BT9 A;  3MKQ A;  3D9O A;  4MLP A;  1IQU A;  4JA7 A;  1WM5 A;  2OVB A;  2J4D A;  2XRY A;  3ZYM A;  5A6C A;  1ZU2 A;  3HYM B;  3Q4A B;  4B8C B;  2IOS A;  1NA3 A;  5LOZ A;  4B0Z A;  4HLE A;  5EDS A;  3SBS A;  3LVR E;  4LCT A;  4G1T A;  4HXI A;  2DCP A;  3D9J A;  3CK8 A;  3G2V A;  3FUM A;  4EEC A;  2CG2 A;  3CKB A;  3JYS A;  3ZYK A;  1OWM A;  1ELW A;  3MX3 A;  2J49 A;  3CGH A;  3ZGQ A;  4A1G A;  4UI9 J;  3ZN3 A;  3JQ0 A;  2Y3A A;  2AVP A;  3D3M A;  4OVU A;  4W9R A;  5BUZ A;  2Y4T A;  3G2U A;  3PZD A;  4NUR A;  4GAA A;  4J8S A;  5JHA A;  4XI0 A;  4Q94 A;  4URK A;  1HG5 A;  1PC2 A;  2FF4 A;  3U64 A;  1HH8 A;  2I6H A;  2VQ2 A;  4WUY A;  3R7Q A;  3U4T A;  2WPV A;  3TGO A;  1FVF A;  2RG8 A;  4HFG A;  4UWL A;  4UQY A;  4ACK A;  4EQF A;  1E7V A;  4H7X A;  2OVF A;  5E75 A;  3TG4 A;  5FQ4 A;  1U3D A;  4EZJ A;  4HOT A;  4HOQ A;  2V8S E;  4Y6C A;  3N71 A;  5M72 A;  2J09 A;  3ASF A;  2WM9 A;  3NF1 A;  2X6I A;  1E8Z A;  4OYS A;  2CHW A;  2VGY A;  3RIB A;  1YA0 A;  3QJZ A;  4IUL A;  2ILR A;  4FP7 A;  4M3O A;  4JHK A;  3CVY A;  2I1J A;  4KZC A;  3IHV A;  3P2B A;  4GA2 A;  3S7F A;  1HX8 A;  4NQ0 A;  4PH4 B;  2J08 A;  3KD7 A;  2UY1 B;  4HS2 A;  4KVM A;  3LY7 A;  3SNX A;  4PS7 A;  3UUX A;  4WWN A;  2GRL A;  1HE8 A;  4L1B A;  4B89 A;  1IYG A;  1INZ A;  4JXT A;  1E8W A;  2L6J A;  5AJL A;  3OTN A;  3LVQ E;  3FUD A;  4GYY A;  3B7R L;  3R7R A;  3RJV A;  2J07 A;  2X6J A;  3FUJ A;  3VTY A;  4ANV A;  4MS6 A;  2VTB B;  1FCH A;  5ANR A;  3CKC A;  5G2N A;  2R17 C;  5LP0 A;  4FA6 A;  4K03 A;  3PEV B;  4DI4 A;  5G55 A;  4GCO A;  4UI9 C;  4D10 C;  2KCK A;  1EDU A;  4ILI A;  3FHE A;  3S7B A;  1HFA A;  2KZT B;  2VJ8 A;  4I9C A;  2WXQ A;  3FWV A;  5HQ8 A;  1A17 A;  3O48 A;  3FU5 A;  3PUJ A;  2VSX E;  2X6K A;  1HS6 A;  4KT6 B;  3SBT B;  2J4B A;  5FQ6 A;  1S0P A;  3PS6 A;  3IKO B;  1U3C A;  2BF0 X;  2PQR A;  2X3M A;  4I1O B;  5FQ7 A;  3CR3 A;  3IV0 A;  5FWQ A;  4J6I A;  4HOS A;  5ANL A;  1UJK A;  3UQ3 A;  4CGW A;  2JLB A;  3FEX A;  3LEW A;  2WXG A;  3ZIM A;  2WXH A;  3PRE A;  3VLF A;  5C2Y A;  4I1M A;  4A1S A;  4GB9 A;  4I2W A;  4GML A;  2P58 C;  4DLQ A;  3CVQ A;  3ASG A;  3C98 A;  1HO8 A;  4GZ6 A;  1QNF A;  2CFZ A;  3TAX A;  4EBA A;  5T4Y A;  3VLE A;  4K0R A;  2IJG X;  2OND A;  4U8H A;  4CCA A;  2JEK A;  3HVE A;  4WNG A;  5CMW A;  2WXO A;  4KMO A;  4PDX A;  3EIJ A;  2AXU A;  4KBQ A;  3QAR A;  1TEZ A;  4RVB A;  2IOL A;  4HOU A;  3B7U X;  1OWL A;  3EIQ C;  2QFC A;  3URZ A;  3NQP A;  3OXF A;  1JUQ A;  3PNL B;  3QK0 A;  4MKT A;  3FUI A;  2UWJ G;  5ARF A;  4E6H A;  1WY6 A;  4FHK A;  3CVN A;  4XX5 A;  2XEV A;  1B89 A;  3FU0 A;  3PEU B;  3PNT B;  4GPK A;  1OWO A;  2WXJ A;  4XZ4 A;  3ZRH A;  1IQR A;  3L22 A;  4LUN U;  4RSY A;  5KCM A;  3RU0 A;  4UWK A;  4AV7 A;  3KS2 A;  2XGS A;  4PS3 A;  2WXP A;  3E4B A;  4F1S A;  4L2Y A;  2KCL A;  3D9K A;  3FFL A;  3MEK A;  4C0E A;  4CEM A;  5CMY A;  2XPZ A;  3CST A;  2EQX A;  2NSZ A;  3MKQ B;  4WAF A;  3FTU A;  3FDH A;  1MHQ A;  4EZL A;  4CDN A;  1FVH A;  4JA9 A;  3UMV A;  3R9A B;  4L7T A;  4AY6 A;  3K9I A;  4BSX A;  3QKY A;  4G2V A;  3TXM A;  3UPV A;  4IN3 B;  4BTA A;  1Z3X A;  4Y6W A;  2XHE A;  2YIN A;  2WXI A;  3ESK A;  3PE4 A;  1PY1 A;  2J9Q A;  3IEG A;  4XE0 A;  5A23 A;  3CVL A;  1GW6 A;  3IBE A;  2WXM A;  4Q69 A;  3GZ2 A;  3FTZ A;  3L08 A;  3LYA A;  3L6A A;  4U63 A;  3WXX A;  4EPZ A;  3VTX A;  2WQ6 A;  2YNQ A;  4YND A;  3CQC B;  3ULQ A;  5JHB A;  1HG2 A;  4BT8 A;  1N52 A;  3LXU X;  4J8F A;  2ION A;  3ASH A;  4A3V A;  2KZT A;  3Q15 A;  5C1D A;  3RO2 A;  5FZQ A;  3CVP A;  3KAE A;  1HU3 A;  3CHQ A;  2WMN A;  4I9E A;  4I6G A;  2X6H A;  3I4R B;  3Q47 B;  5G04 C;  4GCN A;  4GZ3 A;  2AXZ A;  2PM7 A;  5AJD A;  3TXN A;  3QB2 A;  4ANW A;  4GMJ A;  1OWP A;  3JUI A;  3RO3 A;  4FJZ A;  5FZR A;  3BG0 B;  1X5B A;  3ZEF A;  1TJC A;  3U3W A;  4ME2 A;  1UG3 A;  2ZU6 B;  3UT4 A;  3CHR A;  3DPD A;  4ACL A;  3ML8 A;  3SHF A;  2OV8 A;  4PS8 A;  4Q96 A;  4FLH A;  3AU4 A;  5BW8 C;  3LJ3 A;  2VGX B;  2XRZ A;  2BTD A;  2X38 A;  3SI5 A;  3T5X A;  3RRU A;  3KEZ A;  4HVB A;  3QWP A;  2IU1 A;  2WB2 A;  3PDN A;  5EX0 A;  3FUH A;  1SZA A;  5J08 A;  4H7Y A;  1UN8 A;  3L17 A;  3DBS A;  1EYH A;  1TJF A;  4F3V A;  4I2Z A;  3PH0 C;  4ANX A;  2PL2 A;  3IHY A;  4XI9 A;  3FTX A;  3FU6 A;  3UX4 A;  2I2O A;  4FAD A;  1JPL A;  2HO1 A;  4IRU A;  4GYW A;  4ILH B;  3AS5 A;  2PQN A;  3LY8 A;  4N5C A;  1H2T C;  5EX3 A;  3CVV A;  2C0M A;  2WXF A;  4AY5 A;  2FEZ A;  4FU3 A;  3RKV A;  1W3B A;  4L23 A;  3FU3 A;  4AOF A;  1E8Y A;  1UW4 B;  2V0P A;  3U9W A;  5LCW J;  4JEH A;  5T3R A;  2WMO A;  3MYV A;  1KT0 A;  2R5S A;  3BG1 B;  2A4Z A;  4WNF A;  2KM4 A;  4WND A;  1VDY A;  4WNE A;  4CDM A;  3B7S A;  4HOR A;  4WWP A;  4I1A A;  3ZPJ A;  2WQ7 A;  4BX8 A;  3ZW3 A;  3ZVV A;  3TJP A;  2I9C A;  3MKR A;  3CHM A;  3I4G A;  3EHM A;  4CDR A;  3MCX A;  5AEN A;  2MHK A;  4FC8 A;  4P29 A;  2XCC A;  5AYW D;  4ILG A;  4N2S A;  2YHE A;  3ML9 A;  4KXK B;  4U0S A;  3CV0 A;  4UWF A;  1UJJ A;  3QWV A;  3I5P A;  4CGV A;  2L0T B;  1HZ4 A;  3FTV A;  4QFV A;  1MQS A;  3FEY A;  3ZHE A;  1E90 A;  3FTW A;  4B94 A;  3L54 A;  3APF A;  3B13 A;  1OWN A;  3UT8 A;  1NZN A;  2HR2 A;  4B8A A;  2VGX A;  4EBA G;  2KC7 A;  2WXK A;  4GA0 A;  5CHE E;  5DIZ A;  3BEE A;  4V3I A;  2IFU A;  4LRZ A;  1E96 B;  2A5U A;  3NZS A;  3Q49 B;  5KJL A;  1JWG A;  4JC8 A;  4FHJ A;  3QNK A;  2C0L A;  4NRH B;  2IQC A;  3JQ1 A;  3LS8 A;  1UN9 A;  4BFR A;  4CRW A;  2LAH A;  3RK6 A;  4N3C A;  4C9B B;  3QC1 A;  3D9L A;  1H2V C;  2Q7F A;  3QDN A;  3FY4 A;  3CK7 A;  4DLO A;  4GU5 A;  1LF8 A;  3ZHE B;  1ZBP A;  2VTB A;  2FO7 A;  3T5V A;  2WXR A;  3CHP A;  4LER A;  4F53 A;  3OXL A;  5JJ6 A;  4N2Q A;  2VSY A;  5KJM A;  2AW6 A;  2LSV A;  4TRQ A;  3GYZ A;  2Y4U A;  1E7U A;  3HDX A;  2GW1 A;  4KYO B;  4UWG A;  3CVX A;  3TL5 A;  2WVI A;  3APC A;  3QOU A;  4N3B A;  2XGO A;  3OAW A;  1QQE A;  3FH7 A;  3P1U A;  4AP2 A;  4GZ5 A;  4L2L A;  3VLD A;  5E76 A;  3FUL A;  3LDZ A;  1ELK A;  1H6K A;  1JWF A;  5D0Q D;  1H19 A;  4G23 A;  5G05 C;  1P5Q A;  2XCB A;  2I1K A;  4TUU A;  2FUL A;  4TV3 A;  4AVX A;  4I6E A;  4IYP A;  4JL0 A;  4R7L A;  4JW1 A;  3ZYQ A;  3S2A A;  2WQH A;  3GW4 A;  3D9I A;  4NAC A;  3FH8 A;  5ARG A;  3SGH A;  5BV1 A;  4YVO A;  3RRN B;  4AEZ C;  3L13 A;  2QY7 A;  5FJY A;  4BWR A;  3G2S A;  1L5J A;  3SF4 A;  4BY6 A;  4A3T A;  2KAT A;  3SD5 A;  5FTP A;  3PUK A;  3PVL A;  4OVV A;  5BPP A;  3FUK A;  5LFA A;  2R59 A;  3QWW A;  4AJW A;  2CHX A;  4I43 A;  5BV0 A;  1H0A A;  3FUN A;  4JHR A;  3QAQ A;  4I17 A;  1WAO 1;  2AWI A;  2NC9 A;  3HIZ A;  3ZYL A;  2VSO E;  1DNP A;  3L16 A;  1PAQ A;  2XGM A;  1SQM A;  2DIW A;  3CHO A;  3GZS A;  5KJN A;  5G04 J;  4YVQ C;  4J8D A;  4XKC A;  3EDT B;  2E0I A;  4FJY A;  4GZC A;  2C2L A;  3PRZ A;  5JJT A;  4ATG A;  3O4Z A;  4UQZ A;  5LX8 A;  4CT0 A;  3FP3 A;  4DJA A;  4U0Z A;  5DBK A;  3RRM B;  4AM9 A;  3EJN A;  5G05 J;  4KVO A;  3AS8 A;  4WWO A;  3G2T A;  3FUE A;  2LSU A;  2V5F A;  4XKB A;  3LCA A;  4UI9 K;  3S7D A;  3S7J A;  2M63 A;  1SZ9 A;  5KJK A;  4ABN A;  4JEU A;  2E2E A;  3HVE B;  2CFU A;  4CT4 A;  2CG3 A;  3ESL A;  3NZU A;  3MZL B;  4J8E A;  4XIF A;  3CHS A;  3MJW A;  3CEQ A;  3MA5 A;  3U66 A;  4U04 A;  4BTB A;  1Z6T A;  3D9M A;  3Q5M A;  4I6J A;  2XQ0 A;  2BUG A;  5D0O D;  5J90 A;  3FUF A;  2WXL A;  1BPO A;  2HYZ A;  3CQG B;  4BX9 A;  1H2U A;  5AIJ A;  5LCW C;  3CVW A;  5BNW A;  4EZK A;  2GRM A;  4N3A A;  3UT7 A;  4RG6 A;  4O6F A;  3FH5 A;  2L0I A;  4G24 A;  3APD A;  4U07 A;  1ELR A;  2HM8 A;  3GZ1 A;  3AS4 A;  4C0M A;  3FTY A;  4G25 A;  3TG5 A;  4G26 A;  4AIF A;  5CCM A;  5JJ7 A;  4GZD A;  5HI7 A;  1KLX A;  2UY1 A;  3I3N A;  5T8I A;  2YHC A;  4GYO A;  2LO6 A;  4UQX A;  2X6F A;  5A7D B;  2XPI A;  1Z3Y A;  4E85 A;  3MV3 B;  1Y6I A;  2RD0 A;  4PUC A;  4U0U A;  3ENE A;  3CIA A;  4AXH A;  3D9P A;  3CK9 A;  1E8X A;  3B7T A;  3T8M A;  2VYI A;  2PM6 A;  2VSN A;  2DBA A;  1XNF A;  2FI7 A;  3PE3 A;  2GGF A;  4JPS A;  3AU5 A;  3LPZ A;  4GA1 A;  3ZXS A;  1Y8M A;  4FUL A;  3HHM A;  4KZ0 A;  4MRU A;  1N54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...