2LAHA

Solution nmr structure of mitotic checkpoint serine/threonine-protein kinase bub1 n-terminal domain from homo sapiens, northeast structural genomics consortium target hr5460a (methods development)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
160
structure length
160
Chain Sequence
MGHHHHHHSHMDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target HR5460A
rcsb
source organism Homo sapiens
molecule tags Cell cycle, apoptosis
molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1
total genus 59
structure length 160
sequence length 160
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lahA00
4AEZC 2WVIA 3SI5A 2LAHA 4A1GA
chains in the Genus database with same CATH superfamily
4UWFA 2EIJE 3DSWA 5AARA 3GYZA 4JXTA 3MKQA 3E37A 1WG0A 1K3ZD 2V8SE 4CGWA 4MS6A 2XZDG 3GZ2A 2DVWA 4DI3A 3DSVA 4U0SA 3HXBA 4WWPA 3ZUVB 4DJAA 4JA7A 4IRUA 2XZTG 3TWSA 2CG3A 1N9AA 5CEAA 3ABKE 4DRXE 1DNPA 5FZSA 5T8IA 3D9MA 5EILA 3B7RL 3SO8A 3UIPC 4GMRA 4TV3A 2H6HA 4EZLA 5CBNA 2R2LA 2H6GA 1INZA 3FU3A 4CDRA 4ZFHA 2AWIA 4HFGA 2V4HC 2IJGX 3ML9A 5JA4D 4ANWA 3PREA 1P5QA 3W9GA 4I1MA 2WB2A 3URZA 5G55A 1AP7A 4BY6A 4HQDA 4CZ2D 3J5PA 4GA1A 3HXDA 1MZCA 2OV8A 3FUDA 4GA0A 3CK9A 4J8SA 1G3NB 2VGEA 3LS8A 3S7DA 2P9PG 3ZKJA 2WMOA 5D0OD 4I1AA 2WQ6A 1HO8A 5D66A 1BD8A 2I6HA 1GW6A 1S0PA 1JUQA 4LERA 3KSQA 4O1OA 3CHMA 1FT2A 4MRUA 2RG8A 4AIFA 2C0LA 2OVBA 3HYMB 2YHCA 2KCKA 1N4PA 4ANXA 3Q47B 1UJJA 3DEPA 1N4RA 2V0PA 2AVPA 3DSXA 5BV0A 4RQIA 4K03A 5ENTD 3FUHA 2R59A 3ZPJA 3HIZA 4W9RA 5ENOD 3BQOA 4XX5A 4DX6D 5AQBA 3S7BA 5AAOA 3ESLA 4BEPA 2IU1A 4PH4B 3TG4A 5FQ8A 1BU9A 3IV0A 4RLYA 5KJNA 2F37A 3MYVA 3FEXA 3PEVB 2KZTB 3QAQA 1JWGA 3SF4A 5EN5D 4G8KA 2J49A 3FUKA 3ZHEB 3EIQC 3APCA 4GTPA 3HXCA 2PL2A 3G2UA 4K5BA 4JVSA 4CRWA 1HX8A 3NZUA 2L6BA 3BG0B 4I6JA 3T9KA 1N54A 4JEHA 2WXFA 3UMVA 1D8EA 1JCRA 3UUXA 2J4DA 1MYOA 2CHWA 4PS8A 3CSTA 4CT4A 4WWOA 5T4YA 5KJLA 1KZPA 5BPPA 5CEDB 5DIZA 1OT8A 2LXLA 1BI8B 3DWLG 1FPPA 2DCPA 4CDNA 4WAFA 2X6JA 3DRAA 3ZN3A 3KEZA 2Q7FA 4YVOA 4G23A 3D9LA 2GRMA 4G24A 2IO2C 3GZSA 3PNTB 2NSZA 5HS0A 5JJ6A 4L2LA 2P9NG 4UWHA 2GRPB 1ELKA 3VLFA 5LP0A 4XEIG 3ZW3A 4KVOA 4TRQA 5CHEE 4XI0A 4K0RA 1Z3XA 2PM6A 2NC9A 3S7JA 5LX8A 2KBXA 2CFUA 3EDTB 3HVEB 2RD0A 2HYZA 1MX6A 3AS4A 4DLOA 1PAQA 3D9JA 3LJNA 2P58C 5E75A 3FU0A 4EPZA 2XCCA 2Y1LE 3DBSA 2XGOA 4JHJA 3Q15A 3G2VA 5FTPA 2I9CA 2E2EA 5ENRD 2B6CA 3U66A 5G05C 1TNZA 4ATGA 1OUVA 4G25A 2CG2A 3L17A 2BTDA 1OWPA 3PVLA 4L9PA 5KJMA 2EINE 4C48B 4XZ4A 5D2MC 4JW1A 3TG5A 1X5BA 4HRNA 2BKGA 2QZAA 2QC9A 4J6IA 1H0AA 5B3SE 4Q96A 2AXVA 3L08A 3SFXA 1OWMA 3E32A 3FFLA 3FUNA 1MQSA 3RSEG 4OAUC 2UY1B 4YVQC 3FUIA 1TNBA 4F3VA 3MV3B 4UWKA 3S7FA 4N2SA 4Q94A 5G2NA 5AYWD 2L6JA 2LO6A 4LEUA 4LNBA 4J8YA 2ETCA 4U8YD 3IBEA 3EU9A 4HBDA 3MKRA 2P2CP 3PUKA 1HFAA 3CHRA 1HG5A 4WNDA 4NURA 4TXPA 3FEYA 3IXEA 2GROB 4F1PA 1XGWA 5EYPF 2ETAA 3HHMA 3C3OA 4APFA 3NF1A 4OAVB 1LTXA 5KCMA 1U2VG 4U8VD 2VSXE 3LYAA 4I9EA 1OY3D 2IQCA 3D9NA 2XEHA 2IEJA 3UT7A 3HDXA 2YHEA 1UG3A 5FJYA 3CVQA 3QJZA 4L1BA 2BKKB 3I4GA 4IYPA 1NZNA 2OEWA 2OOEA 1IHGA 4B93B 3ESKA 3CEQA 1FVFA 2R5SA 3FH7A 1E90A 3Q75A 1X81A 5EX0A 3O48A 3ZNGA 3AJIA 4ME2A 2XGSA 1TNYA 3UM3A 2HR2A 3ENEA 3BU8A 4U04A 3LKUA 5BNWA 2EIKE 2GRRB 1SQMA 4DX2A 4U7EB 3RJVA 5J90A 3UKUG 3TGOA 3E33A 2ZU6B 1NA0A 2FO7A 4PUCA 3PZ2A 2XPZA 3Q79A 2ZGGA 1JCSA 2VSYA 3UT8A 1JWFA 1E96B 1TNUA 2MYOA 4E6HA 2OVFA 4WUYA 4G1TA 2WXNA 2AXUA 1U3DA 1YA0A 1AWCB 5ANRA 5A6CA 3I4RB 4B94A 2CHXA 3ZXPA 3V30A 4XI9A 2FO1E 5HQ8A 3MV2B 2NXPA 2A5EA 4CEMA 2NYJA 3R7QA 1UW4B 2L0TB 3B13A 4HI9A 3APFA 4KYOB 3FHEA 3KS2A 2RFMA 3NB2A 2AJAA 5FZRA 1ELWA 4TUMA 2ZGDA 3JUIA 1V55E 2P9KG 3MA5A 4E85A 3L82A 2QYUA 1DCQA 5AQAA 1IYGA 3FWVA 2AW6A 3AS8A 3AAAC 4PS7A 1EF1C 3EHNA 3E4BA 5A23A 3SHFA 3CSFA 4IN3B 3RRUA 1WDYA 5EKQD 5H7PA 1N11A 2DWZA 3OXFA 1OCOE 4CDMA 3VLDA 1K1BA 4BX9A 1HF8A 1NL4A 3LY7A 1N0RA 3D9KA 3QDNA 4A1GA 4I2ZA 5HRYA 3L6AA 2V4LA 3AG1E 3FTUA 3HXEA 4U0UA 4R7LA 3ISMC 4OYSA 5CBOA 3TL5A 1JCQA 4ZHBA 2PQRA 4WWNA 1MX4A 3KD7A 1UOHA 4HI8A 4EHMA 3ASOE 4A63B 3GW4A 4FLBA 5KJKA 5KWDA 5KBAA 3HVEA 2WMNA 4HXIA 1Z6TA 2C0MA 2IF4A 2VGXB 2H6FA 3UM1A 3FY4A 3HG0D 3HRAA 5BXOA 1IQRA 1QNFA 4KBQA 3CVYA 3CKCA 1E7UA 3UI2A 2LNIA 4PDXA 4Z68A 2BEDA 4P29A 1SZ9A 2FULA 2ETBA 5IY5E 3U4TA 1OXJA 2R03A 4HS2A 4UI9K 3PZ1A 2KC7A 4V3IA 2XS8A 4M7CA 4GYYA 1Q2ZA 3K9IA 4G26A 3ZYQA 4JL0A 4BERA 5D0QD 3ZYMA 3VTYA 4J8EA 3VTXA 2P9SG 4L7TA 3HXFA 2VYIA 3ZGQA 4FHJA 4L23A 2X3MA 3DEOA 4N5CA 3UQ3A 5LCWJ 4GTSA 2FF4A 1EPUA 5ENNA 4JD2G 3KSLA 3C5RA 3T8KA 1OCZE 2H6IA 2CHZA 2IY0C 3B7TA 4U95D 1PC2A 2VGYA 3NOGD 1N95A 2UWJG 4JA9A 3TWUA 3CQGB 4I1OB 2OCCE 3N71A 4DLQA 3PZ3A 4GB9A 1E8XA 2P9LG 4FJZA 4BX8A 2EQXA 5ENSD 4A55A 5AIJA 2Y0BG 3V79K 4XE0A 1Y6IA 4ANUA 1DVPA 1E8ZA 3PDNA 3ASDA 3QOUA 1MJ0A 3L13A 4YDYA 4B8CB 4N2QA 3TXNA 3ZU7B 3CK8A 3Q7AA 4N3AA 3L22A 1U3CA 4GPKA 2J8SD 5BXUA 1HZ4A 5KNHD 4A1SA 3ZXSA 1A5EA 3R7RA 2I2OA 2X6IA 2BF0X 2EILE 3FH5A 2I1KA 2KCVA 3T8MA 1H6KA 3RIBA 1FVHA 2WVIA 3UM2A 4XKCA 3FU6A 3CVNA 3Q49B 4NIKA 2F8XK 2LAHA 3CK7A 3RO2A 1H2UA 4GCOA 3O4ZA 4Y6WA 1K8KG 3D9OA 3PE4A 4KT6B 2IOLA 2R02A 3LVRE 3Q4AB 3NQPA 1LD7A 3APDA 2IO3C 3B7SA 3UX4A 1OCRE 1Y8MA 4TUUA 4D10C 4UQYA 3DSSA 1UJKA 3NAWA 4RG9A 2WXIA 1IKND 3UKRG 3CVLA 3OXGA 1WY6A 4ILHB 3FTZA 3PH0C 1OCCE 1SA5A 2VSNA 3P2BA 1SVXA 1PY1A 1UN9A 5HKPA 1RZ4A 5DBKA 3AG4E 3ONKA 5AJLA 2XRZA 4UWGA 2XCBA 3JCKC 3DXMG 2MHKA 3ULEG 2WXLA 3FUJA 5CCLA 5EIBE 4A3TA 3TWTA 2WXKA 4UQZA 2VQ2A 3EIJA 3UTMA 4DX7D 1S63A 3EU5A 4KXKB 3EJNA 3TXMA 4BETA 3ZVVA 2ONDA 2KXPC 3ZFWA 1TEZA 4DK5A 3PZDA 4YDOA 4FC8A 3V31A 4LG6A 4I6GA 5LFAA 1IHBA 4A3VA 3MJWA 3Q73A 3WG7E 3U64A 2IONA 4FJYA 3B7BA 4GYOA 1NI1A 3JYSA 1SW6A 4MLPA 3IHYA 4U0ZA 1NP7A 5B1BE 3ASGA 4M3OA 1IQUA 2XHEA 4XIFA 4AM9A 3DXKG 2ZISA 3CHPA 3CHSA 2LUHA 4ILGA 4AY6A 1O5MA 2HM8A 2XGMA 4LNUD 4FHKA 1W3BA 4EBAG 3CGHA 3E30A 2J4BA 4CCAA 4DUIA 3DPDA 3Q9NC 3RRNB 3FTXA 4UWLA 3JQ1A 4L2YA 5M72A 5CECB 4GCNA 3ZIMA 3FTYA 2PQNA 5CCMA 4N3CA 4K5CA 4GTMA 1LF8A 5T3RA 3CVPA 2VSOE 2XENA 3CVVA 4ABNA 2VGXA 3R9AB 3MKQB 1O1SA 5J08A 4GTOA 3F6QA 3MGBA 3BEEA 4LCTA 3TWXA 1TN8A 4GMLA 4NQ0A 3WXXA 5JMND 5FQ6A 2QFCA 1QYMA 4EZJA 1VDYA 4BT9A 5FT9A 1N94A 4GAAA 3Q78A 4JZYA 4Q69A 4DX1A 4F7AA 5JHAA 1N4SA 5JJTA 5ARGA 4UQXA 4KZCA 2WXJA 4GZCA 1HXIA 3LCAA 4HLEA 3I3NA 3L9TA 2B0OE 3EUVA 3T5XA 3ZHEA 3LY8A 4HVBA 3DSTA 3DPYA 4RG6A 4RVBA 3RKVA 3V2OA 5JJ7A 1QQEA 2BUGA 4LSZE 4HRMB 4PS3A 4O6FA 3UINC 3SD5A 4CGVA 3ABME 3ASHA 3V2XA 2UY1A 4QFVA 1A17A 2DZOA 3ASNE 4K5AB 2XPIA 2WXOA 3JXIA 3QB2A 2PZIA 2F0YA 2JABA 4F53A 1S64A 3C72A 1KT1A 2XPYA 1H6PA 1B89A 1SA4A 1ELRA 3PUJA 4B8AA 2J9QA 4I9CA 1O1RA 3FTVA 3Q7FA 3OTNA 3L16A 2WXMA 3W9FA 5G04C 3QC1A 3MZLB 3ML8A 3ULYA 4HB5A 1TR4A 2LAIA 4J0UA 2E0IA 4WNFA 2GW1A 2XRYA 4G2VA 2RFAA 3EHRA 3SGHA 4RSYA 2DYSE 2WQHA 5EIDA 2P9UG 1H6OA 4HNAD 3QARA 4O60A 2VTBA 5ITZF 5ENPD 4AJWA 5CMYA 3FTSA 5AJDA 3UM0A 2JLBA 4LNGA 4NRHB 1Z5SC 3AG2E 1DC2A 3TAXA 3D9HA 4BFRA 4DX5D 4GMJA 3U3WA 3FU5A 4J7WA 2PM7A 3E34A 3FTWA 3FH8A 1Z3YA 3PE3A 4HOUA 2MRIA 4HLLA 3JQ0A 2KM4A 3UXGA 1OWNA 2WQ7A 3P1UA 3X2QE 3AU5A 2PNNA 3SI5A 3BG1B 2GGFA 5AENA 3UPVA 1BLXB 5BV1A 5KNGA 1FCHA 2A4ZA 3LXUX 2C2LA 2LXMA 5AQ7A 4DPRA 3FDHA 2L9BA 3SNXA 4G11A 5ANLA 4GZDA 4FADA 3QWWA 2F8YA 4HORA 2V5QC 3OXLA 4YDEA 2XQ0A 2Y4TA 1OWOA 5EX3A 3LDZA 4Y6CA 2P9IG 3FUMA 5FWQA 1HU3A 4FULA 5LOZA 5LCWC 5EYLA 1MX2A 4EZKA 2DZNA 2I1JA 2QYJA 5CRVA 4EECA 2WXHA 3CQCB 5BT1A 2VJ8A 5BUZA 1TN6A 4JPSA 4GZ3A 3ONLA 5EDSA 3CV0A 5G05J 4FA6A 4ILIA 4HRLA 4YNDA 2DYRE 2OEVA 1TJCA 2KATA 3NZSA 3IHVA 1D8DA 4EQFA 3AG3E 3RO3A 3JUEA 3CR3A 2X6KA 4ACKA 2GRLA 4H7YA 1HE8A 1YMPA 3TWWA 2FEZA 1DCEA 3C98A 3ASFA 4UI9J 5CMWA 3ABLE 3B95A 4GZ5A 1KPSB 3ZYKA 1TJFA 2MOWA 5FIOA 3SBTB 4BWRA 4URKA 3OAWA 5JHBA 1FT1A 2Y3AA 1LD8A 3PNLB 4U96D 3LJ3A 4N5QA 2ZIRA 1TNOA 3FUEA 4DI4A 2WXRA 4I17A 3U9WA 4BSXA 1OWLA 3KAEA 2CFZA 3D9PA 2XEEA 1EDUA 2WM9A 3G2SA 4U63A 2Y69E 4YDWA 3MEKA 3IEGA 3QWPA 3NOCD 5HI7A 2YINA 3PRZA 4BTBA 4H7XA 1E8YA 1O1TA 3CIAA 2QY7A 1E8WA 3J5QB 1ZB1A 3BUAA 2XS1A 3MX3A 2R17C 4UI9C 4AY5A 3TWVA 5FQ4A 3CVUA 3MCXA 2LSUA 1KZOA 4WNGA 4JB8P 5C2YA 3CKBA 5E76A 1HH8A 1SZAA 2EIME 4XKBA 4U07A 1WAO1 2RKKA 3LPZA 1E7VA 3RAUA 3SFYA 4F6RD 4C0MA 3CVWA 2LSVA 4ATZD 4CT0A 4OVVA 1IXVA 4TXQA 2X6FA 4IULA 3FUFA 4FLHA 4FU3A 4MKTA 3LEWA 3JXJA 2HE0A 3D9IA 5C1DA 2WXPA 1H2VC 4B0ZA 5FZQA 2DIWA 4OVUA 2R05A 2DBAA 3EHMA 2JEKA 2L0IA 4WNEA 2J07A 4LRZA 1D9SA 4GYWA 3R9MA 4X8QA 3PEUB 4C9BB 5CRUA 3IKOB 4JEUA 3EHQA 1YCSB 4KVMA 4O1PA 1ZBPA 4TXRA 2YQ8A 3CVXA 1H2TC 4AP2A 3TJPA 2FBNA 3AS5A 1KLXA 3ZRHA 4GTTA 1HG2A 4G8LA 4GU5A 2V5FA 3NBNB 3SQVA 4GTQA 3UIOC 4LUNU 3C3RA 1QZ2A 5FQ7A 3CHQA 4JC8A 1EYHA 5G04J 3TWRA 4AV7A 4EBAA 3I5PA 3VLEA 3AU4A 1RW2A 2X38A 4BTAA 4KZ0A 2HO1A 4GTRA 4B89A 4FP7A 3Q9UC 2J09A 3LY9A 3SFZA 2A5UA 1HS6A 4CYMD 4BT8A 1L5JA 5ARFA 5FINA 2J08A 4AXHA 2IOSA 3DSUA 5BW8C 3G2TA 1MHQA 2VTBB 2ILRA 2XEVA 2Y4UA 3CHOA 5AN8A 3D3MA 2FI7A 4JHKA 3GZ1A 4KMOA 3QK0A 4HOTA 3QWVA 3Q5MA 3SZ7A 1S70B 4U8HA 4UUCA 2WXGA 2WXQA 4HOQA 3KEAA 4I6EA 4AOFA 3CLJA 4BESA 2GRNB 3S2AA 2WPVA 3QNKA 2KZTA 1V54E 4JHRA 4HOSA 4I2WA 3ULQA 4F1SA 5A7DB 4GZ6A 1N0QA 1JPLA 1TN7A 1K1AA 1WM5A 3C3QA 4MBGA 3L54A 3LVQE 4I43A 2M63A 3UT4A 2YNQA 1H19A 1N52A 4NACA 2KCLA 2GRQB 3PS6A 1BPOA 4GA2A 4QQIA 5AQ9A 3RK6A 3T5VA 1TYQG 4AVXA 1UN8A 4N3BA 4GPMA 1ZU2A 4ACLA 2IFUA 3TWQA 3SBSA 3PZ4A 1NA3A 1QBQA 4J8DA 3QKYA 1YYHA 3G2WA 5ENQD 4APOA 3FULA 1XNFA 3RRMB 3ZEFA 3RU0A 1KT0A 2AXZA 4GTVA 3ZYLA 5CERB 4AEZC 3SY2A 2ZXWE 4ANVA 4J8FA 1NFIE 2X6HA 5B1AE 3FP3A 4C0EA 4N39A 4BSZB 3B7UX 1N4QA 1BI7B
chains in the Genus database with same CATH topology
3CVQA 3CQCB 3QJZA 4UWFA 5BT1A 2VJ8A 4L1BA 5BUZA 3GYZA 3I4GA 4JXTA 4JPSA 4IYPA 3MKQA 3ONLA 4GZ3A 5EDSA 3CV0A 1NZNA 2VSNA 3P2BA 2OOEA 1IHGA 5G05J 1PY1A 1UN9A 4FA6A 4ILIA 3ESKA 3CEQA 1FVFA 5DBKA 2R5SA 3FH7A 2V8SE 4YNDA 3ONKA 1E90A 5AJLA 4CGWA 1TJCA 4MS6A 2KATA 4UWGA 2XRZA 3NZSA 5EX0A 3IHVA 3O48A 2XCBA 3JCKC 3GZ2A 4ME2A 4EQFA 2MHKA 2XGSA 4DI3A 2WXLA 4U0SA 2HR2A 3RO3A 3FUJA 3ENEA 4WWPA 3CR3A 5CCLA 2X6KA 4ACKA 4DJAA 2GRLA 4JA7A 4U04A 4IRUA 3LKUA 4H7YA 4A3TA 1HE8A 2CG3A 5BNWA 2FEZA 2WXKA 4UQZA 2VQ2A 1SQMA 3EIJA 3C98A 4KXKB 3ASFA 3EJNA 3RJVA 5J90A 1DNPA 4UI9J 5FZSA 3TXMA 3ZVVA 5T8IA 2ONDA 3D9MA 5CMWA 3TGOA 3B7RL 2ZU6B 1NA0A 2FO7A 4PUCA 3ZFWA 4TV3A 2XPZA 4EZLA 1TEZA 4DK5A 4GZ5A 3PZDA 2VSYA 3UT8A 1INZA 4FC8A 3ZYKA 1TJFA 3FU3A 1JWFA 2MOWA 4CDRA 1E96B 3SBTB 4I6GA 5LFAA 4E6HA 4BWRA 2AWIA 2OVFA 4WUYA 4URKA 4HFGA 4A3VA 4G1TA 3OAWA 5JHBA 2WXNA 2Y3AA 2IJGX 3MJWA 3ML9A 3PNLB 4ANWA 3PREA 2AXUA 3LJ3A 1P5QA 1U3DA 1YA0A 4I1MA 3FUEA 3U64A 2WB2A 2IONA 3URZA 4DI4A 2WXRA 4I17A 5G55A 3U9WA 4BSXA 5ANRA 4BY6A 1OWLA 4FJYA 4GYOA 3KAEA 3JYSA 2CFZA 5A6CA 4MLPA 3IHYA 3D9PA 1NP7A 1EDUA 3ASGA 3I4RB 4U0ZA 4B94A 4M3OA 2WM9A 1IQUA 4GA1A 2XHEA 3G2SA 4U63A 2CHXA 4XIFA 2OV8A 3FUDA 4AM9A 4GA0A 3CK9A 4J8SA 4XI9A 3MEKA 3IEGA 3QWPA 3LS8A 5HI7A 3S7DA 3CHPA 5HQ8A 3MV2B 2YINA 2NXPA 3CHSA 4CEMA 3PRZA 3R7QA 4ILGA 4BTBA 4AY6A 4H7XA 1UW4B 2HM8A 2L0TB 3B13A 1E8YA 2XGMA 2WMOA 3APFA 4FHKA 5D0OD 4KYOB 1W3BA 4EBAG 3FHEA 3KS2A 3CIAA 3CGHA 4I1AA 2QY7A 2WQ6A 2J4BA 4CCAA 1E8WA 5FZRA 1ELWA 1HO8A 3DPDA 3JUIA 2I6HA 1GW6A 3RRNB 3MA5A 3FTXA 4UWLA 1S0PA 3MX3A 3JQ1A 4L2YA 1JUQA 5M72A 2R17C 4UI9C 4E85A 4GCNA 4AY5A 4LERA 3ZIMA 3CHMA 3FTYA 2PQNA 5CCMA 4MRUA 1IYGA 3FWVA 2AW6A 5FQ4A 3CVUA 2RG8A 3MCXA 2LSUA 4AIFA 3AS8A 4N3CA 4PS7A 4WNGA 1EF1C 3EHNA 1LF8A 2C0LA 2OVBA 2YHCA 3HYMB 5C2YA 2KCKA 3E4BA 3CKBA 4ANXA 5A23A 3SHFA 3Q47B 1UJJA 5E76A 1HH8A 3CSFA 4IN3B 1SZAA 5T3RA 2V0PA 3CVPA 2AVPA 2VSOE 3RRUA 4XKBA 4U07A 5EKQD 3CVVA 4ABNA 1WAO1 3OXFA 5BV0A 4K03A 2VGXA 3LPZA 3FUHA 4CDMA 2R59A 3VLDA 3ZPJA 1E7VA 4BX9A 3HIZA 4W9RA 1HF8A 3MKQB 3R9AB 3LY7A 4XX5A 3S7BA 5J08A 3D9KA 4C0MA 3QDNA 3CVWA 3MGBA 2LSVA 3BEEA 4LCTA 3ESLA 4GMLA 4NQ0A 3WXXA 4CT0A 4OVVA 4A1GA 5FQ6A 2IU1A 2QFCA 4I2ZA 4PH4B 3L6AA 2V4LA 3FTUA 4U0UA 5FQ8A 3TG4A 3IV0A 4R7LA 4EZJA 1VDYA 2X6FA 4IULA 4BT9A 3FUFA 4OYSA 4FLHA 5FT9A 4GAAA 4FU3A 4MKTA 3LEWA 4JZYA 5KJNA 3MYVA 3TL5A 4F7AA 4Q69A 3D9IA 5JHAA 5JJTA 2PQRA 4WWNA 3FEXA 5C1DA 2WXPA 1H2VC 3KD7A 3PEVB 2KZTB 4B0ZA 3QAQA 5FZQA 1JWGA 5ARGA 2DIWA 4UQXA 3SF4A 4KZCA 2WXJA 3GW4A 4OVUA 4GZCA 1HXIA 2DBAA 3EHMA 3LCAA 2JEKA 2J49A 2L0IA 4WNEA 4FLBA 3FUKA 5KJKA 2J07A 3I3NA 4LRZA 4HLEA 3ZHEB 4GYWA 3EIQC 3HVEA 2WMNA 3APCA 4HXIA 1Z6TA 3PEUB 3T5XA 4C9BB 3ZHEA 2C0MA 3LY8A 4HVBA 2IF4A 4RG6A 2VGXB 2PL2A 4RVBA 3RKVA 3IKOB 5JJ7A 3G2UA 4JEUA 1QQEA 4JVSA 4CRWA 1HX8A 3FY4A 3NZUA 2BUGA 4PS3A 3BG0B 4I6JA 4KVMA 1N54A 1ZBPA 1IQRA 4JEHA 1QNFA 2YQ8A 4KBQA 3CVYA 2WXFA 3CKCA 4O6FA 3UMVA 1E7UA 3CVXA 1H2TC 4AP2A 3TJPA 3UUXA 2LNIA 2FBNA 4PDXA 3SD5A 3AS5A 2J4DA 4CGVA 1KLXA 3ZRHA 2CHWA 4PS8A 3ASHA 1HG2A 4P29A 4GU5A 1SZ9A 3CSTA 2UY1A 2FULA 2V5FA 4QFVA 4WWOA 4CT4A 5T4YA 3U4TA 4HS2A 1A17A 4UI9K 4LUNU 5KJLA 2XPIA 2WXOA 1QZ2A 5FQ7A 5BPPA 5DIZA 3CHQA 4JC8A 1EYHA 3QB2A 2KC7A 5G04J 4V3IA 2DCPA 4CDNA 2PZIA 4WAFA 2X6JA 3ZN3A 4GYYA 3KEZA 3K9IA 2Q7FA 4G26A 3ZYQA 4AV7A 4F53A 4JL0A 4EBAA 3I5PA 3VLEA 3AU4A 2X38A 4YVOA 4BTAA 5D0QD 1KT1A 2XPYA 4G23A 2HO1A 3D9LA 4KZ0A 4B89A 2GRMA 1B89A 3ZYMA 4FP7A 4G24A 3GZSA 3VTYA 4J8EA 3VTXA 1ELRA 3PNTB 3PUJA 4L7TA 4B8AA 2J09A 2NSZA 2J9QA 3LY9A 4I9CA 3SFZA 5JJ6A 2VYIA 2A5UA 4L2LA 3FTVA 4UWHA 3ZGQA 1HS6A 3OTNA 4FHJA 4BT8A 4L23A 2X3MA 1L5JA 3L16A 1ELKA 5ARFA 4N5CA 3UQ3A 3VLFA 5LCWJ 2J08A 2WXMA 5LP0A 4AXHA 2FF4A 3ZW3A 4KVOA 1EPUA 4TRQA 5CHEE 2IOSA 4XI0A 5BW8C 3G2TA 1MHQA 2VTBB 2ILRA 5ENNA 4K0RA 2XEVA 2Y4UA 1Z3XA 2PM6A 3CHOA 3B7TA 5G04C 2CHZA 3QC1A 1PC2A 2NC9A 3MZLB 3ML8A 3S7JA 5LX8A 2VGYA 3D3MA 2FI7A 2UWJG 4JA9A 3GZ1A 4JHKA 4KMOA 2LAIA 3CQGB 2E0IA 4J0UA 3PH0C 2GW1A 2CFUA 3QK0A 4I1OB 4WNFA 2XRYA 3EDTB 4G2VA 3HVEB 4HOTA 2RD0A 3N71A 2HYZA 3QWVA 4DLQA 3Q5MA 3AS4A 3SGHA 3SZ7A 4GB9A 4RSYA 4U8HA 4DLOA 2WXGA 2WXQA 1E8XA 1PAQA 3D9JA 4FJZA 4HOQA 2P58C 4BX8A 5E75A 2WQHA 2EQXA 4I6EA 3FU0A 4AOFA 3CLJA 4A55A 4EPZA 2XCCA 5AIJA 3QARA 3S2AA 4XE0A 1Y6IA 4ANUA 1E8ZA 1DVPA 2WPVA 3DBSA 3QNKA 2XGOA 4JHJA 2VTBA 3PDNA 2KZTA 3Q15A 3G2VA 3ASDA 3QOUA 4JHRA 5FTPA 4I2WA 2I9CA 5CMYA 2E2EA 4AJWA 4HOSA 3FTSA 5AJDA 3ULQA 3L13A 2JLBA 4F1SA 5A7DB 4B8CB 4N2QA 3U66A 5G05C 3TXNA 4ATGA 3CK8A 1OUVA 4G25A 4GZ6A 2CG2A 4NRHB 3L17A 4N3AA 1JPLA 3TAXA 2BTDA 3L22A 1OWPA 1U3CA 1WM5A 3L54A 3PVLA 4GPKA 3LVQE 4I43A 4BFRA 5KJMA 4XZ4A 1HZ4A 4A1SA 4JW1A 2M63A 4GMJA 3UT4A 3ZXSA 3U3WA 3FU5A 2PM7A 2YNQA 3TG5A 1X5BA 3FTWA 3R7RA 1H19A 3FH8A 2I2OA 1N52A 2X6IA 2BF0X 1Z3YA 4NACA 2KCLA 3PE3A 4J6IA 4HOUA 3PS6A 1H0AA 2MRIA 1BPOA 2AXVA 3JQ0A 4Q96A 3FH5A 3L08A 2KM4A 1OWMA 4GA2A 2I1KA 3RK6A 1OWNA 2KCVA 3T8MA 3T5VA 2WQ7A 1H6KA 3FFLA 3FUNA 3P1UA 1MQSA 3RIBA 3AU5A 4AVXA 1UN8A 4N3BA 1FVHA 2UY1B 1ZU2A 2WVIA 4YVQC 3SI5A 3BG1B 3FUIA 4XKCA 2GGFA 3FU6A 4ACLA 2IFUA 5AENA 4F3VA 3UPVA 3CVNA 3MV3B 3SBSA 5BV1A 1NA3A 4UWKA 3S7FA 4N2SA 1FCHA 3Q49B 2A4ZA 4Q94A 3LXUX 2C2LA 5G2NA 5AYWD 4J8DA 2L6JA 3QKYA 2LO6A 2LAHA 4DPRA 4LEUA 3CK7A 2L9BA 3FDHA 4G11A 3SNXA 5ANLA 3RO2A 4GZDA 3IBEA 3G2WA 4FADA 3MKRA 1H2UA 4GCOA 3O4ZA 3PUKA 3QWWA 4APOA 4Y6WA 3D9OA 4HORA 3FULA 1HFAA 3PE4A 3CHRA 1XNFA 3RRMB 3ZEFA 1HG5A 3RU0A 4KT6B 2IOLA 4NURA 4WNDA 1KT0A 2AXZA 3LVRE 3OXLA 3FEYA 2XQ0A 2Y4TA 3Q4AB 3NQPA 3APDA 3ZYLA 1XGWA 1OWOA 3B7SA 3UX4A 3HHMA 1Y8MA 4TUUA 5EX3A 3LDZA 4Y6CA 4AEZC 4APFA 4D10C 4UQYA 3FUMA 4ANVA 1UJKA 5FWQA 1HU3A 3NF1A 4FULA 4J8FA 5LOZA 5LCWC 5KCMA 2X6HA 4EZKA 3FP3A 4RG9A 2VSXE 2WXIA 4C0EA 3LYAA 4I9EA 2IQCA 3D9NA 4N39A 3B7UX 3CVLA 2I1JA 3OXGA 1WY6A 4ILHB 3FTZA 3UT7A 3HDXA 2YHEA 4EECA 1UG3A 2WXHA 5FJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AEZ C;  2WVI A;  3SI5 A;  2LAH A;  4A1G A; 
#chains in the Genus database with same CATH topology
 4UWF A;  2EIJ E;  3DSW A;  5AAR A;  3GYZ A;  4JXT A;  3MKQ A;  3E37 A;  1WG0 A;  1K3Z D;  2V8S E;  4CGW A;  4MS6 A;  2XZD G;  3GZ2 A;  2DVW A;  4DI3 A;  3DSV A;  4U0S A;  3HXB A;  4WWP A;  3ZUV B;  4DJA A;  4JA7 A;  4IRU A;  2XZT G;  3TWS A;  2CG3 A;  1N9A A;  5CEA A;  3ABK E;  4DRX E;  1DNP A;  5FZS A;  5T8I A;  3D9M A;  5EIL A;  3B7R L;  3SO8 A;  3UIP C;  4GMR A;  4TV3 A;  2H6H A;  4EZL A;  5CBN A;  2R2L A;  2H6G A;  1INZ A;  3FU3 A;  4CDR A;  4ZFH A;  2AWI A;  4HFG A;  2V4H C;  2IJG X;  3ML9 A;  5JA4 D;  4ANW A;  3PRE A;  1P5Q A;  3W9G A;  4I1M A;  2WB2 A;  3URZ A;  5G55 A;  1AP7 A;  4BY6 A;  4HQD A;  4CZ2 D;  3J5P A;  4GA1 A;  3HXD A;  1MZC A;  2OV8 A;  3FUD A;  4GA0 A;  3CK9 A;  4J8S A;  1G3N B;  2VGE A;  3LS8 A;  3S7D A;  2P9P G;  3ZKJ A;  2WMO A;  5D0O D;  4I1A A;  2WQ6 A;  1HO8 A;  5D66 A;  1BD8 A;  2I6H A;  1GW6 A;  1S0P A;  1JUQ A;  4LER A;  3KSQ A;  4O1O A;  3CHM A;  1FT2 A;  4MRU A;  2RG8 A;  4AIF A;  2C0L A;  2OVB A;  3HYM B;  2YHC A;  2KCK A;  1N4P A;  4ANX A;  3Q47 B;  1UJJ A;  3DEP A;  1N4R A;  2V0P A;  2AVP A;  3DSX A;  5BV0 A;  4RQI A;  4K03 A;  5ENT D;  3FUH A;  2R59 A;  3ZPJ A;  3HIZ A;  4W9R A;  5ENO D;  3BQO A;  4XX5 A;  4DX6 D;  5AQB A;  3S7B A;  5AAO A;  3ESL A;  4BEP A;  2IU1 A;  4PH4 B;  3TG4 A;  5FQ8 A;  1BU9 A;  3IV0 A;  4RLY A;  5KJN A;  2F37 A;  3MYV A;  3FEX A;  3PEV B;  2KZT B;  3QAQ A;  1JWG A;  3SF4 A;  5EN5 D;  4G8K A;  2J49 A;  3FUK A;  3ZHE B;  3EIQ C;  3APC A;  4GTP A;  3HXC A;  2PL2 A;  3G2U A;  4K5B A;  4JVS A;  4CRW A;  1HX8 A;  3NZU A;  2L6B A;  3BG0 B;  4I6J A;  3T9K A;  1N54 A;  4JEH A;  2WXF A;  3UMV A;  1D8E A;  1JCR A;  3UUX A;  2J4D A;  1MYO A;  2CHW A;  4PS8 A;  3CST A;  4CT4 A;  4WWO A;  5T4Y A;  5KJL A;  1KZP A;  5BPP A;  5CED B;  5DIZ A;  1OT8 A;  2LXL A;  1BI8 B;  3DWL G;  1FPP A;  2DCP A;  4CDN A;  4WAF A;  2X6J A;  3DRA A;  3ZN3 A;  3KEZ A;  2Q7F A;  4YVO A;  4G23 A;  3D9L A;  2GRM A;  4G24 A;  2IO2 C;  3GZS A;  3PNT B;  2NSZ A;  5HS0 A;  5JJ6 A;  4L2L A;  2P9N G;  4UWH A;  2GRP B;  1ELK A;  3VLF A;  5LP0 A;  4XEI G;  3ZW3 A;  4KVO A;  4TRQ A;  5CHE E;  4XI0 A;  4K0R A;  1Z3X A;  2PM6 A;  2NC9 A;  3S7J A;  5LX8 A;  2KBX A;  2CFU A;  3EDT B;  3HVE B;  2RD0 A;  2HYZ A;  1MX6 A;  3AS4 A;  4DLO A;  1PAQ A;  3D9J A;  3LJN A;  2P58 C;  5E75 A;  3FU0 A;  4EPZ A;  2XCC A;  2Y1L E;  3DBS A;  2XGO A;  4JHJ A;  3Q15 A;  3G2V A;  5FTP A;  2I9C A;  2E2E A;  5ENR D;  2B6C A;  3U66 A;  5G05 C;  1TNZ A;  4ATG A;  1OUV A;  4G25 A;  2CG2 A;  3L17 A;  2BTD A;  1OWP A;  3PVL A;  4L9P A;  5KJM A;  2EIN E;  4C48 B;  4XZ4 A;  5D2M C;  4JW1 A;  3TG5 A;  1X5B A;  4HRN A;  2BKG A;  2QZA A;  2QC9 A;  4J6I A;  1H0A A;  5B3S E;  4Q96 A;  2AXV A;  3L08 A;  3SFX A;  1OWM A;  3E32 A;  3FFL A;  3FUN A;  1MQS A;  3RSE G;  4OAU C;  2UY1 B;  4YVQ C;  3FUI A;  1TNB A;  4F3V A;  3MV3 B;  4UWK A;  3S7F A;  4N2S A;  4Q94 A;  5G2N A;  5AYW D;  2L6J A;  2LO6 A;  4LEU A;  4LNB A;  4J8Y A;  2ETC A;  4U8Y D;  3IBE A;  3EU9 A;  4HBD A;  3MKR A;  2P2C P;  3PUK A;  1HFA A;  3CHR A;  1HG5 A;  4WND A;  4NUR A;  4TXP A;  3FEY A;  3IXE A;  2GRO B;  4F1P A;  1XGW A;  5EYP F;  2ETA A;  3HHM A;  3C3O A;  4APF A;  3NF1 A;  4OAV B;  1LTX A;  5KCM A;  1U2V G;  4U8V D;  2VSX E;  3LYA A;  4I9E A;  1OY3 D;  2IQC A;  3D9N A;  2XEH A;  2IEJ A;  3UT7 A;  3HDX A;  2YHE A;  1UG3 A;  5FJY A;  3CVQ A;  3QJZ A;  4L1B A;  2BKK B;  3I4G A;  4IYP A;  1NZN A;  2OEW A;  2OOE A;  1IHG A;  4B93 B;  3ESK A;  3CEQ A;  1FVF A;  2R5S A;  3FH7 A;  1E90 A;  3Q75 A;  1X81 A;  5EX0 A;  3O48 A;  3ZNG A;  3AJI A;  4ME2 A;  2XGS A;  1TNY A;  3UM3 A;  2HR2 A;  3ENE A;  3BU8 A;  4U04 A;  3LKU A;  5BNW A;  2EIK E;  2GRR B;  1SQM A;  4DX2 A;  4U7E B;  3RJV A;  5J90 A;  3UKU G;  3TGO A;  3E33 A;  2ZU6 B;  1NA0 A;  2FO7 A;  4PUC A;  3PZ2 A;  2XPZ A;  3Q79 A;  2ZGG A;  1JCS A;  2VSY A;  3UT8 A;  1JWF A;  1E96 B;  1TNU A;  2MYO A;  4E6H A;  2OVF A;  4WUY A;  4G1T A;  2WXN A;  2AXU A;  1U3D A;  1YA0 A;  1AWC B;  5ANR A;  5A6C A;  3I4R B;  4B94 A;  2CHX A;  3ZXP A;  3V30 A;  4XI9 A;  2FO1 E;  5HQ8 A;  3MV2 B;  2NXP A;  2A5E A;  4CEM A;  2NYJ A;  3R7Q A;  1UW4 B;  2L0T B;  3B13 A;  4HI9 A;  3APF A;  4KYO B;  3FHE A;  3KS2 A;  2RFM A;  3NB2 A;  2AJA A;  5FZR A;  1ELW A;  4TUM A;  2ZGD A;  3JUI A;  1V55 E;  2P9K G;  3MA5 A;  4E85 A;  3L82 A;  2QYU A;  1DCQ A;  5AQA A;  1IYG A;  3FWV A;  2AW6 A;  3AS8 A;  3AAA C;  4PS7 A;  1EF1 C;  3EHN A;  3E4B A;  5A23 A;  3SHF A;  3CSF A;  4IN3 B;  3RRU A;  1WDY A;  5EKQ D;  5H7P A;  1N11 A;  2DWZ A;  3OXF A;  1OCO E;  4CDM A;  3VLD A;  1K1B A;  4BX9 A;  1HF8 A;  1NL4 A;  3LY7 A;  1N0R A;  3D9K A;  3QDN A;  4A1G A;  4I2Z A;  5HRY A;  3L6A A;  2V4L A;  3AG1 E;  3FTU A;  3HXE A;  4U0U A;  4R7L A;  3ISM C;  4OYS A;  5CBO A;  3TL5 A;  1JCQ A;  4ZHB A;  2PQR A;  4WWN A;  1MX4 A;  3KD7 A;  1UOH A;  4HI8 A;  4EHM A;  3ASO E;  4A63 B;  3GW4 A;  4FLB A;  5KJK A;  5KWD A;  5KBA A;  3HVE A;  2WMN A;  4HXI A;  1Z6T A;  2C0M A;  2IF4 A;  2VGX B;  2H6F A;  3UM1 A;  3FY4 A;  3HG0 D;  3HRA A;  5BXO A;  1IQR A;  1QNF A;  4KBQ A;  3CVY A;  3CKC A;  1E7U A;  3UI2 A;  2LNI A;  4PDX A;  4Z68 A;  2BED A;  4P29 A;  1SZ9 A;  2FUL A;  2ETB A;  5IY5 E;  3U4T A;  1OXJ A;  2R03 A;  4HS2 A;  4UI9 K;  3PZ1 A;  2KC7 A;  4V3I A;  2XS8 A;  4M7C A;  4GYY A;  1Q2Z A;  3K9I A;  4G26 A;  3ZYQ A;  4JL0 A;  4BER A;  5D0Q D;  3ZYM A;  3VTY A;  4J8E A;  3VTX A;  2P9S G;  4L7T A;  3HXF A;  2VYI A;  3ZGQ A;  4FHJ A;  4L23 A;  2X3M A;  3DEO A;  4N5C A;  3UQ3 A;  5LCW J;  4GTS A;  2FF4 A;  1EPU A;  5ENN A;  4JD2 G;  3KSL A;  3C5R A;  3T8K A;  1OCZ E;  2H6I A;  2CHZ A;  2IY0 C;  3B7T A;  4U95 D;  1PC2 A;  2VGY A;  3NOG D;  1N95 A;  2UWJ G;  4JA9 A;  3TWU A;  3CQG B;  4I1O B;  2OCC E;  3N71 A;  4DLQ A;  3PZ3 A;  4GB9 A;  1E8X A;  2P9L G;  4FJZ A;  4BX8 A;  2EQX A;  5ENS D;  4A55 A;  5AIJ A;  2Y0B G;  3V79 K;  4XE0 A;  1Y6I A;  4ANU A;  1DVP A;  1E8Z A;  3PDN A;  3ASD A;  3QOU A;  1MJ0 A;  3L13 A;  4YDY A;  4B8C B;  4N2Q A;  3TXN A;  3ZU7 B;  3CK8 A;  3Q7A A;  4N3A A;  3L22 A;  1U3C A;  4GPK A;  2J8S D;  5BXU A;  1HZ4 A;  5KNH D;  4A1S A;  3ZXS A;  1A5E A;  3R7R A;  2I2O A;  2X6I A;  2BF0 X;  2EIL E;  3FH5 A;  2I1K A;  2KCV A;  3T8M A;  1H6K A;  3RIB A;  1FVH A;  2WVI A;  3UM2 A;  4XKC A;  3FU6 A;  3CVN A;  3Q49 B;  4NIK A;  2F8X K;  2LAH A;  3CK7 A;  3RO2 A;  1H2U A;  4GCO A;  3O4Z A;  4Y6W A;  1K8K G;  3D9O A;  3PE4 A;  4KT6 B;  2IOL A;  2R02 A;  3LVR E;  3Q4A B;  3NQP A;  1LD7 A;  3APD A;  2IO3 C;  3B7S A;  3UX4 A;  1OCR E;  1Y8M A;  4TUU A;  4D10 C;  4UQY A;  3DSS A;  1UJK A;  3NAW A;  4RG9 A;  2WXI A;  1IKN D;  3UKR G;  3CVL A;  3OXG A;  1WY6 A;  4ILH B;  3FTZ A;  3PH0 C;  1OCC E;  1SA5 A;  2VSN A;  3P2B A;  1SVX A;  1PY1 A;  1UN9 A;  5HKP A;  1RZ4 A;  5DBK A;  3AG4 E;  3ONK A;  5AJL A;  2XRZ A;  4UWG A;  2XCB A;  3JCK C;  3DXM G;  2MHK A;  3ULE G;  2WXL A;  3FUJ A;  5CCL A;  5EIB E;  4A3T A;  3TWT A;  2WXK A;  4UQZ A;  2VQ2 A;  3EIJ A;  3UTM A;  4DX7 D;  1S63 A;  3EU5 A;  4KXK B;  3EJN A;  3TXM A;  4BET A;  3ZVV A;  2OND A;  2KXP C;  3ZFW A;  1TEZ A;  4DK5 A;  3PZD A;  4YDO A;  4FC8 A;  3V31 A;  4LG6 A;  4I6G A;  5LFA A;  1IHB A;  4A3V A;  3MJW A;  3Q73 A;  3WG7 E;  3U64 A;  2ION A;  4FJY A;  3B7B A;  4GYO A;  1NI1 A;  3JYS A;  1SW6 A;  4MLP A;  3IHY A;  4U0Z A;  1NP7 A;  5B1B E;  3ASG A;  4M3O A;  1IQU A;  2XHE A;  4XIF A;  4AM9 A;  3DXK G;  2ZIS A;  3CHP A;  3CHS A;  2LUH A;  4ILG A;  4AY6 A;  1O5M A;  2HM8 A;  2XGM A;  4LNU D;  4FHK A;  1W3B A;  4EBA G;  3CGH A;  3E30 A;  2J4B A;  4CCA A;  4DUI A;  3DPD A;  3Q9N C;  3RRN B;  3FTX A;  4UWL A;  3JQ1 A;  4L2Y A;  5M72 A;  5CEC B;  4GCN A;  3ZIM A;  3FTY A;  2PQN A;  5CCM A;  4N3C A;  4K5C A;  4GTM A;  1LF8 A;  5T3R A;  3CVP A;  2VSO E;  2XEN A;  3CVV A;  4ABN A;  2VGX A;  3R9A B;  3MKQ B;  1O1S A;  5J08 A;  4GTO A;  3F6Q A;  3MGB A;  3BEE A;  4LCT A;  3TWX A;  1TN8 A;  4GML A;  4NQ0 A;  3WXX A;  5JMN D;  5FQ6 A;  2QFC A;  1QYM A;  4EZJ A;  1VDY A;  4BT9 A;  5FT9 A;  1N94 A;  4GAA A;  3Q78 A;  4JZY A;  4Q69 A;  4DX1 A;  4F7A A;  5JHA A;  1N4S A;  5JJT A;  5ARG A;  4UQX A;  4KZC A;  2WXJ A;  4GZC A;  1HXI A;  3LCA A;  4HLE A;  3I3N A;  3L9T A;  2B0O E;  3EUV A;  3T5X A;  3ZHE A;  3LY8 A;  4HVB A;  3DST A;  3DPY A;  4RG6 A;  4RVB A;  3RKV A;  3V2O A;  5JJ7 A;  1QQE A;  2BUG A;  4LSZ E;  4HRM B;  4PS3 A;  4O6F A;  3UIN C;  3SD5 A;  4CGV A;  3ABM E;  3ASH A;  3V2X A;  2UY1 A;  4QFV A;  1A17 A;  2DZO A;  3ASN E;  4K5A B;  2XPI A;  2WXO A;  3JXI A;  3QB2 A;  2PZI A;  2F0Y A;  2JAB A;  4F53 A;  1S64 A;  3C72 A;  1KT1 A;  2XPY A;  1H6P A;  1B89 A;  1SA4 A;  1ELR A;  3PUJ A;  4B8A A;  2J9Q A;  4I9C A;  1O1R A;  3FTV A;  3Q7F A;  3OTN A;  3L16 A;  2WXM A;  3W9F A;  5G04 C;  3QC1 A;  3MZL B;  3ML8 A;  3ULY A;  4HB5 A;  1TR4 A;  2LAI A;  4J0U A;  2E0I A;  4WNF A;  2GW1 A;  2XRY A;  4G2V A;  2RFA A;  3EHR A;  3SGH A;  4RSY A;  2DYS E;  2WQH A;  5EID A;  2P9U G;  1H6O A;  4HNA D;  3QAR A;  4O60 A;  2VTB A;  5ITZ F;  5ENP D;  4AJW A;  5CMY A;  3FTS A;  5AJD A;  3UM0 A;  2JLB A;  4LNG A;  4NRH B;  1Z5S C;  3AG2 E;  1DC2 A;  3TAX A;  3D9H A;  4BFR A;  4DX5 D;  4GMJ A;  3U3W A;  3FU5 A;  4J7W A;  2PM7 A;  3E34 A;  3FTW A;  3FH8 A;  1Z3Y A;  3PE3 A;  4HOU A;  2MRI A;  4HLL A;  3JQ0 A;  2KM4 A;  3UXG A;  1OWN A;  2WQ7 A;  3P1U A;  3X2Q E;  3AU5 A;  2PNN A;  3SI5 A;  3BG1 B;  2GGF A;  5AEN A;  3UPV A;  1BLX B;  5BV1 A;  5KNG A;  1FCH A;  2A4Z A;  3LXU X;  2C2L A;  2LXM A;  5AQ7 A;  4DPR A;  3FDH A;  2L9B A;  3SNX A;  4G11 A;  5ANL A;  4GZD A;  4FAD A;  3QWW A;  2F8Y A;  4HOR A;  2V5Q C;  3OXL A;  4YDE A;  2XQ0 A;  2Y4T A;  1OWO A;  5EX3 A;  3LDZ A;  4Y6C A;  2P9I G;  3FUM A;  5FWQ A;  1HU3 A;  4FUL A;  5LOZ A;  5LCW C;  5EYL A;  1MX2 A;  4EZK A;  2DZN A;  2I1J A;  2QYJ A;  5CRV A;  4EEC A;  2WXH A;  3CQC B;  5BT1 A;  2VJ8 A;  5BUZ A;  1TN6 A;  4JPS A;  4GZ3 A;  3ONL A;  5EDS A;  3CV0 A;  5G05 J;  4FA6 A;  4ILI A;  4HRL A;  4YND A;  2DYR E;  2OEV A;  1TJC A;  2KAT A;  3NZS A;  3IHV A;  1D8D A;  4EQF A;  3AG3 E;  3RO3 A;  3JUE A;  3CR3 A;  2X6K A;  4ACK A;  2GRL A;  4H7Y A;  1HE8 A;  1YMP A;  3TWW A;  2FEZ A;  1DCE A;  3C98 A;  3ASF A;  4UI9 J;  5CMW A;  3ABL E;  3B95 A;  4GZ5 A;  1KPS B;  3ZYK A;  1TJF A;  2MOW A;  5FIO A;  3SBT B;  4BWR A;  4URK A;  3OAW A;  5JHB A;  1FT1 A;  2Y3A A;  1LD8 A;  3PNL B;  4U96 D;  3LJ3 A;  4N5Q A;  2ZIR A;  1TNO A;  3FUE A;  4DI4 A;  2WXR A;  4I17 A;  3U9W A;  4BSX A;  1OWL A;  3KAE A;  2CFZ A;  3D9P A;  2XEE A;  1EDU A;  2WM9 A;  3G2S A;  4U63 A;  2Y69 E;  4YDW A;  3MEK A;  3IEG A;  3QWP A;  3NOC D;  5HI7 A;  2YIN A;  3PRZ A;  4BTB A;  4H7X A;  1E8Y A;  1O1T A;  3CIA A;  2QY7 A;  1E8W A;  3J5Q B;  1ZB1 A;  3BUA A;  2XS1 A;  3MX3 A;  2R17 C;  4UI9 C;  4AY5 A;  3TWV A;  5FQ4 A;  3CVU A;  3MCX A;  2LSU A;  1KZO A;  4WNG A;  4JB8 P;  5C2Y A;  3CKB A;  5E76 A;  1HH8 A;  1SZA A;  2EIM E;  4XKB A;  4U07 A;  1WAO 1;  2RKK A;  3LPZ A;  1E7V A;  3RAU A;  3SFY A;  4F6R D;  4C0M A;  3CVW A;  2LSV A;  4ATZ D;  4CT0 A;  4OVV A;  1IXV A;  4TXQ A;  2X6F A;  4IUL A;  3FUF A;  4FLH A;  4FU3 A;  4MKT A;  3LEW A;  3JXJ A;  2HE0 A;  3D9I A;  5C1D A;  2WXP A;  1H2V C;  4B0Z A;  5FZQ A;  2DIW A;  4OVU A;  2R05 A;  2DBA A;  3EHM A;  2JEK A;  2L0I A;  4WNE A;  2J07 A;  4LRZ A;  1D9S A;  4GYW A;  3R9M A;  4X8Q A;  3PEU B;  4C9B B;  5CRU A;  3IKO B;  4JEU A;  3EHQ A;  1YCS B;  4KVM A;  4O1P A;  1ZBP A;  4TXR A;  2YQ8 A;  3CVX A;  1H2T C;  4AP2 A;  3TJP A;  2FBN A;  3AS5 A;  1KLX A;  3ZRH A;  4GTT A;  1HG2 A;  4G8L A;  4GU5 A;  2V5F A;  3NBN B;  3SQV A;  4GTQ A;  3UIO C;  4LUN U;  3C3R A;  1QZ2 A;  5FQ7 A;  3CHQ A;  4JC8 A;  1EYH A;  5G04 J;  3TWR A;  4AV7 A;  4EBA A;  3I5P A;  3VLE A;  3AU4 A;  1RW2 A;  2X38 A;  4BTA A;  4KZ0 A;  2HO1 A;  4GTR A;  4B89 A;  4FP7 A;  3Q9U C;  2J09 A;  3LY9 A;  3SFZ A;  2A5U A;  1HS6 A;  4CYM D;  4BT8 A;  1L5J A;  5ARF A;  5FIN A;  2J08 A;  4AXH A;  2IOS A;  3DSU A;  5BW8 C;  3G2T A;  1MHQ A;  2VTB B;  2ILR A;  2XEV A;  2Y4U A;  3CHO A;  5AN8 A;  3D3M A;  2FI7 A;  4JHK A;  3GZ1 A;  4KMO A;  3QK0 A;  4HOT A;  3QWV A;  3Q5M A;  3SZ7 A;  1S70 B;  4U8H A;  4UUC A;  2WXG A;  2WXQ A;  4HOQ A;  3KEA A;  4I6E A;  4AOF A;  3CLJ A;  4BES A;  2GRN B;  3S2A A;  2WPV A;  3QNK A;  2KZT A;  1V54 E;  4JHR A;  4HOS A;  4I2W A;  3ULQ A;  4F1S A;  5A7D B;  4GZ6 A;  1N0Q A;  1JPL A;  1TN7 A;  1K1A A;  1WM5 A;  3C3Q A;  4MBG A;  3L54 A;  3LVQ E;  4I43 A;  2M63 A;  3UT4 A;  2YNQ A;  1H19 A;  1N52 A;  4NAC A;  2KCL A;  2GRQ B;  3PS6 A;  1BPO A;  4GA2 A;  4QQI A;  5AQ9 A;  3RK6 A;  3T5V A;  1TYQ G;  4AVX A;  1UN8 A;  4N3B A;  4GPM A;  1ZU2 A;  4ACL A;  2IFU A;  3TWQ A;  3SBS A;  3PZ4 A;  1NA3 A;  1QBQ A;  4J8D A;  3QKY A;  1YYH A;  3G2W A;  5ENQ D;  4APO A;  3FUL A;  1XNF A;  3RRM B;  3ZEF A;  3RU0 A;  1KT0 A;  2AXZ A;  4GTV A;  3ZYL A;  5CER B;  4AEZ C;  3SY2 A;  2ZXW E;  4ANV A;  4J8F A;  1NFI E;  2X6H A;  5B1A E;  3FP3 A;  4C0E A;  4N39 A;  4BSZ B;  3B7U X;  1N4Q A;  1BI7 B; 
#chains in the Genus database with same CATH homology
 3CVQ A;  3CQC B;  3QJZ A;  4UWF A;  5BT1 A;  2VJ8 A;  4L1B A;  5BUZ A;  3GYZ A;  3I4G A;  4JXT A;  4JPS A;  4IYP A;  3MKQ A;  3ONL A;  4GZ3 A;  5EDS A;  3CV0 A;  1NZN A;  2VSN A;  3P2B A;  2OOE A;  1IHG A;  5G05 J;  1PY1 A;  1UN9 A;  4FA6 A;  4ILI A;  3ESK A;  3CEQ A;  1FVF A;  5DBK A;  2R5S A;  3FH7 A;  2V8S E;  4YND A;  3ONK A;  1E90 A;  5AJL A;  4CGW A;  1TJC A;  4MS6 A;  2KAT A;  4UWG A;  2XRZ A;  3NZS A;  5EX0 A;  3IHV A;  3O48 A;  2XCB A;  3JCK C;  3GZ2 A;  4ME2 A;  4EQF A;  2MHK A;  2XGS A;  4DI3 A;  2WXL A;  4U0S A;  2HR2 A;  3RO3 A;  3FUJ A;  3ENE A;  4WWP A;  3CR3 A;  5CCL A;  2X6K A;  4ACK A;  4DJA A;  2GRL A;  4JA7 A;  4U04 A;  4IRU A;  3LKU A;  4H7Y A;  4A3T A;  1HE8 A;  2CG3 A;  5BNW A;  2FEZ A;  2WXK A;  4UQZ A;  2VQ2 A;  1SQM A;  3EIJ A;  3C98 A;  4KXK B;  3ASF A;  3EJN A;  3RJV A;  5J90 A;  1DNP A;  4UI9 J;  5FZS A;  3TXM A;  3ZVV A;  5T8I A;  2OND A;  3D9M A;  5CMW A;  3TGO A;  3B7R L;  2ZU6 B;  1NA0 A;  2FO7 A;  4PUC A;  3ZFW A;  4TV3 A;  2XPZ A;  4EZL A;  1TEZ A;  4DK5 A;  4GZ5 A;  3PZD A;  2VSY A;  3UT8 A;  1INZ A;  4FC8 A;  3ZYK A;  1TJF A;  3FU3 A;  1JWF A;  2MOW A;  4CDR A;  1E96 B;  3SBT B;  4I6G A;  5LFA A;  4E6H A;  4BWR A;  2AWI A;  2OVF A;  4WUY A;  4URK A;  4HFG A;  4A3V A;  4G1T A;  3OAW A;  5JHB A;  2WXN A;  2Y3A A;  2IJG X;  3MJW A;  3ML9 A;  3PNL B;  4ANW A;  3PRE A;  2AXU A;  3LJ3 A;  1P5Q A;  1U3D A;  1YA0 A;  4I1M A;  3FUE A;  3U64 A;  2WB2 A;  2ION A;  3URZ A;  4DI4 A;  2WXR A;  4I17 A;  5G55 A;  3U9W A;  4BSX A;  5ANR A;  4BY6 A;  1OWL A;  4FJY A;  4GYO A;  3KAE A;  3JYS A;  2CFZ A;  5A6C A;  4MLP A;  3IHY A;  3D9P A;  1NP7 A;  1EDU A;  3ASG A;  3I4R B;  4U0Z A;  4B94 A;  4M3O A;  2WM9 A;  1IQU A;  4GA1 A;  2XHE A;  3G2S A;  4U63 A;  2CHX A;  4XIF A;  2OV8 A;  3FUD A;  4AM9 A;  4GA0 A;  3CK9 A;  4J8S A;  4XI9 A;  3MEK A;  3IEG A;  3QWP A;  3LS8 A;  5HI7 A;  3S7D A;  3CHP A;  5HQ8 A;  3MV2 B;  2YIN A;  2NXP A;  3CHS A;  4CEM A;  3PRZ A;  3R7Q A;  4ILG A;  4BTB A;  4AY6 A;  4H7X A;  1UW4 B;  2HM8 A;  2L0T B;  3B13 A;  1E8Y A;  2XGM A;  2WMO A;  3APF A;  4FHK A;  5D0O D;  4KYO B;  1W3B A;  4EBA G;  3FHE A;  3KS2 A;  3CIA A;  3CGH A;  4I1A A;  2QY7 A;  2WQ6 A;  2J4B A;  4CCA A;  1E8W A;  5FZR A;  1ELW A;  1HO8 A;  3DPD A;  3JUI A;  2I6H A;  1GW6 A;  3RRN B;  3MA5 A;  3FTX A;  4UWL A;  1S0P A;  3MX3 A;  3JQ1 A;  4L2Y A;  1JUQ A;  5M72 A;  2R17 C;  4UI9 C;  4E85 A;  4GCN A;  4AY5 A;  4LER A;  3ZIM A;  3CHM A;  3FTY A;  2PQN A;  5CCM A;  4MRU A;  1IYG A;  3FWV A;  2AW6 A;  5FQ4 A;  3CVU A;  2RG8 A;  3MCX A;  2LSU A;  4AIF A;  3AS8 A;  4N3C A;  4PS7 A;  4WNG A;  1EF1 C;  3EHN A;  1LF8 A;  2C0L A;  2OVB A;  2YHC A;  3HYM B;  5C2Y A;  2KCK A;  3E4B A;  3CKB A;  4ANX A;  5A23 A;  3SHF A;  3Q47 B;  1UJJ A;  5E76 A;  1HH8 A;  3CSF A;  4IN3 B;  1SZA A;  5T3R A;  2V0P A;  3CVP A;  2AVP A;  2VSO E;  3RRU A;  4XKB A;  4U07 A;  5EKQ D;  3CVV A;  4ABN A;  1WAO 1;  3OXF A;  5BV0 A;  4K03 A;  2VGX A;  3LPZ A;  3FUH A;  4CDM A;  2R59 A;  3VLD A;  3ZPJ A;  1E7V A;  4BX9 A;  3HIZ A;  4W9R A;  1HF8 A;  3MKQ B;  3R9A B;  3LY7 A;  4XX5 A;  3S7B A;  5J08 A;  3D9K A;  4C0M A;  3QDN A;  3CVW A;  3MGB A;  2LSV A;  3BEE A;  4LCT A;  3ESL A;  4GML A;  4NQ0 A;  3WXX A;  4CT0 A;  4OVV A;  4A1G A;  5FQ6 A;  2IU1 A;  2QFC A;  4I2Z A;  4PH4 B;  3L6A A;  2V4L A;  3FTU A;  4U0U A;  5FQ8 A;  3TG4 A;  3IV0 A;  4R7L A;  4EZJ A;  1VDY A;  2X6F A;  4IUL A;  4BT9 A;  3FUF A;  4OYS A;  4FLH A;  5FT9 A;  4GAA A;  4FU3 A;  4MKT A;  3LEW A;  4JZY A;  5KJN A;  3MYV A;  3TL5 A;  4F7A A;  4Q69 A;  3D9I A;  5JHA A;  5JJT A;  2PQR A;  4WWN A;  3FEX A;  5C1D A;  2WXP A;  1H2V C;  3KD7 A;  3PEV B;  2KZT B;  4B0Z A;  3QAQ A;  5FZQ A;  1JWG A;  5ARG A;  2DIW A;  4UQX A;  3SF4 A;  4KZC A;  2WXJ A;  3GW4 A;  4OVU A;  4GZC A;  1HXI A;  2DBA A;  3EHM A;  3LCA A;  2JEK A;  2J49 A;  2L0I A;  4WNE A;  4FLB A;  3FUK A;  5KJK A;  2J07 A;  3I3N A;  4LRZ A;  4HLE A;  3ZHE B;  4GYW A;  3EIQ C;  3HVE A;  2WMN A;  3APC A;  4HXI A;  1Z6T A;  3PEU B;  3T5X A;  4C9B B;  3ZHE A;  2C0M A;  3LY8 A;  4HVB A;  2IF4 A;  4RG6 A;  2VGX B;  2PL2 A;  4RVB A;  3RKV A;  3IKO B;  5JJ7 A;  3G2U A;  4JEU A;  1QQE A;  4JVS A;  4CRW A;  1HX8 A;  3FY4 A;  3NZU A;  2BUG A;  4PS3 A;  3BG0 B;  4I6J A;  4KVM A;  1N54 A;  1ZBP A;  1IQR A;  4JEH A;  1QNF A;  2YQ8 A;  4KBQ A;  3CVY A;  2WXF A;  3CKC A;  4O6F A;  3UMV A;  1E7U A;  3CVX A;  1H2T C;  4AP2 A;  3TJP A;  3UUX A;  2LNI A;  2FBN A;  4PDX A;  3SD5 A;  3AS5 A;  2J4D A;  4CGV A;  1KLX A;  3ZRH A;  2CHW A;  4PS8 A;  3ASH A;  1HG2 A;  4P29 A;  4GU5 A;  1SZ9 A;  3CST A;  2UY1 A;  2FUL A;  2V5F A;  4QFV A;  4WWO A;  4CT4 A;  5T4Y A;  3U4T A;  4HS2 A;  1A17 A;  4UI9 K;  4LUN U;  5KJL A;  2XPI A;  2WXO A;  1QZ2 A;  5FQ7 A;  5BPP A;  5DIZ A;  3CHQ A;  4JC8 A;  1EYH A;  3QB2 A;  2KC7 A;  5G04 J;  4V3I A;  2DCP A;  4CDN A;  2PZI A;  4WAF A;  2X6J A;  3ZN3 A;  4GYY A;  3KEZ A;  3K9I A;  2Q7F A;  4G26 A;  3ZYQ A;  4AV7 A;  4F53 A;  4JL0 A;  4EBA A;  3I5P A;  3VLE A;  3AU4 A;  2X38 A;  4YVO A;  4BTA A;  5D0Q D;  1KT1 A;  2XPY A;  4G23 A;  2HO1 A;  3D9L A;  4KZ0 A;  4B89 A;  2GRM A;  1B89 A;  3ZYM A;  4FP7 A;  4G24 A;  3GZS A;  3VTY A;  4J8E A;  3VTX A;  1ELR A;  3PNT B;  3PUJ A;  4L7T A;  4B8A A;  2J09 A;  2NSZ A;  2J9Q A;  3LY9 A;  4I9C A;  3SFZ A;  5JJ6 A;  2VYI A;  2A5U A;  4L2L A;  3FTV A;  4UWH A;  3ZGQ A;  1HS6 A;  3OTN A;  4FHJ A;  4BT8 A;  4L23 A;  2X3M A;  1L5J A;  3L16 A;  1ELK A;  5ARF A;  4N5C A;  3UQ3 A;  3VLF A;  5LCW J;  2J08 A;  2WXM A;  5LP0 A;  4AXH A;  2FF4 A;  3ZW3 A;  4KVO A;  1EPU A;  4TRQ A;  5CHE E;  2IOS A;  4XI0 A;  5BW8 C;  3G2T A;  1MHQ A;  2VTB B;  2ILR A;  5ENN A;  4K0R A;  2XEV A;  2Y4U A;  1Z3X A;  2PM6 A;  3CHO A;  3B7T A;  5G04 C;  2CHZ A;  3QC1 A;  1PC2 A;  2NC9 A;  3MZL B;  3ML8 A;  3S7J A;  5LX8 A;  2VGY A;  3D3M A;  2FI7 A;  2UWJ G;  4JA9 A;  3GZ1 A;  4JHK A;  4KMO A;  2LAI A;  3CQG B;  2E0I A;  4J0U A;  3PH0 C;  2GW1 A;  2CFU A;  3QK0 A;  4I1O B;  4WNF A;  2XRY A;  3EDT B;  4G2V A;  3HVE B;  4HOT A;  2RD0 A;  3N71 A;  2HYZ A;  3QWV A;  4DLQ A;  3Q5M A;  3AS4 A;  3SGH A;  3SZ7 A;  4GB9 A;  4RSY A;  4U8H A;  4DLO A;  2WXG A;  2WXQ A;  1E8X A;  1PAQ A;  3D9J A;  4FJZ A;  4HOQ A;  2P58 C;  4BX8 A;  5E75 A;  2WQH A;  2EQX A;  4I6E A;  3FU0 A;  4AOF A;  3CLJ A;  4A55 A;  4EPZ A;  2XCC A;  5AIJ A;  3QAR A;  3S2A A;  4XE0 A;  1Y6I A;  4ANU A;  1E8Z A;  1DVP A;  2WPV A;  3DBS A;  3QNK A;  2XGO A;  4JHJ A;  2VTB A;  3PDN A;  2KZT A;  3Q15 A;  3G2V A;  3ASD A;  3QOU A;  4JHR A;  5FTP A;  4I2W A;  2I9C A;  5CMY A;  2E2E A;  4AJW A;  4HOS A;  3FTS A;  5AJD A;  3ULQ A;  3L13 A;  2JLB A;  4F1S A;  5A7D B;  4B8C B;  4N2Q A;  3U66 A;  5G05 C;  3TXN A;  4ATG A;  3CK8 A;  1OUV A;  4G25 A;  4GZ6 A;  2CG2 A;  4NRH B;  3L17 A;  4N3A A;  1JPL A;  3TAX A;  2BTD A;  3L22 A;  1OWP A;  1U3C A;  1WM5 A;  3L54 A;  3PVL A;  4GPK A;  3LVQ E;  4I43 A;  4BFR A;  5KJM A;  4XZ4 A;  1HZ4 A;  4A1S A;  4JW1 A;  2M63 A;  4GMJ A;  3UT4 A;  3ZXS A;  3U3W A;  3FU5 A;  2PM7 A;  2YNQ A;  3TG5 A;  1X5B A;  3FTW A;  3R7R A;  1H19 A;  3FH8 A;  2I2O A;  1N52 A;  2X6I A;  2BF0 X;  1Z3Y A;  4NAC A;  2KCL A;  3PE3 A;  4J6I A;  4HOU A;  3PS6 A;  1H0A A;  2MRI A;  1BPO A;  2AXV A;  3JQ0 A;  4Q96 A;  3FH5 A;  3L08 A;  2KM4 A;  1OWM A;  4GA2 A;  2I1K A;  3RK6 A;  1OWN A;  2KCV A;  3T8M A;  3T5V A;  2WQ7 A;  1H6K A;  3FFL A;  3FUN A;  3P1U A;  1MQS A;  3RIB A;  3AU5 A;  4AVX A;  1UN8 A;  4N3B A;  1FVH A;  2UY1 B;  1ZU2 A;  2WVI A;  4YVQ C;  3SI5 A;  3BG1 B;  3FUI A;  4XKC A;  2GGF A;  3FU6 A;  4ACL A;  2IFU A;  5AEN A;  4F3V A;  3UPV A;  3CVN A;  3MV3 B;  3SBS A;  5BV1 A;  1NA3 A;  4UWK A;  3S7F A;  4N2S A;  1FCH A;  3Q49 B;  2A4Z A;  4Q94 A;  3LXU X;  2C2L A;  5G2N A;  5AYW D;  4J8D A;  2L6J A;  3QKY A;  2LO6 A;  2LAH A;  4DPR A;  4LEU A;  3CK7 A;  2L9B A;  3FDH A;  4G11 A;  3SNX A;  5ANL A;  3RO2 A;  4GZD A;  3IBE A;  3G2W A;  4FAD A;  3MKR A;  1H2U A;  4GCO A;  3O4Z A;  3PUK A;  3QWW A;  4APO A;  4Y6W A;  3D9O A;  4HOR A;  3FUL A;  1HFA A;  3PE4 A;  3CHR A;  1XNF A;  3RRM B;  3ZEF A;  1HG5 A;  3RU0 A;  4KT6 B;  2IOL A;  4NUR A;  4WND A;  1KT0 A;  2AXZ A;  3LVR E;  3OXL A;  3FEY A;  2XQ0 A;  2Y4T A;  3Q4A B;  3NQP A;  3APD A;  3ZYL A;  1XGW A;  1OWO A;  3B7S A;  3UX4 A;  3HHM A;  1Y8M A;  4TUU A;  5EX3 A;  3LDZ A;  4Y6C A;  4AEZ C;  4APF A;  4D10 C;  4UQY A;  3FUM A;  4ANV A;  1UJK A;  5FWQ A;  1HU3 A;  3NF1 A;  4FUL A;  4J8F A;  5LOZ A;  5LCW C;  5KCM A;  2X6H A;  4EZK A;  3FP3 A;  4RG9 A;  2VSX E;  2WXI A;  4C0E A;  3LYA A;  4I9E A;  2IQC A;  3D9N A;  4N39 A;  3B7U X;  3CVL A;  2I1J A;  3OXG A;  1WY6 A;  4ILH B;  3FTZ A;  3UT7 A;  3HDX A;  2YHE A;  4EEC A;  1UG3 A;  2WXH A;  5FJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...