2LAIA

Hyaloperonospora arabidopsidis effector protein atr13
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
101
structure length
101
Chain Sequence
SFGLGKAQDPLDKFFSKIIFSGKPIETSYSAKGIHEKIIEAHDLHVSKSKNAPIQYASVMEYLKKTYPGPDIERIVSTLERHDEVGAKDLGAKLRDALDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avirulence protein ATR13
publication title Structural Elucidation and Functional Characterization of the Hyaloperonospora arabidopsidis Effector Protein ATR13.
pubmed doi rcsb
source organism Hyaloperonospora parasitica
molecule tags Signaling protein
total genus 8
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16829 ATR13 Avirulence protein ATR13, RxLR effector
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.640 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2laiA00
2LAIA
chains in the Genus database with same CATH superfamily
2X3MA 3MZLB 3CVPA 4LNBA 4BERA 3Q9UC 4ANUA 3NQPA 3OXFA 4HRNA 3PUJA 1WY6A 2OVBA 5CCMA 4UUCA 3R7QA 3KSQA 3ML9A 3N71A 4U0ZA 4DPRA 4HOSA 4L9PA 2GGFA 3VTXA 2B0OE 3FUKA 3O4ZA 2V5FA 4ILHB 4CDMA 4GMRA 4NIKA 3L17A 1UJKA 4LSZE 4N39A 5FZRA 3SD5A 1FVFA 4AOFA 4U0UA 4K0RA 3KAEA 4F1PA 4A1SA 3CSTA 4BFRA 3QKYA 1G3NB 4TRQA 3WG7E 2RG8A 4RG6A 5LFAA 4ABNA 4CZ2D 2DYSE 2M63A 5ENNA 3PUKA 3EHMA 5BV1A 5CERB 2LSVA 4J8DA 4Q69A 5CECB 3ABLE 3D9IA 2XCCA 3ZXSA 4I1AA 2R05A 4E6HA 4HRLA 2KXPC 4RLYA 4XX5A 4DLOA 2Y1LE 2F0YA 3OXLA 2Y3AA 2LXMA 2J08A 4B8CB 1Z3XA 4G24A 5T3RA 1IKND 1E7UA 4FP7A 1N4QA 3NZSA 2LNIA 4C0EA 1E8ZA 1KT1A 2R5SA 4WNEA 4GTVA 5EKQD 5HKPA 1KZPA 4N3AA 2C2LA 4AP2A 4AXHA 3B7TA 5ENQD 2F8XK 3EU5A 3FUHA 5D0QD 1X5BA 2WPVA 3DPDA 3QWPA 2XGMA 3Q47B 2XEHA 4XKBA 3FUJA 3EIJA 3FTZA 5B3SE 4GZ6A 3SI5A 4PS8A 3LJ3A 2GROB 3S7DA 3KEZA 3BQOA 4WWPA 1D8EA 4HRMB 5BXUA 3TAXA 5ENRD 3HXCA 1FPPA 3QOUA 5EYLA 4GMLA 2MRIA 3IEGA 4IRUA 3CQGB 4HORA 3CEQA 3FU0A 5T4YA 2P9LG 4PH4B 4FHJA 2GRPB 2XEEA 2X6HA 4B89A 2QFCA 2XEVA 3S2AA 1DVPA 3DWLG 3LVQE 1TJCA 2AXVA 2WXIA 5FIOA 4N2QA 2RFAA 3V2XA 3TGOA 5JA4D 1E8XA 4JL0A 4JD2G 3IHVA 3AJIA 2CHXA 3D3MA 2FBNA 3ESLA 1A17A 4L7TA 3DBSA 2PM6A 3SY2A 2ETCA 1H2UA 4TXPA 3B95A 4DRXE 1BU9A 2V4LA 3PZ3A 3UIPC 1EYHA 3U9WA 4N3CA 2FO1E 3E4BA 3C3QA 3AU4A 1DNPA 2PM7A 3D9NA 4CGVA 3LEWA 3FUIA 5ENSD 2KCLA 1Q2ZA 3MV2B 1U2VG 3ZYKA 3CVQA 5CEDB 1E90A 3D9LA 2P9KG 4GTOA 2BUGA 4CGWA 1BLXB 1XGWA 5JJTA 2AJAA 5FZQA 2QY7A 5BPPA 4FHKA 4ANVA 3APDA 4HB5A 2R59A 2CHWA 3E33A 4YDEA 4ZFHA 4U96D 4I2ZA 3LCAA 3FH8A 4GTSA 2DZNA 2EIJE 3HIZA 1WM5A 1N9AA 2FF4A 4I9CA 2VYIA 1TNUA 2I1KA 5HQ8A 2EIKE 4FADA 2XCBA 4GZ5A 3ZHEB 1LD8A 4ACKA 4JHJA 1TNBA 1JCRA 3RO2A 1N94A 1OCRE 1HE8A 2ZU6B 3L13A 3NZUA 2RFMA 5CHEE 2A4ZA 3UTMA 3CLJA 1EPUA 3TL5A 1MHQA 1N4PA 3WXXA 4F3VA 2IOSA 2DZOA 5KJLA 1OWMA 3I5PA 4X8QA 2WXPA 1LF8A 4NQ0A 3CHMA 2KBXA 3EHQA 3R9MA 4J8EA 4APOA 3ML8A 2WXLA 3C98A 3VLDA 2ETAA 4GB9A 3S7BA 1E8WA 4BX8A 4J6IA 2LAHA 2XPYA 3CKBA 2F8YA 1MZCA 3FFLA 2QYUA 3LPZA 2WVIA 2KATA 2MYOA 4JA7A 4WWOA 5EX0A 3FEXA 4F7AA 4GCOA 4K03A 1SVXA 1N4SA 4U04A 4DX6D 2L6BA 3CV0A 3E32A 2LXLA 5LX8A 2WXGA 4YDOA 5AJDA 1D9SA 3PNTB 1OCZE 3FTSA 4JZYA 4LNGA 3FEYA 3DRAA 5JMND 4J8FA 1V54E 2WMNA 2OVFA 3D9HA 3G2UA 1IQRA 3V79K 4JHRA 3ASDA 4Q94A 1QNFA 3FUMA 3JCKC 5C1DA 2YHEA 3ASFA 3DEOA 3V31A 3P2BA 4KYOB 4JB8P 4DX1A 1HU3A 5FQ6A 4LCTA 1FCHA 3MGBA 4UWFA 4HQDA 3ZRHA 1K1AA 1TNYA 4FULA 5BW8C 2P9NG 1TNZA 3AG2E 2FO7A 4BTBA 3UINC 4A55A 4LUNU 3DSVA 4WUYA 3B13A 4KMOA 4LNUD 4TUUA 5CMYA 4WNDA 4OAVB 3G2WA 2IY0C 3W9FA 4GYYA 3FWVA 4WNGA 4R7LA 3TWVA 1E96B 2BKGA 1SA4A 3ABKE 1TN8A 1Y8MA 4Q96A 3TWUA 3UM2A 2QZAA 1P5QA 5JHBA 4UWLA 2X6KA 1OCOE 2ZGGA 4DI3A 3AG1E 4C48B 4C9BB 4HXIA 4BWRA 3ASOE 3CK8A 3G2VA 5G04C 4WWNA 4I1MA 5AQ9A 3MEKA 4U63A 2NSZA 1OWLA 1MX6A 4JEHA 2XGOA 3D9OA 4AVXA 4XI0A 3FP3A 3FUFA 2GRMA 4DUIA 3B7BA 3DXMG 3B7UX 4JPSA 2JEKA 3ZEFA 5EIDA 3I3NA 1HH8A 1SQMA 3ZPJA 2KCVA 4BTAA 4IN3B 4J8SA 1IHGA 5BUZA 1OUVA 3MKQB 3HHMA 4FJZA 1Y6IA 2C0MA 3LYAA 1E8YA 2ONDA 3NB2A 2PQRA 2XHEA 3MKRA 5AARA 1YCSB 4J0UA 1JWFA 2J09A 3APFA 1S0PA 3MX3A 2H6GA 3URZA 4L23A 5B1AE 2UY1B 2EIME 5G2NA 4UQYA 3U66A 3AG4E 1HO8A 1DC2A 3Q7AA 3ZXPA 5LP0A 2OV8A 1NA3A 3PDNA 2NYJA 3UKRG 5AYWD 2YQ8A 4J8YA 2FEZA 2J4BA 4CDNA 3LY9A 5FWQA 1L5JA 3FULA 2DVWA 1E7VA 5JHAA 4UWKA 3ZNGA 5CRVA 3L16A 2V8SE 3JUEA 3U4TA 4I6GA 1NFIE 2P2CP 1S70B 4YVOA 2NC9A 1XNFA 1LD7A 5G55A 5FQ4A 1JCQA 3UT4A 5FINA 3K9IA 1JWGA 5AQAA 4EECA 2Y4TA 2I2OA 2IO3C 2XPZA 3CHOA 4K5AB 3CK9A 4XIFA 2XRYA 2WB2A 2MHKA 3JQ1A 3RRUA 3ABME 3D9KA 3MYVA 4F53A 2WXNA 4EBAA 1MX2A 2FI7A 3D9PA 2L0TB 2E0IA 2JLBA 4HS2A 3MJWA 3BEEA 4PS3A 4GTRA 4XZ4A 1ZBPA 3KSLA 3AS8A 2GW1A 1N0RA 2R02A 4I2WA 2WXJA 2F37A 3TWSA 4DX5D 4HLLA 4QFVA 3JYSA 4WAFA 3TWRA 4KXKB 1WDYA 2HM8A 3V2OA 3HG0D 2XZDG 1ELWA 2WXMA 5ITZF 2P9SG 3RIBA 2Y69E 5HRYA 1TN7A 2A5UA 1OY3D 3G2TA 2BF0X 1JCSA 4MS6A 3P1UA 2AVPA 3FU6A 2VTBA 2ZXWE 5KNHD 5AQBA 2CG3A 5LCWC 4JHKA 2KC7A 2V0PA 2VQ2A 1H6OA 2HYZA 1V55E 3HXEA 1PAQA 3UM3A 5B1BE 3QC1A 3TG5A 3ZYQA 1O1TA 2IJGX 3C72A 3Q79A 5E75A 3RU0A 2A5EA 5AQ7A 5EDSA 3RK6A 2FULA 2IONA 3SNXA 2WM9A 1GW6A 4N5CA 3PE4A 2CHZA 1FT1A 3APCA 4U8HA 4A63B 4LRZA 4ME2A 4CT0A 3KD7A 4UI9C 4AM9A 3Q9NC 1TJFA 3EU9A 1O1RA 3QJZA 3PZ2A 1KT0A 3CVLA 4UI9K 3TJPA 1YA0A 4N2SA 5KJKA 4DX7D 5ENTD 4P29A 1KZOA 3VLFA 3ULQA 3FTXA 3DSTA 4TUMA 2WXOA 5G05C 4M7CA 3TG4A 4LG6A 1BI7B 3Q5MA 1BI8B 2R17C 3Q15A 1ZU2A 1AP7A 4BT8A 1HG5A 3FUNA 4D10C 5AN8A 3LDZA 4GTQA 4GZCA 1K1BA 1YYHA 3AS4A 3CIAA 5KBAA 3T5XA 3S7FA 2CFUA 1WAO1 4O6FA 5D66A 3SBSA 1ELRA 3UT8A 4EQFA 3UKUG 2PQNA 1K3ZD 3CHSA 2XS8A 5A23A 4AY6A 3L9TA 3UXGA 3PEVB 1H19A 4GA1A 5FTPA 1N52A 4HFGA 4BESA 4GTTA 5J08A 4HLEA 4J7WA 5ARGA 4GTPA 4FU3A 5FQ8A 4FJYA 3ZKJA 2VGXA 5CBOA 4GAAA 1UOHA 3Q73A 4RSYA 3D9JA 2JABA 1S63A 5JJ6A 2EQXA 2V4HC 3F6QA 3L6AA 1KPSB 3CVYA 4U0SA 2J4DA 1DCQA 1IQUA 1BD8A 4PUCA 5IY5E 3L08A 2BKKB 2LUHA 1TNOA 4H7YA 4G8LA 4NURA 4UWGA 2EINE 2LO6A 4UQZA 2WQHA 3V30A 4JA9A 1WG0A 2XZTG 4IULA 1HFAA 2OCCE 3UIOC 5CEAA 3JXJA 3PREA 1PC2A 1N95A 2DYRE 2BEDA 1U3DA 5JJ7A 3DSSA 3MKQA 1OWOA 5CBNA 4PDXA 5G04J 5H7PA 3Q4AB 1B89A 3IBEA 2ZISA 4L2LA 4GZ3A 3NAWA 2J8SD 3OXGA 4A3VA 3NF1A 3UM0A 5AIJA 2J07A 2YNQA 4CT4A 2UY1A 3LY7A 4XI9A 2P9PG 2GRNB 5A7DB 3CVVA 5KWDA 3LVRE 2IEJA 2HE0A 3UM1A 3PZDA 4KVMA 1HX8A 4O1OA 2XGSA 3JQ0A 3L54A 3R7RA 2IU1A 4BETA 3CVXA 1UN9A 3CVWA 3GW4A 2QYJA 2PL2A 2IOLA 4U8YD 3CVUA 5CCLA 3FDHA 4MKTA 3QWVA 1H2VC 5AENA 3C5RA 3CSFA 2R2LA 3CHQA 3B7SA 3SFYA 3QAQA 4EHMA 4BT9A 2I9CA 5HI7A 2CG2A 2WQ6A 5EIBE 4CDRA 4YDWA 3E30A 2MOWA 3U64A 4HOUA 3HYMB 3ULEG 3C3OA 1MX4A 2WQ7A 4CCAA 4E85A 3Q49B 2WXRA 2WMOA 4Y6WA 4NRHB 2YHCA 4O60A 3SHFA 3ASHA 4GMJA 3OTNA 2UWJG 3ISMC 4EZKA 4GYOA 4QQIA 4FA6A 4XEIG 1OT8A 2J9QA 3CKCA 4EZLA 3SFZA 1A5EA 4I6EA 3BG0B 2IO2C 5ANLA 4TV3A 4FLBA 3AG3E 4LERA 5EX3A 3PNLB 1UN8A 3E37A 5EN5D 3UT7A 3DXKG 4HBDA 4IYPA 3HXFA 4MRUA 4U7EB 3TWWA 4AIFA 1N4RA 3FY4A 4ANWA 1H6PA 3GZ2A 3IXEA 3AU5A 3KS2A 1Z6TA 1SA5A 2L6JA 5KJMA 3Q7FA 2DBAA 3NOGD 3FTYA 2VSYA 3VLEA 3NBNB 4KT6B 2AXZA 3AS5A 4AV7A 1Z3YA 2RKKA 1RW2A 3IV0A 3LY8A 5EYPF 1EF1C 1O1SA 3O48A 3IHYA 4N3BA 1MYOA 4U8VD 4GYWA 3RJVA 1EDUA 2WXKA 3EIQC 1U3CA 2NXPA 3FUDA 3R9AB 3TWTA 3VTYA 2X6FA 4KZCA 2ZGDA 5LCWJ 4OVVA 2X6IA 4G26A 3ZU7B 2ZIRA 3QDNA 1HF8A 1TR4A 5FZSA 3UMVA 2GRRB 1IYGA 4CRWA 5BV0A 4HVBA 1OWNA 5AJLA 3FU3A 4NACA 4ZHBA 5D2MC 3NOCD 4JEUA 1TYQG 2X6JA 3EJNA 3L22A 1X81A 2P58C 3MA5A 2HR2A 3X2QE 3HXBA 5EILA 4O1PA 4DLQA 1VDYA 3FH5A 3PRZA 3CHRA 4DJAA 4OAUC 1W3BA 3HDXA 5ENOD 4OVUA 3LJNA 1LTXA 1IHBA 5HS0A 4UI9J 4G2VA 4GTMA 2DCPA 5FQ7A 5D0OD 4GA2A 1SZAA 3FTWA 3ZHEA 3GZSA 3HRAA 2H6FA 2GRLA 1HXIA 5G05J 3BUAA 3T8KA 1O5MA 5T8IA 1QYMA 4H7XA 4LEUA 2IF4A 1HS6A 2GRQB 4BSZB 2KZTB 3FTUA 2AWIA 4M3OA 3AAAC 3EUVA 3SFXA 3ZYLA 1YMPA 3HVEB 4N5QA 4U95D 5KNGA 1N0QA 2L0IA 4BSXA 3QK0A 1OXJA 2Q7FA 4APFA 3EHRA 3FH7A 2PNNA 1JUQA 3JXIA 1SW6A 4DI4A 3ESKA 5ARFA 1QBQA 2LAIA 4K5CA 3UUXA 2IQCA 3B7RL 3SO8A 2OEVA 3ONKA 3ZN3A 2I1JA 3W9GA 3PEUB 4L1BA 4YDYA 3PVLA 1ZB1A 4GPKA 4URKA 3SF4A 5A6CA 4DK5A 3L82A 2VGEA 5BXOA 2L9BA 3ASGA 1FVHA 3CK7A 1TN6A 3S7JA 1OCCE 4EPZA 4HI8A 3JUIA 2Y0BG 5FT9A 2DWZA 4CEMA 4W9RA 2B6CA 2I6HA 5M72A 1UW4B 3DPYA 1SZ9A 4ILGA 3ZGQA 1IXVA 3UPVA 4RG9A 4G8KA 5DIZA 2XENA 4GZDA 3PZ4A 4BX9A 2XPIA 2WXQA 1DCEA 3QNKA 4AJWA 5KCMA 3PE3A 2J49A 4GA0A 3OAWA 3UI2A 3LKUA 1OWPA 4KVOA 2XRZA 3FTVA 3QARA 4G25A 4EZJA 2P9IG 4KBQA 2KM4A 3EDTB 4ATZD 2KCKA 3FHEA 2WXHA 3RAUA 3ULYA 3KEAA 2PZIA 5J90A 4XE0A 2E2EA 4JC8A 3BG1B 4YNDA 1TEZA 4B8AA 4CYMD 4RVBA 4V3IA 3Q78A 1Z5SC 4Y6CA 4G11A 4HI9A 3DSXA 3PH0C 2IFUA 4MBGA 4PS7A 3SGHA 5BT1A 2AW6A 2OOEA 3U3WA 5CRUA 2CFZA 4GU5A 3ENEA 1UG3A 2H6IA 3DSWA 3SBTB 1N54A 4OYSA 2ILRA 3CHPA 4UQXA 2Y4UA 5FJYA 1NI1A 3MV3B 4ATGA 3ZFWA 2H6HA 2RD0A 2HO1A 4I17A 3SQVA 5KJNA 2XS1A 1D8DA 3RSEG 4HOTA 2X38A 5C2YA 3CQCB 4BY6A 2ETBA 2VTBB 3RKVA 1MQSA 5CMWA 4HNAD 4FC8A 3T8MA 4BEPA 4ANXA 3LS8A 2VSOE 3E34A 5LOZA 4Z68A 1PY1A 4K5BA 3ZUVB 2VGYA 2AXUA 3GZ1A 2QC9A 5ANRA 4I43A 3UQ3A 1HG2A 2OEWA 3LXUX 3FU5A 3HXDA 3C3RA 3ASNE 3ZIMA 4A3TA 4F1SA 3SZ7A 3RO3A 1NL4A 1H2TC 3UX4A 1INZA 1RZ4A 1NP7A 3ZYMA 3J5PA 3TXNA 2P9UG 4I1OB 2R03A 1S64A 4MLPA 1AWCB 1JPLA 3Q75A 3FUEA 3I4GA 4AY5A 3J5QB 1K8KG 1NZNA 4F6RD 4ACLA 1NA0A 3CR3A 3DSUA 3GYZA 3ONLA 3PS6A 2LSUA 4XKCA 4B0ZA 4I9EA 4C0MA 1N11A 3G2SA 1QQEA 3IKOB 4JW1A 3T5VA 5AAOA 3PZ1A 2EILE 4TXRA 4YVQC 3RRNB 4GPMA 1H6KA 4ILIA 3TWXA 3ZW3A 1BPOA 4HOQA 2VSNA 2V5QC 1HZ4A 4KZ0A 4DX2A 4U07A 2XQ0A 1QZ2A 4FLHA 4GCNA 3D9MA 3QB2A 5DBKA 5ENPD 4TXQA 2VSXE 4RQIA 4B93B 1ELKA 3TWQA 3BU8A 4UWHA 4EBAG 1MJ0A 2C0LA 4B94A 3CVNA 4G1TA 3CGHA 4WNFA 1KLXA 4AEZC 3T9KA 1H0AA 2VJ8A 4L2YA 4JXTA 4JVSA 3MCXA 5E76A 2BTDA 2WXFA 1UJJA 5BNWA 4I6JA 3EHNA 3DEPA 1FT2A 2DIWA 2KZTA 2VGXB 4A1GA 3I4RB 4G23A 3TXMA 2YINA 3ZVVA 3RRMB 3HVEA 3QWWA
chains in the Genus database with same CATH topology
2X3MA 3FFLA 3MZLB 3LPZA 2WVIA 3QJZA 4UI9J 3CVPA 4G2VA 2KATA 1KT0A 2DCPA 3CVLA 5FQ7A 4UI9K 5D0OD 4JA7A 4ANUA 4WWOA 3TJPA 3NQPA 1YA0A 4N2SA 4GA2A 3OXFA 5KJKA 5EX0A 4P29A 3FEXA 3VLFA 3PUJA 1WY6A 3ULQA 2OVBA 3FTXA 4GCOA 4F7AA 2WXOA 4K03A 5G05C 1SZAA 3TG4A 5CCMA 3FTWA 4U04A 3R7QA 3Q5MA 3CV0A 3ML9A 3N71A 3GZSA 4U0ZA 2R17C 3ZHEA 3Q15A 4DPRA 5LX8A 4HOSA 1ZU2A 2WXGA 2GRLA 1HXIA 5AJDA 2GGFA 5G05J 4BT8A 1HG5A 3VTXA 5T8IA 3FUNA 4D10C 3PNTB 3LDZA 4H7XA 4LEUA 3FUKA 3FTSA 4GZCA 4JZYA 2IF4A 3O4ZA 3AS4A 1HS6A 2V5FA 3CIAA 3FEYA 4ILHB 2KZTB 3FTUA 3T5XA 4CDMA 4J8FA 3S7FA 2CFUA 2AWIA 1WAO1 4M3OA 2WMNA 2OVFA 3G2UA 3ZYLA 1IQRA 4O6FA 4JHRA 3ASDA 3HVEB 4Q94A 1QNFA 3FUMA 3L17A 3SBSA 1ELRA 1UJKA 3UT8A 4EQFA 3JCKC 5C1DA 4N39A 5FZRA 3SD5A 1FVFA 4AOFA 2L0IA 2YHEA 4BSXA 3ASFA 2PQNA 3QK0A 3CHSA 2Q7FA 4U0UA 4K0RA 5A23A 4AY6A 3P2BA 4KYOB 4APFA 3KAEA 3FH7A 3PEVB 1JUQA 4A1SA 3CSTA 1H19A 1HU3A 5FQ6A 4BFRA 4GA1A 4DI4A 3QKYA 4LCTA 3ESKA 4TRQA 5ARFA 1FCHA 5FTPA 1N52A 4HFGA 2LAIA 3MGBA 5J08A 2RG8A 4HLEA 4RG6A 4UWFA 5ARGA 3UUXA 2IQCA 3B7RL 4FU3A 5FQ8A 3ZRHA 5LFAA 4FULA 4ABNA 4FJYA 3ONKA 5BW8C 3ZN3A 2I1JA 2VGXA 3PEUB 2M63A 4L1BA 4GAAA 2FO7A 3PVLA 5ENNA 4GPKA 3PUKA 4BTBA 4A55A 4URKA 3SF4A 4RSYA 3D9JA 4DK5A 3EHMA 5BV1A 5A6CA 4LUNU 5JJ6A 2EQXA 4WUYA 2LSVA 4J8DA 4Q69A 3L6AA 3D9IA 2XCCA 3ZXSA 2L9BA 3CVYA 4I1AA 4E6HA 3ASGA 3B13A 1FVHA 3CK7A 4U0SA 4KMOA 2J4DA 4TUUA 5CMYA 1IQUA 3S7JA 4WNDA 3G2WA 4EPZA 4GYYA 4PUCA 3FWVA 3JUIA 4XX5A 4DLOA 3L08A 4WNGA 4R7LA 5FT9A 1E96B 1Y8MA 4CEMA 4Q96A 4H7YA 1P5QA 3OXLA 2Y3AA 4NURA 5JHBA 4UWGA 4UWLA 2X6KA 4DI3A 2LO6A 4UQZA 2J08A 2WQHA 4C9BB 4JA9A 4B8CB 1Z3XA 4HXIA 4G24A 4IULA 4W9RA 5T3RA 1HFAA 2I6HA 4BWRA 3PREA 1PC2A 1UW4B 5M72A 3CK8A 1E7UA 3G2VA 4FP7A 1SZ9A 4ILGA 5G04C 3ZGQA 1U3DA 4WWNA 4I1MA 3NZSA 5JJ7A 3UPVA 2LNIA 3MKQA 4RG9A 4C0EA 3MEKA 1OWOA 4U63A 1E8ZA 2NSZA 5DIZA 1KT1A 1OWLA 2R5SA 4JEHA 4WNEA 2XGOA 4PDXA 3D9OA 4GZDA 5G04J 5EKQD 3Q4AB 4AVXA 4BX9A 4XI0A 3FP3A 4N3AA 1B89A 2C2LA 2XPIA 3IBEA 4AP2A 2WXQA 3FUFA 4L2LA 4AXHA 2GRMA 3B7TA 3QNKA 4AJWA 4GZ3A 3FUHA 5KCMA 3B7UX 4JPSA 3PE3A 2J49A 4GA0A 5D0QD 1X5BA 3OAWA 4A3VA 2WPVA 3DPDA 3NF1A 2JEKA 3OXGA 3QWPA 3LKUA 3ZEFA 5AIJA 2J07A 2XGMA 2YNQA 1OWPA 3I3NA 3Q47B 4CT4A 2UY1A 4KVOA 3LY7A 1HH8A 4XI9A 1SQMA 2XRZA 3FTVA 3QARA 4G25A 3ZPJA 4XKBA 3FUJA 4EZJA 2KCVA 4BTAA 3EIJA 4IN3B 4J8SA 5A7DB 3CVVA 1IHGA 4KBQA 3FTZA 2KM4A 3LVRE 3EDTB 5BUZA 2KCKA 1OUVA 3FHEA 4GZ6A 2WXHA 3SI5A 3PZDA 3MKQB 4KVMA 4PS8A 3LJ3A 1HX8A 3S7DA 3HHMA 4FJZA 3KEZA 1Y6IA 2XGSA 4WWPA 3TAXA 3JQ0A 2PZIA 3L54A 3R7RA 5J90A 2IU1A 2C0MA 4XE0A 3CVXA 1UN9A 2E2EA 4JC8A 3LYAA 3BG1B 3QOUA 4YNDA 1E8YA 2ONDA 1TEZA 2PQRA 3CVWA 2XHEA 3MKRA 4B8AA 4J0UA 1JWFA 4GMLA 2J09A 3GW4A 4RVBA 3APFA 4V3IA 2MRIA 2PL2A 1S0PA 2IOLA 3IEGA 4IRUA 3CQGB 3MX3A 3URZA 4HORA 3CEQA 3CVUA 4Y6CA 5CCLA 4G11A 4L23A 3FDHA 4MKTA 3FU0A 3PH0C 3QWVA 1H2VC 2IFUA 2UY1B 5T4YA 5AENA 5G2NA 4UQYA 3U66A 3CSFA 1HO8A 4PH4B 4PS7A 3SGHA 4FHJA 5BT1A 3CHQA 5LP0A 2OV8A 2AW6A 1NA3A 2OOEA 2X6HA 3PDNA 3U3WA 4B89A 3B7SA 5AYWD 3QAQA 2QFCA 2CFZA 4GU5A 2YQ8A 2FEZA 2J4BA 2XEVA 3ENEA 1UG3A 4CDNA 3SBTB 1N54A 1DVPA 3LY9A 5FWQA 3S2AA 4OYSA 2ILRA 4BT9A 2I9CA 5HI7A 2CG2A 1L5JA 3FULA 2WQ6A 3LVQE 4CDRA 3CHPA 1TJCA 1E7VA 2AXVA 2MOWA 5JHAA 4UQXA 3U64A 2WXIA 4HOUA 2Y4UA 5FJYA 4UWKA 3HYMB 4N2QA 3MV3B 3L16A 4ATGA 3ZFWA 2WQ7A 2V8SE 2RD0A 4CCAA 3TGOA 2HO1A 4E85A 3Q49B 2WXRA 2WMOA 1E8XA 4I17A 3U4TA 4I6GA 4JL0A 5KJNA 3IHVA 3D3MA 2CHXA 4Y6WA 4YVOA 2NC9A 4HOTA 2FBNA 2YHCA 2X38A 4NRHB 3ESLA 5C2YA 1XNFA 1A17A 5G55A 4L7TA 3SHFA 3ASHA 5FQ4A 3CQCB 3OTNA 4GMJA 4BY6A 2VTBB 2UWJG 3DBSA 1MQSA 3RKVA 4EZKA 5CMWA 4GYOA 3UT4A 4FC8A 2PM6A 4EECA 3K9IA 1JWGA 3T8MA 4ANXA 2Y4TA 2I2OA 4FA6A 3LS8A 1H2UA 2XPZA 3CHOA 3CK9A 4XIFA 2J9QA 2VSOE 2XRYA 3CKCA 5LOZA 2WB2A 2MHKA 4EZLA 3SFZA 3JQ1A 2V4LA 4I6EA 3RRUA 1PY1A 3BG0B 3D9KA 5ANLA 4TV3A 1EYHA 3U9WA 4FLBA 3MYVA 4N3CA 3E4BA 4F53A 2WXNA 4LERA 4EBAA 3AU4A 2VGYA 2AXUA 3GZ1A 5EX3A 5ANRA 3PNLB 4I43A 2FI7A 3UQ3A 3D9PA 1HG2A 1DNPA 2PM7A 1UN8A 3D9NA 2L0TB 2E0IA 4CGVA 2JLBA 3LXUX 3LEWA 4HS2A 3FUIA 3UT7A 3FU5A 3MJWA 3BEEA 4PS3A 4XZ4A 2KCLA 3ZIMA 3MV2B 1ZBPA 4IYPA 3ZYKA 4A3TA 4F1SA 3CVQA 3RO3A 3SZ7A 3AS8A 2GW1A 1E90A 1H2TC 4MRUA 3UX4A 4I2WA 4AIFA 3D9LA 1INZA 3FY4A 4ANWA 2WXJA 1NP7A 3GZ2A 2BUGA 3ZYMA 3TXNA 4QFVA 4I1OB 3JYSA 4CGWA 3AU5A 4MLPA 4WAFA 4KXKB 1XGWA 2HM8A 1JPLA 3KS2A 1Z6TA 5JJTA 5FZQA 2QY7A 3FUEA 5BPPA 1ELWA 2WXMA 3I4GA 2L6JA 4FHKA 3APDA 4ANVA 4AY5A 5KJMA 3RIBA 2R59A 1NZNA 2DBAA 2A5UA 2CHWA 4I2ZA 4ACLA 1NA0A 3CR3A 3LCAA 3FTYA 2VSYA 3FH8A 3G2TA 3VLEA 2BF0X 3GYZA 3ONLA 3PS6A 4KT6B 2AXZA 2LSUA 4XKCA 3AS5A 4B0ZA 4AV7A 1Z3YA 4I9EA 4C0MA 3IV0A 3LY8A 3HIZA 3G2SA 1WM5A 2FF4A 1EF1C 4I9CA 1QQEA 2VYIA 3IKOB 4JW1A 3O48A 3T5VA 3IHYA 4MS6A 3P1UA 2AVPA 3FU6A 4N3BA 2VTBA 5HQ8A 2I1KA 4GYWA 3RJVA 4FADA 2XCBA 1EDUA 2WXKA 2CG3A 5LCWC 4GZ5A 3EIQC 4YVQC 3ZHEB 4ACKA 1U3CA 3RRNB 1H6KA 2NXPA 3FUDA 4ILIA 3R9AB 4JHJA 3VTYA 1BPOA 2X6FA 4HOQA 4JHKA 3ZW3A 4KZCA 2KC7A 2V0PA 2VQ2A 5LCWJ 4OVVA 2X6IA 2VSNA 4G26A 2HYZA 3RO2A 1PAQA 1HE8A 2ZU6B 3L13A 3QDNA 1HZ4A 4KZ0A 1HF8A 3NZUA 4U07A 2XQ0A 1QZ2A 4FLHA 5CHEE 2A4ZA 5FZSA 3UMVA 3QC1A 4GCNA 3D9MA 1IYGA 4CRWA 3TG5A 5BV0A 4HVBA 3QB2A 5DBKA 3ZYQA 1OWNA 3CLJA 2IJGX 5AJLA 1EPUA 3FU3A 3TL5A 1MHQA 2VSXE 4NACA 1ELKA 3WXXA 4F3VA 4JEUA 4UWHA 2IOSA 2X6JA 3EJNA 3L22A 5E75A 3RU0A 4EBAG 2C0LA 2P58C 5KJLA 4B94A 1OWMA 3I5PA 3MA5A 5EDSA 2WXPA 2HR2A 3RK6A 3CVNA 2FULA 2IONA 4G1TA 3CGHA 3SNXA 4WNFA 1KLXA 4AEZC 1LF8A 4NQ0A 2WM9A 1GW6A 1H0AA 2VJ8A 4L2YA 4JXTA 4DLQA 1VDYA 3FH5A 3PRZA 3CHRA 4N5CA 3PE4A 2CHZA 4JVSA 3MCXA 5E76A 2BTDA 2WXFA 3CHMA 1UJJA 3APCA 5BNWA 4I6JA 4U8HA 4J8EA 4APOA 3EHNA 4DJAA 4LRZA 4ME2A 3ML8A 2WXLA 4CT0A 3C98A 2DIWA 2KZTA 2VGXB 3VLDA 4A1GA 3KD7A 1W3BA 4GB9A 3I4RB 4G23A 3TXMA 2YINA 3HDXA 4UI9C 1E8WA 3S7BA 4BX8A 4OVUA 4J6IA 3ZVVA 3RRMB 2LAHA 2XPYA 3HVEA 3CKBA 4AM9A 3QWWA 1TJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAI A; 
#chains in the Genus database with same CATH topology
 2X3M A;  3MZL B;  3CVP A;  4LNB A;  4BER A;  3Q9U C;  4ANU A;  3NQP A;  3OXF A;  4HRN A;  3PUJ A;  1WY6 A;  2OVB A;  5CCM A;  4UUC A;  3R7Q A;  3KSQ A;  3ML9 A;  3N71 A;  4U0Z A;  4DPR A;  4HOS A;  4L9P A;  2GGF A;  3VTX A;  2B0O E;  3FUK A;  3O4Z A;  2V5F A;  4ILH B;  4CDM A;  4GMR A;  4NIK A;  3L17 A;  1UJK A;  4LSZ E;  4N39 A;  5FZR A;  3SD5 A;  1FVF A;  4AOF A;  4U0U A;  4K0R A;  3KAE A;  4F1P A;  4A1S A;  3CST A;  4BFR A;  3QKY A;  1G3N B;  4TRQ A;  3WG7 E;  2RG8 A;  4RG6 A;  5LFA A;  4ABN A;  4CZ2 D;  2DYS E;  2M63 A;  5ENN A;  3PUK A;  3EHM A;  5BV1 A;  5CER B;  2LSV A;  4J8D A;  4Q69 A;  5CEC B;  3ABL E;  3D9I A;  2XCC A;  3ZXS A;  4I1A A;  2R05 A;  4E6H A;  4HRL A;  2KXP C;  4RLY A;  4XX5 A;  4DLO A;  2Y1L E;  2F0Y A;  3OXL A;  2Y3A A;  2LXM A;  2J08 A;  4B8C B;  1Z3X A;  4G24 A;  5T3R A;  1IKN D;  1E7U A;  4FP7 A;  1N4Q A;  3NZS A;  2LNI A;  4C0E A;  1E8Z A;  1KT1 A;  2R5S A;  4WNE A;  4GTV A;  5EKQ D;  5HKP A;  1KZP A;  4N3A A;  2C2L A;  4AP2 A;  4AXH A;  3B7T A;  5ENQ D;  2F8X K;  3EU5 A;  3FUH A;  5D0Q D;  1X5B A;  2WPV A;  3DPD A;  3QWP A;  2XGM A;  3Q47 B;  2XEH A;  4XKB A;  3FUJ A;  3EIJ A;  3FTZ A;  5B3S E;  4GZ6 A;  3SI5 A;  4PS8 A;  3LJ3 A;  2GRO B;  3S7D A;  3KEZ A;  3BQO A;  4WWP A;  1D8E A;  4HRM B;  5BXU A;  3TAX A;  5ENR D;  3HXC A;  1FPP A;  3QOU A;  5EYL A;  4GML A;  2MRI A;  3IEG A;  4IRU A;  3CQG B;  4HOR A;  3CEQ A;  3FU0 A;  5T4Y A;  2P9L G;  4PH4 B;  4FHJ A;  2GRP B;  2XEE A;  2X6H A;  4B89 A;  2QFC A;  2XEV A;  3S2A A;  1DVP A;  3DWL G;  3LVQ E;  1TJC A;  2AXV A;  2WXI A;  5FIO A;  4N2Q A;  2RFA A;  3V2X A;  3TGO A;  5JA4 D;  1E8X A;  4JL0 A;  4JD2 G;  3IHV A;  3AJI A;  2CHX A;  3D3M A;  2FBN A;  3ESL A;  1A17 A;  4L7T A;  3DBS A;  2PM6 A;  3SY2 A;  2ETC A;  1H2U A;  4TXP A;  3B95 A;  4DRX E;  1BU9 A;  2V4L A;  3PZ3 A;  3UIP C;  1EYH A;  3U9W A;  4N3C A;  2FO1 E;  3E4B A;  3C3Q A;  3AU4 A;  1DNP A;  2PM7 A;  3D9N A;  4CGV A;  3LEW A;  3FUI A;  5ENS D;  2KCL A;  1Q2Z A;  3MV2 B;  1U2V G;  3ZYK A;  3CVQ A;  5CED B;  1E90 A;  3D9L A;  2P9K G;  4GTO A;  2BUG A;  4CGW A;  1BLX B;  1XGW A;  5JJT A;  2AJA A;  5FZQ A;  2QY7 A;  5BPP A;  4FHK A;  4ANV A;  3APD A;  4HB5 A;  2R59 A;  2CHW A;  3E33 A;  4YDE A;  4ZFH A;  4U96 D;  4I2Z A;  3LCA A;  3FH8 A;  4GTS A;  2DZN A;  2EIJ E;  3HIZ A;  1WM5 A;  1N9A A;  2FF4 A;  4I9C A;  2VYI A;  1TNU A;  2I1K A;  5HQ8 A;  2EIK E;  4FAD A;  2XCB A;  4GZ5 A;  3ZHE B;  1LD8 A;  4ACK A;  4JHJ A;  1TNB A;  1JCR A;  3RO2 A;  1N94 A;  1OCR E;  1HE8 A;  2ZU6 B;  3L13 A;  3NZU A;  2RFM A;  5CHE E;  2A4Z A;  3UTM A;  3CLJ A;  1EPU A;  3TL5 A;  1MHQ A;  1N4P A;  3WXX A;  4F3V A;  2IOS A;  2DZO A;  5KJL A;  1OWM A;  3I5P A;  4X8Q A;  2WXP A;  1LF8 A;  4NQ0 A;  3CHM A;  2KBX A;  3EHQ A;  3R9M A;  4J8E A;  4APO A;  3ML8 A;  2WXL A;  3C98 A;  3VLD A;  2ETA A;  4GB9 A;  3S7B A;  1E8W A;  4BX8 A;  4J6I A;  2LAH A;  2XPY A;  3CKB A;  2F8Y A;  1MZC A;  3FFL A;  2QYU A;  3LPZ A;  2WVI A;  2KAT A;  2MYO A;  4JA7 A;  4WWO A;  5EX0 A;  3FEX A;  4F7A A;  4GCO A;  4K03 A;  1SVX A;  1N4S A;  4U04 A;  4DX6 D;  2L6B A;  3CV0 A;  3E32 A;  2LXL A;  5LX8 A;  2WXG A;  4YDO A;  5AJD A;  1D9S A;  3PNT B;  1OCZ E;  3FTS A;  4JZY A;  4LNG A;  3FEY A;  3DRA A;  5JMN D;  4J8F A;  1V54 E;  2WMN A;  2OVF A;  3D9H A;  3G2U A;  1IQR A;  3V79 K;  4JHR A;  3ASD A;  4Q94 A;  1QNF A;  3FUM A;  3JCK C;  5C1D A;  2YHE A;  3ASF A;  3DEO A;  3V31 A;  3P2B A;  4KYO B;  4JB8 P;  4DX1 A;  1HU3 A;  5FQ6 A;  4LCT A;  1FCH A;  3MGB A;  4UWF A;  4HQD A;  3ZRH A;  1K1A A;  1TNY A;  4FUL A;  5BW8 C;  2P9N G;  1TNZ A;  3AG2 E;  2FO7 A;  4BTB A;  3UIN C;  4A55 A;  4LUN U;  3DSV A;  4WUY A;  3B13 A;  4KMO A;  4LNU D;  4TUU A;  5CMY A;  4WND A;  4OAV B;  3G2W A;  2IY0 C;  3W9F A;  4GYY A;  3FWV A;  4WNG A;  4R7L A;  3TWV A;  1E96 B;  2BKG A;  1SA4 A;  3ABK E;  1TN8 A;  1Y8M A;  4Q96 A;  3TWU A;  3UM2 A;  2QZA A;  1P5Q A;  5JHB A;  4UWL A;  2X6K A;  1OCO E;  2ZGG A;  4DI3 A;  3AG1 E;  4C48 B;  4C9B B;  4HXI A;  4BWR A;  3ASO E;  3CK8 A;  3G2V A;  5G04 C;  4WWN A;  4I1M A;  5AQ9 A;  3MEK A;  4U63 A;  2NSZ A;  1OWL A;  1MX6 A;  4JEH A;  2XGO A;  3D9O A;  4AVX A;  4XI0 A;  3FP3 A;  3FUF A;  2GRM A;  4DUI A;  3B7B A;  3DXM G;  3B7U X;  4JPS A;  2JEK A;  3ZEF A;  5EID A;  3I3N A;  1HH8 A;  1SQM A;  3ZPJ A;  2KCV A;  4BTA A;  4IN3 B;  4J8S A;  1IHG A;  5BUZ A;  1OUV A;  3MKQ B;  3HHM A;  4FJZ A;  1Y6I A;  2C0M A;  3LYA A;  1E8Y A;  2OND A;  3NB2 A;  2PQR A;  2XHE A;  3MKR A;  5AAR A;  1YCS B;  4J0U A;  1JWF A;  2J09 A;  3APF A;  1S0P A;  3MX3 A;  2H6G A;  3URZ A;  4L23 A;  5B1A E;  2UY1 B;  2EIM E;  5G2N A;  4UQY A;  3U66 A;  3AG4 E;  1HO8 A;  1DC2 A;  3Q7A A;  3ZXP A;  5LP0 A;  2OV8 A;  1NA3 A;  3PDN A;  2NYJ A;  3UKR G;  5AYW D;  2YQ8 A;  4J8Y A;  2FEZ A;  2J4B A;  4CDN A;  3LY9 A;  5FWQ A;  1L5J A;  3FUL A;  2DVW A;  1E7V A;  5JHA A;  4UWK A;  3ZNG A;  5CRV A;  3L16 A;  2V8S E;  3JUE A;  3U4T A;  4I6G A;  1NFI E;  2P2C P;  1S70 B;  4YVO A;  2NC9 A;  1XNF A;  1LD7 A;  5G55 A;  5FQ4 A;  1JCQ A;  3UT4 A;  5FIN A;  3K9I A;  1JWG A;  5AQA A;  4EEC A;  2Y4T A;  2I2O A;  2IO3 C;  2XPZ A;  3CHO A;  4K5A B;  3CK9 A;  4XIF A;  2XRY A;  2WB2 A;  2MHK A;  3JQ1 A;  3RRU A;  3ABM E;  3D9K A;  3MYV A;  4F53 A;  2WXN A;  4EBA A;  1MX2 A;  2FI7 A;  3D9P A;  2L0T B;  2E0I A;  2JLB A;  4HS2 A;  3MJW A;  3BEE A;  4PS3 A;  4GTR A;  4XZ4 A;  1ZBP A;  3KSL A;  3AS8 A;  2GW1 A;  1N0R A;  2R02 A;  4I2W A;  2WXJ A;  2F37 A;  3TWS A;  4DX5 D;  4HLL A;  4QFV A;  3JYS A;  4WAF A;  3TWR A;  4KXK B;  1WDY A;  2HM8 A;  3V2O A;  3HG0 D;  2XZD G;  1ELW A;  2WXM A;  5ITZ F;  2P9S G;  3RIB A;  2Y69 E;  5HRY A;  1TN7 A;  2A5U A;  1OY3 D;  3G2T A;  2BF0 X;  1JCS A;  4MS6 A;  3P1U A;  2AVP A;  3FU6 A;  2VTB A;  2ZXW E;  5KNH D;  5AQB A;  2CG3 A;  5LCW C;  4JHK A;  2KC7 A;  2V0P A;  2VQ2 A;  1H6O A;  2HYZ A;  1V55 E;  3HXE A;  1PAQ A;  3UM3 A;  5B1B E;  3QC1 A;  3TG5 A;  3ZYQ A;  1O1T A;  2IJG X;  3C72 A;  3Q79 A;  5E75 A;  3RU0 A;  2A5E A;  5AQ7 A;  5EDS A;  3RK6 A;  2FUL A;  2ION A;  3SNX A;  2WM9 A;  1GW6 A;  4N5C A;  3PE4 A;  2CHZ A;  1FT1 A;  3APC A;  4U8H A;  4A63 B;  4LRZ A;  4ME2 A;  4CT0 A;  3KD7 A;  4UI9 C;  4AM9 A;  3Q9N C;  1TJF A;  3EU9 A;  1O1R A;  3QJZ A;  3PZ2 A;  1KT0 A;  3CVL A;  4UI9 K;  3TJP A;  1YA0 A;  4N2S A;  5KJK A;  4DX7 D;  5ENT D;  4P29 A;  1KZO A;  3VLF A;  3ULQ A;  3FTX A;  3DST A;  4TUM A;  2WXO A;  5G05 C;  4M7C A;  3TG4 A;  4LG6 A;  1BI7 B;  3Q5M A;  1BI8 B;  2R17 C;  3Q15 A;  1ZU2 A;  1AP7 A;  4BT8 A;  1HG5 A;  3FUN A;  4D10 C;  5AN8 A;  3LDZ A;  4GTQ A;  4GZC A;  1K1B A;  1YYH A;  3AS4 A;  3CIA A;  5KBA A;  3T5X A;  3S7F A;  2CFU A;  1WAO 1;  4O6F A;  5D66 A;  3SBS A;  1ELR A;  3UT8 A;  4EQF A;  3UKU G;  2PQN A;  1K3Z D;  3CHS A;  2XS8 A;  5A23 A;  4AY6 A;  3L9T A;  3UXG A;  3PEV B;  1H19 A;  4GA1 A;  5FTP A;  1N52 A;  4HFG A;  4BES A;  4GTT A;  5J08 A;  4HLE A;  4J7W A;  5ARG A;  4GTP A;  4FU3 A;  5FQ8 A;  4FJY A;  3ZKJ A;  2VGX A;  5CBO A;  4GAA A;  1UOH A;  3Q73 A;  4RSY A;  3D9J A;  2JAB A;  1S63 A;  5JJ6 A;  2EQX A;  2V4H C;  3F6Q A;  3L6A A;  1KPS B;  3CVY A;  4U0S A;  2J4D A;  1DCQ A;  1IQU A;  1BD8 A;  4PUC A;  5IY5 E;  3L08 A;  2BKK B;  2LUH A;  1TNO A;  4H7Y A;  4G8L A;  4NUR A;  4UWG A;  2EIN E;  2LO6 A;  4UQZ A;  2WQH A;  3V30 A;  4JA9 A;  1WG0 A;  2XZT G;  4IUL A;  1HFA A;  2OCC E;  3UIO C;  5CEA A;  3JXJ A;  3PRE A;  1PC2 A;  1N95 A;  2DYR E;  2BED A;  1U3D A;  5JJ7 A;  3DSS A;  3MKQ A;  1OWO A;  5CBN A;  4PDX A;  5G04 J;  5H7P A;  3Q4A B;  1B89 A;  3IBE A;  2ZIS A;  4L2L A;  4GZ3 A;  3NAW A;  2J8S D;  3OXG A;  4A3V A;  3NF1 A;  3UM0 A;  5AIJ A;  2J07 A;  2YNQ A;  4CT4 A;  2UY1 A;  3LY7 A;  4XI9 A;  2P9P G;  2GRN B;  5A7D B;  3CVV A;  5KWD A;  3LVR E;  2IEJ A;  2HE0 A;  3UM1 A;  3PZD A;  4KVM A;  1HX8 A;  4O1O A;  2XGS A;  3JQ0 A;  3L54 A;  3R7R A;  2IU1 A;  4BET A;  3CVX A;  1UN9 A;  3CVW A;  3GW4 A;  2QYJ A;  2PL2 A;  2IOL A;  4U8Y D;  3CVU A;  5CCL A;  3FDH A;  4MKT A;  3QWV A;  1H2V C;  5AEN A;  3C5R A;  3CSF A;  2R2L A;  3CHQ A;  3B7S A;  3SFY A;  3QAQ A;  4EHM A;  4BT9 A;  2I9C A;  5HI7 A;  2CG2 A;  2WQ6 A;  5EIB E;  4CDR A;  4YDW A;  3E30 A;  2MOW A;  3U64 A;  4HOU A;  3HYM B;  3ULE G;  3C3O A;  1MX4 A;  2WQ7 A;  4CCA A;  4E85 A;  3Q49 B;  2WXR A;  2WMO A;  4Y6W A;  4NRH B;  2YHC A;  4O60 A;  3SHF A;  3ASH A;  4GMJ A;  3OTN A;  2UWJ G;  3ISM C;  4EZK A;  4GYO A;  4QQI A;  4FA6 A;  4XEI G;  1OT8 A;  2J9Q A;  3CKC A;  4EZL A;  3SFZ A;  1A5E A;  4I6E A;  3BG0 B;  2IO2 C;  5ANL A;  4TV3 A;  4FLB A;  3AG3 E;  4LER A;  5EX3 A;  3PNL B;  1UN8 A;  3E37 A;  5EN5 D;  3UT7 A;  3DXK G;  4HBD A;  4IYP A;  3HXF A;  4MRU A;  4U7E B;  3TWW A;  4AIF A;  1N4R A;  3FY4 A;  4ANW A;  1H6P A;  3GZ2 A;  3IXE A;  3AU5 A;  3KS2 A;  1Z6T A;  1SA5 A;  2L6J A;  5KJM A;  3Q7F A;  2DBA A;  3NOG D;  3FTY A;  2VSY A;  3VLE A;  3NBN B;  4KT6 B;  2AXZ A;  3AS5 A;  4AV7 A;  1Z3Y A;  2RKK A;  1RW2 A;  3IV0 A;  3LY8 A;  5EYP F;  1EF1 C;  1O1S A;  3O48 A;  3IHY A;  4N3B A;  1MYO A;  4U8V D;  4GYW A;  3RJV A;  1EDU A;  2WXK A;  3EIQ C;  1U3C A;  2NXP A;  3FUD A;  3R9A B;  3TWT A;  3VTY A;  2X6F A;  4KZC A;  2ZGD A;  5LCW J;  4OVV A;  2X6I A;  4G26 A;  3ZU7 B;  2ZIR A;  3QDN A;  1HF8 A;  1TR4 A;  5FZS A;  3UMV A;  2GRR B;  1IYG A;  4CRW A;  5BV0 A;  4HVB A;  1OWN A;  5AJL A;  3FU3 A;  4NAC A;  4ZHB A;  5D2M C;  3NOC D;  4JEU A;  1TYQ G;  2X6J A;  3EJN A;  3L22 A;  1X81 A;  2P58 C;  3MA5 A;  2HR2 A;  3X2Q E;  3HXB A;  5EIL A;  4O1P A;  4DLQ A;  1VDY A;  3FH5 A;  3PRZ A;  3CHR A;  4DJA A;  4OAU C;  1W3B A;  3HDX A;  5ENO D;  4OVU A;  3LJN A;  1LTX A;  1IHB A;  5HS0 A;  4UI9 J;  4G2V A;  4GTM A;  2DCP A;  5FQ7 A;  5D0O D;  4GA2 A;  1SZA A;  3FTW A;  3ZHE A;  3GZS A;  3HRA A;  2H6F A;  2GRL A;  1HXI A;  5G05 J;  3BUA A;  3T8K A;  1O5M A;  5T8I A;  1QYM A;  4H7X A;  4LEU A;  2IF4 A;  1HS6 A;  2GRQ B;  4BSZ B;  2KZT B;  3FTU A;  2AWI A;  4M3O A;  3AAA C;  3EUV A;  3SFX A;  3ZYL A;  1YMP A;  3HVE B;  4N5Q A;  4U95 D;  5KNG A;  1N0Q A;  2L0I A;  4BSX A;  3QK0 A;  1OXJ A;  2Q7F A;  4APF A;  3EHR A;  3FH7 A;  2PNN A;  1JUQ A;  3JXI A;  1SW6 A;  4DI4 A;  3ESK A;  5ARF A;  1QBQ A;  2LAI A;  4K5C A;  3UUX A;  2IQC A;  3B7R L;  3SO8 A;  2OEV A;  3ONK A;  3ZN3 A;  2I1J A;  3W9G A;  3PEU B;  4L1B A;  4YDY A;  3PVL A;  1ZB1 A;  4GPK A;  4URK A;  3SF4 A;  5A6C A;  4DK5 A;  3L82 A;  2VGE A;  5BXO A;  2L9B A;  3ASG A;  1FVH A;  3CK7 A;  1TN6 A;  3S7J A;  1OCC E;  4EPZ A;  4HI8 A;  3JUI A;  2Y0B G;  5FT9 A;  2DWZ A;  4CEM A;  4W9R A;  2B6C A;  2I6H A;  5M72 A;  1UW4 B;  3DPY A;  1SZ9 A;  4ILG A;  3ZGQ A;  1IXV A;  3UPV A;  4RG9 A;  4G8K A;  5DIZ A;  2XEN A;  4GZD A;  3PZ4 A;  4BX9 A;  2XPI A;  2WXQ A;  1DCE A;  3QNK A;  4AJW A;  5KCM A;  3PE3 A;  2J49 A;  4GA0 A;  3OAW A;  3UI2 A;  3LKU A;  1OWP A;  4KVO A;  2XRZ A;  3FTV A;  3QAR A;  4G25 A;  4EZJ A;  2P9I G;  4KBQ A;  2KM4 A;  3EDT B;  4ATZ D;  2KCK A;  3FHE A;  2WXH A;  3RAU A;  3ULY A;  3KEA A;  2PZI A;  5J90 A;  4XE0 A;  2E2E A;  4JC8 A;  3BG1 B;  4YND A;  1TEZ A;  4B8A A;  4CYM D;  4RVB A;  4V3I A;  3Q78 A;  1Z5S C;  4Y6C A;  4G11 A;  4HI9 A;  3DSX A;  3PH0 C;  2IFU A;  4MBG A;  4PS7 A;  3SGH A;  5BT1 A;  2AW6 A;  2OOE A;  3U3W A;  5CRU A;  2CFZ A;  4GU5 A;  3ENE A;  1UG3 A;  2H6I A;  3DSW A;  3SBT B;  1N54 A;  4OYS A;  2ILR A;  3CHP A;  4UQX A;  2Y4U A;  5FJY A;  1NI1 A;  3MV3 B;  4ATG A;  3ZFW A;  2H6H A;  2RD0 A;  2HO1 A;  4I17 A;  3SQV A;  5KJN A;  2XS1 A;  1D8D A;  3RSE G;  4HOT A;  2X38 A;  5C2Y A;  3CQC B;  4BY6 A;  2ETB A;  2VTB B;  3RKV A;  1MQS A;  5CMW A;  4HNA D;  4FC8 A;  3T8M A;  4BEP A;  4ANX A;  3LS8 A;  2VSO E;  3E34 A;  5LOZ A;  4Z68 A;  1PY1 A;  4K5B A;  3ZUV B;  2VGY A;  2AXU A;  3GZ1 A;  2QC9 A;  5ANR A;  4I43 A;  3UQ3 A;  1HG2 A;  2OEW A;  3LXU X;  3FU5 A;  3HXD A;  3C3R A;  3ASN E;  3ZIM A;  4A3T A;  4F1S A;  3SZ7 A;  3RO3 A;  1NL4 A;  1H2T C;  3UX4 A;  1INZ A;  1RZ4 A;  1NP7 A;  3ZYM A;  3J5P A;  3TXN A;  2P9U G;  4I1O B;  2R03 A;  1S64 A;  4MLP A;  1AWC B;  1JPL A;  3Q75 A;  3FUE A;  3I4G A;  4AY5 A;  3J5Q B;  1K8K G;  1NZN A;  4F6R D;  4ACL A;  1NA0 A;  3CR3 A;  3DSU A;  3GYZ A;  3ONL A;  3PS6 A;  2LSU A;  4XKC A;  4B0Z A;  4I9E A;  4C0M A;  1N11 A;  3G2S A;  1QQE A;  3IKO B;  4JW1 A;  3T5V A;  5AAO A;  3PZ1 A;  2EIL E;  4TXR A;  4YVQ C;  3RRN B;  4GPM A;  1H6K A;  4ILI A;  3TWX A;  3ZW3 A;  1BPO A;  4HOQ A;  2VSN A;  2V5Q C;  1HZ4 A;  4KZ0 A;  4DX2 A;  4U07 A;  2XQ0 A;  1QZ2 A;  4FLH A;  4GCN A;  3D9M A;  3QB2 A;  5DBK A;  5ENP D;  4TXQ A;  2VSX E;  4RQI A;  4B93 B;  1ELK A;  3TWQ A;  3BU8 A;  4UWH A;  4EBA G;  1MJ0 A;  2C0L A;  4B94 A;  3CVN A;  4G1T A;  3CGH A;  4WNF A;  1KLX A;  4AEZ C;  3T9K A;  1H0A A;  2VJ8 A;  4L2Y A;  4JXT A;  4JVS A;  3MCX A;  5E76 A;  2BTD A;  2WXF A;  1UJJ A;  5BNW A;  4I6J A;  3EHN A;  3DEP A;  1FT2 A;  2DIW A;  2KZT A;  2VGX B;  4A1G A;  3I4R B;  4G23 A;  3TXM A;  2YIN A;  3ZVV A;  3RRM B;  3HVE A;  3QWW A; 
#chains in the Genus database with same CATH homology
 2X3M A;  3FFL A;  3MZL B;  3LPZ A;  2WVI A;  3QJZ A;  4UI9 J;  3CVP A;  4G2V A;  2KAT A;  1KT0 A;  2DCP A;  3CVL A;  5FQ7 A;  4UI9 K;  5D0O D;  4JA7 A;  4ANU A;  4WWO A;  3TJP A;  3NQP A;  1YA0 A;  4N2S A;  4GA2 A;  3OXF A;  5KJK A;  5EX0 A;  4P29 A;  3FEX A;  3VLF A;  3PUJ A;  1WY6 A;  3ULQ A;  2OVB A;  3FTX A;  4GCO A;  4F7A A;  2WXO A;  4K03 A;  5G05 C;  1SZA A;  3TG4 A;  5CCM A;  3FTW A;  4U04 A;  3R7Q A;  3Q5M A;  3CV0 A;  3ML9 A;  3N71 A;  3GZS A;  4U0Z A;  2R17 C;  3ZHE A;  3Q15 A;  4DPR A;  5LX8 A;  4HOS A;  1ZU2 A;  2WXG A;  2GRL A;  1HXI A;  5AJD A;  2GGF A;  5G05 J;  4BT8 A;  1HG5 A;  3VTX A;  5T8I A;  3FUN A;  4D10 C;  3PNT B;  3LDZ A;  4H7X A;  4LEU A;  3FUK A;  3FTS A;  4GZC A;  4JZY A;  2IF4 A;  3O4Z A;  3AS4 A;  1HS6 A;  2V5F A;  3CIA A;  3FEY A;  4ILH B;  2KZT B;  3FTU A;  3T5X A;  4CDM A;  4J8F A;  3S7F A;  2CFU A;  2AWI A;  1WAO 1;  4M3O A;  2WMN A;  2OVF A;  3G2U A;  3ZYL A;  1IQR A;  4O6F A;  4JHR A;  3ASD A;  3HVE B;  4Q94 A;  1QNF A;  3FUM A;  3L17 A;  3SBS A;  1ELR A;  1UJK A;  3UT8 A;  4EQF A;  3JCK C;  5C1D A;  4N39 A;  5FZR A;  3SD5 A;  1FVF A;  4AOF A;  2L0I A;  2YHE A;  4BSX A;  3ASF A;  2PQN A;  3QK0 A;  3CHS A;  2Q7F A;  4U0U A;  4K0R A;  5A23 A;  4AY6 A;  3P2B A;  4KYO B;  4APF A;  3KAE A;  3FH7 A;  3PEV B;  1JUQ A;  4A1S A;  3CST A;  1H19 A;  1HU3 A;  5FQ6 A;  4BFR A;  4GA1 A;  4DI4 A;  3QKY A;  4LCT A;  3ESK A;  4TRQ A;  5ARF A;  1FCH A;  5FTP A;  1N52 A;  4HFG A;  2LAI A;  3MGB A;  5J08 A;  2RG8 A;  4HLE A;  4RG6 A;  4UWF A;  5ARG A;  3UUX A;  2IQC A;  3B7R L;  4FU3 A;  5FQ8 A;  3ZRH A;  5LFA A;  4FUL A;  4ABN A;  4FJY A;  3ONK A;  5BW8 C;  3ZN3 A;  2I1J A;  2VGX A;  3PEU B;  2M63 A;  4L1B A;  4GAA A;  2FO7 A;  3PVL A;  5ENN A;  4GPK A;  3PUK A;  4BTB A;  4A55 A;  4URK A;  3SF4 A;  4RSY A;  3D9J A;  4DK5 A;  3EHM A;  5BV1 A;  5A6C A;  4LUN U;  5JJ6 A;  2EQX A;  4WUY A;  2LSV A;  4J8D A;  4Q69 A;  3L6A A;  3D9I A;  2XCC A;  3ZXS A;  2L9B A;  3CVY A;  4I1A A;  4E6H A;  3ASG A;  3B13 A;  1FVH A;  3CK7 A;  4U0S A;  4KMO A;  2J4D A;  4TUU A;  5CMY A;  1IQU A;  3S7J A;  4WND A;  3G2W A;  4EPZ A;  4GYY A;  4PUC A;  3FWV A;  3JUI A;  4XX5 A;  4DLO A;  3L08 A;  4WNG A;  4R7L A;  5FT9 A;  1E96 B;  1Y8M A;  4CEM A;  4Q96 A;  4H7Y A;  1P5Q A;  3OXL A;  2Y3A A;  4NUR A;  5JHB A;  4UWG A;  4UWL A;  2X6K A;  4DI3 A;  2LO6 A;  4UQZ A;  2J08 A;  2WQH A;  4C9B B;  4JA9 A;  4B8C B;  1Z3X A;  4HXI A;  4G24 A;  4IUL A;  4W9R A;  5T3R A;  1HFA A;  2I6H A;  4BWR A;  3PRE A;  1PC2 A;  1UW4 B;  5M72 A;  3CK8 A;  1E7U A;  3G2V A;  4FP7 A;  1SZ9 A;  4ILG A;  5G04 C;  3ZGQ A;  1U3D A;  4WWN A;  4I1M A;  3NZS A;  5JJ7 A;  3UPV A;  2LNI A;  3MKQ A;  4RG9 A;  4C0E A;  3MEK A;  1OWO A;  4U63 A;  1E8Z A;  2NSZ A;  5DIZ A;  1KT1 A;  1OWL A;  2R5S A;  4JEH A;  4WNE A;  2XGO A;  4PDX A;  3D9O A;  4GZD A;  5G04 J;  5EKQ D;  3Q4A B;  4AVX A;  4BX9 A;  4XI0 A;  3FP3 A;  4N3A A;  1B89 A;  2C2L A;  2XPI A;  3IBE A;  4AP2 A;  2WXQ A;  3FUF A;  4L2L A;  4AXH A;  2GRM A;  3B7T A;  3QNK A;  4AJW A;  4GZ3 A;  3FUH A;  5KCM A;  3B7U X;  4JPS A;  3PE3 A;  2J49 A;  4GA0 A;  5D0Q D;  1X5B A;  3OAW A;  4A3V A;  2WPV A;  3DPD A;  3NF1 A;  2JEK A;  3OXG A;  3QWP A;  3LKU A;  3ZEF A;  5AIJ A;  2J07 A;  2XGM A;  2YNQ A;  1OWP A;  3I3N A;  3Q47 B;  4CT4 A;  2UY1 A;  4KVO A;  3LY7 A;  1HH8 A;  4XI9 A;  1SQM A;  2XRZ A;  3FTV A;  3QAR A;  4G25 A;  3ZPJ A;  4XKB A;  3FUJ A;  4EZJ A;  2KCV A;  4BTA A;  3EIJ A;  4IN3 B;  4J8S A;  5A7D B;  3CVV A;  1IHG A;  4KBQ A;  3FTZ A;  2KM4 A;  3LVR E;  3EDT B;  5BUZ A;  2KCK A;  1OUV A;  3FHE A;  4GZ6 A;  2WXH A;  3SI5 A;  3PZD A;  3MKQ B;  4KVM A;  4PS8 A;  3LJ3 A;  1HX8 A;  3S7D A;  3HHM A;  4FJZ A;  3KEZ A;  1Y6I A;  2XGS A;  4WWP A;  3TAX A;  3JQ0 A;  2PZI A;  3L54 A;  3R7R A;  5J90 A;  2IU1 A;  2C0M A;  4XE0 A;  3CVX A;  1UN9 A;  2E2E A;  4JC8 A;  3LYA A;  3BG1 B;  3QOU A;  4YND A;  1E8Y A;  2OND A;  1TEZ A;  2PQR A;  3CVW A;  2XHE A;  3MKR A;  4B8A A;  4J0U A;  1JWF A;  4GML A;  2J09 A;  3GW4 A;  4RVB A;  3APF A;  4V3I A;  2MRI A;  2PL2 A;  1S0P A;  2IOL A;  3IEG A;  4IRU A;  3CQG B;  3MX3 A;  3URZ A;  4HOR A;  3CEQ A;  3CVU A;  4Y6C A;  5CCL A;  4G11 A;  4L23 A;  3FDH A;  4MKT A;  3FU0 A;  3PH0 C;  3QWV A;  1H2V C;  2IFU A;  2UY1 B;  5T4Y A;  5AEN A;  5G2N A;  4UQY A;  3U66 A;  3CSF A;  1HO8 A;  4PH4 B;  4PS7 A;  3SGH A;  4FHJ A;  5BT1 A;  3CHQ A;  5LP0 A;  2OV8 A;  2AW6 A;  1NA3 A;  2OOE A;  2X6H A;  3PDN A;  3U3W A;  4B89 A;  3B7S A;  5AYW D;  3QAQ A;  2QFC A;  2CFZ A;  4GU5 A;  2YQ8 A;  2FEZ A;  2J4B A;  2XEV A;  3ENE A;  1UG3 A;  4CDN A;  3SBT B;  1N54 A;  1DVP A;  3LY9 A;  5FWQ A;  3S2A A;  4OYS A;  2ILR A;  4BT9 A;  2I9C A;  5HI7 A;  2CG2 A;  1L5J A;  3FUL A;  2WQ6 A;  3LVQ E;  4CDR A;  3CHP A;  1TJC A;  1E7V A;  2AXV A;  2MOW A;  5JHA A;  4UQX A;  3U64 A;  2WXI A;  4HOU A;  2Y4U A;  5FJY A;  4UWK A;  3HYM B;  4N2Q A;  3MV3 B;  3L16 A;  4ATG A;  3ZFW A;  2WQ7 A;  2V8S E;  2RD0 A;  4CCA A;  3TGO A;  2HO1 A;  4E85 A;  3Q49 B;  2WXR A;  2WMO A;  1E8X A;  4I17 A;  3U4T A;  4I6G A;  4JL0 A;  5KJN A;  3IHV A;  3D3M A;  2CHX A;  4Y6W A;  4YVO A;  2NC9 A;  4HOT A;  2FBN A;  2YHC A;  2X38 A;  4NRH B;  3ESL A;  5C2Y A;  1XNF A;  1A17 A;  5G55 A;  4L7T A;  3SHF A;  3ASH A;  5FQ4 A;  3CQC B;  3OTN A;  4GMJ A;  4BY6 A;  2VTB B;  2UWJ G;  3DBS A;  1MQS A;  3RKV A;  4EZK A;  5CMW A;  4GYO A;  3UT4 A;  4FC8 A;  2PM6 A;  4EEC A;  3K9I A;  1JWG A;  3T8M A;  4ANX A;  2Y4T A;  2I2O A;  4FA6 A;  3LS8 A;  1H2U A;  2XPZ A;  3CHO A;  3CK9 A;  4XIF A;  2J9Q A;  2VSO E;  2XRY A;  3CKC A;  5LOZ A;  2WB2 A;  2MHK A;  4EZL A;  3SFZ A;  3JQ1 A;  2V4L A;  4I6E A;  3RRU A;  1PY1 A;  3BG0 B;  3D9K A;  5ANL A;  4TV3 A;  1EYH A;  3U9W A;  4FLB A;  3MYV A;  4N3C A;  3E4B A;  4F53 A;  2WXN A;  4LER A;  4EBA A;  3AU4 A;  2VGY A;  2AXU A;  3GZ1 A;  5EX3 A;  5ANR A;  3PNL B;  4I43 A;  2FI7 A;  3UQ3 A;  3D9P A;  1HG2 A;  1DNP A;  2PM7 A;  1UN8 A;  3D9N A;  2L0T B;  2E0I A;  4CGV A;  2JLB A;  3LXU X;  3LEW A;  4HS2 A;  3FUI A;  3UT7 A;  3FU5 A;  3MJW A;  3BEE A;  4PS3 A;  4XZ4 A;  2KCL A;  3ZIM A;  3MV2 B;  1ZBP A;  4IYP A;  3ZYK A;  4A3T A;  4F1S A;  3CVQ A;  3RO3 A;  3SZ7 A;  3AS8 A;  2GW1 A;  1E90 A;  1H2T C;  4MRU A;  3UX4 A;  4I2W A;  4AIF A;  3D9L A;  1INZ A;  3FY4 A;  4ANW A;  2WXJ A;  1NP7 A;  3GZ2 A;  2BUG A;  3ZYM A;  3TXN A;  4QFV A;  4I1O B;  3JYS A;  4CGW A;  3AU5 A;  4MLP A;  4WAF A;  4KXK B;  1XGW A;  2HM8 A;  1JPL A;  3KS2 A;  1Z6T A;  5JJT A;  5FZQ A;  2QY7 A;  3FUE A;  5BPP A;  1ELW A;  2WXM A;  3I4G A;  2L6J A;  4FHK A;  3APD A;  4ANV A;  4AY5 A;  5KJM A;  3RIB A;  2R59 A;  1NZN A;  2DBA A;  2A5U A;  2CHW A;  4I2Z A;  4ACL A;  1NA0 A;  3CR3 A;  3LCA A;  3FTY A;  2VSY A;  3FH8 A;  3G2T A;  3VLE A;  2BF0 X;  3GYZ A;  3ONL A;  3PS6 A;  4KT6 B;  2AXZ A;  2LSU A;  4XKC A;  3AS5 A;  4B0Z A;  4AV7 A;  1Z3Y A;  4I9E A;  4C0M A;  3IV0 A;  3LY8 A;  3HIZ A;  3G2S A;  1WM5 A;  2FF4 A;  1EF1 C;  4I9C A;  1QQE A;  2VYI A;  3IKO B;  4JW1 A;  3O48 A;  3T5V A;  3IHY A;  4MS6 A;  3P1U A;  2AVP A;  3FU6 A;  4N3B A;  2VTB A;  5HQ8 A;  2I1K A;  4GYW A;  3RJV A;  4FAD A;  2XCB A;  1EDU A;  2WXK A;  2CG3 A;  5LCW C;  4GZ5 A;  3EIQ C;  4YVQ C;  3ZHE B;  4ACK A;  1U3C A;  3RRN B;  1H6K A;  2NXP A;  3FUD A;  4ILI A;  3R9A B;  4JHJ A;  3VTY A;  1BPO A;  2X6F A;  4HOQ A;  4JHK A;  3ZW3 A;  4KZC A;  2KC7 A;  2V0P A;  2VQ2 A;  5LCW J;  4OVV A;  2X6I A;  2VSN A;  4G26 A;  2HYZ A;  3RO2 A;  1PAQ A;  1HE8 A;  2ZU6 B;  3L13 A;  3QDN A;  1HZ4 A;  4KZ0 A;  1HF8 A;  3NZU A;  4U07 A;  2XQ0 A;  1QZ2 A;  4FLH A;  5CHE E;  2A4Z A;  5FZS A;  3UMV A;  3QC1 A;  4GCN A;  3D9M A;  1IYG A;  4CRW A;  3TG5 A;  5BV0 A;  4HVB A;  3QB2 A;  5DBK A;  3ZYQ A;  1OWN A;  3CLJ A;  2IJG X;  5AJL A;  1EPU A;  3FU3 A;  3TL5 A;  1MHQ A;  2VSX E;  4NAC A;  1ELK A;  3WXX A;  4F3V A;  4JEU A;  4UWH A;  2IOS A;  2X6J A;  3EJN A;  3L22 A;  5E75 A;  3RU0 A;  4EBA G;  2C0L A;  2P58 C;  5KJL A;  4B94 A;  1OWM A;  3I5P A;  3MA5 A;  5EDS A;  2WXP A;  2HR2 A;  3RK6 A;  3CVN A;  2FUL A;  2ION A;  4G1T A;  3CGH A;  3SNX A;  4WNF A;  1KLX A;  4AEZ C;  1LF8 A;  4NQ0 A;  2WM9 A;  1GW6 A;  1H0A A;  2VJ8 A;  4L2Y A;  4JXT A;  4DLQ A;  1VDY A;  3FH5 A;  3PRZ A;  3CHR A;  4N5C A;  3PE4 A;  2CHZ A;  4JVS A;  3MCX A;  5E76 A;  2BTD A;  2WXF A;  3CHM A;  1UJJ A;  3APC A;  5BNW A;  4I6J A;  4U8H A;  4J8E A;  4APO A;  3EHN A;  4DJA A;  4LRZ A;  4ME2 A;  3ML8 A;  2WXL A;  4CT0 A;  3C98 A;  2DIW A;  2KZT A;  2VGX B;  3VLD A;  4A1G A;  3KD7 A;  1W3B A;  4GB9 A;  3I4R B;  4G23 A;  3TXM A;  2YIN A;  3HDX A;  4UI9 C;  1E8W A;  3S7B A;  4BX8 A;  4OVU A;  4J6I A;  3ZVV A;  3RRM B;  2LAH A;  2XPY A;  3HVE A;  3CKB A;  4AM9 A;  3QWW A;  1TJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...