2LAHA

Solution nmr structure of mitotic checkpoint serine/threonine-protein kinase bub1 n-terminal domain from homo sapiens, northeast structural genomics consortium target hr5460a (methods development)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
160
structure length
160
Chain Sequence
MGHHHHHHSHMDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1
publication title Northeast Structural Genomics Consortium Target HR5460A
rcsb
source organism Homo sapiens
molecule tags Cell cycle, apoptosis
total genus 59
structure length 160
sequence length 160
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lahA00
2LAHA 2WVIA 3SI5A 4AEZC 4A1GA
chains in the Genus database with same CATH superfamily
3MV3B 3AG1E 4KVOA 3TWVA 3NZUA 3JUEA 3D9IA 4J8EA 3O4ZA 3BQOA 5FT9A 4FU3A 3QWWA 1S0PA 2DCPA 3FY4A 3GZ2A 1EPUA 2F8XK 1UN8A 2YNQA 5CMYA 1BD8A 3ONLA 2XEHA 5ANRA 4KZCA 4GMLA 3PZ4A 4J6IA 2L9BA 3QNKA 2XEEA 3TG5A 3V30A 3V31A 3FUEA 4GTQA 4BSXA 2DWZA 4TXQA 5ARFA 3D9KA 5FQ8A 2WM9A 1OY3D 2VQ2A 2Y1LE 3EJNA 4Q96A 2QY7A 5AQ7A 5FZSA 2P9NG 1JWGA 3EIQC 1TN6A 3ULYA 1NA0A 1WY6A 4KBQA 3CK7A 2VSOE 3O48A 4J7WA 4CT4A 2KCKA 3L08A 5EX0A 2P9UG 3NF1A 3D9NA 4FA6A 4MBGA 3UUXA 4WAFA 4I1AA 1OWOA 4U7EB 4QFVA 3CVWA 1TNZA 1Y6IA 4CT0A 3MKQA 4ANXA 5LCWJ 3L82A 4A55A 4DX6D 3HYMB 1JWFA 4CRWA 3RK6A 2YINA 2P9KG 1JCSA 3CHQA 1IHBA 2XPYA 3TXNA 2MRIA 2V5FA 4D10C 1L5JA 2ZISA 3JUIA 5DBKA 2J07A 1KT1A 2XCBA 2X6KA 1TJFA 3CV0A 4MLPA 4JL0A 3ONKA 2IY0C 4GZ6A 4U8HA 4GZCA 1TEZA 1NP7A 4G23A 3CHSA 1HX8A 3HIZA 3FEYA 1UOHA 1Z3YA 4K03A 5ENSD 3DWLG 3S7JA 2NYJA 2V8SE 4DX7D 3DPYA 4UI9J 3UKUG 2WVIA 2VSXE 4Q94A 2YQ8A 3DSVA 3L13A 4BT9A 1Z3XA 2P9PG 3DEPA 5AJLA 1FPPA 4L2LA 3TG4A 4DI3A 3FTWA 1K1BA 2VYIA 3ZHEA 1TN8A 3ML8A 3BUAA 2WXJA 2V4HC 4OYSA 4LUNU 4M7CA 4G24A 3PUKA 2LAHA 4AOFA 3J5PA 2WPVA 3EUVA 3NOCD 5HS0A 1B89A 4C48B 1S70B 1N0QA 4V3IA 4GYWA 4GA0A 4GCOA 5EYPF 1BI8B 3PVLA 1N52A 3Q9UC 1X5BA 1FT2A 4IULA 1MZCA 3G2TA 2J4BA 4M3OA 4A1GA 1D9SA 5ENNA 4ILGA 3LS8A 2VGEA 4AY5A 2R17C 2QFCA 2PM6A 3K9IA 5KJNA 5EN5D 2IFUA 3OXGA 4EECA 1N9AA 1MX6A 3ENEA 3SQVA 2R02A 3TWXA 4I17A 3MKQB 3CR3A 4L1BA 1OWNA 2RKKA 2VSNA 3GYZA 3BG1B 3FH8A 2CG3A 5LCWC 3MEKA 3DSWA 3QB2A 4A63B 2GRNB 3CKCA 5FINA 4L9PA 1DVPA 4LCTA 3SI5A 3Q75A 3SHFA 4BX8A 3AU5A 4G25A 2HM8A 2XPZA 2P58C 4G2VA 1TN7A 4PS3A 2FULA 3NZSA 4J0UA 3CSFA 3BU8A 5KJLA 1K3ZD 2KCLA 4KXKB 3PS6A 4ACLA 3C3RA 3CLJA 1VDYA 5EYLA 3SO8A 3S7BA 3ISMC 1SA4A 2J09A 4UI9C 1O1RA 2VTBA 3U64A 1O5MA 2GRMA 3UT7A 5CHEE 3FDHA 3FWVA 3Q5MA 3L9TA 4EHMA 3MKRA 2P2CP 1NL4A 3FUJA 5D0QD 1INZA 2XZTG 2XENA 2LSUA 1TNOA 4HB5A 4PS8A 1FT1A 3OXFA 3ZHEB 3CSTA 4MKTA 1LD8A 3KEZA 2ZU6B 4WNEA 3PUJA 2DBAA 2FF4A 1WDYA 3GZ1A 1JCRA 3DSXA 1ZBPA 5T4YA 2PNNA 2ZGDA 3ZFWA 2Y69E 3CVUA 3R7QA 2R5SA 1HXIA 3QKYA 3RRMB 2A4ZA 3AG3E 4AIFA 3CHPA 2VGYA 1D8DA 5AQBA 2CHXA 3TWUA 4Z68A 2F37A 4NURA 1N94A 3TJPA 4CDRA 3PREA 2OEWA 2BF0X 2ETAA 2AW6A 2FBNA 1ZB1A 5FZQA 3HXCA 2QZAA 4GZ5A 4B94A 4L23A 4JA9A 2KZTA 4CDNA 5AAOA 3IEGA 3ZNGA 2L6BA 3Q7AA 1PY1A 3UM1A 3IKOB 3SFXA 3LCAA 3JCKC 2GRPB 3RO2A 2RD0A 3UM2A 3B7SA 3V79K 4AJWA 1OXJA 3UPVA 3UIOC 4XIFA 3KSLA 4DRXE 2R05A 4EPZA 3Q7FA 4OVVA 1TNBA 2F0YA 2JEKA 4YVOA 5KNGA 1S64A 3HXDA 3LYAA 2RFAA 1TJCA 4N3BA 4UQYA 1OT8A 5IY5E 4J8SA 2NXPA 3Q49B 3JXIA 3F6QA 1E8YA 4RG9A 4GA1A 4Y6CA 2R59A 4BTBA 1EDUA 1O1TA 2Y3AA 2IQCA 3L6AA 2PQNA 1P5QA 4KVMA 2JLBA 4N2SA 3RU0A 3RJVA 4L7TA 3D9LA 3FUKA 2PZIA 2WXFA 2X6JA 2OV8A 3ML9A 4HOUA 4FADA 4GMJA 4O6FA 2VTBB 4LNBA 2X38A 3Q9NC 1TNYA 2NC9A 4C0EA 3B7RL 4PH4B 1TR4A 3UMVA 4B8AA 1K8KG 4WWPA 4CCAA 3CVXA 3UM0A 3Q47B 2QYUA 1N0RA 5EX3A 5DIZA 4B89A 3ZGQA 5J90A 3ZYLA 3R9AB 3LY9A 3LKUA 5BV1A 5BUZA 4JZYA 1IQRA 1KZOA 3MCXA 1N11A 3ULEG 4DLOA 1TNUA 2LSVA 3E4BA 4GA2A 3S7DA 1YYHA 1QBQA 1MQSA 4DX1A 2ETCA 3W9FA 3PEVB 4ATGA 2E0IA 3MV2B 3SBSA 5FWQA 4HOSA 3PE4A 3ZIMA 3UIPC 3VTXA 1LD7A 4KYOB 3T5VA 4XZ4A 2LAIA 2KZTB 3TWRA 2BKKB 5AENA 2HYZA 4ZHBA 3DEOA 4G11A 3CVLA 2WXIA 4JHJA 2ONDA 3T8MA 3GW4A 5CEDB 5G04C 3MJWA 3D9JA 2HO1A 3KSQA 1BLXB 3AU4A 2V4LA 5ENQD 4PDXA 2BTDA 3UX4A 3TWSA 4OAVB 3ZKJA 2PL2A 3IXEA 4XI0A 5CBOA 4I6JA 3EU5A 1ELKA 4PS7A 2WXMA 2DVWA 4WWNA 3SFYA 2HE0A 3PZ2A 1E96B 5B1BE 1OWLA 4HI9A 2J4DA 5FIOA 3FEXA 3CK9A 3CHRA 2E2EA 3ESKA 5ENPD 2WQHA 2P9SG 5EIDA 1HF8A 3V2XA 5E76A 5AN8A 3SZ7A 4KT6B 3X2QE 3C72A 3PNLB 3OTNA 4HNAD 5AQ9A 3APDA 3WG7E 2FO1E 4HFGA 4I2ZA 3QK0A 4YVQC 3RAUA 2H6FA 4TXPA 1XGWA 3C98A 2RG8A 1NFIE 2YHEA 4FHKA 4N2QA 2WMNA 4ANUA 1KLXA 4HLEA 3SNXA 4XE0A 4XKBA 3ZYKA 4LRZA 4EZJA 4B8CB 3D9HA 3AS8A 4N3CA 5AIJA 2I6HA 5A6CA 2GRRB 5KBAA 3Q15A 4QQIA 1H6PA 2XGOA 4IYPA 5ENTD 1MYOA 3FH5A 4ILHB 4RVBA 3TWTA 4N3AA 5AQAA 5HRYA 3QJZA 4BSZB 1ELRA 5T3RA 1E90A 3Q78A 4JB8P 3PDNA 3IHVA 4U0ZA 3QAQA 2J08A 3FTZA 3FU6A 3JXJA 5A7DB 3B13A 2X6HA 4WNFA 1PC2A 2WXQA 4U04A 3FUDA 4ILIA 3NAWA 1AP7A 3I4GA 3L54A 2XQ0A 4TUUA 1IYGA 4F7AA 3AJIA 5BXUA 1H2UA 1MHQA 3RRNB 3FTSA 3I3NA 5ITZF 2WXHA 2CFUA 3DBSA 4MS6A 4GZ3A 1BU9A 2GRQB 5FQ7A 4EZLA 4IN3B 4GTTA 3DXKG 3SD5A 1U3DA 4KMOA 3PH0C 3EIJA 1HG2A 2WXRA 5FJYA 2UWJG 4DUIA 1ZU2A 1O1SA 3U3WA 4NIKA 3I5PA 1W3BA 2KXPC 3UINC 4HBDA 1NZNA 3FTUA 2QYJA 3RIBA 1N4RA 2MHKA 5LP0A 2OVFA 2H6GA 2I1KA 3UT8A 2WXLA 4O1OA 4EQFA 5EIBE 1NI1A 5BT1A 3QOUA 3CQCB 3G2WA 3CVPA 2B6CA 5J08A 5CEAA 2Y0BG 4NQ0A 1OCCE 2HR2A 2EQXA 1SW6A 1Y8MA 1DCEA 3AG2E 3UQ3A 5BPPA 2I1JA 3LPZA 4AY6A 4BERA 1UW4B 2H6IA 4B93B 3C3QA 2FO7A 1Q2ZA 1E8XA 4HRMB 4Y6WA 2X6FA 2NSZA 1N95A 2A5EA 3QWPA 3ZN3A 2EINE 3ZEFA 4LERA 4YNDA 3TXMA 4EBAG 5CMWA 3E34A 3UM3A 4UWFA 1NA3A 1WG0A 4J8FA 2MOWA 4A3TA 3CVYA 3CIAA 4YDEA 2GRLA 5FQ4A 2L6JA 3VTYA 2BUGA 4RG6A 3HXBA 3LDZA 4NRHB 2I9CA 3ZU7B 4K0RA 4N39A 2GW1A 1RZ4A 2X6IA 3FUMA 4BETA 4GYOA 4GTRA 3RRUA 3CEQA 4U8YD 3U66A 3L16A 4AV7A 3FTVA 3FUFA 2UY1A 3EHRA 2ETBA 3IHYA 5CRUA 3G2SA 1KT0A 4E6HA 4K5CA 3FP3A 3ASDA 3LY7A 1S63A 2XS8A 4G8KA 1IKND 4TXRA 1U2VG 4RLYA 4GYYA 4F53A 2XRZA 3CKBA 4ME2A 1N4PA 2XZDG 1IQUA 3LVRE 4DPRA 1SVXA 4I1MA 3EU9A 3WXXA 4GPMA 4GMRA 5JMND 4HOQA 1UJKA 5FTPA 1D8EA 3B7BA 3DRAA 3OAWA 5G04J 2AWIA 4GTMA 2C0LA 5LX8A 4DLQA 4LG6A 5ANLA 4GZDA 3CHOA 2GGFA 2BKGA 4F3VA 1H0AA 2DZOA 2AJAA 4HVBA 4CZ2D 3L22A 3AS5A 4UWKA 5JJTA 4O1PA 4FHJA 5LOZA 4G26A 3ZXPA 5G2NA 2MYOA 2B0OE 1UN9A 4GTSA 4Q69A 3U4TA 4JPSA 4YDOA 5CRVA 2L0IA 3CK8A 2XGSA 4FULA 4TUMA 4I1OB 2XS1A 3D3MA 2Q7FA 4HLLA 4TV3A 4HXIA 2LO6A 4FJZA 2OEVA 2ZXWE 5KJKA 3JQ1A 1X81A 4LEUA 3CQGB 5HI7A 3VLDA 3CVQA 1HG5A 1IHGA 4HORA 4E85A 3FTXA 3HHMA 4J8DA 3S2AA 3D9PA 4UQZA 3C5RA 2WQ6A 5EKQD 1UG3A 3BG0B 3CGHA 1FVHA 3EHMA 3PZ3A 4UI9K 4GU5A 5G05C 2UY1B 5EDSA 5D0OD 3FH7A 5BXOA 1H2VC 1N54A 1G3NB 2WXOA 3LEWA 4K5AB 2XGMA 2M63A 2XPIA 3EHNA 1TYQG 1H6OA 4WNDA 1U3CA 1PAQA 3FUNA 3SBTB 3UT4A 4ANWA 3LVQE 5AARA 3AS4A 3KS2A 3JYSA 3APCA 1A5EA 4BEPA 3MX3A 3LJ3A 2CHWA 3HXFA 3NQPA 3PE3A 3MGBA 2FI7A 3KAEA 1V55E 3P1UA 3ASOE 3B7TA 4URKA 4JEUA 1H19A 1OWPA 1HU3A 4G1TA 1OCOE 3ASHA 2IO2C 3PEUB 3URZA 1H6KA 3QWVA 4CYMD 4I2WA 2XHEA 1QNFA 2WQ7A 2KCVA 5JHBA 3N71A 3CVVA 4N5CA 4CGWA 1HFAA 3V2OA 2KBXA 4JD2G 2WXNA 4BWRA 4YDWA 2DYRE 1BPOA 4I9EA 2XEVA 4BX9A 4F6RD 4L2YA 4LNUD 1E7UA 3FFLA 3SFZA 3PRZA 2EIKE 4TRQA 4OAUC 3GZSA 3Q4AB 3T9KA 5A23A 4C0MA 1OUVA 1MJ0A 2C2LA 4KZ0A 3MA5A 1H2TC 2Y4UA 1SZAA 2WXKA 3HVEA 3DSTA 3LXUX 4J8YA 2AVPA 3FHEA 2IF4A 4EBAA 3ASNE 2AXZA 4GTPA 4DI4A 2WXPA 4JXTA 3KD7A 3T5XA 5BW8C 2ZIRA 3G2VA 3W9GA 4CGVA 3ZYQA 3QDNA 3R7RA 2J8SD 5FQ6A 4U0SA 3FU0A 4CDMA 1OCRE 3MZLB 4GTOA 2P9IG 3ZYMA 2X3MA 2WXGA 4AVXA 4P29A 4AEZC 3TL5A 3KEAA 4HRLA 1E7VA 3E37A 1HH8A 2C0MA 2IU1A 3NBNB 3D9OA 3E32A 1E8ZA 4DX2A 2R03A 4A3VA 2CHZA 4U95D 1HZ4A 1YA0A 2GROB 4MRUA 3UI2A 3C3OA 1JPLA 3PZDA 4DJAA 1XNFA 2L0TB 4JC8A 1LF8A 2IJGX 3ABKE 4ATZD 1V54E 4I6EA 2P9LG 5ENRD 4R7LA 2ZGGA 1E8WA 1YCSB 3RKVA 5M72A 4HI8A 4ACKA 2LNIA 5CECB 3ZUVB 3ULQA 3FU5A 3Q79A 3UTMA 2IO3C 3ASFA 2F8YA 4WUYA 5KNHD 2AXVA 2XCCA 2VGXA 2OCCE 1AWCB 3E33A 3E30A 3VLEA 5BNWA 3TWQA 4UUCA 1KPSB 2AXUA 4BY6A 1HE8A 5E75A 3ZW3A 5CCMA 1N4QA 2CG2A 4AP2A 5LFAA 2RFMA 2Y4TA 5HKPA 4JEHA 2IEJA 4FLHA 2PM7A 2LXMA 4JA7A 3HXEA 5JJ7A 4F1PA 3B7UX 3FUHA 5H7PA 5JJ6A 3HVEB 4U63A 4CEMA 4I43A 3S7FA 4EZKA 3FU3A 4DX5D 3D9MA 4FC8A 4U8VD 5KWDA 2H6HA 2CFZA 1HO8A 4W9RA 1IXVA 3EDTB 1EYHA 1FVFA 3PZ1A 2J9QA 5CBNA 4RSYA 4UWHA 4X8QA 4HQDA 3AG4E 4WNGA 1OWMA 4NACA 3LY8A 3B95A 4C9BB 1FCHA 3NOGD 4LNGA 3J5QB 1BI7B 4U96D 1Z6TA 5C1DA 5CERB 4N5QA 1A17A 4GCNA 3I4RB 1JCQA 3FTYA 2JABA 2IONA 3P2BA 5B1AE 5BV0A 1Z5SC 3QC1A 3AAAC 5ENOD 2OVBA 5KCMA 3ZRHA 1YMPA 4RQIA 1KZPA 1DNPA 3RSEG 3QARA 5G05J 2LXLA 4JVSA 3ASGA 5B3SE 3ABME 3SY2A 2V5QC 3DSUA 2LUHA 1JUQA 3APFA 2IOSA 1MX2A 3CVNA 4F1SA 2DIWA 1WAO1 4XI9A 4A1SA 3PNTB 3DPDA 2VGXB 4BTAA 3SF4A 3ZPJA 3MYVA 4ANVA 5HQ8A 2V0PA 4B0ZA 4BT8A 4HS2A 4K5BA 5CCLA 4GB9A 4ABNA 2KATA 5EILA 4H7YA 2VSYA 3ABLE 4O60A 1LTXA 3DXMG 4HOTA 1GW6A 2EILE 4I6GA 2WMOA 4XKCA 3SGHA 4APFA 4FJYA 4GTVA 3TGOA 2BEDA 3TAXA 4WWOA 4BFRA 4XX5A 4DK5A 3Q73A 5AJDA 2KC7A 1SQMA 1QYMA 1UJJA 5D66A 1QQEA 1N4SA 1MX4A 2XRYA 5KJMA 3L17A 1EF1C 4H7XA 2WB2A 2DZNA 2QC9A 5G55A 5JA4D 2KM4A 4HRNA 2A5UA 4APOA 1DCQA 1RW2A 4JHRA 4YDYA 5AYWD 1QZ2A 2YHCA 4FP7A 2ILRA 3TWWA 2IOLA 4AXHA 3HG0D 2FEZA 4I9CA 4LSZE 4G8LA 3CHMA 3RO3A 3OXLA 1OCZE 2VJ8A 2I2OA 4AM9A 2EIME 1HS6A 3FULA 1DC2A 3HDXA 2DYSE 2OOEA 5FZRA 3ZXSA 2PQRA 3R9MA 3UKRG 5ARGA 5D2MC 3ZVVA 4JHKA 4UWGA 4ZFHA 1SA5A 4IRUA 3G2UA 3HRAA 4OVUA 5T8IA 3JQ0A 4BESA 4UQXA 3VLFA 4PUCA 3DSSA 3U9WA 3T8KA 1SZ9A 4UWLA 4JW1A 2J49A 4FLBA 4U0UA 1WM5A 4GAAA 3EHQA 1ELWA 3BEEA 2R2LA 3UXGA 5JHAA 1K1AA 4GPKA 5C2YA 2EIJE 3IBEA 3ESLA 3LJNA 3IV0A 3NB2A 3FUIA 4U07A 4XEIG
chains in the Genus database with same CATH topology
3MV3B 4KVOA 1E7VA 5BPPA 2I1JA 3LPZA 1HH8A 4AY6A 1UW4B 2C0MA 4EPZA 2IU1A 4OVVA 3D9OA 3NZUA 1E8ZA 2FO7A 3D9IA 4J8EA 2JEKA 1E8XA 4Y6WA 4YVOA 2X6FA 2NSZA 4A3VA 2CHZA 1HZ4A 3O4ZA 1YA0A 4MRUA 5FT9A 3QWPA 4FU3A 3LYAA 3QWWA 3ZN3A 1S0PA 2DCPA 1JPLA 3FY4A 1TJCA 3GZ2A 3PZDA 3ZEFA 4LERA 4YNDA 1EPUA 4DJAA 3TXMA 1XNFA 4EBAG 4N3BA 5CMWA 2L0TB 1UN8A 4UQYA 2YNQA 4J8SA 4JC8A 4UWFA 1NA3A 5CMYA 2NXPA 3Q49B 1LF8A 2IJGX 3ONLA 4J8FA 2MOWA 4A3TA 1E8YA 4I6EA 3CVYA 4RG9A 4GA1A 4KZCA 4Y6CA 5ANRA 2R59A 4GMLA 4J6IA 3CIAA 4BTBA 2GRLA 2L9BA 1EDUA 3QNKA 5FQ4A 3TG5A 4R7LA 2L6JA 3FUEA 3VTYA 2BUGA 2Y3AA 2IQCA 1E8WA 4RG6A 4BSXA 3L6AA 2PQNA 1P5QA 3RKVA 5M72A 3LDZA 4NRHB 4ACKA 4KVMA 5ARFA 2JLBA 2LNIA 2I9CA 3D9KA 4N2SA 3RU0A 4K0RA 4N39A 3ULQA 2GW1A 5FQ8A 3FU5A 2WM9A 2X6IA 3RJVA 3FUMA 2VQ2A 4L7TA 3EJNA 4GYOA 3D9LA 4Q96A 3ASFA 2QY7A 3RRUA 3CEQA 5FZSA 4WUYA 3FUKA 2PZIA 2WXFA 3U66A 2AXVA 2X6JA 2XCCA 1JWGA 3EIQC 2OV8A 3L16A 2VGXA 3ML9A 4AV7A 3FTVA 3FUFA 4HOUA 1NA0A 4FADA 1WY6A 2UY1A 4KBQA 3VLEA 3CK7A 2VSOE 5BNWA 4GMJA 3O48A 4CT4A 2KCKA 3L08A 5EX0A 4O6FA 3IHYA 2VTBB 3NF1A 3G2SA 2X38A 2NC9A 4C0EA 3B7RL 2AXUA 3D9NA 4PH4B 4FA6A 3UMVA 1KT0A 4E6HA 4BY6A 3UUXA 4WAFA 1HE8A 4I1AA 3FP3A 4B8AA 1OWOA 5E75A 3ASDA 3LY7A 4WWPA 3ZW3A 4QFVA 3CVWA 4CCAA 5CCMA 3CVXA 1Y6IA 4CT0A 3MKQA 4ANXA 3Q47B 5LCWJ 2CG2A 4AP2A 5EX3A 5LFAA 4GYYA 4A55A 5DIZA 4F53A 4B89A 3HYMB 3ZGQA 1JWFA 4CRWA 2XRZA 2Y4TA 3CKBA 5J90A 4ME2A 3ZYLA 3RK6A 2YINA 4JEHA 3R9AB 4FLHA 3LY9A 2PM7A 4JA7A 3LKUA 5BV1A 5BUZA 1IQUA 3LVRE 4JZYA 5JJ7A 4DPRA 1IQRA 3MCXA 3CHQA 4DLOA 2XPYA 3TXNA 2LSVA 2MRIA 3B7UX 3FUHA 3E4BA 4I1MA 4GA2A 2V5FA 5JJ6A 3S7DA 3WXXA 4D10C 3HVEB 4U63A 4HOQA 1L5JA 1UJKA 5FTPA 4CEMA 1MQSA 4I43A 3S7FA 4EZKA 3FU3A 3JUIA 3D9MA 5DBKA 2J07A 1KT1A 2XCBA 2X6KA 3PEVB 4FC8A 5G04J 3OAWA 2E0IA 4ATGA 3MV2B 1TJFA 3CV0A 4MLPA 2AWIA 4JL0A 3SBSA 5FWQA 3ONKA 4GZ6A 4U8HA 2CFZA 1HO8A 4HOSA 2C0LA 4W9RA 5LX8A 3PE4A 4GZCA 1NP7A 4DLQA 4G23A 1TEZA 3EDTB 3CHSA 1EYHA 1HX8A 3ZIMA 1FVFA 5ANLA 3VTXA 3HIZA 4GZDA 3CHOA 2GGFA 4KYOB 3T5VA 4XZ4A 2J9QA 2LAIA 2KZTB 3FEYA 4RSYA 4F3VA 4UWHA 1H0AA 1Z3YA 4HVBA 5AENA 4WNGA 4K03A 1OWMA 2HYZA 3L22A 4NACA 3S7JA 3LY8A 4C9BB 3AS5A 1FCHA 4G11A 2V8SE 3CVLA 4UI9J 2WVIA 4UWKA 5JJTA 2VSXE 2WXIA 4FHJA 2ONDA 2YQ8A 4JHJA 4Q94A 3L13A 3T8MA 3GW4A 1Z6TA 4BT9A 5C1DA 1Z3XA 4G26A 5LOZA 5G04C 3MJWA 1A17A 3D9JA 2HO1A 4GCNA 5G2NA 3AU4A 5AJLA 4L2LA 3TG4A 3I4RB 3FTYA 2IONA 2V4LA 1UN9A 4DI3A 3P2BA 3FTWA 4Q69A 3U4TA 2VYIA 4JPSA 3ZHEA 4PDXA 2BTDA 3ML8A 5BV0A 2WXJA 3UX4A 4OYSA 2L0IA 3CK8A 3QC1A 2XGSA 4LUNU 4FULA 2PL2A 4G24A 3PUKA 4I1OB 2OVBA 5KCMA 4XI0A 2LAHA 3ZRHA 4AOFA 3D3MA 2Q7FA 1DNPA 2WPVA 4I6JA 1ELKA 3QARA 4PS7A 5G05J 1B89A 2WXMA 4TV3A 4WWNA 4HXIA 2LO6A 4FJZA 5KJKA 3JQ1A 4JVSA 3ASGA 1E96B 4LEUA 3CQGB 5HI7A 1OWLA 3VLDA 3CVQA 4V3IA 1HG5A 2J4DA 4GYWA 4GA0A 3UPVA 1IHGA 3FEXA 3CK9A 4GCOA 4HORA 4E85A 3FTXA 3CHRA 2E2EA 3ESKA 3HHMA 4J8DA 3PVLA 3S2AA 2WQHA 3D9PA 1N52A 1HF8A 1X5BA 1JUQA 4UQZA 5E76A 2WQ6A 3SZ7A 4IULA 5EKQD 3APFA 1UG3A 2IOSA 3BG0B 4KT6B 3G2TA 2J4BA 3CGHA 3CVNA 3PNLB 4M3OA 4A1GA 4F1SA 3OTNA 2DIWA 1FVHA 1WAO1 4XI9A 4A1SA 3APDA 3EHMA 3PNTB 3DPDA 5ENNA 2VGXB 4ILGA 4UI9K 4BTAA 3LS8A 4GU5A 3SF4A 4AY5A 5G05C 2UY1B 5EDSA 5D0OD 4HFGA 3FH7A 3ZPJA 2R17C 3QK0A 4I2ZA 2QFCA 2PM6A 1H2VC 1N54A 3K9IA 4YVQC 3MYVA 2WXOA 4ANVA 5KJNA 2IFUA 5HQ8A 3LEWA 2V0PA 3OXGA 2XGMA 4EECA 4B0ZA 2M63A 1XGWA 3ENEA 4BT8A 2XPIA 4HS2A 3C98A 2RG8A 5CCLA 2YHEA 4GB9A 4I17A 4FHKA 3MKQB 4N2QA 4ABNA 2KATA 3EHNA 3CR3A 4H7YA 4L1BA 2WMNA 4ANUA 2VSYA 1OWNA 1KLXA 2VSNA 3GYZA 4HLEA 4HOTA 1GW6A 3BG1B 3FH8A 2CG3A 4I6GA 3MEKA 5LCWC 2WMOA 4WNDA 3SNXA 4XE0A 4XKBA 1U3CA 1PAQA 3QB2A 3ZYKA 3FUNA 3CKCA 4XKCA 3SGHA 3SBTB 4APFA 4FJYA 3UT4A 4LRZA 4EZJA 3TGOA 4B8CB 3TAXA 3AS8A 4WWOA 4ANWA 3LVQE 4N3CA 4BFRA 3AS4A 4XX5A 5AIJA 3KS2A 2I6HA 4DK5A 3JYSA 5A6CA 1DVPA 3Q15A 3APCA 4LCTA 3SI5A 5AJDA 3SHFA 4BX8A 2XGOA 3AU5A 4IYPA 2KC7A 3MX3A 3LJ3A 2CHWA 1SQMA 3FH5A 4G25A 4ILHB 1UJJA 4RVBA 2HM8A 2XPZA 1QQEA 4N3AA 3QJZA 2P58C 2XRYA 1ELRA 3NQPA 4G2VA 5KJMA 5T3RA 3L17A 1E90A 4PS3A 2FULA 3PE3A 3NZSA 4J0UA 3CSFA 3MGBA 2FI7A 1EF1C 3KAEA 4H7XA 2WB2A 3P1UA 5KJLA 2KCLA 3B7TA 3IHVA 3PDNA 5G55A 4JEUA 4KXKB 4URKA 1H19A 3PS6A 2KM4A 4U0ZA 1OWPA 2A5UA 4APOA 1HU3A 4G1TA 3QAQA 4ACLA 3ASHA 3CLJA 4JHRA 3PEUB 1VDYA 2J08A 3FTZA 3FU6A 3URZA 5AYWD 5A7DB 1H6KA 1QZ2A 2YHCA 3QWVA 4I2WA 2XHEA 3B13A 4FP7A 3S7BA 1QNFA 2ILRA 2X6HA 2WQ7A 2IOLA 4AXHA 2KCVA 5JHBA 2FEZA 4I9CA 4WNFA 1PC2A 3N71A 2J09A 2WXQA 4U04A 4UI9C 3CVVA 3CHMA 4N5CA 2VTBA 3U64A 3FUDA 3RO3A 4CGWA 1HFAA 2GRMA 3OXLA 4ILIA 3I4GA 3L54A 2XQ0A 4TUUA 3UT7A 5CHEE 2VJ8A 2I2OA 3FDHA 3FWVA 2WXNA 3Q5MA 4AM9A 4BWRA 4F7AA 1IYGA 1HS6A 1BPOA 4I9EA 2XEVA 3FULA 3MKRA 1H2UA 4BX9A 1MHQA 3HDXA 3FUJA 4L2YA 3RRNB 5D0QD 1INZA 2OOEA 1E7UA 2LSUA 3FFLA 3SFZA 3PRZA 3FTSA 4PS8A 5FZRA 3OXFA 4TRQA 3ZHEB 3ZXSA 3GZSA 2PQRA 3Q4AB 3I3NA 5A23A 3CSTA 5ARGA 4C0MA 4MKTA 1OUVA 3KEZA 2ZU6B 4WNEA 2WXHA 2CFUA 3PUJA 3DBSA 4MS6A 2DBAA 2FF4A 4GZ3A 4JHKA 2C2LA 4KZ0A 3ZVVA 5FQ7A 3MA5A 3GZ1A 4UWGA 1ZBPA 5T4YA 4IRUA 4EZLA 1H2TC 4IN3B 3ZFWA 3G2UA 2Y4UA 1SZAA 3CVUA 3R7QA 2R5SA 1HXIA 2WXKA 3QKYA 3RRMB 2A4ZA 4OVUA 5T8IA 3JQ0A 4AIFA 4UQXA 3VLFA 4PUCA 3CHPA 2VGYA 1U3DA 3SD5A 4KMOA 3PH0C 3EIJA 1HG2A 2WXRA 3HVEA 3LXUX 5FJYA 2UWJG 3U9WA 2AVPA 3FHEA 2CHXA 2IF4A 1ZU2A 1SZ9A 4EBAA 3U3WA 4UWLA 3I5PA 4JW1A 4NURA 3TJPA 1W3BA 2AXZA 2J49A 4CDRA 3PREA 4FLBA 4U0UA 1WM5A 2BF0X 2FBNA 2AW6A 4DI4A 5FZQA 1NZNA 2WXPA 4GAAA 4JXTA 3FTUA 3KD7A 3RIBA 3T5XA 5BW8C 2MHKA 5LP0A 2OVFA 2I1KA 3UT8A 1ELWA 3G2VA 2WXLA 4EQFA 4CGVA 3BEEA 3ZYQA 3QDNA 4GZ5A 3R7RA 5JHAA 4B94A 4L23A 4JA9A 2KZTA 5FQ6A 4CDNA 5BT1A 4GPKA 4U0SA 3IEGA 3QOUA 3CQCB 3FU0A 5C2YA 3IBEA 3G2WA 4CDMA 3ESLA 3CVPA 1PY1A 5J08A 3MZLB 3IKOB 4NQ0A 3IV0A 3LCAA 3FUIA 3JCKC 3ZYMA 3RO2A 2HR2A 2EQXA 2X3MA 2RD0A 2WXGA 1Y8MA 3B7SA 4AVXA 4P29A 4AEZC 4AJWA 3TL5A 4U07A 4XIFA 3UQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAH A;  2WVI A;  3SI5 A;  4AEZ C;  4A1G A; 
#chains in the Genus database with same CATH topology
 3MV3 B;  3AG1 E;  4KVO A;  3TWV A;  3NZU A;  3JUE A;  3D9I A;  4J8E A;  3O4Z A;  3BQO A;  5FT9 A;  4FU3 A;  3QWW A;  1S0P A;  2DCP A;  3FY4 A;  3GZ2 A;  1EPU A;  2F8X K;  1UN8 A;  2YNQ A;  5CMY A;  1BD8 A;  3ONL A;  2XEH A;  5ANR A;  4KZC A;  4GML A;  3PZ4 A;  4J6I A;  2L9B A;  3QNK A;  2XEE A;  3TG5 A;  3V30 A;  3V31 A;  3FUE A;  4GTQ A;  4BSX A;  2DWZ A;  4TXQ A;  5ARF A;  3D9K A;  5FQ8 A;  2WM9 A;  1OY3 D;  2VQ2 A;  2Y1L E;  3EJN A;  4Q96 A;  2QY7 A;  5AQ7 A;  5FZS A;  2P9N G;  1JWG A;  3EIQ C;  1TN6 A;  3ULY A;  1NA0 A;  1WY6 A;  4KBQ A;  3CK7 A;  2VSO E;  3O48 A;  4J7W A;  4CT4 A;  2KCK A;  3L08 A;  5EX0 A;  2P9U G;  3NF1 A;  3D9N A;  4FA6 A;  4MBG A;  3UUX A;  4WAF A;  4I1A A;  1OWO A;  4U7E B;  4QFV A;  3CVW A;  1TNZ A;  1Y6I A;  4CT0 A;  3MKQ A;  4ANX A;  5LCW J;  3L82 A;  4A55 A;  4DX6 D;  3HYM B;  1JWF A;  4CRW A;  3RK6 A;  2YIN A;  2P9K G;  1JCS A;  3CHQ A;  1IHB A;  2XPY A;  3TXN A;  2MRI A;  2V5F A;  4D10 C;  1L5J A;  2ZIS A;  3JUI A;  5DBK A;  2J07 A;  1KT1 A;  2XCB A;  2X6K A;  1TJF A;  3CV0 A;  4MLP A;  4JL0 A;  3ONK A;  2IY0 C;  4GZ6 A;  4U8H A;  4GZC A;  1TEZ A;  1NP7 A;  4G23 A;  3CHS A;  1HX8 A;  3HIZ A;  3FEY A;  1UOH A;  1Z3Y A;  4K03 A;  5ENS D;  3DWL G;  3S7J A;  2NYJ A;  2V8S E;  4DX7 D;  3DPY A;  4UI9 J;  3UKU G;  2WVI A;  2VSX E;  4Q94 A;  2YQ8 A;  3DSV A;  3L13 A;  4BT9 A;  1Z3X A;  2P9P G;  3DEP A;  5AJL A;  1FPP A;  4L2L A;  3TG4 A;  4DI3 A;  3FTW A;  1K1B A;  2VYI A;  3ZHE A;  1TN8 A;  3ML8 A;  3BUA A;  2WXJ A;  2V4H C;  4OYS A;  4LUN U;  4M7C A;  4G24 A;  3PUK A;  2LAH A;  4AOF A;  3J5P A;  2WPV A;  3EUV A;  3NOC D;  5HS0 A;  1B89 A;  4C48 B;  1S70 B;  1N0Q A;  4V3I A;  4GYW A;  4GA0 A;  4GCO A;  5EYP F;  1BI8 B;  3PVL A;  1N52 A;  3Q9U C;  1X5B A;  1FT2 A;  4IUL A;  1MZC A;  3G2T A;  2J4B A;  4M3O A;  4A1G A;  1D9S A;  5ENN A;  4ILG A;  3LS8 A;  2VGE A;  4AY5 A;  2R17 C;  2QFC A;  2PM6 A;  3K9I A;  5KJN A;  5EN5 D;  2IFU A;  3OXG A;  4EEC A;  1N9A A;  1MX6 A;  3ENE A;  3SQV A;  2R02 A;  3TWX A;  4I17 A;  3MKQ B;  3CR3 A;  4L1B A;  1OWN A;  2RKK A;  2VSN A;  3GYZ A;  3BG1 B;  3FH8 A;  2CG3 A;  5LCW C;  3MEK A;  3DSW A;  3QB2 A;  4A63 B;  2GRN B;  3CKC A;  5FIN A;  4L9P A;  1DVP A;  4LCT A;  3SI5 A;  3Q75 A;  3SHF A;  4BX8 A;  3AU5 A;  4G25 A;  2HM8 A;  2XPZ A;  2P58 C;  4G2V A;  1TN7 A;  4PS3 A;  2FUL A;  3NZS A;  4J0U A;  3CSF A;  3BU8 A;  5KJL A;  1K3Z D;  2KCL A;  4KXK B;  3PS6 A;  4ACL A;  3C3R A;  3CLJ A;  1VDY A;  5EYL A;  3SO8 A;  3S7B A;  3ISM C;  1SA4 A;  2J09 A;  4UI9 C;  1O1R A;  2VTB A;  3U64 A;  1O5M A;  2GRM A;  3UT7 A;  5CHE E;  3FDH A;  3FWV A;  3Q5M A;  3L9T A;  4EHM A;  3MKR A;  2P2C P;  1NL4 A;  3FUJ A;  5D0Q D;  1INZ A;  2XZT G;  2XEN A;  2LSU A;  1TNO A;  4HB5 A;  4PS8 A;  1FT1 A;  3OXF A;  3ZHE B;  3CST A;  4MKT A;  1LD8 A;  3KEZ A;  2ZU6 B;  4WNE A;  3PUJ A;  2DBA A;  2FF4 A;  1WDY A;  3GZ1 A;  1JCR A;  3DSX A;  1ZBP A;  5T4Y A;  2PNN A;  2ZGD A;  3ZFW A;  2Y69 E;  3CVU A;  3R7Q A;  2R5S A;  1HXI A;  3QKY A;  3RRM B;  2A4Z A;  3AG3 E;  4AIF A;  3CHP A;  2VGY A;  1D8D A;  5AQB A;  2CHX A;  3TWU A;  4Z68 A;  2F37 A;  4NUR A;  1N94 A;  3TJP A;  4CDR A;  3PRE A;  2OEW A;  2BF0 X;  2ETA A;  2AW6 A;  2FBN A;  1ZB1 A;  5FZQ A;  3HXC A;  2QZA A;  4GZ5 A;  4B94 A;  4L23 A;  4JA9 A;  2KZT A;  4CDN A;  5AAO A;  3IEG A;  3ZNG A;  2L6B A;  3Q7A A;  1PY1 A;  3UM1 A;  3IKO B;  3SFX A;  3LCA A;  3JCK C;  2GRP B;  3RO2 A;  2RD0 A;  3UM2 A;  3B7S A;  3V79 K;  4AJW A;  1OXJ A;  3UPV A;  3UIO C;  4XIF A;  3KSL A;  4DRX E;  2R05 A;  4EPZ A;  3Q7F A;  4OVV A;  1TNB A;  2F0Y A;  2JEK A;  4YVO A;  5KNG A;  1S64 A;  3HXD A;  3LYA A;  2RFA A;  1TJC A;  4N3B A;  4UQY A;  1OT8 A;  5IY5 E;  4J8S A;  2NXP A;  3Q49 B;  3JXI A;  3F6Q A;  1E8Y A;  4RG9 A;  4GA1 A;  4Y6C A;  2R59 A;  4BTB A;  1EDU A;  1O1T A;  2Y3A A;  2IQC A;  3L6A A;  2PQN A;  1P5Q A;  4KVM A;  2JLB A;  4N2S A;  3RU0 A;  3RJV A;  4L7T A;  3D9L A;  3FUK A;  2PZI A;  2WXF A;  2X6J A;  2OV8 A;  3ML9 A;  4HOU A;  4FAD A;  4GMJ A;  4O6F A;  2VTB B;  4LNB A;  2X38 A;  3Q9N C;  1TNY A;  2NC9 A;  4C0E A;  3B7R L;  4PH4 B;  1TR4 A;  3UMV A;  4B8A A;  1K8K G;  4WWP A;  4CCA A;  3CVX A;  3UM0 A;  3Q47 B;  2QYU A;  1N0R A;  5EX3 A;  5DIZ A;  4B89 A;  3ZGQ A;  5J90 A;  3ZYL A;  3R9A B;  3LY9 A;  3LKU A;  5BV1 A;  5BUZ A;  4JZY A;  1IQR A;  1KZO A;  3MCX A;  1N11 A;  3ULE G;  4DLO A;  1TNU A;  2LSV A;  3E4B A;  4GA2 A;  3S7D A;  1YYH A;  1QBQ A;  1MQS A;  4DX1 A;  2ETC A;  3W9F A;  3PEV B;  4ATG A;  2E0I A;  3MV2 B;  3SBS A;  5FWQ A;  4HOS A;  3PE4 A;  3ZIM A;  3UIP C;  3VTX A;  1LD7 A;  4KYO B;  3T5V A;  4XZ4 A;  2LAI A;  2KZT B;  3TWR A;  2BKK B;  5AEN A;  2HYZ A;  4ZHB A;  3DEO A;  4G11 A;  3CVL A;  2WXI A;  4JHJ A;  2OND A;  3T8M A;  3GW4 A;  5CED B;  5G04 C;  3MJW A;  3D9J A;  2HO1 A;  3KSQ A;  1BLX B;  3AU4 A;  2V4L A;  5ENQ D;  4PDX A;  2BTD A;  3UX4 A;  3TWS A;  4OAV B;  3ZKJ A;  2PL2 A;  3IXE A;  4XI0 A;  5CBO A;  4I6J A;  3EU5 A;  1ELK A;  4PS7 A;  2WXM A;  2DVW A;  4WWN A;  3SFY A;  2HE0 A;  3PZ2 A;  1E96 B;  5B1B E;  1OWL A;  4HI9 A;  2J4D A;  5FIO A;  3FEX A;  3CK9 A;  3CHR A;  2E2E A;  3ESK A;  5ENP D;  2WQH A;  2P9S G;  5EID A;  1HF8 A;  3V2X A;  5E76 A;  5AN8 A;  3SZ7 A;  4KT6 B;  3X2Q E;  3C72 A;  3PNL B;  3OTN A;  4HNA D;  5AQ9 A;  3APD A;  3WG7 E;  2FO1 E;  4HFG A;  4I2Z A;  3QK0 A;  4YVQ C;  3RAU A;  2H6F A;  4TXP A;  1XGW A;  3C98 A;  2RG8 A;  1NFI E;  2YHE A;  4FHK A;  4N2Q A;  2WMN A;  4ANU A;  1KLX A;  4HLE A;  3SNX A;  4XE0 A;  4XKB A;  3ZYK A;  4LRZ A;  4EZJ A;  4B8C B;  3D9H A;  3AS8 A;  4N3C A;  5AIJ A;  2I6H A;  5A6C A;  2GRR B;  5KBA A;  3Q15 A;  4QQI A;  1H6P A;  2XGO A;  4IYP A;  5ENT D;  1MYO A;  3FH5 A;  4ILH B;  4RVB A;  3TWT A;  4N3A A;  5AQA A;  5HRY A;  3QJZ A;  4BSZ B;  1ELR A;  5T3R A;  1E90 A;  3Q78 A;  4JB8 P;  3PDN A;  3IHV A;  4U0Z A;  3QAQ A;  2J08 A;  3FTZ A;  3FU6 A;  3JXJ A;  5A7D B;  3B13 A;  2X6H A;  4WNF A;  1PC2 A;  2WXQ A;  4U04 A;  3FUD A;  4ILI A;  3NAW A;  1AP7 A;  3I4G A;  3L54 A;  2XQ0 A;  4TUU A;  1IYG A;  4F7A A;  3AJI A;  5BXU A;  1H2U A;  1MHQ A;  3RRN B;  3FTS A;  3I3N A;  5ITZ F;  2WXH A;  2CFU A;  3DBS A;  4MS6 A;  4GZ3 A;  1BU9 A;  2GRQ B;  5FQ7 A;  4EZL A;  4IN3 B;  4GTT A;  3DXK G;  3SD5 A;  1U3D A;  4KMO A;  3PH0 C;  3EIJ A;  1HG2 A;  2WXR A;  5FJY A;  2UWJ G;  4DUI A;  1ZU2 A;  1O1S A;  3U3W A;  4NIK A;  3I5P A;  1W3B A;  2KXP C;  3UIN C;  4HBD A;  1NZN A;  3FTU A;  2QYJ A;  3RIB A;  1N4R A;  2MHK A;  5LP0 A;  2OVF A;  2H6G A;  2I1K A;  3UT8 A;  2WXL A;  4O1O A;  4EQF A;  5EIB E;  1NI1 A;  5BT1 A;  3QOU A;  3CQC B;  3G2W A;  3CVP A;  2B6C A;  5J08 A;  5CEA A;  2Y0B G;  4NQ0 A;  1OCC E;  2HR2 A;  2EQX A;  1SW6 A;  1Y8M A;  1DCE A;  3AG2 E;  3UQ3 A;  5BPP A;  2I1J A;  3LPZ A;  4AY6 A;  4BER A;  1UW4 B;  2H6I A;  4B93 B;  3C3Q A;  2FO7 A;  1Q2Z A;  1E8X A;  4HRM B;  4Y6W A;  2X6F A;  2NSZ A;  1N95 A;  2A5E A;  3QWP A;  3ZN3 A;  2EIN E;  3ZEF A;  4LER A;  4YND A;  3TXM A;  4EBA G;  5CMW A;  3E34 A;  3UM3 A;  4UWF A;  1NA3 A;  1WG0 A;  4J8F A;  2MOW A;  4A3T A;  3CVY A;  3CIA A;  4YDE A;  2GRL A;  5FQ4 A;  2L6J A;  3VTY A;  2BUG A;  4RG6 A;  3HXB A;  3LDZ A;  4NRH B;  2I9C A;  3ZU7 B;  4K0R A;  4N39 A;  2GW1 A;  1RZ4 A;  2X6I A;  3FUM A;  4BET A;  4GYO A;  4GTR A;  3RRU A;  3CEQ A;  4U8Y D;  3U66 A;  3L16 A;  4AV7 A;  3FTV A;  3FUF A;  2UY1 A;  3EHR A;  2ETB A;  3IHY A;  5CRU A;  3G2S A;  1KT0 A;  4E6H A;  4K5C A;  3FP3 A;  3ASD A;  3LY7 A;  1S63 A;  2XS8 A;  4G8K A;  1IKN D;  4TXR A;  1U2V G;  4RLY A;  4GYY A;  4F53 A;  2XRZ A;  3CKB A;  4ME2 A;  1N4P A;  2XZD G;  1IQU A;  3LVR E;  4DPR A;  1SVX A;  4I1M A;  3EU9 A;  3WXX A;  4GPM A;  4GMR A;  5JMN D;  4HOQ A;  1UJK A;  5FTP A;  1D8E A;  3B7B A;  3DRA A;  3OAW A;  5G04 J;  2AWI A;  4GTM A;  2C0L A;  5LX8 A;  4DLQ A;  4LG6 A;  5ANL A;  4GZD A;  3CHO A;  2GGF A;  2BKG A;  4F3V A;  1H0A A;  2DZO A;  2AJA A;  4HVB A;  4CZ2 D;  3L22 A;  3AS5 A;  4UWK A;  5JJT A;  4O1P A;  4FHJ A;  5LOZ A;  4G26 A;  3ZXP A;  5G2N A;  2MYO A;  2B0O E;  1UN9 A;  4GTS A;  4Q69 A;  3U4T A;  4JPS A;  4YDO A;  5CRV A;  2L0I A;  3CK8 A;  2XGS A;  4FUL A;  4TUM A;  4I1O B;  2XS1 A;  3D3M A;  2Q7F A;  4HLL A;  4TV3 A;  4HXI A;  2LO6 A;  4FJZ A;  2OEV A;  2ZXW E;  5KJK A;  3JQ1 A;  1X81 A;  4LEU A;  3CQG B;  5HI7 A;  3VLD A;  3CVQ A;  1HG5 A;  1IHG A;  4HOR A;  4E85 A;  3FTX A;  3HHM A;  4J8D A;  3S2A A;  3D9P A;  4UQZ A;  3C5R A;  2WQ6 A;  5EKQ D;  1UG3 A;  3BG0 B;  3CGH A;  1FVH A;  3EHM A;  3PZ3 A;  4UI9 K;  4GU5 A;  5G05 C;  2UY1 B;  5EDS A;  5D0O D;  3FH7 A;  5BXO A;  1H2V C;  1N54 A;  1G3N B;  2WXO A;  3LEW A;  4K5A B;  2XGM A;  2M63 A;  2XPI A;  3EHN A;  1TYQ G;  1H6O A;  4WND A;  1U3C A;  1PAQ A;  3FUN A;  3SBT B;  3UT4 A;  4ANW A;  3LVQ E;  5AAR A;  3AS4 A;  3KS2 A;  3JYS A;  3APC A;  1A5E A;  4BEP A;  3MX3 A;  3LJ3 A;  2CHW A;  3HXF A;  3NQP A;  3PE3 A;  3MGB A;  2FI7 A;  3KAE A;  1V55 E;  3P1U A;  3ASO E;  3B7T A;  4URK A;  4JEU A;  1H19 A;  1OWP A;  1HU3 A;  4G1T A;  1OCO E;  3ASH A;  2IO2 C;  3PEU B;  3URZ A;  1H6K A;  3QWV A;  4CYM D;  4I2W A;  2XHE A;  1QNF A;  2WQ7 A;  2KCV A;  5JHB A;  3N71 A;  3CVV A;  4N5C A;  4CGW A;  1HFA A;  3V2O A;  2KBX A;  4JD2 G;  2WXN A;  4BWR A;  4YDW A;  2DYR E;  1BPO A;  4I9E A;  2XEV A;  4BX9 A;  4F6R D;  4L2Y A;  4LNU D;  1E7U A;  3FFL A;  3SFZ A;  3PRZ A;  2EIK E;  4TRQ A;  4OAU C;  3GZS A;  3Q4A B;  3T9K A;  5A23 A;  4C0M A;  1OUV A;  1MJ0 A;  2C2L A;  4KZ0 A;  3MA5 A;  1H2T C;  2Y4U A;  1SZA A;  2WXK A;  3HVE A;  3DST A;  3LXU X;  4J8Y A;  2AVP A;  3FHE A;  2IF4 A;  4EBA A;  3ASN E;  2AXZ A;  4GTP A;  4DI4 A;  2WXP A;  4JXT A;  3KD7 A;  3T5X A;  5BW8 C;  2ZIR A;  3G2V A;  3W9G A;  4CGV A;  3ZYQ A;  3QDN A;  3R7R A;  2J8S D;  5FQ6 A;  4U0S A;  3FU0 A;  4CDM A;  1OCR E;  3MZL B;  4GTO A;  2P9I G;  3ZYM A;  2X3M A;  2WXG A;  4AVX A;  4P29 A;  4AEZ C;  3TL5 A;  3KEA A;  4HRL A;  1E7V A;  3E37 A;  1HH8 A;  2C0M A;  2IU1 A;  3NBN B;  3D9O A;  3E32 A;  1E8Z A;  4DX2 A;  2R03 A;  4A3V A;  2CHZ A;  4U95 D;  1HZ4 A;  1YA0 A;  2GRO B;  4MRU A;  3UI2 A;  3C3O A;  1JPL A;  3PZD A;  4DJA A;  1XNF A;  2L0T B;  4JC8 A;  1LF8 A;  2IJG X;  3ABK E;  4ATZ D;  1V54 E;  4I6E A;  2P9L G;  5ENR D;  4R7L A;  2ZGG A;  1E8W A;  1YCS B;  3RKV A;  5M72 A;  4HI8 A;  4ACK A;  2LNI A;  5CEC B;  3ZUV B;  3ULQ A;  3FU5 A;  3Q79 A;  3UTM A;  2IO3 C;  3ASF A;  2F8Y A;  4WUY A;  5KNH D;  2AXV A;  2XCC A;  2VGX A;  2OCC E;  1AWC B;  3E33 A;  3E30 A;  3VLE A;  5BNW A;  3TWQ A;  4UUC A;  1KPS B;  2AXU A;  4BY6 A;  1HE8 A;  5E75 A;  3ZW3 A;  5CCM A;  1N4Q A;  2CG2 A;  4AP2 A;  5LFA A;  2RFM A;  2Y4T A;  5HKP A;  4JEH A;  2IEJ A;  4FLH A;  2PM7 A;  2LXM A;  4JA7 A;  3HXE A;  5JJ7 A;  4F1P A;  3B7U X;  3FUH A;  5H7P A;  5JJ6 A;  3HVE B;  4U63 A;  4CEM A;  4I43 A;  3S7F A;  4EZK A;  3FU3 A;  4DX5 D;  3D9M A;  4FC8 A;  4U8V D;  5KWD A;  2H6H A;  2CFZ A;  1HO8 A;  4W9R A;  1IXV A;  3EDT B;  1EYH A;  1FVF A;  3PZ1 A;  2J9Q A;  5CBN A;  4RSY A;  4UWH A;  4X8Q A;  4HQD A;  3AG4 E;  4WNG A;  1OWM A;  4NAC A;  3LY8 A;  3B95 A;  4C9B B;  1FCH A;  3NOG D;  4LNG A;  3J5Q B;  1BI7 B;  4U96 D;  1Z6T A;  5C1D A;  5CER B;  4N5Q A;  1A17 A;  4GCN A;  3I4R B;  1JCQ A;  3FTY A;  2JAB A;  2ION A;  3P2B A;  5B1A E;  5BV0 A;  1Z5S C;  3QC1 A;  3AAA C;  5ENO D;  2OVB A;  5KCM A;  3ZRH A;  1YMP A;  4RQI A;  1KZP A;  1DNP A;  3RSE G;  3QAR A;  5G05 J;  2LXL A;  4JVS A;  3ASG A;  5B3S E;  3ABM E;  3SY2 A;  2V5Q C;  3DSU A;  2LUH A;  1JUQ A;  3APF A;  2IOS A;  1MX2 A;  3CVN A;  4F1S A;  2DIW A;  1WAO 1;  4XI9 A;  4A1S A;  3PNT B;  3DPD A;  2VGX B;  4BTA A;  3SF4 A;  3ZPJ A;  3MYV A;  4ANV A;  5HQ8 A;  2V0P A;  4B0Z A;  4BT8 A;  4HS2 A;  4K5B A;  5CCL A;  4GB9 A;  4ABN A;  2KAT A;  5EIL A;  4H7Y A;  2VSY A;  3ABL E;  4O60 A;  1LTX A;  3DXM G;  4HOT A;  1GW6 A;  2EIL E;  4I6G A;  2WMO A;  4XKC A;  3SGH A;  4APF A;  4FJY A;  4GTV A;  3TGO A;  2BED A;  3TAX A;  4WWO A;  4BFR A;  4XX5 A;  4DK5 A;  3Q73 A;  5AJD A;  2KC7 A;  1SQM A;  1QYM A;  1UJJ A;  5D66 A;  1QQE A;  1N4S A;  1MX4 A;  2XRY A;  5KJM A;  3L17 A;  1EF1 C;  4H7X A;  2WB2 A;  2DZN A;  2QC9 A;  5G55 A;  5JA4 D;  2KM4 A;  4HRN A;  2A5U A;  4APO A;  1DCQ A;  1RW2 A;  4JHR A;  4YDY A;  5AYW D;  1QZ2 A;  2YHC A;  4FP7 A;  2ILR A;  3TWW A;  2IOL A;  4AXH A;  3HG0 D;  2FEZ A;  4I9C A;  4LSZ E;  4G8L A;  3CHM A;  3RO3 A;  3OXL A;  1OCZ E;  2VJ8 A;  2I2O A;  4AM9 A;  2EIM E;  1HS6 A;  3FUL A;  1DC2 A;  3HDX A;  2DYS E;  2OOE A;  5FZR A;  3ZXS A;  2PQR A;  3R9M A;  3UKR G;  5ARG A;  5D2M C;  3ZVV A;  4JHK A;  4UWG A;  4ZFH A;  1SA5 A;  4IRU A;  3G2U A;  3HRA A;  4OVU A;  5T8I A;  3JQ0 A;  4BES A;  4UQX A;  3VLF A;  4PUC A;  3DSS A;  3U9W A;  3T8K A;  1SZ9 A;  4UWL A;  4JW1 A;  2J49 A;  4FLB A;  4U0U A;  1WM5 A;  4GAA A;  3EHQ A;  1ELW A;  3BEE A;  2R2L A;  3UXG A;  5JHA A;  1K1A A;  4GPK A;  5C2Y A;  2EIJ E;  3IBE A;  3ESL A;  3LJN A;  3IV0 A;  3NB2 A;  3FUI A;  4U07 A;  4XEI G; 
#chains in the Genus database with same CATH homology
 3MV3 B;  4KVO A;  1E7V A;  5BPP A;  2I1J A;  3LPZ A;  1HH8 A;  4AY6 A;  1UW4 B;  2C0M A;  4EPZ A;  2IU1 A;  4OVV A;  3D9O A;  3NZU A;  1E8Z A;  2FO7 A;  3D9I A;  4J8E A;  2JEK A;  1E8X A;  4Y6W A;  4YVO A;  2X6F A;  2NSZ A;  4A3V A;  2CHZ A;  1HZ4 A;  3O4Z A;  1YA0 A;  4MRU A;  5FT9 A;  3QWP A;  4FU3 A;  3LYA A;  3QWW A;  3ZN3 A;  1S0P A;  2DCP A;  1JPL A;  3FY4 A;  1TJC A;  3GZ2 A;  3PZD A;  3ZEF A;  4LER A;  4YND A;  1EPU A;  4DJA A;  3TXM A;  1XNF A;  4EBA G;  4N3B A;  5CMW A;  2L0T B;  1UN8 A;  4UQY A;  2YNQ A;  4J8S A;  4JC8 A;  4UWF A;  1NA3 A;  5CMY A;  2NXP A;  3Q49 B;  1LF8 A;  2IJG X;  3ONL A;  4J8F A;  2MOW A;  4A3T A;  1E8Y A;  4I6E A;  3CVY A;  4RG9 A;  4GA1 A;  4KZC A;  4Y6C A;  5ANR A;  2R59 A;  4GML A;  4J6I A;  3CIA A;  4BTB A;  2GRL A;  2L9B A;  1EDU A;  3QNK A;  5FQ4 A;  3TG5 A;  4R7L A;  2L6J A;  3FUE A;  3VTY A;  2BUG A;  2Y3A A;  2IQC A;  1E8W A;  4RG6 A;  4BSX A;  3L6A A;  2PQN A;  1P5Q A;  3RKV A;  5M72 A;  3LDZ A;  4NRH B;  4ACK A;  4KVM A;  5ARF A;  2JLB A;  2LNI A;  2I9C A;  3D9K A;  4N2S A;  3RU0 A;  4K0R A;  4N39 A;  3ULQ A;  2GW1 A;  5FQ8 A;  3FU5 A;  2WM9 A;  2X6I A;  3RJV A;  3FUM A;  2VQ2 A;  4L7T A;  3EJN A;  4GYO A;  3D9L A;  4Q96 A;  3ASF A;  2QY7 A;  3RRU A;  3CEQ A;  5FZS A;  4WUY A;  3FUK A;  2PZI A;  2WXF A;  3U66 A;  2AXV A;  2X6J A;  2XCC A;  1JWG A;  3EIQ C;  2OV8 A;  3L16 A;  2VGX A;  3ML9 A;  4AV7 A;  3FTV A;  3FUF A;  4HOU A;  1NA0 A;  4FAD A;  1WY6 A;  2UY1 A;  4KBQ A;  3VLE A;  3CK7 A;  2VSO E;  5BNW A;  4GMJ A;  3O48 A;  4CT4 A;  2KCK A;  3L08 A;  5EX0 A;  4O6F A;  3IHY A;  2VTB B;  3NF1 A;  3G2S A;  2X38 A;  2NC9 A;  4C0E A;  3B7R L;  2AXU A;  3D9N A;  4PH4 B;  4FA6 A;  3UMV A;  1KT0 A;  4E6H A;  4BY6 A;  3UUX A;  4WAF A;  1HE8 A;  4I1A A;  3FP3 A;  4B8A A;  1OWO A;  5E75 A;  3ASD A;  3LY7 A;  4WWP A;  3ZW3 A;  4QFV A;  3CVW A;  4CCA A;  5CCM A;  3CVX A;  1Y6I A;  4CT0 A;  3MKQ A;  4ANX A;  3Q47 B;  5LCW J;  2CG2 A;  4AP2 A;  5EX3 A;  5LFA A;  4GYY A;  4A55 A;  5DIZ A;  4F53 A;  4B89 A;  3HYM B;  3ZGQ A;  1JWF A;  4CRW A;  2XRZ A;  2Y4T A;  3CKB A;  5J90 A;  4ME2 A;  3ZYL A;  3RK6 A;  2YIN A;  4JEH A;  3R9A B;  4FLH A;  3LY9 A;  2PM7 A;  4JA7 A;  3LKU A;  5BV1 A;  5BUZ A;  1IQU A;  3LVR E;  4JZY A;  5JJ7 A;  4DPR A;  1IQR A;  3MCX A;  3CHQ A;  4DLO A;  2XPY A;  3TXN A;  2LSV A;  2MRI A;  3B7U X;  3FUH A;  3E4B A;  4I1M A;  4GA2 A;  2V5F A;  5JJ6 A;  3S7D A;  3WXX A;  4D10 C;  3HVE B;  4U63 A;  4HOQ A;  1L5J A;  1UJK A;  5FTP A;  4CEM A;  1MQS A;  4I43 A;  3S7F A;  4EZK A;  3FU3 A;  3JUI A;  3D9M A;  5DBK A;  2J07 A;  1KT1 A;  2XCB A;  2X6K A;  3PEV B;  4FC8 A;  5G04 J;  3OAW A;  2E0I A;  4ATG A;  3MV2 B;  1TJF A;  3CV0 A;  4MLP A;  2AWI A;  4JL0 A;  3SBS A;  5FWQ A;  3ONK A;  4GZ6 A;  4U8H A;  2CFZ A;  1HO8 A;  4HOS A;  2C0L A;  4W9R A;  5LX8 A;  3PE4 A;  4GZC A;  1NP7 A;  4DLQ A;  4G23 A;  1TEZ A;  3EDT B;  3CHS A;  1EYH A;  1HX8 A;  3ZIM A;  1FVF A;  5ANL A;  3VTX A;  3HIZ A;  4GZD A;  3CHO A;  2GGF A;  4KYO B;  3T5V A;  4XZ4 A;  2J9Q A;  2LAI A;  2KZT B;  3FEY A;  4RSY A;  4F3V A;  4UWH A;  1H0A A;  1Z3Y A;  4HVB A;  5AEN A;  4WNG A;  4K03 A;  1OWM A;  2HYZ A;  3L22 A;  4NAC A;  3S7J A;  3LY8 A;  4C9B B;  3AS5 A;  1FCH A;  4G11 A;  2V8S E;  3CVL A;  4UI9 J;  2WVI A;  4UWK A;  5JJT A;  2VSX E;  2WXI A;  4FHJ A;  2OND A;  2YQ8 A;  4JHJ A;  4Q94 A;  3L13 A;  3T8M A;  3GW4 A;  1Z6T A;  4BT9 A;  5C1D A;  1Z3X A;  4G26 A;  5LOZ A;  5G04 C;  3MJW A;  1A17 A;  3D9J A;  2HO1 A;  4GCN A;  5G2N A;  3AU4 A;  5AJL A;  4L2L A;  3TG4 A;  3I4R B;  3FTY A;  2ION A;  2V4L A;  1UN9 A;  4DI3 A;  3P2B A;  3FTW A;  4Q69 A;  3U4T A;  2VYI A;  4JPS A;  3ZHE A;  4PDX A;  2BTD A;  3ML8 A;  5BV0 A;  2WXJ A;  3UX4 A;  4OYS A;  2L0I A;  3CK8 A;  3QC1 A;  2XGS A;  4LUN U;  4FUL A;  2PL2 A;  4G24 A;  3PUK A;  4I1O B;  2OVB A;  5KCM A;  4XI0 A;  2LAH A;  3ZRH A;  4AOF A;  3D3M A;  2Q7F A;  1DNP A;  2WPV A;  4I6J A;  1ELK A;  3QAR A;  4PS7 A;  5G05 J;  1B89 A;  2WXM A;  4TV3 A;  4WWN A;  4HXI A;  2LO6 A;  4FJZ A;  5KJK A;  3JQ1 A;  4JVS A;  3ASG A;  1E96 B;  4LEU A;  3CQG B;  5HI7 A;  1OWL A;  3VLD A;  3CVQ A;  4V3I A;  1HG5 A;  2J4D A;  4GYW A;  4GA0 A;  3UPV A;  1IHG A;  3FEX A;  3CK9 A;  4GCO A;  4HOR A;  4E85 A;  3FTX A;  3CHR A;  2E2E A;  3ESK A;  3HHM A;  4J8D A;  3PVL A;  3S2A A;  2WQH A;  3D9P A;  1N52 A;  1HF8 A;  1X5B A;  1JUQ A;  4UQZ A;  5E76 A;  2WQ6 A;  3SZ7 A;  4IUL A;  5EKQ D;  3APF A;  1UG3 A;  2IOS A;  3BG0 B;  4KT6 B;  3G2T A;  2J4B A;  3CGH A;  3CVN A;  3PNL B;  4M3O A;  4A1G A;  4F1S A;  3OTN A;  2DIW A;  1FVH A;  1WAO 1;  4XI9 A;  4A1S A;  3APD A;  3EHM A;  3PNT B;  3DPD A;  5ENN A;  2VGX B;  4ILG A;  4UI9 K;  4BTA A;  3LS8 A;  4GU5 A;  3SF4 A;  4AY5 A;  5G05 C;  2UY1 B;  5EDS A;  5D0O D;  4HFG A;  3FH7 A;  3ZPJ A;  2R17 C;  3QK0 A;  4I2Z A;  2QFC A;  2PM6 A;  1H2V C;  1N54 A;  3K9I A;  4YVQ C;  3MYV A;  2WXO A;  4ANV A;  5KJN A;  2IFU A;  5HQ8 A;  3LEW A;  2V0P A;  3OXG A;  2XGM A;  4EEC A;  4B0Z A;  2M63 A;  1XGW A;  3ENE A;  4BT8 A;  2XPI A;  4HS2 A;  3C98 A;  2RG8 A;  5CCL A;  2YHE A;  4GB9 A;  4I17 A;  4FHK A;  3MKQ B;  4N2Q A;  4ABN A;  2KAT A;  3EHN A;  3CR3 A;  4H7Y A;  4L1B A;  2WMN A;  4ANU A;  2VSY A;  1OWN A;  1KLX A;  2VSN A;  3GYZ A;  4HLE A;  4HOT A;  1GW6 A;  3BG1 B;  3FH8 A;  2CG3 A;  4I6G A;  3MEK A;  5LCW C;  2WMO A;  4WND A;  3SNX A;  4XE0 A;  4XKB A;  1U3C A;  1PAQ A;  3QB2 A;  3ZYK A;  3FUN A;  3CKC A;  4XKC A;  3SGH A;  3SBT B;  4APF A;  4FJY A;  3UT4 A;  4LRZ A;  4EZJ A;  3TGO A;  4B8C B;  3TAX A;  3AS8 A;  4WWO A;  4ANW A;  3LVQ E;  4N3C A;  4BFR A;  3AS4 A;  4XX5 A;  5AIJ A;  3KS2 A;  2I6H A;  4DK5 A;  3JYS A;  5A6C A;  1DVP A;  3Q15 A;  3APC A;  4LCT A;  3SI5 A;  5AJD A;  3SHF A;  4BX8 A;  2XGO A;  3AU5 A;  4IYP A;  2KC7 A;  3MX3 A;  3LJ3 A;  2CHW A;  1SQM A;  3FH5 A;  4G25 A;  4ILH B;  1UJJ A;  4RVB A;  2HM8 A;  2XPZ A;  1QQE A;  4N3A A;  3QJZ A;  2P58 C;  2XRY A;  1ELR A;  3NQP A;  4G2V A;  5KJM A;  5T3R A;  3L17 A;  1E90 A;  4PS3 A;  2FUL A;  3PE3 A;  3NZS A;  4J0U A;  3CSF A;  3MGB A;  2FI7 A;  1EF1 C;  3KAE A;  4H7X A;  2WB2 A;  3P1U A;  5KJL A;  2KCL A;  3B7T A;  3IHV A;  3PDN A;  5G55 A;  4JEU A;  4KXK B;  4URK A;  1H19 A;  3PS6 A;  2KM4 A;  4U0Z A;  1OWP A;  2A5U A;  4APO A;  1HU3 A;  4G1T A;  3QAQ A;  4ACL A;  3ASH A;  3CLJ A;  4JHR A;  3PEU B;  1VDY A;  2J08 A;  3FTZ A;  3FU6 A;  3URZ A;  5AYW D;  5A7D B;  1H6K A;  1QZ2 A;  2YHC A;  3QWV A;  4I2W A;  2XHE A;  3B13 A;  4FP7 A;  3S7B A;  1QNF A;  2ILR A;  2X6H A;  2WQ7 A;  2IOL A;  4AXH A;  2KCV A;  5JHB A;  2FEZ A;  4I9C A;  4WNF A;  1PC2 A;  3N71 A;  2J09 A;  2WXQ A;  4U04 A;  4UI9 C;  3CVV A;  3CHM A;  4N5C A;  2VTB A;  3U64 A;  3FUD A;  3RO3 A;  4CGW A;  1HFA A;  2GRM A;  3OXL A;  4ILI A;  3I4G A;  3L54 A;  2XQ0 A;  4TUU A;  3UT7 A;  5CHE E;  2VJ8 A;  2I2O A;  3FDH A;  3FWV A;  2WXN A;  3Q5M A;  4AM9 A;  4BWR A;  4F7A A;  1IYG A;  1HS6 A;  1BPO A;  4I9E A;  2XEV A;  3FUL A;  3MKR A;  1H2U A;  4BX9 A;  1MHQ A;  3HDX A;  3FUJ A;  4L2Y A;  3RRN B;  5D0Q D;  1INZ A;  2OOE A;  1E7U A;  2LSU A;  3FFL A;  3SFZ A;  3PRZ A;  3FTS A;  4PS8 A;  5FZR A;  3OXF A;  4TRQ A;  3ZHE B;  3ZXS A;  3GZS A;  2PQR A;  3Q4A B;  3I3N A;  5A23 A;  3CST A;  5ARG A;  4C0M A;  4MKT A;  1OUV A;  3KEZ A;  2ZU6 B;  4WNE A;  2WXH A;  2CFU A;  3PUJ A;  3DBS A;  4MS6 A;  2DBA A;  2FF4 A;  4GZ3 A;  4JHK A;  2C2L A;  4KZ0 A;  3ZVV A;  5FQ7 A;  3MA5 A;  3GZ1 A;  4UWG A;  1ZBP A;  5T4Y A;  4IRU A;  4EZL A;  1H2T C;  4IN3 B;  3ZFW A;  3G2U A;  2Y4U A;  1SZA A;  3CVU A;  3R7Q A;  2R5S A;  1HXI A;  2WXK A;  3QKY A;  3RRM B;  2A4Z A;  4OVU A;  5T8I A;  3JQ0 A;  4AIF A;  4UQX A;  3VLF A;  4PUC A;  3CHP A;  2VGY A;  1U3D A;  3SD5 A;  4KMO A;  3PH0 C;  3EIJ A;  1HG2 A;  2WXR A;  3HVE A;  3LXU X;  5FJY A;  2UWJ G;  3U9W A;  2AVP A;  3FHE A;  2CHX A;  2IF4 A;  1ZU2 A;  1SZ9 A;  4EBA A;  3U3W A;  4UWL A;  3I5P A;  4JW1 A;  4NUR A;  3TJP A;  1W3B A;  2AXZ A;  2J49 A;  4CDR A;  3PRE A;  4FLB A;  4U0U A;  1WM5 A;  2BF0 X;  2FBN A;  2AW6 A;  4DI4 A;  5FZQ A;  1NZN A;  2WXP A;  4GAA A;  4JXT A;  3FTU A;  3KD7 A;  3RIB A;  3T5X A;  5BW8 C;  2MHK A;  5LP0 A;  2OVF A;  2I1K A;  3UT8 A;  1ELW A;  3G2V A;  2WXL A;  4EQF A;  4CGV A;  3BEE A;  3ZYQ A;  3QDN A;  4GZ5 A;  3R7R A;  5JHA A;  4B94 A;  4L23 A;  4JA9 A;  2KZT A;  5FQ6 A;  4CDN A;  5BT1 A;  4GPK A;  4U0S A;  3IEG A;  3QOU A;  3CQC B;  3FU0 A;  5C2Y A;  3IBE A;  3G2W A;  4CDM A;  3ESL A;  3CVP A;  1PY1 A;  5J08 A;  3MZL B;  3IKO B;  4NQ0 A;  3IV0 A;  3LCA A;  3FUI A;  3JCK C;  3ZYM A;  3RO2 A;  2HR2 A;  2EQX A;  2X3M A;  2RD0 A;  2WXG A;  1Y8M A;  3B7S A;  4AVX A;  4P29 A;  4AEZ C;  4AJW A;  3TL5 A;  4U07 A;  4XIF A;  3UQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...