2LAIA

Hyaloperonospora arabidopsidis effector protein atr13
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
101
structure length
101
Chain Sequence
SFGLGKAQDPLDKFFSKIIFSGKPIETSYSAKGIHEKIIEAHDLHVSKSKNAPIQYASVMEYLKKTYPGPDIERIVSTLERHDEVGAKDLGAKLRDALDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Elucidation and Functional Characterization of the Hyaloperonospora arabidopsidis Effector Protein ATR13.
pubmed doi rcsb
source organism Hyaloperonospora parasitica
molecule tags Signaling protein
molecule keywords Avirulence protein ATR13
total genus 8
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16829 ATR13 Avirulence protein ATR13, RxLR effector
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.640 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2laiA00
2LAIA
chains in the Genus database with same CATH superfamily
5FQ6A 1HF8A 5BNWA 5ENNA 3CR3A 4BX8A 4OAVB 2P9IG 1DC2A 4DPRA 4FP7A 5LX8A 5BV0A 4BERA 3RAUA 4CZ2D 2R2LA 3APFA 4WWNA 3LDZA 4I6JA 3PUJA 4GTPA 4JEHA 4H7XA 3IXEA 3FUDA 4DLOA 1TNZA 2GRPB 2YNQA 3BG1B 3ULYA 1NFIE 2I9CA 4O6FA 1SA5A 3SY2A 3EJNA 3D9NA 3E32A 4J8SA 3CQGB 1EF1C 2CHZA 3PE4A 4J8YA 4BESA 5AJLA 2LAHA 3IHYA 5HRYA 5ENQD 5H7PA 2H6IA 5G2NA 3JCKC 5AIJA 1OT8A 4ILHB 4TRQA 3D9IA 1Z6TA 4YDYA 5FZQA 1INZA 1FPPA 1S70B 2FO1E 3HIZA 4JHKA 4GZ5A 2IO3C 1W3BA 2J9QA 2IFUA 4JPSA 2C2LA 2RFMA 1QNFA 3SQVA 3VLFA 4GTVA 3AG2E 1D9SA 4AV7A 1TNUA 4BSZB 3VTYA 1SW6A 3FWVA 4UWFA 2XRZA 4G11A 2NSZA 3QNKA 4WNGA 5KNHD 4RG6A 3ZYQA 3RSEG 4DI3A 4HOQA 2XEEA 1E8ZA 2WXJA 3DSVA 3MV3B 4U07A 4HQDA 3Q9NC 3R7RA 1TN7A 4CT0A 4BEPA 5BXOA 4LUNU 3V79K 2KCKA 2FI7A 1HX8A 1UN8A 4Y6WA 4WAFA 4CGWA 4AJWA 4MS6A 2OV8A 4J8EA 3KD7A 2VGXA 3ZNGA 4LSZE 2HM8A 4ZFHA 3LS8A 2BKKB 2L0IA 4GMJA 1X81A 4BETA 3EUVA 4DRXE 5LOZA 3SFZA 1MZCA 3FULA 3CSTA 3UT4A 2XGOA 4LNUD 1N0QA 3OAWA 5DIZA 4DI4A 2VTBA 1IHGA 3APDA 3MA5A 4ANVA 1TNYA 4UQXA 3LXUX 5FTPA 3CVLA 5EYPF 4GZCA 4F1SA 2J09A 3ASDA 2GW1A 2I1JA 1DCEA 4CYMD 5JJ7A 2DZOA 2L0TB 2P9KG 2WXLA 2VSYA 3FU3A 4IRUA 3P2BA 5KNGA 2PQRA 4K0RA 3UX4A 3FUJA 4A3TA 1HXIA 2WQ6A 2WXNA 3QB2A 2VTBB 3ZUVB 4I6GA 5D0QD 1N4PA 1HO8A 2RG8A 4FJZA 4I1AA 2FEZA 4N39A 1IQUA 1YYHA 3EU5A 4YDOA 3CKCA 2LO6A 2RFAA 4EBAG 4KVMA 2I6HA 3FTVA 2GGFA 4L9PA 4ME2A 2J49A 4UWGA 2XEVA 3PZ3A 1WDYA 2WXOA 4ANXA 1N54A 2Y1LE 4GYOA 1Z3YA 2RKKA 3PREA 4EBAA 1JCRA 5KJNA 3FEYA 1H2UA 3V31A 4JA9A 4XI0A 4I1MA 1SA4A 3T5XA 3ONKA 2GROB 1Y6IA 1LD7A 4KZ0A 3D3MA 3PNLB 4GA0A 1UOHA 2XRYA 2PM7A 4JA7A 2L9BA 3CKBA 2IOSA 4J7WA 4LERA 1UJJA 4GAAA 3QAQA 3Q79A 5IY5E 3W9FA 1TN8A 3DSUA 2E2EA 2V4LA 1YMPA 4WNDA 3CHQA 5G05C 3CHRA 3D9LA 4DUIA 4NACA 5EX3A 2F0YA 3L08A 4PH4B 1SZ9A 3FDHA 2JEKA 2V5FA 4URKA 3DWLG 4GTQA 2XS8A 3WXXA 4B0ZA 1BI7B 3E37A 1BLXB 3AAAC 3I5PA 2WQ7A 2V5QC 3NZUA 5EILA 4B8CB 3DXKG 2IEJA 5J08A 2DVWA 4YVOA 4P29A 3UM0A 3CGHA 4GCOA 4HOTA 1E8XA 3ASFA 4HLLA 2JLBA 3PEUB 3ENEA 5G55A 3HVEA 1NZNA 2F8XK 2H6HA 2VGEA 1N9AA 4JXTA 1N52A 4GPMA 2VJ8A 4FHJA 4OYSA 4F6RD 3LY7A 2VSXE 3FU6A 4APOA 2NC9A 1UN9A 3L16A 2EINE 1BPOA 3C3OA 1Y8MA 4O1PA 4GTRA 1Z5SC 3TJPA 4L7TA 4U8VD 4UWLA 3NAWA 1BU9A 1K8KG 1EDUA 4GZ3A 4KZCA 3MGBA 3ZFWA 3DXMG 5JJ6A 3PNTB 1U3DA 4XX5A 1WM5A 3LJNA 3AU4A 1E8WA 3TWUA 3UPVA 3ZHEB 3UKRG 5KJLA 3U4TA 5A23A 1HG5A 3FFLA 3RO2A 4UUCA 4ACLA 5ENRD 4XI9A 4DX5D 2EIJE 4ANWA 4FHKA 2OVBA 3JXJA 1PC2A 1HFAA 1A17A 2LSVA 1TJCA 2ONDA 3Q15A 1KZOA 3C98A 2YHEA 1N11A 3E4BA 3Q75A 5DBKA 3ASGA 4HNAD 1FT1A 4U04A 2WXGA 4JL0A 2NXPA 3L22A 2J08A 4DLQA 3PZ2A 4AY6A 1ZU2A 1RZ4A 5BW8C 1B89A 3HVEB 3CHSA 1ZB1A 3B7RL 2VQ2A 2LAIA 3Q5MA 3R7QA 3S2AA 3JUEA 5C2YA 3RRMB 5FZRA 1OWLA 4OVVA 4U96D 3FTSA 4G24A 5CCMA 1QQEA 2EIME 3PRZA 3ZVVA 2ZU6B 4HI8A 3W9GA 2C0MA 3HRAA 5D2MC 3QARA 2M63A 2FO7A 1FCHA 4KXKB 1FVFA 2P2CP 3TWVA 3QC1A 4D10C 2UY1A 2P9NG 3BG0B 4RLYA 2VYIA 2QYJA 2H6FA 4GCNA 1UG3A 3CK9A 1E96B 2F37A 1N95A 1SQMA 3OXGA 2XGMA 5T4YA 2DIWA 5JHAA 3R9MA 2KCLA 3Q4AB 2P9UG 3URZA 4CDNA 2UWJG 4FLHA 4GTSA 2XPYA 3UM1A 1YCSB 2L6JA 1OWOA 3PZDA 3ZEFA 3WG7E 1S63A 1DNPA 4U7EB 5FQ7A 3SHFA 4U8HA 3B7TA 5AENA 3GZ1A 2WB2A 1SVXA 2R59A 3EHMA 4PS3A 4KVOA 4N2SA 2AW6A 5FT9A 1OCOE 3E34A 1BI8B 4KT6B 2Q7FA 4BTAA 1E7VA 3ZYLA 5CERB 1AP7A 2P9PG 3FTWA 3RJVA 2WMOA 4EPZA 3ABME 2Y4TA 3BQOA 5FINA 2V8SE 4PDXA 2WXRA 3LJ3A 2ETBA 4J8FA 1E7UA 4PS7A 4I43A 2KM4A 4BY6A 3PS6A 1ELKA 4TXQA 4GU5A 4U0UA 4EECA 4GMLA 2X6KA 4I6EA 4CEMA 4XIFA 3FUIA 1WG0A 3NQPA 3JQ0A 3ZU7B 3QKYA 2R02A 4HB5A 1JCQA 2R17C 3C5RA 4HFGA 3CVVA 3TG4A 3FUMA 3ABLE 5G04J 5G04C 4LCTA 2XHEA 4AP2A 5EDSA 4U8YD 3EHQA 4YDEA 4UI9J 3TWSA 3KEZA 5AJDA 2R05A 3MYVA 1SZAA 2XCCA 3BEEA 2P9LG 1XNFA 2A5UA 5FQ8A 1MX4A 3O48A 3LY8A 2V0PA 4FULA 5CEAA 3DSXA 4ANUA 2GRLA 3FUEA 3ULEG 4AY5A 2LUHA 4NQ0A 5C1DA 3V2OA 3NZSA 3PZ1A 2A4ZA 3ZXSA 2UY1B 3S7FA 5ANRA 3NOCD 1H6OA 3HHMA 1TJFA 3DSWA 4FC8A 3ZRHA 1NA3A 3P1UA 2VSOE 3ASOE 4HRMB 4N3BA 4Q96A 3APCA 3L6AA 4B93B 4N5CA 3CVXA 2GRQB 1ZBPA 4GA1A 5ENOD 3VLDA 3HXDA 2LXMA 2BTDA 2J07A 4KMOA 1EYHA 3ASHA 3QK0A 3ZW3A 4C48B 1LD8A 3IEGA 3FP3A 3BUAA 5JHBA 3SNXA 2XCBA 3C3QA 1IXVA 4O60A 3B7SA 4KYOB 4B89A 2MHKA 4RQIA 2DYRE 3B13A 3G2SA 3SGHA 4XKCA 2WXPA 4PUCA 3ESKA 3FH5A 4CGVA 3CSFA 4K5AB 4UQYA 3T8KA 1V54E 3OTNA 3GZSA 4BSXA 1Q2ZA 4HBDA 4WNEA 5EIDA 4W9RA 5D66A 4KBQA 4ILGA 3NOGD 1MJ0A 4AM9A 5AQ9A 1VDYA 5AQAA 1WY6A 4MKTA 2IQCA 3CK8A 3TL5A 3I4GA 3HXBA 3FHEA 1HU3A 4UQZA 3C3RA 1FT2A 3IKOB 3CIAA 4GZDA 3AG3E 4B94A 2GRNB 2FBNA 2R5SA 4G2VA 2XEHA 2ZIRA 3HXEA 1H0AA 3X2QE 3CVQA 3RIBA 4H7YA 5CRVA 1K1BA 4HLEA 2VGXB 1V55E 3DSSA 4A63B 4ILIA 1U3CA 3MJWA 4A1SA 4AIFA 3CHPA 1KT1A 2XENA 4DX1A 2IJGX 3ML8A 3ZYKA 4EZLA 3TGOA 2YQ8A 4GTOA 4TUMA 4WUYA 3LYAA 4LNBA 1OWNA 3Q73A 3CVPA 4F3VA 1JWFA 3MKQA 4GTTA 4DK5A 5M72A 3SFYA 4WNFA 2QFCA 3T8MA 4A3VA 1N4QA 4N5QA 1S0PA 3ZKJA 2DCPA 4WWOA 1TR4A 3HDXA 1AWCB 1H19A 3AG1E 3PH0C 1IQRA 4FU3A 4IULA 2PQNA 3KSLA 3QJZA 1LF8A 3K9IA 3RKVA 2CG3A 3NF1A 3FTZA 3PEVB 3QDNA 5BUZA 3B95A 2QC9A 3PZ4A 4EZJA 1MX6A 2X6FA 3I3NA 4BTBA 1O1RA 1N4RA 5AARA 3AS5A 1FVHA 4L1BA 3LVRE 2KZTA 4C9BB 4CCAA 4J0UA 2AXUA 3DRAA 2GRRB 1KLXA 5AYWD 2LXLA 1HG2A 3FH8A 4DX6D 2MOWA 4HXIA 4J6IA 3DPDA 3Q47B 3G2TA 4I2ZA 2YINA 2V4HC 2XZTG 1OCZE 5EYLA 4QQIA 1OCRE 3DSTA 4R7LA 2IO2C 4YDWA 4U95D 3LKUA 1JCSA 2AXZA 3GYZA 5BT1A 3F6QA 2IU1A 3GW4A 4NRHB 4G8LA 2XPIA 4Y6CA 5CEDB 3CQCB 3EIJA 5BPPA 3TWTA 2WXHA 3O4ZA 1DVPA 2ETCA 2E0IA 4FLBA 3UMVA 4AOFA 3UT8A 1H2TC 5D0OD 2WXQA 2C0LA 3AU5A 3MKRA 4GPKA 3TWXA 3UM2A 1HH8A 3UIPC 4ATZD 1OWMA 3L13A 3TWWA 2BUGA 4I17A 3RRUA 3MV2B 2X6IA 4G23A 3LY9A 1NL4A 2WQHA 5FQ4A 3D9KA 3U64A 3ONLA 5KJMA 3EDTB 3LEWA 4AEZC 3UKUG 2PL2A 4FADA 2PZIA 4BWRA 1HS6A 3Q78A 1BD8A 3C72A 2KATA 2EQXA 5AQ7A 5EIBE 3KSQA 4TXRA 1N94A 4F53A 4DX7D 2DWZA 1H6PA 3FY4A 3SI5A 3ZGQA 4YNDA 3OXLA 4JVSA 1OUVA 3D9OA 3Q9UC 4EZKA 4JZYA 5A6CA 2X3MA 4G26A 3GZ2A 4CRWA 3D9HA 3R9AB 3U3WA 4TUUA 2KZTB 3CHMA 4AXHA 3DPYA 2FF4A 1GW6A 1IHBA 5KCMA 5HS0A 2FULA 3V30A 2X6HA 3ASNE 5CMWA 4RVBA 3SF4A 3RU0A 5CHEE 5B1BE 2QZAA 2PNNA 3UT7A 4V3IA 3TXMA 3E30A 3CVUA 4BT9A 4GZ6A 4MRUA 4GB9A 4Q69A 2AVPA 3KS2A 2ILRA 3ULQA 5E75A 1OXJA 4K5CA 3JXIA 5ENSD 1NI1A 2CHWA 2BF0X 3MEKA 5T3RA 3CK7A 4JEUA 2OEVA 2YHCA 1PAQA 3J5PA 3Q7FA 1H2VC 2ZISA 2ZXWE 5EX0A 3JQ1A 4C0MA 2X38A 4GTMA 1A5EA 3FUKA 3G2VA 4MLPA 2IY0C 3DEPA 5E76A 5KWDA 3TWQA 3MZLB 4FJYA 2AXVA 4UWHA 2HE0A 3AS4A 4Q94A 4N3AA 4FA6A 3SO8A 2H6GA 1IYGA 3ZYMA 3ABKE 1OY3D 4HOSA 3CVYA 1G3NB 2XZDG 1NP7A 3UUXA 3TXNA 2XGSA 1HZ4A 3V2XA 4N3CA 3Q49B 1ELWA 2Y0BG 3FEXA 3MKQB 2IONA 3SBSA 3T5VA 3RRNB 4TXPA 3ZXPA 3FUNA 2X6JA 4GMRA 1IKND 4U63A 2CFUA 3G2UA 4OVUA 3B7UX 1KT0A 2CHXA 2HYZA 1YA0A 4I9CA 1UJKA 2DBAA 5BV1A 2WPVA 3TG5A 3LCAA 2ZGGA 2KCVA 2BEDA 4YVQC 2KBXA 4XZ4A 4NIKA 4HS2A 4J8DA 3OXFA 3D9JA 1QYMA 4CT4A 3CV0A 4EQFA 4E85A 2JABA 1WAO1 3D9PA 2WVIA 4M3OA 1KPSB 2LSUA 2OOEA 3Q7AA 4G1TA 1N0RA 5JJTA 2P58C 3ML9A 1UW4B 4XKBA 3ZN3A 3EIQC 4MBGA 2WXFA 4G8KA 2RD0A 3G2WA 3PUKA 2IOLA 1JWGA 5CECB 3QWVA 1QBQA 5J90A 4X8QA 4JB8P 3EU9A 2J4DA 5ITZF 1MQSA 5T8IA 2HR2A 2BKGA 5CCLA 4JHJA 4IYPA 2B6CA 3CEQA 4JW1A 4LEUA 5G05J 4PS8A 5LCWC 2L6BA 3EHRA 3SFXA 1E8YA 4LG6A 1OCCE 1ELRA 3KEAA 3JYSA 3SD5A 4L2YA 2I1KA 3S7JA 3IV0A 3DEOA 4DJAA 2P9SG 1TN6A 5B1AE 2EIKE 2WXMA 1Z3XA 4I9EA 3PVLA 5HKPA 3EHNA 2VSNA 3UIOC 2MRIA 2OCCE 2DYSE 4RG9A 5CMYA 2AJAA 3I4RB 3ISMC 5AQBA 3QOUA 4GYYA 4HOUA 3UM3A 5ARFA 2WM9A 4U0SA 4NURA 5HI7A 1H6KA 3FU0A 3MX3A 3SBTB 4BX9A 4I2WA 1RW2A 5JMND 3CVWA 1QZ2A 4JHRA 4LRZA 1E90A 3UI2A 4HRLA 3L9TA 3ESLA 4OAUC 3MCXA 3L17A 3S7BA 3IBEA 4HVBA 5B3SE 4GA2A 3LVQE 5LFAA 4JD2G 3CLJA 4HORA 4G25A 1O1SA 5KJKA 2PM6A 3N71A 4A55A 1OWPA 1X5BA 2Y4UA 4DX2A 3FUHA 4UWKA 1LTXA 1TNBA 2J4BA 3ZIMA 2NYJA 3BU8A 1S64A 1DCQA 5CRUA 3L82A 5BXUA 3AJIA 2GRMA 2Y69E 4WWPA 4JC8A 4O1OA 2XQ0A 2F8YA 4E6HA 4RSYA 1U2VG 3FTXA 1K1AA 1XGWA 2DZNA 3QWWA 3ZPJA 4ZHBA 5ARGA 5ENPD 3VTXA 3UXGA 3UQ3A 1O5MA 3RK6A 4QFVA 2WXIA 3DBSA 4A1GA 1P5QA 4BT8A 1MYOA 1TNOA 4APFA 4TV3A 3U9WA 4ACKA 4B8AA 4C0EA 2VGYA 3U66A 4ATGA 5CBOA 5CBNA 3JUIA 2AWIA 3J5QB 5EKQD 3T9KA 2KC7A 2OEWA 2B0OE 3TAXA 1O1TA 2R03A 1MHQA 1D8EA 4U0ZA 4UI9C 3TWRA 2WMNA 4HRNA 2ZGDA 5JA4D 4L2LA 4BFRA 2CFZA 5LP0A 4K5BA 4LNGA 1D8DA 2IF4A 3VLEA 1JPLA 2QY7A 3QWPA 2XS1A 5FJYA 5FZSA 3UINC 4GYWA 5LCWJ 5ENTD 3HG0D 4EHMA 5KBAA 4M7CA 3AG4E 2MYOA 2KXPC 1KZPA 1HE8A 1L5JA 3FTUA 3PDNA 3S7DA 3FUFA 3UTMA 3NBNB 2WXKA 3B7BA 2HO1A 2CG2A 2XPZA 2EILE 1K3ZD 3FH7A 1NA0A 3HXFA 1EPUA 4XEIG 4AVXA 4I1OB 5EN5D 4F1PA 3PE3A 2QYUA 2OVFA 3E33A 5HQ8A 4F7AA 3L54A 4K03A 4Z68A 3KAEA 5FIOA 4ABNA 1TYQG 4HI9A 4UI9K 2I2OA 3NB2A 4XE0A 4IN3B 5AN8A 3CHOA 3SZ7A 1PY1A 5ANLA 3RO3A 2A5EA 3IHVA 4CDMA 3FU5A 3D9MA 3HXCA 1JUQA 4L23A 1MX2A 4N2QA 2J8SD 3FTYA 4CDRA 2ETAA 3AS8A 5FWQA 5AAOA 1TEZA 3LPZA 5A7DB 2Y3AA 3HYMB 1N4SA 3CVNA 2LNIA 3ZHEA
chains in the Genus database with same CATH topology
5FQ6A 4AM9A 1VDYA 4UWLA 1HF8A 1NP7A 3UUXA 1WY6A 3TXNA 2XGSA 4MKTA 1HZ4A 5BNWA 2IQCA 1EDUA 3CK8A 1ELWA 3Q49B 3CR3A 4N3CA 4GZ3A 4KZCA 5ENNA 3I4GA 3TL5A 4BX8A 3MGBA 3ZFWA 3FHEA 3FEXA 4DPRA 3MKQB 1HU3A 4FP7A 4UQZA 5BV0A 5JJ6A 2IONA 5LX8A 3IKOB 3CIAA 3PNTB 3SBSA 3T5VA 4GZDA 3RRNB 1U3DA 3APFA 4XX5A 1WM5A 4WWNA 4B94A 3FUNA 3AU4A 1E8WA 2X6JA 3LDZA 2FBNA 3UPVA 2R5SA 4G2VA 3ZHEB 4I6JA 3PUJA 4U63A 5KJLA 2CFUA 3G2UA 3U4TA 4JEHA 1H0AA 5A23A 1HG5A 3FFLA 4H7XA 3RO2A 4OVUA 3CVQA 3RIBA 3B7UX 3FUDA 4DLOA 4ACLA 1KT0A 2CHXA 4H7YA 4XI9A 2HYZA 1YA0A 4I9CA 2YNQA 4ANWA 4HLEA 2VGXB 3BG1B 4FHKA 2I9CA 1UJKA 2OVBA 4ILIA 1U3CA 3MJWA 2DBAA 4A1SA 2WPVA 1PC2A 3TG5A 4AIFA 5BV1A 3LCAA 2KCVA 1HFAA 1A17A 4O6FA 4YVQC 2LSVA 4XZ4A 3CHPA 3EJNA 3D9NA 1KT1A 1TJCA 4HS2A 4J8DA 2ONDA 3OXFA 3Q15A 3D9JA 2IJGX 4CT4A 3ML8A 3CV0A 3ZYKA 4EZLA 3C98A 3TGOA 2YHEA 2YQ8A 4J8SA 4EQFA 3CQGB 3E4BA 4E85A 1WAO1 3D9PA 1EF1C 2CHZA 4WUYA 5DBKA 3LYAA 3PE4A 3ASGA 1OWNA 4F3VA 3CVPA 4U04A 2WVIA 2WXGA 4JL0A 4M3OA 5AJLA 2LSUA 2NXPA 2OOEA 2LAHA 3L22A 4G1TA 1JWFA 3MKQA 5JJTA 3IHYA 2P58C 3ML9A 1UW4B 4XKBA 3ZN3A 5G2NA 3EIQC 2J08A 2WXFA 3JCKC 5AIJA 2RD0A 3G2WA 3PUKA 4ILHB 2IOLA 4DLQA 4DK5A 4TRQA 1ZU2A 5M72A 4AY6A 1JWGA 3D9IA 3QWVA 5BW8C 4WNFA 1Z6TA 5J90A 1B89A 5FZQA 2QFCA 1INZA 3HVEB 3CHSA 3T8MA 4A3VA 3HIZA 2J4DA 1MQSA 5T8IA 3B7RL 2VQ2A 2LAIA 2HR2A 4GZ5A 1S0PA 4JHKA 3Q5MA 5CCLA 1W3BA 2DCPA 4JHJA 4WWOA 2J9QA 3HDXA 4IYPA 3R7QA 3S2AA 5C2YA 2IFUA 3CEQA 1H19A 3RRMB 4JW1A 3PH0C 5FZRA 1IQRA 4LEUA 1OWLA 4FU3A 4IULA 4OVVA 4JPSA 5G05J 2PQNA 2C2LA 3QJZA 1LF8A 4PS8A 5LCWC 3FTSA 3K9IA 3RKVA 1QNFA 4G24A 5CCMA 2CG3A 1QQEA 3NF1A 3PRZA 3ZVVA 2ZU6B 3VLFA 1E8YA 3FTZA 3PEVB 2C0MA 3QDNA 4AV7A 3QARA 1ELRA 2M63A 2FO7A 5BUZA 3VTYA 3JYSA 1FCHA 4KXKB 3FWVA 1FVFA 4UWFA 2XRZA 4G11A 2NSZA 3QC1A 3QNKA 2I1KA 4L2YA 3SD5A 4EZJA 4D10C 4WNGA 2UY1A 3BG0B 3S7JA 2X6FA 4RG6A 3I3NA 3ZYQA 3IV0A 4BTBA 4DJAA 2VYIA 3AS5A 4GCNA 2WXMA 1Z3XA 4DI3A 4I9EA 1FVHA 4L1BA 1UG3A 3CK9A 3PVLA 4HOQA 1E96B 1E8ZA 3EHNA 2WXJA 2VSNA 3LVRE 2KZTA 3MV3B 4C9BB 2MRIA 4U07A 4RG9A 5CMYA 4CCAA 3I4RB 4J0UA 3R7RA 2AXUA 1SQMA 3QOUA 4GYYA 4HOUA 1KLXA 5ARFA 5AYWD 3OXGA 2XGMA 4CT0A 5T4YA 2WM9A 1HG2A 4U0SA 3FH8A 4LUNU 2DIWA 2KCKA 2MOWA 4NURA 5HI7A 1H6KA 5JHAA 2FI7A 3FU0A 3MX3A 3SBTB 4HXIA 4BX9A 4J6IA 1HX8A 1UN8A 2KCLA 3DPDA 3Q47B 4I2WA 4Y6WA 4WAFA 4CGWA 3Q4AB 3G2TA 3URZA 4I2ZA 4AJWA 4MS6A 2OV8A 3CVWA 4CDNA 1QZ2A 2YINA 4JHRA 4J8EA 4LRZA 2UWJG 3KD7A 4FLHA 2VGXA 1E90A 2XPYA 3ESLA 2HM8A 3LS8A 2L6JA 2L0IA 4GMJA 1OWOA 3MCXA 3PZDA 3L17A 3S7BA 3IBEA 4R7LA 3ZEFA 1DNPA 4HVBA 5FQ7A 4GA2A 5LOZA 3LVQE 3SFZA 3SHFA 3FULA 4U8HA 3B7TA 5AENA 3CSTA 3CLJA 3GZ1A 5LFAA 2WB2A 4HORA 2R59A 3UT4A 3EHMA 4G25A 3LKUA 2XGOA 5KJKA 4PS3A 2PM6A 4KVOA 2AXZA 3GYZA 3N71A 4A55A 4N2SA 2AW6A 5BT1A 5FT9A 2IU1A 3GW4A 1OWPA 4NRHB 1X5BA 2XPIA 3OAWA 4Y6CA 5DIZA 4DI4A 2Y4UA 4KT6B 3CQCB 1IHGA 3APDA 3FUHA 3MA5A 2J4BA 2Q7FA 4UWKA 4ANVA 4BTAA 2VTBA 4UQXA 3LXUX 3EIJA 5FTPA 1E7VA 3CVLA 3ZIMA 3ZYLA 4GZCA 5BPPA 4F1SA 2J09A 2WXHA 3O4ZA 3ASDA 2GW1A 2I1JA 3FTWA 3RJVA 5JJ7A 1DVPA 2GRMA 4WWPA 2L0TB 2E0IA 2WMOA 2VSYA 2WXLA 4FLBA 4JC8A 3UMVA 4AOFA 3UT8A 4EPZA 2Y4TA 3FU3A 1H2TC 2V8SE 4IRUA 2XQ0A 4PDXA 3P2BA 2WXRA 5D0OD 4E6HA 2WXQA 3LJ3A 2C0LA 4J8FA 3AU5A 1E7UA 4RSYA 2PQRA 4K0RA 3MKRA 3FUJA 4PS7A 3FTXA 2KM4A 4I43A 3UX4A 4A3TA 4GPKA 4BY6A 1XGWA 1HH8A 1HXIA 3PS6A 3QWWA 1ELKA 1OWMA 4GU5A 3ZPJA 3L13A 5ARGA 2BUGA 4I17A 3RRUA 3VTXA 3MV2B 4U0UA 2X6IA 4EECA 4G23A 3UQ3A 2WXNA 4GMLA 2WQ6A 3LY9A 3RK6A 2X6KA 4I6EA 3QB2A 2WQHA 2VTBB 4QFVA 5FQ4A 2WXIA 3DBSA 4A1GA 1P5QA 3D9KA 3U64A 4BT8A 3ONLA 4CEMA 4I6GA 5D0QD 5KJMA 4XIFA 3FUIA 4APFA 3EDTB 1HO8A 2RG8A 4FJZA 3NQPA 4TV3A 3LEWA 3U9WA 4AEZC 2PL2A 3JQ0A 4FADA 4ACKA 4I1AA 3QKYA 2FEZA 2PZIA 2R17C 4BWRA 1HS6A 1IQUA 4N39A 4B8AA 4HFGA 3CKCA 2LO6A 4C0EA 2VGYA 3TG4A 4EBAG 3CVVA 3FUMA 2KATA 2EQXA 4ATGA 3U66A 4KVMA 5G04J 2I6HA 3JUIA 2AWIA 5EKQD 5G04C 2KC7A 3FTVA 4LCTA 2XHEA 4F53A 2GGFA 4AP2A 4ME2A 5EDSA 2J49A 3TAXA 4UWGA 2XEVA 3FY4A 4UI9J 1MHQA 3KEZA 4U0ZA 4UI9C 3SI5A 2WXOA 3ZGQA 4ANXA 5AJDA 1N54A 2WMNA 3MYVA 4GYOA 1SZAA 4YNDA 1Z3YA 2XCCA 3OXLA 3PREA 3BEEA 4JVSA 1OUVA 3D9OA 1XNFA 2A5UA 5FQ8A 4L2LA 4EBAA 4EZKA 5KJNA 3O48A 4BFRA 3FEYA 2CFZA 1H2UA 5LP0A 4JZYA 4JA9A 4XI0A 5A6CA 3LY8A 2X3MA 4G26A 3GZ2A 2V0PA 4I1MA 4FULA 3T5XA 3ONKA 2IF4A 4CRWA 3R9AB 1Y6IA 4ANUA 3U3WA 4TUUA 2GRLA 2KZTB 3FUEA 4AY5A 3CHMA 4KZ0A 3D3MA 3PNLB 4GA0A 4NQ0A 5C1DA 3VLEA 4AXHA 1JPLA 2FF4A 2PM7A 2QY7A 2XRYA 2L9BA 3CKBA 2IOSA 3NZSA 1GW6A 2A4ZA 4JA7A 3QWPA 4LERA 5FJYA 1UJJA 5FZSA 5KCMA 4GAAA 3ZXSA 2UY1B 3QAQA 4GYWA 5LCWJ 3S7FA 5ANRA 2FULA 2E2EA 2V4LA 2X6HA 5CMWA 4WNDA 4RVBA 3SF4A 3CHQA 3RU0A 5CHEE 3HHMA 5G05C 1HE8A 1TJFA 3CHRA 1L5JA 3D9LA 4FC8A 3ZRHA 3FTUA 3PDNA 4NACA 5EX3A 3S7DA 1NA3A 3FUFA 3P1UA 3UT7A 4V3IA 2VSOE 3TXMA 3L08A 2WXKA 4N3BA 1SZ9A 4PH4B 4Q96A 3CVUA 4BT9A 2HO1A 3APCA 3FDHA 3L6AA 2CG2A 2JEKA 2V5FA 2XPZA 4GB9A 4GZ6A 4MRUA 4Q69A 4URKA 2AVPA 4N5CA 3CVXA 3WXXA 4B0ZA 1ZBPA 3KS2A 4GA1A 2ILRA 3FH7A 3I5PA 3ULQA 5E75A 1NA0A 2WQ7A 3NZUA 3VLDA 1EPUA 4AVXA 4I1OB 2CHWA 2BTDA 2BF0X 3MEKA 5T3RA 2J07A 3CK7A 4B8CB 4KMOA 1EYHA 3ASHA 3QK0A 3ZW3A 4JEUA 2YHCA 3PE3A 1PAQA 2OVFA 1H2VC 5J08A 3IEGA 3FP3A 5HQ8A 4F7AA 5EX0A 3L54A 3JQ1A 4K03A 4C0MA 5JHBA 2X38A 3KAEA 2XCBA 4P29A 4YVOA 3SNXA 4ABNA 3CGHA 3FUKA 4GCOA 4HOTA 3B7SA 4KYOB 1E8XA 3ASFA 4B89A 3G2VA 2JLBA 2MHKA 3ENEA 3PEUB 2I2OA 4UI9K 4MLPA 3B13A 3G2SA 4XE0A 5G55A 3SGHA 3HVEA 4XKCA 4IN3B 2WXPA 1NZNA 3CHOA 4PUCA 3SZ7A 1PY1A 3ESKA 5E76A 5ANLA 3RO3A 3IHVA 3FH5A 4CDMA 3FU5A 4CGVA 3CSFA 3D9MA 1JUQA 3MZLB 4UQYA 4FJYA 4JXTA 4L23A 1N52A 2AXVA 3OTNA 2VJ8A 4N2QA 4FHJA 3GZSA 4OYSA 4UWHA 3AS4A 3FTYA 3LY7A 4CDRA 2VSXE 3FU6A 4APOA 4BSXA 2NC9A 3AS8A 4WNEA 5FWQA 1UN9A 4Q94A 1TEZA 3L16A 4N3AA 3LPZA 4FA6A 4W9RA 1BPOA 5A7DB 1IYGA 3ZYMA 2Y3AA 3HYMB 4KBQA 1Y8MA 4HOSA 3TJPA 3CVNA 2LNIA 4ILGA 4L7TA 3CVYA 3ZHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAI A; 
#chains in the Genus database with same CATH topology
 5FQ6 A;  1HF8 A;  5BNW A;  5ENN A;  3CR3 A;  4BX8 A;  4OAV B;  2P9I G;  1DC2 A;  4DPR A;  4FP7 A;  5LX8 A;  5BV0 A;  4BER A;  3RAU A;  4CZ2 D;  2R2L A;  3APF A;  4WWN A;  3LDZ A;  4I6J A;  3PUJ A;  4GTP A;  4JEH A;  4H7X A;  3IXE A;  3FUD A;  4DLO A;  1TNZ A;  2GRP B;  2YNQ A;  3BG1 B;  3ULY A;  1NFI E;  2I9C A;  4O6F A;  1SA5 A;  3SY2 A;  3EJN A;  3D9N A;  3E32 A;  4J8S A;  3CQG B;  1EF1 C;  2CHZ A;  3PE4 A;  4J8Y A;  4BES A;  5AJL A;  2LAH A;  3IHY A;  5HRY A;  5ENQ D;  5H7P A;  2H6I A;  5G2N A;  3JCK C;  5AIJ A;  1OT8 A;  4ILH B;  4TRQ A;  3D9I A;  1Z6T A;  4YDY A;  5FZQ A;  1INZ A;  1FPP A;  1S70 B;  2FO1 E;  3HIZ A;  4JHK A;  4GZ5 A;  2IO3 C;  1W3B A;  2J9Q A;  2IFU A;  4JPS A;  2C2L A;  2RFM A;  1QNF A;  3SQV A;  3VLF A;  4GTV A;  3AG2 E;  1D9S A;  4AV7 A;  1TNU A;  4BSZ B;  3VTY A;  1SW6 A;  3FWV A;  4UWF A;  2XRZ A;  4G11 A;  2NSZ A;  3QNK A;  4WNG A;  5KNH D;  4RG6 A;  3ZYQ A;  3RSE G;  4DI3 A;  4HOQ A;  2XEE A;  1E8Z A;  2WXJ A;  3DSV A;  3MV3 B;  4U07 A;  4HQD A;  3Q9N C;  3R7R A;  1TN7 A;  4CT0 A;  4BEP A;  5BXO A;  4LUN U;  3V79 K;  2KCK A;  2FI7 A;  1HX8 A;  1UN8 A;  4Y6W A;  4WAF A;  4CGW A;  4AJW A;  4MS6 A;  2OV8 A;  4J8E A;  3KD7 A;  2VGX A;  3ZNG A;  4LSZ E;  2HM8 A;  4ZFH A;  3LS8 A;  2BKK B;  2L0I A;  4GMJ A;  1X81 A;  4BET A;  3EUV A;  4DRX E;  5LOZ A;  3SFZ A;  1MZC A;  3FUL A;  3CST A;  3UT4 A;  2XGO A;  4LNU D;  1N0Q A;  3OAW A;  5DIZ A;  4DI4 A;  2VTB A;  1IHG A;  3APD A;  3MA5 A;  4ANV A;  1TNY A;  4UQX A;  3LXU X;  5FTP A;  3CVL A;  5EYP F;  4GZC A;  4F1S A;  2J09 A;  3ASD A;  2GW1 A;  2I1J A;  1DCE A;  4CYM D;  5JJ7 A;  2DZO A;  2L0T B;  2P9K G;  2WXL A;  2VSY A;  3FU3 A;  4IRU A;  3P2B A;  5KNG A;  2PQR A;  4K0R A;  3UX4 A;  3FUJ A;  4A3T A;  1HXI A;  2WQ6 A;  2WXN A;  3QB2 A;  2VTB B;  3ZUV B;  4I6G A;  5D0Q D;  1N4P A;  1HO8 A;  2RG8 A;  4FJZ A;  4I1A A;  2FEZ A;  4N39 A;  1IQU A;  1YYH A;  3EU5 A;  4YDO A;  3CKC A;  2LO6 A;  2RFA A;  4EBA G;  4KVM A;  2I6H A;  3FTV A;  2GGF A;  4L9P A;  4ME2 A;  2J49 A;  4UWG A;  2XEV A;  3PZ3 A;  1WDY A;  2WXO A;  4ANX A;  1N54 A;  2Y1L E;  4GYO A;  1Z3Y A;  2RKK A;  3PRE A;  4EBA A;  1JCR A;  5KJN A;  3FEY A;  1H2U A;  3V31 A;  4JA9 A;  4XI0 A;  4I1M A;  1SA4 A;  3T5X A;  3ONK A;  2GRO B;  1Y6I A;  1LD7 A;  4KZ0 A;  3D3M A;  3PNL B;  4GA0 A;  1UOH A;  2XRY A;  2PM7 A;  4JA7 A;  2L9B A;  3CKB A;  2IOS A;  4J7W A;  4LER A;  1UJJ A;  4GAA A;  3QAQ A;  3Q79 A;  5IY5 E;  3W9F A;  1TN8 A;  3DSU A;  2E2E A;  2V4L A;  1YMP A;  4WND A;  3CHQ A;  5G05 C;  3CHR A;  3D9L A;  4DUI A;  4NAC A;  5EX3 A;  2F0Y A;  3L08 A;  4PH4 B;  1SZ9 A;  3FDH A;  2JEK A;  2V5F A;  4URK A;  3DWL G;  4GTQ A;  2XS8 A;  3WXX A;  4B0Z A;  1BI7 B;  3E37 A;  1BLX B;  3AAA C;  3I5P A;  2WQ7 A;  2V5Q C;  3NZU A;  5EIL A;  4B8C B;  3DXK G;  2IEJ A;  5J08 A;  2DVW A;  4YVO A;  4P29 A;  3UM0 A;  3CGH A;  4GCO A;  4HOT A;  1E8X A;  3ASF A;  4HLL A;  2JLB A;  3PEU B;  3ENE A;  5G55 A;  3HVE A;  1NZN A;  2F8X K;  2H6H A;  2VGE A;  1N9A A;  4JXT A;  1N52 A;  4GPM A;  2VJ8 A;  4FHJ A;  4OYS A;  4F6R D;  3LY7 A;  2VSX E;  3FU6 A;  4APO A;  2NC9 A;  1UN9 A;  3L16 A;  2EIN E;  1BPO A;  3C3O A;  1Y8M A;  4O1P A;  4GTR A;  1Z5S C;  3TJP A;  4L7T A;  4U8V D;  4UWL A;  3NAW A;  1BU9 A;  1K8K G;  1EDU A;  4GZ3 A;  4KZC A;  3MGB A;  3ZFW A;  3DXM G;  5JJ6 A;  3PNT B;  1U3D A;  4XX5 A;  1WM5 A;  3LJN A;  3AU4 A;  1E8W A;  3TWU A;  3UPV A;  3ZHE B;  3UKR G;  5KJL A;  3U4T A;  5A23 A;  1HG5 A;  3FFL A;  3RO2 A;  4UUC A;  4ACL A;  5ENR D;  4XI9 A;  4DX5 D;  2EIJ E;  4ANW A;  4FHK A;  2OVB A;  3JXJ A;  1PC2 A;  1HFA A;  1A17 A;  2LSV A;  1TJC A;  2OND A;  3Q15 A;  1KZO A;  3C98 A;  2YHE A;  1N11 A;  3E4B A;  3Q75 A;  5DBK A;  3ASG A;  4HNA D;  1FT1 A;  4U04 A;  2WXG A;  4JL0 A;  2NXP A;  3L22 A;  2J08 A;  4DLQ A;  3PZ2 A;  4AY6 A;  1ZU2 A;  1RZ4 A;  5BW8 C;  1B89 A;  3HVE B;  3CHS A;  1ZB1 A;  3B7R L;  2VQ2 A;  2LAI A;  3Q5M A;  3R7Q A;  3S2A A;  3JUE A;  5C2Y A;  3RRM B;  5FZR A;  1OWL A;  4OVV A;  4U96 D;  3FTS A;  4G24 A;  5CCM A;  1QQE A;  2EIM E;  3PRZ A;  3ZVV A;  2ZU6 B;  4HI8 A;  3W9G A;  2C0M A;  3HRA A;  5D2M C;  3QAR A;  2M63 A;  2FO7 A;  1FCH A;  4KXK B;  1FVF A;  2P2C P;  3TWV A;  3QC1 A;  4D10 C;  2UY1 A;  2P9N G;  3BG0 B;  4RLY A;  2VYI A;  2QYJ A;  2H6F A;  4GCN A;  1UG3 A;  3CK9 A;  1E96 B;  2F37 A;  1N95 A;  1SQM A;  3OXG A;  2XGM A;  5T4Y A;  2DIW A;  5JHA A;  3R9M A;  2KCL A;  3Q4A B;  2P9U G;  3URZ A;  4CDN A;  2UWJ G;  4FLH A;  4GTS A;  2XPY A;  3UM1 A;  1YCS B;  2L6J A;  1OWO A;  3PZD A;  3ZEF A;  3WG7 E;  1S63 A;  1DNP A;  4U7E B;  5FQ7 A;  3SHF A;  4U8H A;  3B7T A;  5AEN A;  3GZ1 A;  2WB2 A;  1SVX A;  2R59 A;  3EHM A;  4PS3 A;  4KVO A;  4N2S A;  2AW6 A;  5FT9 A;  1OCO E;  3E34 A;  1BI8 B;  4KT6 B;  2Q7F A;  4BTA A;  1E7V A;  3ZYL A;  5CER B;  1AP7 A;  2P9P G;  3FTW A;  3RJV A;  2WMO A;  4EPZ A;  3ABM E;  2Y4T A;  3BQO A;  5FIN A;  2V8S E;  4PDX A;  2WXR A;  3LJ3 A;  2ETB A;  4J8F A;  1E7U A;  4PS7 A;  4I43 A;  2KM4 A;  4BY6 A;  3PS6 A;  1ELK A;  4TXQ A;  4GU5 A;  4U0U A;  4EEC A;  4GML A;  2X6K A;  4I6E A;  4CEM A;  4XIF A;  3FUI A;  1WG0 A;  3NQP A;  3JQ0 A;  3ZU7 B;  3QKY A;  2R02 A;  4HB5 A;  1JCQ A;  2R17 C;  3C5R A;  4HFG A;  3CVV A;  3TG4 A;  3FUM A;  3ABL E;  5G04 J;  5G04 C;  4LCT A;  2XHE A;  4AP2 A;  5EDS A;  4U8Y D;  3EHQ A;  4YDE A;  4UI9 J;  3TWS A;  3KEZ A;  5AJD A;  2R05 A;  3MYV A;  1SZA A;  2XCC A;  3BEE A;  2P9L G;  1XNF A;  2A5U A;  5FQ8 A;  1MX4 A;  3O48 A;  3LY8 A;  2V0P A;  4FUL A;  5CEA A;  3DSX A;  4ANU A;  2GRL A;  3FUE A;  3ULE G;  4AY5 A;  2LUH A;  4NQ0 A;  5C1D A;  3V2O A;  3NZS A;  3PZ1 A;  2A4Z A;  3ZXS A;  2UY1 B;  3S7F A;  5ANR A;  3NOC D;  1H6O A;  3HHM A;  1TJF A;  3DSW A;  4FC8 A;  3ZRH A;  1NA3 A;  3P1U A;  2VSO E;  3ASO E;  4HRM B;  4N3B A;  4Q96 A;  3APC A;  3L6A A;  4B93 B;  4N5C A;  3CVX A;  2GRQ B;  1ZBP A;  4GA1 A;  5ENO D;  3VLD A;  3HXD A;  2LXM A;  2BTD A;  2J07 A;  4KMO A;  1EYH A;  3ASH A;  3QK0 A;  3ZW3 A;  4C48 B;  1LD8 A;  3IEG A;  3FP3 A;  3BUA A;  5JHB A;  3SNX A;  2XCB A;  3C3Q A;  1IXV A;  4O60 A;  3B7S A;  4KYO B;  4B89 A;  2MHK A;  4RQI A;  2DYR E;  3B13 A;  3G2S A;  3SGH A;  4XKC A;  2WXP A;  4PUC A;  3ESK A;  3FH5 A;  4CGV A;  3CSF A;  4K5A B;  4UQY A;  3T8K A;  1V54 E;  3OTN A;  3GZS A;  4BSX A;  1Q2Z A;  4HBD A;  4WNE A;  5EID A;  4W9R A;  5D66 A;  4KBQ A;  4ILG A;  3NOG D;  1MJ0 A;  4AM9 A;  5AQ9 A;  1VDY A;  5AQA A;  1WY6 A;  4MKT A;  2IQC A;  3CK8 A;  3TL5 A;  3I4G A;  3HXB A;  3FHE A;  1HU3 A;  4UQZ A;  3C3R A;  1FT2 A;  3IKO B;  3CIA A;  4GZD A;  3AG3 E;  4B94 A;  2GRN B;  2FBN A;  2R5S A;  4G2V A;  2XEH A;  2ZIR A;  3HXE A;  1H0A A;  3X2Q E;  3CVQ A;  3RIB A;  4H7Y A;  5CRV A;  1K1B A;  4HLE A;  2VGX B;  1V55 E;  3DSS A;  4A63 B;  4ILI A;  1U3C A;  3MJW A;  4A1S A;  4AIF A;  3CHP A;  1KT1 A;  2XEN A;  4DX1 A;  2IJG X;  3ML8 A;  3ZYK A;  4EZL A;  3TGO A;  2YQ8 A;  4GTO A;  4TUM A;  4WUY A;  3LYA A;  4LNB A;  1OWN A;  3Q73 A;  3CVP A;  4F3V A;  1JWF A;  3MKQ A;  4GTT A;  4DK5 A;  5M72 A;  3SFY A;  4WNF A;  2QFC A;  3T8M A;  4A3V A;  1N4Q A;  4N5Q A;  1S0P A;  3ZKJ A;  2DCP A;  4WWO A;  1TR4 A;  3HDX A;  1AWC B;  1H19 A;  3AG1 E;  3PH0 C;  1IQR A;  4FU3 A;  4IUL A;  2PQN A;  3KSL A;  3QJZ A;  1LF8 A;  3K9I A;  3RKV A;  2CG3 A;  3NF1 A;  3FTZ A;  3PEV B;  3QDN A;  5BUZ A;  3B95 A;  2QC9 A;  3PZ4 A;  4EZJ A;  1MX6 A;  2X6F A;  3I3N A;  4BTB A;  1O1R A;  1N4R A;  5AAR A;  3AS5 A;  1FVH A;  4L1B A;  3LVR E;  2KZT A;  4C9B B;  4CCA A;  4J0U A;  2AXU A;  3DRA A;  2GRR B;  1KLX A;  5AYW D;  2LXL A;  1HG2 A;  3FH8 A;  4DX6 D;  2MOW A;  4HXI A;  4J6I A;  3DPD A;  3Q47 B;  3G2T A;  4I2Z A;  2YIN A;  2V4H C;  2XZT G;  1OCZ E;  5EYL A;  4QQI A;  1OCR E;  3DST A;  4R7L A;  2IO2 C;  4YDW A;  4U95 D;  3LKU A;  1JCS A;  2AXZ A;  3GYZ A;  5BT1 A;  3F6Q A;  2IU1 A;  3GW4 A;  4NRH B;  4G8L A;  2XPI A;  4Y6C A;  5CED B;  3CQC B;  3EIJ A;  5BPP A;  3TWT A;  2WXH A;  3O4Z A;  1DVP A;  2ETC A;  2E0I A;  4FLB A;  3UMV A;  4AOF A;  3UT8 A;  1H2T C;  5D0O D;  2WXQ A;  2C0L A;  3AU5 A;  3MKR A;  4GPK A;  3TWX A;  3UM2 A;  1HH8 A;  3UIP C;  4ATZ D;  1OWM A;  3L13 A;  3TWW A;  2BUG A;  4I17 A;  3RRU A;  3MV2 B;  2X6I A;  4G23 A;  3LY9 A;  1NL4 A;  2WQH A;  5FQ4 A;  3D9K A;  3U64 A;  3ONL A;  5KJM A;  3EDT B;  3LEW A;  4AEZ C;  3UKU G;  2PL2 A;  4FAD A;  2PZI A;  4BWR A;  1HS6 A;  3Q78 A;  1BD8 A;  3C72 A;  2KAT A;  2EQX A;  5AQ7 A;  5EIB E;  3KSQ A;  4TXR A;  1N94 A;  4F53 A;  4DX7 D;  2DWZ A;  1H6P A;  3FY4 A;  3SI5 A;  3ZGQ A;  4YND A;  3OXL A;  4JVS A;  1OUV A;  3D9O A;  3Q9U C;  4EZK A;  4JZY A;  5A6C A;  2X3M A;  4G26 A;  3GZ2 A;  4CRW A;  3D9H A;  3R9A B;  3U3W A;  4TUU A;  2KZT B;  3CHM A;  4AXH A;  3DPY A;  2FF4 A;  1GW6 A;  1IHB A;  5KCM A;  5HS0 A;  2FUL A;  3V30 A;  2X6H A;  3ASN E;  5CMW A;  4RVB A;  3SF4 A;  3RU0 A;  5CHE E;  5B1B E;  2QZA A;  2PNN A;  3UT7 A;  4V3I A;  3TXM A;  3E30 A;  3CVU A;  4BT9 A;  4GZ6 A;  4MRU A;  4GB9 A;  4Q69 A;  2AVP A;  3KS2 A;  2ILR A;  3ULQ A;  5E75 A;  1OXJ A;  4K5C A;  3JXI A;  5ENS D;  1NI1 A;  2CHW A;  2BF0 X;  3MEK A;  5T3R A;  3CK7 A;  4JEU A;  2OEV A;  2YHC A;  1PAQ A;  3J5P A;  3Q7F A;  1H2V C;  2ZIS A;  2ZXW E;  5EX0 A;  3JQ1 A;  4C0M A;  2X38 A;  4GTM A;  1A5E A;  3FUK A;  3G2V A;  4MLP A;  2IY0 C;  3DEP A;  5E76 A;  5KWD A;  3TWQ A;  3MZL B;  4FJY A;  2AXV A;  4UWH A;  2HE0 A;  3AS4 A;  4Q94 A;  4N3A A;  4FA6 A;  3SO8 A;  2H6G A;  1IYG A;  3ZYM A;  3ABK E;  1OY3 D;  4HOS A;  3CVY A;  1G3N B;  2XZD G;  1NP7 A;  3UUX A;  3TXN A;  2XGS A;  1HZ4 A;  3V2X A;  4N3C A;  3Q49 B;  1ELW A;  2Y0B G;  3FEX A;  3MKQ B;  2ION A;  3SBS A;  3T5V A;  3RRN B;  4TXP A;  3ZXP A;  3FUN A;  2X6J A;  4GMR A;  1IKN D;  4U63 A;  2CFU A;  3G2U A;  4OVU A;  3B7U X;  1KT0 A;  2CHX A;  2HYZ A;  1YA0 A;  4I9C A;  1UJK A;  2DBA A;  5BV1 A;  2WPV A;  3TG5 A;  3LCA A;  2ZGG A;  2KCV A;  2BED A;  4YVQ C;  2KBX A;  4XZ4 A;  4NIK A;  4HS2 A;  4J8D A;  3OXF A;  3D9J A;  1QYM A;  4CT4 A;  3CV0 A;  4EQF A;  4E85 A;  2JAB A;  1WAO 1;  3D9P A;  2WVI A;  4M3O A;  1KPS B;  2LSU A;  2OOE A;  3Q7A A;  4G1T A;  1N0R A;  5JJT A;  2P58 C;  3ML9 A;  1UW4 B;  4XKB A;  3ZN3 A;  3EIQ C;  4MBG A;  2WXF A;  4G8K A;  2RD0 A;  3G2W A;  3PUK A;  2IOL A;  1JWG A;  5CEC B;  3QWV A;  1QBQ A;  5J90 A;  4X8Q A;  4JB8 P;  3EU9 A;  2J4D A;  5ITZ F;  1MQS A;  5T8I A;  2HR2 A;  2BKG A;  5CCL A;  4JHJ A;  4IYP A;  2B6C A;  3CEQ A;  4JW1 A;  4LEU A;  5G05 J;  4PS8 A;  5LCW C;  2L6B A;  3EHR A;  3SFX A;  1E8Y A;  4LG6 A;  1OCC E;  1ELR A;  3KEA A;  3JYS A;  3SD5 A;  4L2Y A;  2I1K A;  3S7J A;  3IV0 A;  3DEO A;  4DJA A;  2P9S G;  1TN6 A;  5B1A E;  2EIK E;  2WXM A;  1Z3X A;  4I9E A;  3PVL A;  5HKP A;  3EHN A;  2VSN A;  3UIO C;  2MRI A;  2OCC E;  2DYS E;  4RG9 A;  5CMY A;  2AJA A;  3I4R B;  3ISM C;  5AQB A;  3QOU A;  4GYY A;  4HOU A;  3UM3 A;  5ARF A;  2WM9 A;  4U0S A;  4NUR A;  5HI7 A;  1H6K A;  3FU0 A;  3MX3 A;  3SBT B;  4BX9 A;  4I2W A;  1RW2 A;  5JMN D;  3CVW A;  1QZ2 A;  4JHR A;  4LRZ A;  1E90 A;  3UI2 A;  4HRL A;  3L9T A;  3ESL A;  4OAU C;  3MCX A;  3L17 A;  3S7B A;  3IBE A;  4HVB A;  5B3S E;  4GA2 A;  3LVQ E;  5LFA A;  4JD2 G;  3CLJ A;  4HOR A;  4G25 A;  1O1S A;  5KJK A;  2PM6 A;  3N71 A;  4A55 A;  1OWP A;  1X5B A;  2Y4U A;  4DX2 A;  3FUH A;  4UWK A;  1LTX A;  1TNB A;  2J4B A;  3ZIM A;  2NYJ A;  3BU8 A;  1S64 A;  1DCQ A;  5CRU A;  3L82 A;  5BXU A;  3AJI A;  2GRM A;  2Y69 E;  4WWP A;  4JC8 A;  4O1O A;  2XQ0 A;  2F8Y A;  4E6H A;  4RSY A;  1U2V G;  3FTX A;  1K1A A;  1XGW A;  2DZN A;  3QWW A;  3ZPJ A;  4ZHB A;  5ARG A;  5ENP D;  3VTX A;  3UXG A;  3UQ3 A;  1O5M A;  3RK6 A;  4QFV A;  2WXI A;  3DBS A;  4A1G A;  1P5Q A;  4BT8 A;  1MYO A;  1TNO A;  4APF A;  4TV3 A;  3U9W A;  4ACK A;  4B8A A;  4C0E A;  2VGY A;  3U66 A;  4ATG A;  5CBO A;  5CBN A;  3JUI A;  2AWI A;  3J5Q B;  5EKQ D;  3T9K A;  2KC7 A;  2OEW A;  2B0O E;  3TAX A;  1O1T A;  2R03 A;  1MHQ A;  1D8E A;  4U0Z A;  4UI9 C;  3TWR A;  2WMN A;  4HRN A;  2ZGD A;  5JA4 D;  4L2L A;  4BFR A;  2CFZ A;  5LP0 A;  4K5B A;  4LNG A;  1D8D A;  2IF4 A;  3VLE A;  1JPL A;  2QY7 A;  3QWP A;  2XS1 A;  5FJY A;  5FZS A;  3UIN C;  4GYW A;  5LCW J;  5ENT D;  3HG0 D;  4EHM A;  5KBA A;  4M7C A;  3AG4 E;  2MYO A;  2KXP C;  1KZP A;  1HE8 A;  1L5J A;  3FTU A;  3PDN A;  3S7D A;  3FUF A;  3UTM A;  3NBN B;  2WXK A;  3B7B A;  2HO1 A;  2CG2 A;  2XPZ A;  2EIL E;  1K3Z D;  3FH7 A;  1NA0 A;  3HXF A;  1EPU A;  4XEI G;  4AVX A;  4I1O B;  5EN5 D;  4F1P A;  3PE3 A;  2QYU A;  2OVF A;  3E33 A;  5HQ8 A;  4F7A A;  3L54 A;  4K03 A;  4Z68 A;  3KAE A;  5FIO A;  4ABN A;  1TYQ G;  4HI9 A;  4UI9 K;  2I2O A;  3NB2 A;  4XE0 A;  4IN3 B;  5AN8 A;  3CHO A;  3SZ7 A;  1PY1 A;  5ANL A;  3RO3 A;  2A5E A;  3IHV A;  4CDM A;  3FU5 A;  3D9M A;  3HXC A;  1JUQ A;  4L23 A;  1MX2 A;  4N2Q A;  2J8S D;  3FTY A;  4CDR A;  2ETA A;  3AS8 A;  5FWQ A;  5AAO A;  1TEZ A;  3LPZ A;  5A7D B;  2Y3A A;  3HYM B;  1N4S A;  3CVN A;  2LNI A;  3ZHE A; 
#chains in the Genus database with same CATH homology
 5FQ6 A;  4AM9 A;  1VDY A;  4UWL A;  1HF8 A;  1NP7 A;  3UUX A;  1WY6 A;  3TXN A;  2XGS A;  4MKT A;  1HZ4 A;  5BNW A;  2IQC A;  1EDU A;  3CK8 A;  1ELW A;  3Q49 B;  3CR3 A;  4N3C A;  4GZ3 A;  4KZC A;  5ENN A;  3I4G A;  3TL5 A;  4BX8 A;  3MGB A;  3ZFW A;  3FHE A;  3FEX A;  4DPR A;  3MKQ B;  1HU3 A;  4FP7 A;  4UQZ A;  5BV0 A;  5JJ6 A;  2ION A;  5LX8 A;  3IKO B;  3CIA A;  3PNT B;  3SBS A;  3T5V A;  4GZD A;  3RRN B;  1U3D A;  3APF A;  4XX5 A;  1WM5 A;  4WWN A;  4B94 A;  3FUN A;  3AU4 A;  1E8W A;  2X6J A;  3LDZ A;  2FBN A;  3UPV A;  2R5S A;  4G2V A;  3ZHE B;  4I6J A;  3PUJ A;  4U63 A;  5KJL A;  2CFU A;  3G2U A;  3U4T A;  4JEH A;  1H0A A;  5A23 A;  1HG5 A;  3FFL A;  4H7X A;  3RO2 A;  4OVU A;  3CVQ A;  3RIB A;  3B7U X;  3FUD A;  4DLO A;  4ACL A;  1KT0 A;  2CHX A;  4H7Y A;  4XI9 A;  2HYZ A;  1YA0 A;  4I9C A;  2YNQ A;  4ANW A;  4HLE A;  2VGX B;  3BG1 B;  4FHK A;  2I9C A;  1UJK A;  2OVB A;  4ILI A;  1U3C A;  3MJW A;  2DBA A;  4A1S A;  2WPV A;  1PC2 A;  3TG5 A;  4AIF A;  5BV1 A;  3LCA A;  2KCV A;  1HFA A;  1A17 A;  4O6F A;  4YVQ C;  2LSV A;  4XZ4 A;  3CHP A;  3EJN A;  3D9N A;  1KT1 A;  1TJC A;  4HS2 A;  4J8D A;  2OND A;  3OXF A;  3Q15 A;  3D9J A;  2IJG X;  4CT4 A;  3ML8 A;  3CV0 A;  3ZYK A;  4EZL A;  3C98 A;  3TGO A;  2YHE A;  2YQ8 A;  4J8S A;  4EQF A;  3CQG B;  3E4B A;  4E85 A;  1WAO 1;  3D9P A;  1EF1 C;  2CHZ A;  4WUY A;  5DBK A;  3LYA A;  3PE4 A;  3ASG A;  1OWN A;  4F3V A;  3CVP A;  4U04 A;  2WVI A;  2WXG A;  4JL0 A;  4M3O A;  5AJL A;  2LSU A;  2NXP A;  2OOE A;  2LAH A;  3L22 A;  4G1T A;  1JWF A;  3MKQ A;  5JJT A;  3IHY A;  2P58 C;  3ML9 A;  1UW4 B;  4XKB A;  3ZN3 A;  5G2N A;  3EIQ C;  2J08 A;  2WXF A;  3JCK C;  5AIJ A;  2RD0 A;  3G2W A;  3PUK A;  4ILH B;  2IOL A;  4DLQ A;  4DK5 A;  4TRQ A;  1ZU2 A;  5M72 A;  4AY6 A;  1JWG A;  3D9I A;  3QWV A;  5BW8 C;  4WNF A;  1Z6T A;  5J90 A;  1B89 A;  5FZQ A;  2QFC A;  1INZ A;  3HVE B;  3CHS A;  3T8M A;  4A3V A;  3HIZ A;  2J4D A;  1MQS A;  5T8I A;  3B7R L;  2VQ2 A;  2LAI A;  2HR2 A;  4GZ5 A;  1S0P A;  4JHK A;  3Q5M A;  5CCL A;  1W3B A;  2DCP A;  4JHJ A;  4WWO A;  2J9Q A;  3HDX A;  4IYP A;  3R7Q A;  3S2A A;  5C2Y A;  2IFU A;  3CEQ A;  1H19 A;  3RRM B;  4JW1 A;  3PH0 C;  5FZR A;  1IQR A;  4LEU A;  1OWL A;  4FU3 A;  4IUL A;  4OVV A;  4JPS A;  5G05 J;  2PQN A;  2C2L A;  3QJZ A;  1LF8 A;  4PS8 A;  5LCW C;  3FTS A;  3K9I A;  3RKV A;  1QNF A;  4G24 A;  5CCM A;  2CG3 A;  1QQE A;  3NF1 A;  3PRZ A;  3ZVV A;  2ZU6 B;  3VLF A;  1E8Y A;  3FTZ A;  3PEV B;  2C0M A;  3QDN A;  4AV7 A;  3QAR A;  1ELR A;  2M63 A;  2FO7 A;  5BUZ A;  3VTY A;  3JYS A;  1FCH A;  4KXK B;  3FWV A;  1FVF A;  4UWF A;  2XRZ A;  4G11 A;  2NSZ A;  3QC1 A;  3QNK A;  2I1K A;  4L2Y A;  3SD5 A;  4EZJ A;  4D10 C;  4WNG A;  2UY1 A;  3BG0 B;  3S7J A;  2X6F A;  4RG6 A;  3I3N A;  3ZYQ A;  3IV0 A;  4BTB A;  4DJA A;  2VYI A;  3AS5 A;  4GCN A;  2WXM A;  1Z3X A;  4DI3 A;  4I9E A;  1FVH A;  4L1B A;  1UG3 A;  3CK9 A;  3PVL A;  4HOQ A;  1E96 B;  1E8Z A;  3EHN A;  2WXJ A;  2VSN A;  3LVR E;  2KZT A;  3MV3 B;  4C9B B;  2MRI A;  4U07 A;  4RG9 A;  5CMY A;  4CCA A;  3I4R B;  4J0U A;  3R7R A;  2AXU A;  1SQM A;  3QOU A;  4GYY A;  4HOU A;  1KLX A;  5ARF A;  5AYW D;  3OXG A;  2XGM A;  4CT0 A;  5T4Y A;  2WM9 A;  1HG2 A;  4U0S A;  3FH8 A;  4LUN U;  2DIW A;  2KCK A;  2MOW A;  4NUR A;  5HI7 A;  1H6K A;  5JHA A;  2FI7 A;  3FU0 A;  3MX3 A;  3SBT B;  4HXI A;  4BX9 A;  4J6I A;  1HX8 A;  1UN8 A;  2KCL A;  3DPD A;  3Q47 B;  4I2W A;  4Y6W A;  4WAF A;  4CGW A;  3Q4A B;  3G2T A;  3URZ A;  4I2Z A;  4AJW A;  4MS6 A;  2OV8 A;  3CVW A;  4CDN A;  1QZ2 A;  2YIN A;  4JHR A;  4J8E A;  4LRZ A;  2UWJ G;  3KD7 A;  4FLH A;  2VGX A;  1E90 A;  2XPY A;  3ESL A;  2HM8 A;  3LS8 A;  2L6J A;  2L0I A;  4GMJ A;  1OWO A;  3MCX A;  3PZD A;  3L17 A;  3S7B A;  3IBE A;  4R7L A;  3ZEF A;  1DNP A;  4HVB A;  5FQ7 A;  4GA2 A;  5LOZ A;  3LVQ E;  3SFZ A;  3SHF A;  3FUL A;  4U8H A;  3B7T A;  5AEN A;  3CST A;  3CLJ A;  3GZ1 A;  5LFA A;  2WB2 A;  4HOR A;  2R59 A;  3UT4 A;  3EHM A;  4G25 A;  3LKU A;  2XGO A;  5KJK A;  4PS3 A;  2PM6 A;  4KVO A;  2AXZ A;  3GYZ A;  3N71 A;  4A55 A;  4N2S A;  2AW6 A;  5BT1 A;  5FT9 A;  2IU1 A;  3GW4 A;  1OWP A;  4NRH B;  1X5B A;  2XPI A;  3OAW A;  4Y6C A;  5DIZ A;  4DI4 A;  2Y4U A;  4KT6 B;  3CQC B;  1IHG A;  3APD A;  3FUH A;  3MA5 A;  2J4B A;  2Q7F A;  4UWK A;  4ANV A;  4BTA A;  2VTB A;  4UQX A;  3LXU X;  3EIJ A;  5FTP A;  1E7V A;  3CVL A;  3ZIM A;  3ZYL A;  4GZC A;  5BPP A;  4F1S A;  2J09 A;  2WXH A;  3O4Z A;  3ASD A;  2GW1 A;  2I1J A;  3FTW A;  3RJV A;  5JJ7 A;  1DVP A;  2GRM A;  4WWP A;  2L0T B;  2E0I A;  2WMO A;  2VSY A;  2WXL A;  4FLB A;  4JC8 A;  3UMV A;  4AOF A;  3UT8 A;  4EPZ A;  2Y4T A;  3FU3 A;  1H2T C;  2V8S E;  4IRU A;  2XQ0 A;  4PDX A;  3P2B A;  2WXR A;  5D0O D;  4E6H A;  2WXQ A;  3LJ3 A;  2C0L A;  4J8F A;  3AU5 A;  1E7U A;  4RSY A;  2PQR A;  4K0R A;  3MKR A;  3FUJ A;  4PS7 A;  3FTX A;  2KM4 A;  4I43 A;  3UX4 A;  4A3T A;  4GPK A;  4BY6 A;  1XGW A;  1HH8 A;  1HXI A;  3PS6 A;  3QWW A;  1ELK A;  1OWM A;  4GU5 A;  3ZPJ A;  3L13 A;  5ARG A;  2BUG A;  4I17 A;  3RRU A;  3VTX A;  3MV2 B;  4U0U A;  2X6I A;  4EEC A;  4G23 A;  3UQ3 A;  2WXN A;  4GML A;  2WQ6 A;  3LY9 A;  3RK6 A;  2X6K A;  4I6E A;  3QB2 A;  2WQH A;  2VTB B;  4QFV A;  5FQ4 A;  2WXI A;  3DBS A;  4A1G A;  1P5Q A;  3D9K A;  3U64 A;  4BT8 A;  3ONL A;  4CEM A;  4I6G A;  5D0Q D;  5KJM A;  4XIF A;  3FUI A;  4APF A;  3EDT B;  1HO8 A;  2RG8 A;  4FJZ A;  3NQP A;  4TV3 A;  3LEW A;  3U9W A;  4AEZ C;  2PL2 A;  3JQ0 A;  4FAD A;  4ACK A;  4I1A A;  3QKY A;  2FEZ A;  2PZI A;  2R17 C;  4BWR A;  1HS6 A;  1IQU A;  4N39 A;  4B8A A;  4HFG A;  3CKC A;  2LO6 A;  4C0E A;  2VGY A;  3TG4 A;  4EBA G;  3CVV A;  3FUM A;  2KAT A;  2EQX A;  4ATG A;  3U66 A;  4KVM A;  5G04 J;  2I6H A;  3JUI A;  2AWI A;  5EKQ D;  5G04 C;  2KC7 A;  3FTV A;  4LCT A;  2XHE A;  4F53 A;  2GGF A;  4AP2 A;  4ME2 A;  5EDS A;  2J49 A;  3TAX A;  4UWG A;  2XEV A;  3FY4 A;  4UI9 J;  1MHQ A;  3KEZ A;  4U0Z A;  4UI9 C;  3SI5 A;  2WXO A;  3ZGQ A;  4ANX A;  5AJD A;  1N54 A;  2WMN A;  3MYV A;  4GYO A;  1SZA A;  4YND A;  1Z3Y A;  2XCC A;  3OXL A;  3PRE A;  3BEE A;  4JVS A;  1OUV A;  3D9O A;  1XNF A;  2A5U A;  5FQ8 A;  4L2L A;  4EBA A;  4EZK A;  5KJN A;  3O48 A;  4BFR A;  3FEY A;  2CFZ A;  1H2U A;  5LP0 A;  4JZY A;  4JA9 A;  4XI0 A;  5A6C A;  3LY8 A;  2X3M A;  4G26 A;  3GZ2 A;  2V0P A;  4I1M A;  4FUL A;  3T5X A;  3ONK A;  2IF4 A;  4CRW A;  3R9A B;  1Y6I A;  4ANU A;  3U3W A;  4TUU A;  2GRL A;  2KZT B;  3FUE A;  4AY5 A;  3CHM A;  4KZ0 A;  3D3M A;  3PNL B;  4GA0 A;  4NQ0 A;  5C1D A;  3VLE A;  4AXH A;  1JPL A;  2FF4 A;  2PM7 A;  2QY7 A;  2XRY A;  2L9B A;  3CKB A;  2IOS A;  3NZS A;  1GW6 A;  2A4Z A;  4JA7 A;  3QWP A;  4LER A;  5FJY A;  1UJJ A;  5FZS A;  5KCM A;  4GAA A;  3ZXS A;  2UY1 B;  3QAQ A;  4GYW A;  5LCW J;  3S7F A;  5ANR A;  2FUL A;  2E2E A;  2V4L A;  2X6H A;  5CMW A;  4WND A;  4RVB A;  3SF4 A;  3CHQ A;  3RU0 A;  5CHE E;  3HHM A;  5G05 C;  1HE8 A;  1TJF A;  3CHR A;  1L5J A;  3D9L A;  4FC8 A;  3ZRH A;  3FTU A;  3PDN A;  4NAC A;  5EX3 A;  3S7D A;  1NA3 A;  3FUF A;  3P1U A;  3UT7 A;  4V3I A;  2VSO E;  3TXM A;  3L08 A;  2WXK A;  4N3B A;  1SZ9 A;  4PH4 B;  4Q96 A;  3CVU A;  4BT9 A;  2HO1 A;  3APC A;  3FDH A;  3L6A A;  2CG2 A;  2JEK A;  2V5F A;  2XPZ A;  4GB9 A;  4GZ6 A;  4MRU A;  4Q69 A;  4URK A;  2AVP A;  4N5C A;  3CVX A;  3WXX A;  4B0Z A;  1ZBP A;  3KS2 A;  4GA1 A;  2ILR A;  3FH7 A;  3I5P A;  3ULQ A;  5E75 A;  1NA0 A;  2WQ7 A;  3NZU A;  3VLD A;  1EPU A;  4AVX A;  4I1O B;  2CHW A;  2BTD A;  2BF0 X;  3MEK A;  5T3R A;  2J07 A;  3CK7 A;  4B8C B;  4KMO A;  1EYH A;  3ASH A;  3QK0 A;  3ZW3 A;  4JEU A;  2YHC A;  3PE3 A;  1PAQ A;  2OVF A;  1H2V C;  5J08 A;  3IEG A;  3FP3 A;  5HQ8 A;  4F7A A;  5EX0 A;  3L54 A;  3JQ1 A;  4K03 A;  4C0M A;  5JHB A;  2X38 A;  3KAE A;  2XCB A;  4P29 A;  4YVO A;  3SNX A;  4ABN A;  3CGH A;  3FUK A;  4GCO A;  4HOT A;  3B7S A;  4KYO B;  1E8X A;  3ASF A;  4B89 A;  3G2V A;  2JLB A;  2MHK A;  3ENE A;  3PEU B;  2I2O A;  4UI9 K;  4MLP A;  3B13 A;  3G2S A;  4XE0 A;  5G55 A;  3SGH A;  3HVE A;  4XKC A;  4IN3 B;  2WXP A;  1NZN A;  3CHO A;  4PUC A;  3SZ7 A;  1PY1 A;  3ESK A;  5E76 A;  5ANL A;  3RO3 A;  3IHV A;  3FH5 A;  4CDM A;  3FU5 A;  4CGV A;  3CSF A;  3D9M A;  1JUQ A;  3MZL B;  4UQY A;  4FJY A;  4JXT A;  4L23 A;  1N52 A;  2AXV A;  3OTN A;  2VJ8 A;  4N2Q A;  4FHJ A;  3GZS A;  4OYS A;  4UWH A;  3AS4 A;  3FTY A;  3LY7 A;  4CDR A;  2VSX E;  3FU6 A;  4APO A;  4BSX A;  2NC9 A;  3AS8 A;  4WNE A;  5FWQ A;  1UN9 A;  4Q94 A;  1TEZ A;  3L16 A;  4N3A A;  3LPZ A;  4FA6 A;  4W9R A;  1BPO A;  5A7D B;  1IYG A;  3ZYM A;  2Y3A A;  3HYM B;  4KBQ A;  1Y8M A;  4HOS A;  3TJP A;  3CVN A;  2LNI A;  4ILG A;  4L7T A;  3CVY A;  3ZHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...