2LAHA

Solution nmr structure of mitotic checkpoint serine/threonine-protein kinase bub1 n-terminal domain from homo sapiens, northeast structural genomics consortium target hr5460a (methods development)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
160
structure length
160
Chain Sequence
MGHHHHHHSHMDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target HR5460A
rcsb
source organism Homo sapiens
molecule tags Cell cycle, apoptosis
molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1
total genus 59
structure length 160
sequence length 160
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lahA00
3SI5A 4A1GA 4AEZC 2LAHA 2WVIA
chains in the Genus database with same CATH superfamily
2PNNA 4C48B 3FUNA 4J8YA 2ZIRA 3FEXA 4I17A 3G2TA 2RD0A 2AXZA 4GPKA 4JHJA 1QQEA 2OV8A 4CRWA 3Q47B 4GB9A 4E85A 3K9IA 4DRXE 1TNYA 4RQIA 3AU4A 4Y6CA 3VTYA 5LFAA 1EF1C 1MJ0A 3ABME 3LY8A 5T3RA 2VGXA 3FTYA 2IEJA 2GROB 3ZPJA 3RO3A 3DSWA 2ETCA 3NBNB 3EHQA 3PDNA 2JABA 2CHXA 5JMND 3E30A 4KVOA 3FU0A 3C98A 4F53A 3OXFA 5CMYA 3ESLA 1OCOE 1P5QA 4KZ0A 3UI2A 4XIFA 4GZCA 4HFGA 4BX9A 3V2OA 4L2YA 1YYHA 4LUNU 3CR3A 3PEVB 3ZYKA 4CT0A 3ZNGA 2GGFA 2X6HA 3U9WA 1K8KG 2GRPB 4GZ3A 3EU5A 4L1BA 2J9QA 4BEPA 2MOWA 3R9MA 2Y0BG 2ETBA 5BPPA 4FHJA 4UQXA 2C0LA 3V31A 4HOSA 3EIQC 1Q2ZA 4U95D 3UINC 2FF4A 2OCCE 2GRQB 3RRNB 2HR2A 1X5BA 3PUKA 4A3VA 3IHYA 2Y3AA 4G26A 1OWLA 5AAOA 3V30A 5BV1A 4OAUC 4KMOA 3DSTA 1YA0A 1TN7A 5CBNA 2XQ0A 1PY1A 3ULQA 1SQMA 3ASDA 4I2WA 4FADA 5HKPA 2KCVA 3G2WA 4AOFA 2I9CA 3FFLA 1WG0A 3E32A 3LYAA 3Q7FA 4HRMB 1KZPA 2WXFA 3EDTB 5FZSA 4UWFA 5E75A 3PH0C 2ETAA 4NQ0A 3PUJA 3CVQA 4K5BA 4BSXA 4DUIA 2CHZA 3TWWA 2J8SD 2QC9A 4F6RD 4UWLA 4HNAD 1HS6A 3TAXA 4JPSA 4L23A 2L6JA 1E8ZA 2HM8A 3MKRA 2DZNA 3N71A 3ML9A 3R9AB 2XEVA 4BTBA 2AVPA 2J4DA 2UWJG 3R7RA 5FQ7A 3EJNA 4I1OB 3DEPA 4EZLA 3DSSA 3JXJA 1Z3YA 3KD7A 3JQ0A 2UY1A 5AARA 4X8QA 4UUCA 2IFUA 2V5FA 3FU6A 2WXJA 4UQZA 1U3CA 2JLBA 1JWFA 4F3VA 4G8LA 4WWPA 5FZQA 3PRZA 1E8WA 4EBAG 2BUGA 2C2LA 4ZHBA 3FTWA 3IKOB 3ZKJA 1N94A 2HO1A 5BUZA 3CKBA 2Y4UA 3GZSA 4BWRA 2B0OE 4GZDA 2ZISA 4KXKB 4BTAA 4KZCA 2A5UA 3DXMG 5LCWC 3IV0A 4AIFA 4U0UA 4U63A 4GAAA 4L2LA 4K03A 3IXEA 1LD8A 3LY7A 3LEWA 3TXNA 2L0TB 4FULA 4WWOA 3Q5MA 4ANUA 4GTRA 3URZA 2IO2C 4B0ZA 2XPYA 1ELKA 3LY9A 4CZ2D 3W9FA 2WB2A 2X6JA 4HXIA 4RG9A 2WQHA 1BI8B 5AJDA 1MX6A 4ANVA 3AS4A 4A1GA 4ILIA 1NFIE 4GCOA 2GRMA 2WXQA 2F0YA 3V2XA 4O6FA 3QARA 4TXPA 4GTQA 4C9BB 3ASGA 4EBAA 3HHMA 4GTTA 4YDOA 3TWVA 4XI9A 2ONDA 4WNEA 4L7TA 4XX5A 3MGBA 5EKQD 1U2VG 3EHMA 1SA5A 2H6GA 3LXUX 3SO8A 5CECB 1OWOA 3UIOC 3GYZA 3RAUA 2VGEA 4J8FA 1K1AA 3FP3A 1O1SA 4PH4B 5ENRD 4XEIG 4PS8A 4O1PA 2WXGA 5EIDA 2IO3C 2LAIA 3HYMB 3RK6A 2AW6A 2WXLA 2P9SG 4FJYA 3MEKA 4JA7A 4KYOB 5LOZA 3U4TA 2IQCA 4CT4A 2XGSA 4NIKA 5D0OD 3RKVA 3QOUA 2R03A 3B7UX 3ASNE 1HG5A 1TNOA 3ZFWA 2AXUA 2LO6A 3KAEA 2WVIA 3ENEA 3NZSA 3DSUA 4LNBA 2XZDG 1GW6A 1BD8A 4DLQA 2XENA 2IOLA 3Q4AB 4HQDA 2VSYA 4U0ZA 3FHEA 3S7DA 3PZ3A 3PVLA 2GRRB 4JHRA 2XGOA 4PUCA 3TWTA 2EIJE 1JCRA 1IQUA 4AY5A 4I6GA 5AYWD 2XCBA 3E37A 2P9PG 2A5EA 2FO7A 2R59A 1YCSB 3D9KA 1WDYA 5C1DA 5KJKA 1K3ZD 3TWRA 3L9TA 1E7VA 4JB8P 3CK7A 2RFMA 3E4BA 4PS7A 4ANWA 1H2UA 2P9LG 2IOSA 3NZUA 5DIZA 1HF8A 3FDHA 3RSEG 4DJAA 3MKQA 3UTMA 3OAWA 3LPZA 3T5XA 3S7JA 3UM0A 4JEHA 5KJLA 3F6QA 3B7RL 4I1AA 1MX4A 3CEQA 2NYJA 1E90A 3EHRA 5JHBA 5JJ7A 4EZJA 3CIAA 1SZAA 2EIKE 2XEHA 4BSZB 3ZEFA 3EU9A 3D9JA 3QNKA 4FC8A 2DWZA 2X6IA 4OYSA 1N4QA 2I1JA 1W3BA 4IN3B 4CDRA 5EX3A 3W9GA 1EDUA 3HXFA 1NL4A 1B89A 4GA2A 3C3QA 3IEGA 4MKTA 3PZDA 4H7XA 2BTDA 2R5SA 1O1RA 4WNDA 5ENQD 3AS8A 3FUKA 1Y8MA 2WM9A 2Q7FA 3CVVA 3SQVA 4APFA 3B13A 4JEUA 3Q79A 2OOEA 3KS2A 4FHKA 2XS8A 3FUJA 1HFAA 4IYPA 4JHKA 4ACLA 2VSOE 5AQBA 3D9IA 1IXVA 1ELRA 1DCQA 3JUEA 3UUXA 2H6IA 4B8CB 4MRUA 3AG1E 4Q96A 2CFZA 4HI9A 1Z3XA 1N52A 1WAO1 3UM1A 3GW4A 1DVPA 5EYLA 4LNUD 4HOQA 4HI8A 2J07A 5D0QD 2OVBA 5FQ8A 3TL5A 3CK9A 5FJYA 2L6BA 5G05C 5CCLA 1NZNA 2XZTG 3ASHA 3D9OA 1S64A 5AJLA 5B1AE 3SI5A 3FWVA 2MYOA 5KNHD 4AJWA 3QWPA 2P9KG 2LUHA 4AP2A 3LJ3A 2MRIA 1TEZA 2EIME 1UOHA 2WMOA 3QB2A 3HG0D 3Q73A 3LDZA 3NQPA 3MYVA 3ZVVA 2XPIA 3E34A 5ENOD 5KNGA 5CCMA 4KT6B 3SNXA 3D9MA 4I1MA 2MHKA 4K5AB 4ATZD 3UX4A 3FU5A 3AG2E 4GTSA 2XCCA 3SFYA 2VTBB 1A17A 4UWKA 3C3RA 5C2YA 3DBSA 5H7PA 3RU0A 4GMLA 3IHVA 4TV3A 3CHMA 4RG6A 3CHRA 1K1BA 1HU3A 1SA4A 4HOUA 2Y4TA 3ZU7B 1PAQA 3DXKG 3JUIA 3ASOE 4BETA 2XGMA 5G55A 4BT9A 3VLEA 4C0MA 1SW6A 1ZB1A 1E7UA 3HVEB 5JJ6A 3ZGQA 3RO2A 4JXTA 3LCAA 2NC9A 3CGHA 4GYYA 4CCAA 4GTPA 1RZ4A 5FTPA 4URKA 3U66A 2ZGDA 4K5CA 5ANLA 3RIBA 3I4RB 3FTSA 5FINA 1MX2A 2WXHA 2DYSE 4M3OA 1FVFA 2NXPA 1OUVA 2A4ZA 2PL2A 4N3AA 4XZ4A 3MZLB 4D10C 5HQ8A 2E0IA 4R7LA 1OCRE 1TYQG 4L9PA 4G23A 4JZYA 2YHCA 3KEAA 4GZ5A 4HB5A 3L22A 4HLLA 2EINE 4FJZA 3AG4E 4GZ6A 4H7YA 4NURA 3LKUA 4LSZE 1E96B 2ILRA 4ATGA 3DPYA 5KJMA 3RRMB 3J5QB 4JA9A 1OWNA 5HI7A 4FU3A 5IY5E 2YHEA 1IHBA 4HBDA 4U04A 2WQ7A 1E8XA 1VDYA 2J4BA 3NAWA 1QNFA 2IONA 3DPDA 3HIZA 3D3MA 4J6IA 3TJPA 2DYRE 3UM3A 2DIWA 3VLFA 3O4ZA 4JVSA 2LAHA 5J90A 2V4HC 1E8YA 4RVBA 3KSQA 2BKGA 4LRZA 3OXGA 3ZXPA 4N3BA 2P9IG 2L0IA 1JUQA 2FULA 4YDYA 1EYHA 4A3TA 4FLHA 4GTOA 1OT8A 4EPZA 4CGWA 1MHQA 2PM6A 1O1TA 3FTZA 3QDNA 2PM7A 3E33A 4AEZC 4U96D 3PZ1A 3DEOA 2WMNA 2WXRA 2AJAA 3CHOA 1LD7A 1JCQA 4G11A 4WNGA 3HDXA 2DZOA 1UG3A 4WNFA 2V8SE 2J08A 5ENSD 2FEZA 3BU8A 3HXCA 3PEUB 3FTVA 2CG2A 4LEUA 5FQ6A 1DC2A 3V79K 1TR4A 5FZRA 3PS6A 1JPLA 4FLBA 3QAQA 4NACA 4MS6A 5BW8C 5CRVA 4G2VA 4DX1A 3LS8A 4N5CA 4HS2A 4Q94A 4ZFHA 1MZCA 3Q78A 4N3CA 2L9BA 2KC7A 2CHWA 3L17A 5ENNA 3BQOA 3UM2A 1PC2A 5B1BE 4M7CA 1DNPA 3Q9NC 3UXGA 2PZIA 4GYOA 2QYUA 1KLXA 2KCLA 4V3IA 4CDMA 3B7TA 2YNQA 3S7BA 3PNTB 3B95A 3G2UA 4YVQC 5BXOA 4LG6A 4I6JA 3I3NA 3EIJA 1LTXA 3Q15A 1XNFA 4DX5D 5G04J 1UJKA 1KPSB 1KT1A 4KVMA 4DX2A 3EHNA 5J08A 1N54A 1TJCA 3FTUA 3UT8A 4DI3A 4I6EA 5ARGA 2F37A 3ZYMA 1JCSA 4G8KA 4QFVA 3TG4A 1IYGA 2KBXA 3FUIA 2AXVA 2B6CA 2PQRA 1TNBA 3U64A 3ZIMA 1N4RA 3UKRG 1OWPA 5FWQA 2M63A 3CVXA 1TN8A 3CSTA 2P9UG 3SFZA 2RKKA 1AWCB 3HXDA 1LF8A 2VJ8A 2DCPA 3JQ1A 3AS5A 4IRUA 3QWVA 3QWWA 3MA5A 4E6HA 1N95A 4Z68A 5AQ9A 4A63B 3UQ3A 3I4GA 4B94A 1TNUA 5FT9A 5AIJA 5LP0A 2J49A 1INZA 4GA0A 4UWGA 2LXLA 4DX6D 3IBEA 4RLYA 5T4YA 5EX0A 2V0PA 1H2TC 3BEEA 3KSLA 5FIOA 4G25A 4I43A 3PREA 4CGVA 4WWNA 3NOCD 1H19A 1ZU2A 1ZBPA 3HVEA 1DCEA 4FP7A 3FUDA 3C5RA 1N0RA 3ULYA 3GZ1A 4ILGA 3S7FA 3Q49B 3D9PA 3EUVA 3SD5A 1XGWA 4I9EA 2RG8A 2DBAA 5AENA 1HZ4A 3ZRHA 4J8EA 5KJNA 3D9NA 5D2MC 3G2VA 3S2AA 2YQ8A 3D9HA 4HLEA 2OVFA 4BESA 4ACKA 3AJIA 1H6OA 4A55A 3MX3A 1HE8A 2VYIA 1S0PA 2P9NG 2BEDA 2C0MA 2F8YA 1U3DA 4N5QA 2AWIA 2KXPC 1MQSA 3QC1A 4TXQA 2I6HA 2VGYA 3CQCB 4J8SA 4FA6A 3BG0B 2CG3A 3PZ4A 4YDWA 4LCTA 4TUUA 2BKKB 5AQAA 2QYJA 1V54E 3SY2A 1QZ2A 3Q75A 3R7QA 3SFXA 5BNWA 5ENPD 4WUYA 3FH5A 4DI4A 1D8DA 5T8IA 1L5JA 4ABNA 1FT2A 5G2NA 3TG5A 2WXPA 3ZUVB 1OWMA 2DVWA 2CFUA 5CBOA 1S70B 1OXJA 1Y6IA 3X2QE 3CV0A 3RRUA 4CYMD 3CHPA 2JEKA 3MKQB 4OVVA 4KBQA 2F8XK 4F7AA 3MV2B 1HO8A 2I2OA 3LJNA 4HORA 4DX7D 5CEDB 3FUEA 5KBAA 1WM5A 3ZW3A 2EILE 3FEYA 3PE3A 2H6FA 2I1KA 3CLJA 4HRNA 2HYZA 1UN9A 3FH8A 2E2EA 2X6FA 1MYOA 1O5MA 2EQXA 4K0RA 4PS3A 3FULA 3UPVA 1H0AA 5EN5D 3SZ7A 1BPOA 2LSUA 2P58C 2UY1B 5A7DB 5CERB 2KM4A 2WXOA 4F1PA 3T8MA 3GZ2A 4BX8A 1UW4B 4NRHB 2WXNA 1N9AA 4GPMA 2KCKA 2X38A 4DK5A 3MCXA 4ILHB 5ARFA 2NSZA 1N11A 4G1TA 4WAFA 3JXIA 2IJGX 3AAAC 3P1UA 4DPRA 3C72A 3TXMA 1RW2A 2WXKA 4YVOA 5G05J 3HXEA 4XKCA 1D8EA 1QBQA 4DLOA 5LCWJ 2J09A 3FUHA 5FQ4A 3Q9UC 3ABLE 3QKYA 5AQ7A 3PNLB 4UI9C 2BF0X 3ONLA 3L6AA 2XRYA 3D9LA 3SGHA 3DSXA 2QY7A 4B8AA 4ME2A 4GYWA 4GU5A 3L82A 5JJTA 1S63A 3DWLG 2XPZA 3J5PA 4GTMA 4U8YD 3OTNA 4O1OA 1WY6A 4AXHA 2X6KA 3PE4A 3SHFA 4F1SA 4MBGA 3MV3B 5ANRA 3CVYA 3CSFA 3NOGD 1BLXB 2GRLA 4JC8A 4JL0A 4BERA 4W9RA 3I5PA 3TWUA 4I9CA 3ZYLA 2FO1E 3VLDA 3L54A 3UMVA 2XRZA 1D9SA 4JW1A 3B7BA 1FT1A 3ZHEA 3Q7AA 3BG1B 5A6CA 2YINA 3MJWA 4O60A 4TUMA 4Y6WA 4U8VD 2LNIA 5EDSA 3ASFA 3NB2A 2LSVA 5HRYA 4XI0A 4IULA 5B3SE 3U3WA 3QK0A 4B89A 5KWDA 1JWGA 1QYMA 5CEAA 5DBKA 3CK8A 2IF4A 5D66A 4AV7A 1N4PA 2Y69E 5G04C 2VSXE 3T8KA 2ZGGA 3SBSA 2V4LA 3HRAA 4U07A 3L13A 3DSVA 3APDA 4C0EA 3AG3E 2ZU6B 4U0SA 2H6HA 4EQFA 3B7SA 3ONKA 3APFA 3TWXA 2FBNA 3CVPA 3CHSA 2LXMA 3JYSA 3PZ2A 3WG7E 1OCCE 3VTXA 3LVRE 2VGXB 4J7WA 3CVNA 1TJFA 4N39A 3L08A 4AVXA 1FVHA 1Z6TA 1FPPA 4LNGA 4I2ZA 3SF4A 3WXXA 3ZHEB 3TWQA 4CEMA 5BT1A 4GMRA 3FY4A 3UIPC 4JD2G 3CKCA 3T5VA 5CHEE 2FI7A 4APOA 1NI1A 3FH7A 1NA0A 2XEEA 5ENTD 5BXUA 4Q69A 1Z5SC 4YNDA 4RSYA 1NP7A 2VSNA 2KATA 3KEZA 1SZ9A 4TRQA 5E76A 4ANXA 3ZN3A 4MLPA 2QFCA 2XS1A 4EZKA 3HXBA 1HG2A 4HVBA 3OXLA 4AY6A 3UKUG 3L16A 1IQRA 5ITZF 3CVLA 4J0UA 4HRLA 4LERA 4YDEA 1FCHA 2QZAA 1YMPA 1IHGA 4OVUA 3ABKE 1BI7B 2VQ2A 1NA3A 2R05A 1N4SA 2KZTB 1A5EA 4BT8A 3FUFA 4BFRA 3FTXA 3G2SA 1V55E 3CHQA 2WPVA 2OEWA 4N2QA 1HXIA 3C3OA 3P2BA 5LX8A 4HOTA 1KZOA 2R02A 2IU1A 3JCKC 2V5QC 1HH8A 1N0QA 1X81A 3SBTB 4P29A 2IY0C 3UT7A 3QJZA 2RFAA 2R2LA 3CVWA 4QQIA 2WXIA 2GRNB 5M72A 4OAVB 1HX8A 3T9KA 1ELWA 3ZYQA 5EIBE 2OEVA 3ESKA 3FUMA 2ZXWE 4UWHA 3RJVA 4UI9J 4BY6A 4GMJA 4U8HA 3ZXSA 4AM9A 2X3MA 1H2VC 1SVXA 4EHMA 1UN8A 3CQGB 5KCMA 3TGOA 5AN8A 3APCA 2PQNA 5JHAA 4XKBA 3FU3A 3TWSA 4A1SA 4GTVA 2KZTA 5A23A 4GCNA 1OY3D 4G24A 2R17C 4GA1A 3DRAA 1TN6A 1EPUA 1G3NB 4J8DA 4XE0A 1KT0A 2HE0A 2WQ6A 3ML8A 1AP7A 3ISMC 1TNZA 1OCZE 3LVQE 4CDNA 4UI9K 5EYPF 4TXRA 4PDXA 2VTBA 4B93B 5HS0A 5BV0A 3CVUA 5EILA 1UJJA 2Y1LE 3BUAA 4U7EB 2P2CP 5CRUA 1BU9A 4N2SA 1IKND 3ULEG 3UT4A 4UQYA 2GW1A 4EECA 3O48A 5JA4D 1H6PA 3NF1A 2XHEA 1H6KA 5CMWA 3AU5A 2WXMA
chains in the Genus database with same CATH topology
3HIZA 1GW6A 3D3MA 4DLQA 4J6IA 3FUNA 3TJPA 2IOLA 3Q4AB 2DIWA 3VLFA 2LSUA 2P58C 3FEXA 4I17A 3G2TA 2VSYA 2UY1B 5A7DB 2KM4A 4U0ZA 3O4ZA 3FHEA 4JVSA 2LAHA 2RD0A 3S7DA 5J90A 2WXOA 3PVLA 2AXZA 3T8MA 1E8YA 4GPKA 4RVBA 4JHRA 2XGOA 4PUCA 3GZ2A 4BX8A 4JHJA 4LRZA 3OXGA 1UW4B 1QQEA 2OV8A 4NRHB 2WXNA 4N3BA 4CRWA 2L0IA 1JUQA 3Q47B 4GB9A 2FULA 4E85A 3K9IA 1IQUA 2KCKA 2X38A 3AU4A 4I6GA 1EYHA 4Y6CA 3MCXA 5AYWD 2XCBA 3VTYA 4A3TA 4DK5A 5LFAA 4FLHA 1EF1C 3LY8A 4ILHB 5T3RA 2VGXA 5ARFA 4EPZA 4CGWA 3FTYA 1MHQA 2PM6A 2FO7A 2NSZA 3ZPJA 3RO3A 4G1TA 4WAFA 2R59A 3FTZA 3D9KA 2IJGX 3P1UA 2PM7A 3QDNA 4DPRA 5C1DA 4AEZC 5KJKA 3TXMA 1E7VA 2WXKA 4YVOA 2WMNA 5G05J 2WXRA 4XKCA 3CHOA 3CK7A 4DLOA 3PDNA 3E4BA 5LCWJ 2CHXA 4PS7A 2J09A 3FUHA 4G11A 4WNGA 3HDXA 5FQ4A 1H2UA 4ANWA 4KVOA 2IOSA 3FU0A 3C98A 3NZUA 3QKYA 4F53A 5DIZA 3PNLB 4UI9C 2BF0X 3OXFA 1UG3A 3ONLA 4WNFA 3L6AA 5CMYA 3ESLA 1HF8A 2V8SE 2J08A 3FDHA 2XRYA 2FEZA 3D9LA 3SGHA 4DJAA 1P5QA 4KZ0A 2QY7A 3MKQA 4B8AA 3PEUB 4ME2A 4GYWA 3FTVA 3OAWA 3LPZA 4GU5A 3T5XA 2CG2A 3S7JA 5JJTA 4XIFA 4JEHA 4GZCA 4LEUA 5FQ6A 5KJLA 4HFGA 4BX9A 5FZRA 3B7RL 3PS6A 2XPZA 4I1AA 4L2YA 3CEQA 4LUNU 3CR3A 1JPLA 1E90A 4FLBA 3PEVB 3OTNA 3QAQA 5JHBA 4NACA 5JJ7A 3ZYKA 4MS6A 4EZJA 5BW8C 1WY6A 3CIAA 4G2VA 4AXHA 1SZAA 3LS8A 4CT0A 2GGFA 2X6KA 3PE4A 3ZEFA 3D9JA 3QNKA 4N5CA 4FC8A 3SHFA 2X6IA 2X6HA 4HS2A 4Q94A 4F1SA 4OYSA 1W3BA 2I1JA 3U9WA 4GZ3A 4IN3B 4N3CA 3MV3B 5ANRA 2L9BA 2KC7A 3CVYA 3CSFA 4L1BA 2J9QA 5EX3A 4CDRA 2MOWA 2CHWA 3L17A 1EDUA 5ENNA 5BPPA 4FHJA 1B89A 2GRLA 4JC8A 4JL0A 4UQXA 2C0LA 4W9RA 4GA2A 1PC2A 3IEGA 4HOSA 3EIQC 3I5PA 1DNPA 4MKTA 4I9CA 3PZDA 3ZYLA 2FF4A 4H7XA 2BTDA 2PZIA 2R5SA 4GYOA 3RRNB 3VLDA 1KLXA 2KCLA 2HR2A 3L54A 4V3IA 4CDMA 3B7TA 4WNDA 3UMVA 1X5BA 2XRZA 2YNQA 3PUKA 3S7BA 3PNTB 4JW1A 4A3VA 3G2UA 3AS8A 3FUKA 4YVQC 1Y8MA 2WM9A 2Q7FA 4I6JA 3I3NA 3IHYA 2Y3AA 4G26A 3ZHEA 1OWLA 3CVVA 5BV1A 3EIJA 3BG1B 4KMOA 5A6CA 3Q15A 2YINA 1XNFA 1YA0A 3MJWA 4APFA 3B13A 5G04J 1UJKA 4JEUA 4Y6WA 1KT1A 4KVMA 2LNIA 2OOEA 5EDSA 3KS2A 3EHNA 4FHKA 3ASFA 5J08A 2XQ0A 1PY1A 3ULQA 3FUJA 1N54A 1TJCA 3FTUA 3UT8A 2LSVA 1HFAA 4IYPA 1SQMA 4I6EA 5ARGA 4XI0A 4IULA 4DI3A 3ASDA 4I2WA 3U3WA 4JHKA 3QK0A 2VSOE 3ZYMA 4ACLA 4B89A 4FADA 1JWGA 2KCVA 3G2WA 3D9IA 4AOFA 1ELRA 2I9CA 3FFLA 4QFVA 3TG4A 1IYGA 5DBKA 3CK8A 3FUIA 2IF4A 3UUXA 4AV7A 2AXVA 2PQRA 5G04C 4B8CB 4MRUA 2VSXE 3SBSA 3LYAA 2V4LA 3U64A 4U07A 3L13A 4Q96A 3ZIMA 2CFZA 2WXFA 1Z3XA 1N52A 1OWPA 1WAO1 3EDTB 5FZSA 3APDA 4UWFA 3GW4A 1DVPA 5E75A 3PH0C 5FWQA 4C0EA 4NQ0A 3PUJA 2M63A 3CVQA 4BSXA 4HOQA 2ZU6B 2CHZA 3CVXA 2J07A 4U0SA 4AY5A 4EQFA 3CSTA 4UWLA 5D0QD 2OVBA 3SFZA 5FQ8A 1HS6A 3TAXA 3B7SA 3ONKA 3APFA 4JPSA 3TL5A 4L23A 3CK9A 5FJYA 2FBNA 2L6JA 3CVPA 1E8ZA 3CHSA 5G05C 2HM8A 5CCLA 1LF8A 3JYSA 1NZNA 2VJ8A 3MKRA 2DCPA 3N71A 3ASHA 3ML9A 3JQ1A 3AS5A 3D9OA 3VTXA 3LVRE 2VGXB 3R9AB 4IRUA 2XEVA 4BTBA 3CVNA 1TJFA 2AVPA 3QWVA 4N39A 3L08A 5AJLA 3QWWA 3MA5A 1FVHA 4AVXA 1Z6TA 4E6HA 3SI5A 2J4DA 2UWJG 3FWVA 3R7RA 5FQ7A 3EJNA 3UQ3A 3I4GA 4B94A 4I2ZA 5FT9A 3SF4A 4I1OB 3WXXA 3ZHEB 4EZLA 4CEMA 5BT1A 5AIJA 5LP0A 1Z3YA 3KD7A 2J49A 4AJWA 3FY4A 4GA0A 3QWPA 1INZA 4UWGA 3CKCA 3T5VA 3JQ0A 5CHEE 2UY1A 2FI7A 4APOA 4AP2A 3FH7A 3LJ3A 2MRIA 3IBEA 1NA0A 2IFUA 2V5FA 3FU6A 5T4YA 1TEZA 2WXJA 4UQZA 5EX0A 1U3CA 2V0PA 2JLBA 1H2TC 3BEEA 1JWFA 4Q69A 4F3VA 4G25A 4WWPA 2WMOA 4YNDA 4RSYA 3QB2A 4I43A 1NP7A 5FZQA 2VSNA 3PRZA 1E8WA 3PREA 2KATA 4CGVA 3LDZA 4WWNA 3NQPA 4EBAG 2BUGA 3MYVA 2C2LA 3ZVVA 1H19A 1ZU2A 2XPIA 1SZ9A 3KEZA 1ZBPA 4TRQA 5E76A 3FTWA 3IKOB 3HVEA 4ANXA 4FP7A 3FUDA 2HO1A 3ZN3A 5BUZA 3CKBA 2Y4UA 4MLPA 3GZSA 4BWRA 4GZDA 5CCMA 2QFCA 4KT6B 4KXKB 4EZKA 4BTAA 3GZ1A 4KZCA 1HG2A 3SNXA 4HVBA 3OXLA 3D9MA 4AY6A 2A5UA 4I1MA 2MHKA 3L16A 4ILGA 3S7FA 1IQRA 5LCWC 3Q49B 3CVLA 3IV0A 4J0UA 3UX4A 3D9PA 3SD5A 4AIFA 3FU5A 1XGWA 4U0UA 4U63A 4LERA 4GAAA 4I9EA 1FCHA 4K03A 4L2LA 2RG8A 2DBAA 2XCCA 3LY7A 5AENA 1HZ4A 3ZRHA 1IHGA 4J8EA 3LEWA 4OVUA 5KJNA 3TXNA 2VTBB 3D9NA 1A17A 4UWKA 5C2YA 2L0TB 3DBSA 4FULA 3G2VA 2VQ2A 4WWOA 3Q5MA 1NA3A 4ANUA 2KZTB 3S2AA 2YQ8A 4HLEA 4BT8A 2OVFA 3FUFA 3RU0A 3URZA 4GMLA 4BFRA 3IHVA 4ACKA 4B0ZA 2XPYA 3FTXA 1ELKA 3G2SA 3LY9A 4A55A 4TV3A 3CHMA 3MX3A 2WB2A 3CHQA 2WPVA 4RG6A 3CHRA 2X6JA 4HXIA 1HE8A 4N2QA 2VYIA 1HXIA 1HU3A 4RG9A 1S0PA 3P2BA 4HOUA 2WQHA 2Y4TA 5LX8A 2C0MA 5AJDA 4HOTA 4ANVA 3JCKC 1PAQA 2IU1A 1U3DA 3AS4A 1HH8A 2AWIA 3JUIA 1MQSA 3QC1A 4A1GA 4ILIA 3SBTB 4GCOA 4P29A 3UT7A 2GRMA 2XGMA 3QJZA 3CVWA 2WXQA 2I6HA 2VGYA 2WXIA 3CQCB 4J8SA 5G55A 5M72A 1HX8A 4FA6A 4BT9A 4O6FA 3QARA 3VLEA 4C0MA 1E7UA 3HVEB 3BG0B 1ELWA 5JJ6A 2CG3A 3ASGA 3ZGQA 3RO2A 3ZYQA 4C9BB 4EBAA 4JXTA 3HHMA 3ESKA 3FUMA 3LCAA 2NC9A 3CGHA 4UWHA 3RJVA 4UI9J 4BY6A 4GYYA 4GMJA 4U8HA 4CCAA 3ZXSA 4XI9A 4LCTA 4TUUA 2ONDA 5FTPA 4WNEA 4L7TA 4AM9A 4XX5A 2X3MA 3MGBA 4URKA 1H2VC 3U66A 1QZ2A 1UN8A 3R7QA 3CQGB 5EKQD 5KCMA 5ANLA 3TGOA 3EHMA 3RIBA 3I4RB 5BNWA 3APCA 3FTSA 3LXUX 2PQNA 2WXHA 3FH5A 4WUYA 4DI4A 4M3OA 5T8IA 1L5JA 4ABNA 1OWOA 3GYZA 1FVFA 3FU3A 4XKBA 2WXPA 5G2NA 3TG5A 5JHAA 2NXPA 1OUVA 2A4ZA 4J8FA 4A1SA 1OWMA 2PL2A 2CFUA 4N3AA 4XZ4A 3FP3A 3MZLB 2KZTA 4PH4B 5A23A 1Y6IA 4GCNA 4D10C 4G24A 5HQ8A 2E0IA 4R7LA 3CV0A 2R17C 4GA1A 4G23A 4JZYA 1EPUA 2YHCA 4PS8A 3RRUA 4J8DA 4GZ5A 2WXGA 3CHPA 4XE0A 1KT0A 2JEKA 2LAIA 3MKQB 4OVVA 2WQ6A 3HYMB 3RK6A 3ML8A 4KBQA 2AW6A 3L22A 2WXLA 4F7AA 4FJYA 3MV2B 3LVQE 4CDNA 1HO8A 4UI9K 2I2OA 3MEKA 4FJZA 4HORA 4PDXA 4JA7A 4KYOB 4GZ6A 4H7YA 2VTBA 4NURA 3LKUA 5BV0A 3CVUA 1E96B 5LOZA 2ILRA 3FUEA 1UJJA 4ATGA 1WM5A 3U4TA 3ZW3A 5KJMA 2IQCA 3FEYA 3PE3A 3RRMB 4CT4A 2XGSA 2I1KA 4JA9A 1OWNA 3CLJA 5D0OD 5HI7A 2HYZA 4FU3A 2YHEA 4N2SA 4U04A 2WQ7A 3RKVA 1UN9A 3FH8A 2E2EA 2X6FA 3QOUA 3UT4A 4UQYA 3B7UX 1E8XA 1HG5A 2GW1A 1VDYA 2J4BA 2EQXA 3ZFWA 4EECA 3O48A 4K0RA 2AXUA 2LO6A 4PS3A 5CMWA 3KAEA 3FULA 1QNFA 2WVIA 3NF1A 3UPVA 1H0AA 2XHEA 3ENEA 2IONA 3NZSA 1H6KA 3DPDA 3SZ7A 3AU5A 2WXMA 1BPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI5 A;  4A1G A;  4AEZ C;  2LAH A;  2WVI A; 
#chains in the Genus database with same CATH topology
 2PNN A;  4C48 B;  3FUN A;  4J8Y A;  2ZIR A;  3FEX A;  4I17 A;  3G2T A;  2RD0 A;  2AXZ A;  4GPK A;  4JHJ A;  1QQE A;  2OV8 A;  4CRW A;  3Q47 B;  4GB9 A;  4E85 A;  3K9I A;  4DRX E;  1TNY A;  4RQI A;  3AU4 A;  4Y6C A;  3VTY A;  5LFA A;  1EF1 C;  1MJ0 A;  3ABM E;  3LY8 A;  5T3R A;  2VGX A;  3FTY A;  2IEJ A;  2GRO B;  3ZPJ A;  3RO3 A;  3DSW A;  2ETC A;  3NBN B;  3EHQ A;  3PDN A;  2JAB A;  2CHX A;  5JMN D;  3E30 A;  4KVO A;  3FU0 A;  3C98 A;  4F53 A;  3OXF A;  5CMY A;  3ESL A;  1OCO E;  1P5Q A;  4KZ0 A;  3UI2 A;  4XIF A;  4GZC A;  4HFG A;  4BX9 A;  3V2O A;  4L2Y A;  1YYH A;  4LUN U;  3CR3 A;  3PEV B;  3ZYK A;  4CT0 A;  3ZNG A;  2GGF A;  2X6H A;  3U9W A;  1K8K G;  2GRP B;  4GZ3 A;  3EU5 A;  4L1B A;  2J9Q A;  4BEP A;  2MOW A;  3R9M A;  2Y0B G;  2ETB A;  5BPP A;  4FHJ A;  4UQX A;  2C0L A;  3V31 A;  4HOS A;  3EIQ C;  1Q2Z A;  4U95 D;  3UIN C;  2FF4 A;  2OCC E;  2GRQ B;  3RRN B;  2HR2 A;  1X5B A;  3PUK A;  4A3V A;  3IHY A;  2Y3A A;  4G26 A;  1OWL A;  5AAO A;  3V30 A;  5BV1 A;  4OAU C;  4KMO A;  3DST A;  1YA0 A;  1TN7 A;  5CBN A;  2XQ0 A;  1PY1 A;  3ULQ A;  1SQM A;  3ASD A;  4I2W A;  4FAD A;  5HKP A;  2KCV A;  3G2W A;  4AOF A;  2I9C A;  3FFL A;  1WG0 A;  3E32 A;  3LYA A;  3Q7F A;  4HRM B;  1KZP A;  2WXF A;  3EDT B;  5FZS A;  4UWF A;  5E75 A;  3PH0 C;  2ETA A;  4NQ0 A;  3PUJ A;  3CVQ A;  4K5B A;  4BSX A;  4DUI A;  2CHZ A;  3TWW A;  2J8S D;  2QC9 A;  4F6R D;  4UWL A;  4HNA D;  1HS6 A;  3TAX A;  4JPS A;  4L23 A;  2L6J A;  1E8Z A;  2HM8 A;  3MKR A;  2DZN A;  3N71 A;  3ML9 A;  3R9A B;  2XEV A;  4BTB A;  2AVP A;  2J4D A;  2UWJ G;  3R7R A;  5FQ7 A;  3EJN A;  4I1O B;  3DEP A;  4EZL A;  3DSS A;  3JXJ A;  1Z3Y A;  3KD7 A;  3JQ0 A;  2UY1 A;  5AAR A;  4X8Q A;  4UUC A;  2IFU A;  2V5F A;  3FU6 A;  2WXJ A;  4UQZ A;  1U3C A;  2JLB A;  1JWF A;  4F3V A;  4G8L A;  4WWP A;  5FZQ A;  3PRZ A;  1E8W A;  4EBA G;  2BUG A;  2C2L A;  4ZHB A;  3FTW A;  3IKO B;  3ZKJ A;  1N94 A;  2HO1 A;  5BUZ A;  3CKB A;  2Y4U A;  3GZS A;  4BWR A;  2B0O E;  4GZD A;  2ZIS A;  4KXK B;  4BTA A;  4KZC A;  2A5U A;  3DXM G;  5LCW C;  3IV0 A;  4AIF A;  4U0U A;  4U63 A;  4GAA A;  4L2L A;  4K03 A;  3IXE A;  1LD8 A;  3LY7 A;  3LEW A;  3TXN A;  2L0T B;  4FUL A;  4WWO A;  3Q5M A;  4ANU A;  4GTR A;  3URZ A;  2IO2 C;  4B0Z A;  2XPY A;  1ELK A;  3LY9 A;  4CZ2 D;  3W9F A;  2WB2 A;  2X6J A;  4HXI A;  4RG9 A;  2WQH A;  1BI8 B;  5AJD A;  1MX6 A;  4ANV A;  3AS4 A;  4A1G A;  4ILI A;  1NFI E;  4GCO A;  2GRM A;  2WXQ A;  2F0Y A;  3V2X A;  4O6F A;  3QAR A;  4TXP A;  4GTQ A;  4C9B B;  3ASG A;  4EBA A;  3HHM A;  4GTT A;  4YDO A;  3TWV A;  4XI9 A;  2OND A;  4WNE A;  4L7T A;  4XX5 A;  3MGB A;  5EKQ D;  1U2V G;  3EHM A;  1SA5 A;  2H6G A;  3LXU X;  3SO8 A;  5CEC B;  1OWO A;  3UIO C;  3GYZ A;  3RAU A;  2VGE A;  4J8F A;  1K1A A;  3FP3 A;  1O1S A;  4PH4 B;  5ENR D;  4XEI G;  4PS8 A;  4O1P A;  2WXG A;  5EID A;  2IO3 C;  2LAI A;  3HYM B;  3RK6 A;  2AW6 A;  2WXL A;  2P9S G;  4FJY A;  3MEK A;  4JA7 A;  4KYO B;  5LOZ A;  3U4T A;  2IQC A;  4CT4 A;  2XGS A;  4NIK A;  5D0O D;  3RKV A;  3QOU A;  2R03 A;  3B7U X;  3ASN E;  1HG5 A;  1TNO A;  3ZFW A;  2AXU A;  2LO6 A;  3KAE A;  2WVI A;  3ENE A;  3NZS A;  3DSU A;  4LNB A;  2XZD G;  1GW6 A;  1BD8 A;  4DLQ A;  2XEN A;  2IOL A;  3Q4A B;  4HQD A;  2VSY A;  4U0Z A;  3FHE A;  3S7D A;  3PZ3 A;  3PVL A;  2GRR B;  4JHR A;  2XGO A;  4PUC A;  3TWT A;  2EIJ E;  1JCR A;  1IQU A;  4AY5 A;  4I6G A;  5AYW D;  2XCB A;  3E37 A;  2P9P G;  2A5E A;  2FO7 A;  2R59 A;  1YCS B;  3D9K A;  1WDY A;  5C1D A;  5KJK A;  1K3Z D;  3TWR A;  3L9T A;  1E7V A;  4JB8 P;  3CK7 A;  2RFM A;  3E4B A;  4PS7 A;  4ANW A;  1H2U A;  2P9L G;  2IOS A;  3NZU A;  5DIZ A;  1HF8 A;  3FDH A;  3RSE G;  4DJA A;  3MKQ A;  3UTM A;  3OAW A;  3LPZ A;  3T5X A;  3S7J A;  3UM0 A;  4JEH A;  5KJL A;  3F6Q A;  3B7R L;  4I1A A;  1MX4 A;  3CEQ A;  2NYJ A;  1E90 A;  3EHR A;  5JHB A;  5JJ7 A;  4EZJ A;  3CIA A;  1SZA A;  2EIK E;  2XEH A;  4BSZ B;  3ZEF A;  3EU9 A;  3D9J A;  3QNK A;  4FC8 A;  2DWZ A;  2X6I A;  4OYS A;  1N4Q A;  2I1J A;  1W3B A;  4IN3 B;  4CDR A;  5EX3 A;  3W9G A;  1EDU A;  3HXF A;  1NL4 A;  1B89 A;  4GA2 A;  3C3Q A;  3IEG A;  4MKT A;  3PZD A;  4H7X A;  2BTD A;  2R5S A;  1O1R A;  4WND A;  5ENQ D;  3AS8 A;  3FUK A;  1Y8M A;  2WM9 A;  2Q7F A;  3CVV A;  3SQV A;  4APF A;  3B13 A;  4JEU A;  3Q79 A;  2OOE A;  3KS2 A;  4FHK A;  2XS8 A;  3FUJ A;  1HFA A;  4IYP A;  4JHK A;  4ACL A;  2VSO E;  5AQB A;  3D9I A;  1IXV A;  1ELR A;  1DCQ A;  3JUE A;  3UUX A;  2H6I A;  4B8C B;  4MRU A;  3AG1 E;  4Q96 A;  2CFZ A;  4HI9 A;  1Z3X A;  1N52 A;  1WAO 1;  3UM1 A;  3GW4 A;  1DVP A;  5EYL A;  4LNU D;  4HOQ A;  4HI8 A;  2J07 A;  5D0Q D;  2OVB A;  5FQ8 A;  3TL5 A;  3CK9 A;  5FJY A;  2L6B A;  5G05 C;  5CCL A;  1NZN A;  2XZT G;  3ASH A;  3D9O A;  1S64 A;  5AJL A;  5B1A E;  3SI5 A;  3FWV A;  2MYO A;  5KNH D;  4AJW A;  3QWP A;  2P9K G;  2LUH A;  4AP2 A;  3LJ3 A;  2MRI A;  1TEZ A;  2EIM E;  1UOH A;  2WMO A;  3QB2 A;  3HG0 D;  3Q73 A;  3LDZ A;  3NQP A;  3MYV A;  3ZVV A;  2XPI A;  3E34 A;  5ENO D;  5KNG A;  5CCM A;  4KT6 B;  3SNX A;  3D9M A;  4I1M A;  2MHK A;  4K5A B;  4ATZ D;  3UX4 A;  3FU5 A;  3AG2 E;  4GTS A;  2XCC A;  3SFY A;  2VTB B;  1A17 A;  4UWK A;  3C3R A;  5C2Y A;  3DBS A;  5H7P A;  3RU0 A;  4GML A;  3IHV A;  4TV3 A;  3CHM A;  4RG6 A;  3CHR A;  1K1B A;  1HU3 A;  1SA4 A;  4HOU A;  2Y4T A;  3ZU7 B;  1PAQ A;  3DXK G;  3JUI A;  3ASO E;  4BET A;  2XGM A;  5G55 A;  4BT9 A;  3VLE A;  4C0M A;  1SW6 A;  1ZB1 A;  1E7U A;  3HVE B;  5JJ6 A;  3ZGQ A;  3RO2 A;  4JXT A;  3LCA A;  2NC9 A;  3CGH A;  4GYY A;  4CCA A;  4GTP A;  1RZ4 A;  5FTP A;  4URK A;  3U66 A;  2ZGD A;  4K5C A;  5ANL A;  3RIB A;  3I4R B;  3FTS A;  5FIN A;  1MX2 A;  2WXH A;  2DYS E;  4M3O A;  1FVF A;  2NXP A;  1OUV A;  2A4Z A;  2PL2 A;  4N3A A;  4XZ4 A;  3MZL B;  4D10 C;  5HQ8 A;  2E0I A;  4R7L A;  1OCR E;  1TYQ G;  4L9P A;  4G23 A;  4JZY A;  2YHC A;  3KEA A;  4GZ5 A;  4HB5 A;  3L22 A;  4HLL A;  2EIN E;  4FJZ A;  3AG4 E;  4GZ6 A;  4H7Y A;  4NUR A;  3LKU A;  4LSZ E;  1E96 B;  2ILR A;  4ATG A;  3DPY A;  5KJM A;  3RRM B;  3J5Q B;  4JA9 A;  1OWN A;  5HI7 A;  4FU3 A;  5IY5 E;  2YHE A;  1IHB A;  4HBD A;  4U04 A;  2WQ7 A;  1E8X A;  1VDY A;  2J4B A;  3NAW A;  1QNF A;  2ION A;  3DPD A;  3HIZ A;  3D3M A;  4J6I A;  3TJP A;  2DYR E;  3UM3 A;  2DIW A;  3VLF A;  3O4Z A;  4JVS A;  2LAH A;  5J90 A;  2V4H C;  1E8Y A;  4RVB A;  3KSQ A;  2BKG A;  4LRZ A;  3OXG A;  3ZXP A;  4N3B A;  2P9I G;  2L0I A;  1JUQ A;  2FUL A;  4YDY A;  1EYH A;  4A3T A;  4FLH A;  4GTO A;  1OT8 A;  4EPZ A;  4CGW A;  1MHQ A;  2PM6 A;  1O1T A;  3FTZ A;  3QDN A;  2PM7 A;  3E33 A;  4AEZ C;  4U96 D;  3PZ1 A;  3DEO A;  2WMN A;  2WXR A;  2AJA A;  3CHO A;  1LD7 A;  1JCQ A;  4G11 A;  4WNG A;  3HDX A;  2DZO A;  1UG3 A;  4WNF A;  2V8S E;  2J08 A;  5ENS D;  2FEZ A;  3BU8 A;  3HXC A;  3PEU B;  3FTV A;  2CG2 A;  4LEU A;  5FQ6 A;  1DC2 A;  3V79 K;  1TR4 A;  5FZR A;  3PS6 A;  1JPL A;  4FLB A;  3QAQ A;  4NAC A;  4MS6 A;  5BW8 C;  5CRV A;  4G2V A;  4DX1 A;  3LS8 A;  4N5C A;  4HS2 A;  4Q94 A;  4ZFH A;  1MZC A;  3Q78 A;  4N3C A;  2L9B A;  2KC7 A;  2CHW A;  3L17 A;  5ENN A;  3BQO A;  3UM2 A;  1PC2 A;  5B1B E;  4M7C A;  1DNP A;  3Q9N C;  3UXG A;  2PZI A;  4GYO A;  2QYU A;  1KLX A;  2KCL A;  4V3I A;  4CDM A;  3B7T A;  2YNQ A;  3S7B A;  3PNT B;  3B95 A;  3G2U A;  4YVQ C;  5BXO A;  4LG6 A;  4I6J A;  3I3N A;  3EIJ A;  1LTX A;  3Q15 A;  1XNF A;  4DX5 D;  5G04 J;  1UJK A;  1KPS B;  1KT1 A;  4KVM A;  4DX2 A;  3EHN A;  5J08 A;  1N54 A;  1TJC A;  3FTU A;  3UT8 A;  4DI3 A;  4I6E A;  5ARG A;  2F37 A;  3ZYM A;  1JCS A;  4G8K A;  4QFV A;  3TG4 A;  1IYG A;  2KBX A;  3FUI A;  2AXV A;  2B6C A;  2PQR A;  1TNB A;  3U64 A;  3ZIM A;  1N4R A;  3UKR G;  1OWP A;  5FWQ A;  2M63 A;  3CVX A;  1TN8 A;  3CST A;  2P9U G;  3SFZ A;  2RKK A;  1AWC B;  3HXD A;  1LF8 A;  2VJ8 A;  2DCP A;  3JQ1 A;  3AS5 A;  4IRU A;  3QWV A;  3QWW A;  3MA5 A;  4E6H A;  1N95 A;  4Z68 A;  5AQ9 A;  4A63 B;  3UQ3 A;  3I4G A;  4B94 A;  1TNU A;  5FT9 A;  5AIJ A;  5LP0 A;  2J49 A;  1INZ A;  4GA0 A;  4UWG A;  2LXL A;  4DX6 D;  3IBE A;  4RLY A;  5T4Y A;  5EX0 A;  2V0P A;  1H2T C;  3BEE A;  3KSL A;  5FIO A;  4G25 A;  4I43 A;  3PRE A;  4CGV A;  4WWN A;  3NOC D;  1H19 A;  1ZU2 A;  1ZBP A;  3HVE A;  1DCE A;  4FP7 A;  3FUD A;  3C5R A;  1N0R A;  3ULY A;  3GZ1 A;  4ILG A;  3S7F A;  3Q49 B;  3D9P A;  3EUV A;  3SD5 A;  1XGW A;  4I9E A;  2RG8 A;  2DBA A;  5AEN A;  1HZ4 A;  3ZRH A;  4J8E A;  5KJN A;  3D9N A;  5D2M C;  3G2V A;  3S2A A;  2YQ8 A;  3D9H A;  4HLE A;  2OVF A;  4BES A;  4ACK A;  3AJI A;  1H6O A;  4A55 A;  3MX3 A;  1HE8 A;  2VYI A;  1S0P A;  2P9N G;  2BED A;  2C0M A;  2F8Y A;  1U3D A;  4N5Q A;  2AWI A;  2KXP C;  1MQS A;  3QC1 A;  4TXQ A;  2I6H A;  2VGY A;  3CQC B;  4J8S A;  4FA6 A;  3BG0 B;  2CG3 A;  3PZ4 A;  4YDW A;  4LCT A;  4TUU A;  2BKK B;  5AQA A;  2QYJ A;  1V54 E;  3SY2 A;  1QZ2 A;  3Q75 A;  3R7Q A;  3SFX A;  5BNW A;  5ENP D;  4WUY A;  3FH5 A;  4DI4 A;  1D8D A;  5T8I A;  1L5J A;  4ABN A;  1FT2 A;  5G2N A;  3TG5 A;  2WXP A;  3ZUV B;  1OWM A;  2DVW A;  2CFU A;  5CBO A;  1S70 B;  1OXJ A;  1Y6I A;  3X2Q E;  3CV0 A;  3RRU A;  4CYM D;  3CHP A;  2JEK A;  3MKQ B;  4OVV A;  4KBQ A;  2F8X K;  4F7A A;  3MV2 B;  1HO8 A;  2I2O A;  3LJN A;  4HOR A;  4DX7 D;  5CED B;  3FUE A;  5KBA A;  1WM5 A;  3ZW3 A;  2EIL E;  3FEY A;  3PE3 A;  2H6F A;  2I1K A;  3CLJ A;  4HRN A;  2HYZ A;  1UN9 A;  3FH8 A;  2E2E A;  2X6F A;  1MYO A;  1O5M A;  2EQX A;  4K0R A;  4PS3 A;  3FUL A;  3UPV A;  1H0A A;  5EN5 D;  3SZ7 A;  1BPO A;  2LSU A;  2P58 C;  2UY1 B;  5A7D B;  5CER B;  2KM4 A;  2WXO A;  4F1P A;  3T8M A;  3GZ2 A;  4BX8 A;  1UW4 B;  4NRH B;  2WXN A;  1N9A A;  4GPM A;  2KCK A;  2X38 A;  4DK5 A;  3MCX A;  4ILH B;  5ARF A;  2NSZ A;  1N11 A;  4G1T A;  4WAF A;  3JXI A;  2IJG X;  3AAA C;  3P1U A;  4DPR A;  3C72 A;  3TXM A;  1RW2 A;  2WXK A;  4YVO A;  5G05 J;  3HXE A;  4XKC A;  1D8E A;  1QBQ A;  4DLO A;  5LCW J;  2J09 A;  3FUH A;  5FQ4 A;  3Q9U C;  3ABL E;  3QKY A;  5AQ7 A;  3PNL B;  4UI9 C;  2BF0 X;  3ONL A;  3L6A A;  2XRY A;  3D9L A;  3SGH A;  3DSX A;  2QY7 A;  4B8A A;  4ME2 A;  4GYW A;  4GU5 A;  3L82 A;  5JJT A;  1S63 A;  3DWL G;  2XPZ A;  3J5P A;  4GTM A;  4U8Y D;  3OTN A;  4O1O A;  1WY6 A;  4AXH A;  2X6K A;  3PE4 A;  3SHF A;  4F1S A;  4MBG A;  3MV3 B;  5ANR A;  3CVY A;  3CSF A;  3NOG D;  1BLX B;  2GRL A;  4JC8 A;  4JL0 A;  4BER A;  4W9R A;  3I5P A;  3TWU A;  4I9C A;  3ZYL A;  2FO1 E;  3VLD A;  3L54 A;  3UMV A;  2XRZ A;  1D9S A;  4JW1 A;  3B7B A;  1FT1 A;  3ZHE A;  3Q7A A;  3BG1 B;  5A6C A;  2YIN A;  3MJW A;  4O60 A;  4TUM A;  4Y6W A;  4U8V D;  2LNI A;  5EDS A;  3ASF A;  3NB2 A;  2LSV A;  5HRY A;  4XI0 A;  4IUL A;  5B3S E;  3U3W A;  3QK0 A;  4B89 A;  5KWD A;  1JWG A;  1QYM A;  5CEA A;  5DBK A;  3CK8 A;  2IF4 A;  5D66 A;  4AV7 A;  1N4P A;  2Y69 E;  5G04 C;  2VSX E;  3T8K A;  2ZGG A;  3SBS A;  2V4L A;  3HRA A;  4U07 A;  3L13 A;  3DSV A;  3APD A;  4C0E A;  3AG3 E;  2ZU6 B;  4U0S A;  2H6H A;  4EQF A;  3B7S A;  3ONK A;  3APF A;  3TWX A;  2FBN A;  3CVP A;  3CHS A;  2LXM A;  3JYS A;  3PZ2 A;  3WG7 E;  1OCC E;  3VTX A;  3LVR E;  2VGX B;  4J7W A;  3CVN A;  1TJF A;  4N39 A;  3L08 A;  4AVX A;  1FVH A;  1Z6T A;  1FPP A;  4LNG A;  4I2Z A;  3SF4 A;  3WXX A;  3ZHE B;  3TWQ A;  4CEM A;  5BT1 A;  4GMR A;  3FY4 A;  3UIP C;  4JD2 G;  3CKC A;  3T5V A;  5CHE E;  2FI7 A;  4APO A;  1NI1 A;  3FH7 A;  1NA0 A;  2XEE A;  5ENT D;  5BXU A;  4Q69 A;  1Z5S C;  4YND A;  4RSY A;  1NP7 A;  2VSN A;  2KAT A;  3KEZ A;  1SZ9 A;  4TRQ A;  5E76 A;  4ANX A;  3ZN3 A;  4MLP A;  2QFC A;  2XS1 A;  4EZK A;  3HXB A;  1HG2 A;  4HVB A;  3OXL A;  4AY6 A;  3UKU G;  3L16 A;  1IQR A;  5ITZ F;  3CVL A;  4J0U A;  4HRL A;  4LER A;  4YDE A;  1FCH A;  2QZA A;  1YMP A;  1IHG A;  4OVU A;  3ABK E;  1BI7 B;  2VQ2 A;  1NA3 A;  2R05 A;  1N4S A;  2KZT B;  1A5E A;  4BT8 A;  3FUF A;  4BFR A;  3FTX A;  3G2S A;  1V55 E;  3CHQ A;  2WPV A;  2OEW A;  4N2Q A;  1HXI A;  3C3O A;  3P2B A;  5LX8 A;  4HOT A;  1KZO A;  2R02 A;  2IU1 A;  3JCK C;  2V5Q C;  1HH8 A;  1N0Q A;  1X81 A;  3SBT B;  4P29 A;  2IY0 C;  3UT7 A;  3QJZ A;  2RFA A;  2R2L A;  3CVW A;  4QQI A;  2WXI A;  2GRN B;  5M72 A;  4OAV B;  1HX8 A;  3T9K A;  1ELW A;  3ZYQ A;  5EIB E;  2OEV A;  3ESK A;  3FUM A;  2ZXW E;  4UWH A;  3RJV A;  4UI9 J;  4BY6 A;  4GMJ A;  4U8H A;  3ZXS A;  4AM9 A;  2X3M A;  1H2V C;  1SVX A;  4EHM A;  1UN8 A;  3CQG B;  5KCM A;  3TGO A;  5AN8 A;  3APC A;  2PQN A;  5JHA A;  4XKB A;  3FU3 A;  3TWS A;  4A1S A;  4GTV A;  2KZT A;  5A23 A;  4GCN A;  1OY3 D;  4G24 A;  2R17 C;  4GA1 A;  3DRA A;  1TN6 A;  1EPU A;  1G3N B;  4J8D A;  4XE0 A;  1KT0 A;  2HE0 A;  2WQ6 A;  3ML8 A;  1AP7 A;  3ISM C;  1TNZ A;  1OCZ E;  3LVQ E;  4CDN A;  4UI9 K;  5EYP F;  4TXR A;  4PDX A;  2VTB A;  4B93 B;  5HS0 A;  5BV0 A;  3CVU A;  5EIL A;  1UJJ A;  2Y1L E;  3BUA A;  4U7E B;  2P2C P;  5CRU A;  1BU9 A;  4N2S A;  1IKN D;  3ULE G;  3UT4 A;  4UQY A;  2GW1 A;  4EEC A;  3O48 A;  5JA4 D;  1H6P A;  3NF1 A;  2XHE A;  1H6K A;  5CMW A;  3AU5 A;  2WXM A; 
#chains in the Genus database with same CATH homology
 3HIZ A;  1GW6 A;  3D3M A;  4DLQ A;  4J6I A;  3FUN A;  3TJP A;  2IOL A;  3Q4A B;  2DIW A;  3VLF A;  2LSU A;  2P58 C;  3FEX A;  4I17 A;  3G2T A;  2VSY A;  2UY1 B;  5A7D B;  2KM4 A;  4U0Z A;  3O4Z A;  3FHE A;  4JVS A;  2LAH A;  2RD0 A;  3S7D A;  5J90 A;  2WXO A;  3PVL A;  2AXZ A;  3T8M A;  1E8Y A;  4GPK A;  4RVB A;  4JHR A;  2XGO A;  4PUC A;  3GZ2 A;  4BX8 A;  4JHJ A;  4LRZ A;  3OXG A;  1UW4 B;  1QQE A;  2OV8 A;  4NRH B;  2WXN A;  4N3B A;  4CRW A;  2L0I A;  1JUQ A;  3Q47 B;  4GB9 A;  2FUL A;  4E85 A;  3K9I A;  1IQU A;  2KCK A;  2X38 A;  3AU4 A;  4I6G A;  1EYH A;  4Y6C A;  3MCX A;  5AYW D;  2XCB A;  3VTY A;  4A3T A;  4DK5 A;  5LFA A;  4FLH A;  1EF1 C;  3LY8 A;  4ILH B;  5T3R A;  2VGX A;  5ARF A;  4EPZ A;  4CGW A;  3FTY A;  1MHQ A;  2PM6 A;  2FO7 A;  2NSZ A;  3ZPJ A;  3RO3 A;  4G1T A;  4WAF A;  2R59 A;  3FTZ A;  3D9K A;  2IJG X;  3P1U A;  2PM7 A;  3QDN A;  4DPR A;  5C1D A;  4AEZ C;  5KJK A;  3TXM A;  1E7V A;  2WXK A;  4YVO A;  2WMN A;  5G05 J;  2WXR A;  4XKC A;  3CHO A;  3CK7 A;  4DLO A;  3PDN A;  3E4B A;  5LCW J;  2CHX A;  4PS7 A;  2J09 A;  3FUH A;  4G11 A;  4WNG A;  3HDX A;  5FQ4 A;  1H2U A;  4ANW A;  4KVO A;  2IOS A;  3FU0 A;  3C98 A;  3NZU A;  3QKY A;  4F53 A;  5DIZ A;  3PNL B;  4UI9 C;  2BF0 X;  3OXF A;  1UG3 A;  3ONL A;  4WNF A;  3L6A A;  5CMY A;  3ESL A;  1HF8 A;  2V8S E;  2J08 A;  3FDH A;  2XRY A;  2FEZ A;  3D9L A;  3SGH A;  4DJA A;  1P5Q A;  4KZ0 A;  2QY7 A;  3MKQ A;  4B8A A;  3PEU B;  4ME2 A;  4GYW A;  3FTV A;  3OAW A;  3LPZ A;  4GU5 A;  3T5X A;  2CG2 A;  3S7J A;  5JJT A;  4XIF A;  4JEH A;  4GZC A;  4LEU A;  5FQ6 A;  5KJL A;  4HFG A;  4BX9 A;  5FZR A;  3B7R L;  3PS6 A;  2XPZ A;  4I1A A;  4L2Y A;  3CEQ A;  4LUN U;  3CR3 A;  1JPL A;  1E90 A;  4FLB A;  3PEV B;  3OTN A;  3QAQ A;  5JHB A;  4NAC A;  5JJ7 A;  3ZYK A;  4MS6 A;  4EZJ A;  5BW8 C;  1WY6 A;  3CIA A;  4G2V A;  4AXH A;  1SZA A;  3LS8 A;  4CT0 A;  2GGF A;  2X6K A;  3PE4 A;  3ZEF A;  3D9J A;  3QNK A;  4N5C A;  4FC8 A;  3SHF A;  2X6I A;  2X6H A;  4HS2 A;  4Q94 A;  4F1S A;  4OYS A;  1W3B A;  2I1J A;  3U9W A;  4GZ3 A;  4IN3 B;  4N3C A;  3MV3 B;  5ANR A;  2L9B A;  2KC7 A;  3CVY A;  3CSF A;  4L1B A;  2J9Q A;  5EX3 A;  4CDR A;  2MOW A;  2CHW A;  3L17 A;  1EDU A;  5ENN A;  5BPP A;  4FHJ A;  1B89 A;  2GRL A;  4JC8 A;  4JL0 A;  4UQX A;  2C0L A;  4W9R A;  4GA2 A;  1PC2 A;  3IEG A;  4HOS A;  3EIQ C;  3I5P A;  1DNP A;  4MKT A;  4I9C A;  3PZD A;  3ZYL A;  2FF4 A;  4H7X A;  2BTD A;  2PZI A;  2R5S A;  4GYO A;  3RRN B;  3VLD A;  1KLX A;  2KCL A;  2HR2 A;  3L54 A;  4V3I A;  4CDM A;  3B7T A;  4WND A;  3UMV A;  1X5B A;  2XRZ A;  2YNQ A;  3PUK A;  3S7B A;  3PNT B;  4JW1 A;  4A3V A;  3G2U A;  3AS8 A;  3FUK A;  4YVQ C;  1Y8M A;  2WM9 A;  2Q7F A;  4I6J A;  3I3N A;  3IHY A;  2Y3A A;  4G26 A;  3ZHE A;  1OWL A;  3CVV A;  5BV1 A;  3EIJ A;  3BG1 B;  4KMO A;  5A6C A;  3Q15 A;  2YIN A;  1XNF A;  1YA0 A;  3MJW A;  4APF A;  3B13 A;  5G04 J;  1UJK A;  4JEU A;  4Y6W A;  1KT1 A;  4KVM A;  2LNI A;  2OOE A;  5EDS A;  3KS2 A;  3EHN A;  4FHK A;  3ASF A;  5J08 A;  2XQ0 A;  1PY1 A;  3ULQ A;  3FUJ A;  1N54 A;  1TJC A;  3FTU A;  3UT8 A;  2LSV A;  1HFA A;  4IYP A;  1SQM A;  4I6E A;  5ARG A;  4XI0 A;  4IUL A;  4DI3 A;  3ASD A;  4I2W A;  3U3W A;  4JHK A;  3QK0 A;  2VSO E;  3ZYM A;  4ACL A;  4B89 A;  4FAD A;  1JWG A;  2KCV A;  3G2W A;  3D9I A;  4AOF A;  1ELR A;  2I9C A;  3FFL A;  4QFV A;  3TG4 A;  1IYG A;  5DBK A;  3CK8 A;  3FUI A;  2IF4 A;  3UUX A;  4AV7 A;  2AXV A;  2PQR A;  5G04 C;  4B8C B;  4MRU A;  2VSX E;  3SBS A;  3LYA A;  2V4L A;  3U64 A;  4U07 A;  3L13 A;  4Q96 A;  3ZIM A;  2CFZ A;  2WXF A;  1Z3X A;  1N52 A;  1OWP A;  1WAO 1;  3EDT B;  5FZS A;  3APD A;  4UWF A;  3GW4 A;  1DVP A;  5E75 A;  3PH0 C;  5FWQ A;  4C0E A;  4NQ0 A;  3PUJ A;  2M63 A;  3CVQ A;  4BSX A;  4HOQ A;  2ZU6 B;  2CHZ A;  3CVX A;  2J07 A;  4U0S A;  4AY5 A;  4EQF A;  3CST A;  4UWL A;  5D0Q D;  2OVB A;  3SFZ A;  5FQ8 A;  1HS6 A;  3TAX A;  3B7S A;  3ONK A;  3APF A;  4JPS A;  3TL5 A;  4L23 A;  3CK9 A;  5FJY A;  2FBN A;  2L6J A;  3CVP A;  1E8Z A;  3CHS A;  5G05 C;  2HM8 A;  5CCL A;  1LF8 A;  3JYS A;  1NZN A;  2VJ8 A;  3MKR A;  2DCP A;  3N71 A;  3ASH A;  3ML9 A;  3JQ1 A;  3AS5 A;  3D9O A;  3VTX A;  3LVR E;  2VGX B;  3R9A B;  4IRU A;  2XEV A;  4BTB A;  3CVN A;  1TJF A;  2AVP A;  3QWV A;  4N39 A;  3L08 A;  5AJL A;  3QWW A;  3MA5 A;  1FVH A;  4AVX A;  1Z6T A;  4E6H A;  3SI5 A;  2J4D A;  2UWJ G;  3FWV A;  3R7R A;  5FQ7 A;  3EJN A;  3UQ3 A;  3I4G A;  4B94 A;  4I2Z A;  5FT9 A;  3SF4 A;  4I1O B;  3WXX A;  3ZHE B;  4EZL A;  4CEM A;  5BT1 A;  5AIJ A;  5LP0 A;  1Z3Y A;  3KD7 A;  2J49 A;  4AJW A;  3FY4 A;  4GA0 A;  3QWP A;  1INZ A;  4UWG A;  3CKC A;  3T5V A;  3JQ0 A;  5CHE E;  2UY1 A;  2FI7 A;  4APO A;  4AP2 A;  3FH7 A;  3LJ3 A;  2MRI A;  3IBE A;  1NA0 A;  2IFU A;  2V5F A;  3FU6 A;  5T4Y A;  1TEZ A;  2WXJ A;  4UQZ A;  5EX0 A;  1U3C A;  2V0P A;  2JLB A;  1H2T C;  3BEE A;  1JWF A;  4Q69 A;  4F3V A;  4G25 A;  4WWP A;  2WMO A;  4YND A;  4RSY A;  3QB2 A;  4I43 A;  1NP7 A;  5FZQ A;  2VSN A;  3PRZ A;  1E8W A;  3PRE A;  2KAT A;  4CGV A;  3LDZ A;  4WWN A;  3NQP A;  4EBA G;  2BUG A;  3MYV A;  2C2L A;  3ZVV A;  1H19 A;  1ZU2 A;  2XPI A;  1SZ9 A;  3KEZ A;  1ZBP A;  4TRQ A;  5E76 A;  3FTW A;  3IKO B;  3HVE A;  4ANX A;  4FP7 A;  3FUD A;  2HO1 A;  3ZN3 A;  5BUZ A;  3CKB A;  2Y4U A;  4MLP A;  3GZS A;  4BWR A;  4GZD A;  5CCM A;  2QFC A;  4KT6 B;  4KXK B;  4EZK A;  4BTA A;  3GZ1 A;  4KZC A;  1HG2 A;  3SNX A;  4HVB A;  3OXL A;  3D9M A;  4AY6 A;  2A5U A;  4I1M A;  2MHK A;  3L16 A;  4ILG A;  3S7F A;  1IQR A;  5LCW C;  3Q49 B;  3CVL A;  3IV0 A;  4J0U A;  3UX4 A;  3D9P A;  3SD5 A;  4AIF A;  3FU5 A;  1XGW A;  4U0U A;  4U63 A;  4LER A;  4GAA A;  4I9E A;  1FCH A;  4K03 A;  4L2L A;  2RG8 A;  2DBA A;  2XCC A;  3LY7 A;  5AEN A;  1HZ4 A;  3ZRH A;  1IHG A;  4J8E A;  3LEW A;  4OVU A;  5KJN A;  3TXN A;  2VTB B;  3D9N A;  1A17 A;  4UWK A;  5C2Y A;  2L0T B;  3DBS A;  4FUL A;  3G2V A;  2VQ2 A;  4WWO A;  3Q5M A;  1NA3 A;  4ANU A;  2KZT B;  3S2A A;  2YQ8 A;  4HLE A;  4BT8 A;  2OVF A;  3FUF A;  3RU0 A;  3URZ A;  4GML A;  4BFR A;  3IHV A;  4ACK A;  4B0Z A;  2XPY A;  3FTX A;  1ELK A;  3G2S A;  3LY9 A;  4A55 A;  4TV3 A;  3CHM A;  3MX3 A;  2WB2 A;  3CHQ A;  2WPV A;  4RG6 A;  3CHR A;  2X6J A;  4HXI A;  1HE8 A;  4N2Q A;  2VYI A;  1HXI A;  1HU3 A;  4RG9 A;  1S0P A;  3P2B A;  4HOU A;  2WQH A;  2Y4T A;  5LX8 A;  2C0M A;  5AJD A;  4HOT A;  4ANV A;  3JCK C;  1PAQ A;  2IU1 A;  1U3D A;  3AS4 A;  1HH8 A;  2AWI A;  3JUI A;  1MQS A;  3QC1 A;  4A1G A;  4ILI A;  3SBT B;  4GCO A;  4P29 A;  3UT7 A;  2GRM A;  2XGM A;  3QJZ A;  3CVW A;  2WXQ A;  2I6H A;  2VGY A;  2WXI A;  3CQC B;  4J8S A;  5G55 A;  5M72 A;  1HX8 A;  4FA6 A;  4BT9 A;  4O6F A;  3QAR A;  3VLE A;  4C0M A;  1E7U A;  3HVE B;  3BG0 B;  1ELW A;  5JJ6 A;  2CG3 A;  3ASG A;  3ZGQ A;  3RO2 A;  3ZYQ A;  4C9B B;  4EBA A;  4JXT A;  3HHM A;  3ESK A;  3FUM A;  3LCA A;  2NC9 A;  3CGH A;  4UWH A;  3RJV A;  4UI9 J;  4BY6 A;  4GYY A;  4GMJ A;  4U8H A;  4CCA A;  3ZXS A;  4XI9 A;  4LCT A;  4TUU A;  2OND A;  5FTP A;  4WNE A;  4L7T A;  4AM9 A;  4XX5 A;  2X3M A;  3MGB A;  4URK A;  1H2V C;  3U66 A;  1QZ2 A;  1UN8 A;  3R7Q A;  3CQG B;  5EKQ D;  5KCM A;  5ANL A;  3TGO A;  3EHM A;  3RIB A;  3I4R B;  5BNW A;  3APC A;  3FTS A;  3LXU X;  2PQN A;  2WXH A;  3FH5 A;  4WUY A;  4DI4 A;  4M3O A;  5T8I A;  1L5J A;  4ABN A;  1OWO A;  3GYZ A;  1FVF A;  3FU3 A;  4XKB A;  2WXP A;  5G2N A;  3TG5 A;  5JHA A;  2NXP A;  1OUV A;  2A4Z A;  4J8F A;  4A1S A;  1OWM A;  2PL2 A;  2CFU A;  4N3A A;  4XZ4 A;  3FP3 A;  3MZL B;  2KZT A;  4PH4 B;  5A23 A;  1Y6I A;  4GCN A;  4D10 C;  4G24 A;  5HQ8 A;  2E0I A;  4R7L A;  3CV0 A;  2R17 C;  4GA1 A;  4G23 A;  4JZY A;  1EPU A;  2YHC A;  4PS8 A;  3RRU A;  4J8D A;  4GZ5 A;  2WXG A;  3CHP A;  4XE0 A;  1KT0 A;  2JEK A;  2LAI A;  3MKQ B;  4OVV A;  2WQ6 A;  3HYM B;  3RK6 A;  3ML8 A;  4KBQ A;  2AW6 A;  3L22 A;  2WXL A;  4F7A A;  4FJY A;  3MV2 B;  3LVQ E;  4CDN A;  1HO8 A;  4UI9 K;  2I2O A;  3MEK A;  4FJZ A;  4HOR A;  4PDX A;  4JA7 A;  4KYO B;  4GZ6 A;  4H7Y A;  2VTB A;  4NUR A;  3LKU A;  5BV0 A;  3CVU A;  1E96 B;  5LOZ A;  2ILR A;  3FUE A;  1UJJ A;  4ATG A;  1WM5 A;  3U4T A;  3ZW3 A;  5KJM A;  2IQC A;  3FEY A;  3PE3 A;  3RRM B;  4CT4 A;  2XGS A;  2I1K A;  4JA9 A;  1OWN A;  3CLJ A;  5D0O D;  5HI7 A;  2HYZ A;  4FU3 A;  2YHE A;  4N2S A;  4U04 A;  2WQ7 A;  3RKV A;  1UN9 A;  3FH8 A;  2E2E A;  2X6F A;  3QOU A;  3UT4 A;  4UQY A;  3B7U X;  1E8X A;  1HG5 A;  2GW1 A;  1VDY A;  2J4B A;  2EQX A;  3ZFW A;  4EEC A;  3O48 A;  4K0R A;  2AXU A;  2LO6 A;  4PS3 A;  5CMW A;  3KAE A;  3FUL A;  1QNF A;  2WVI A;  3NF1 A;  3UPV A;  1H0A A;  2XHE A;  3ENE A;  2ION A;  3NZS A;  1H6K A;  3DPD A;  3SZ7 A;  3AU5 A;  2WXM A;  1BPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...