2LAOA

Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
238
structure length
238
Chain Sequence
ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of the periplasmic lysine/arginine/ornithine-binding protein with and without a ligand.
pubmed rcsb
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
molecule tags Amino-acid binding protein
source organism Salmonella typhimurium
total genus 80
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2laoA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2laoA02
1M5DA 4JSOA 4LZ5A 3MZBA 3TDJA 2PMSA 4OFLA 1LBBA 3MPKA 1MY1A 2R6GE 1MQGA 1MH3A 1SYIA 5TP9A 3CR9A 4YICA 4BDOA 2FA7A 1USYE 2OBGA 3MVYA 2DP8A 3ONMA 4FE8A 4F3GA 2DWIA 4R6KA 2AIXA 3P7IA 3ILTB 4ZS9A 3EF7A 3FASA 2IEEA 1MXVA 1GV8A 2DVZA 1ZIUA 2O68A 2DWAA 3W9WA 4F19A 2D3IA 3DELB 1Z7NE 3UORA 3PPQA 1NMUA 3K6XA 1XVXA 2ZNSA 1B3FA 2G29A 5JTYB 5AA2D 3O6HA 1B3GA 1DPEA 3FV2A 3T96B 2AL4A 4GF8A 4IO5A 3LSXA 3FJGA 3CSBA 3K01A 1P1OA 3IR1A 3PV0E 2H99A 3CG1A 3W15C 4O3BA 1Y9UA 4EQBA 3S9MC 3MWBA 3MAMA 2PT1A 4G8NA 4JB7A 3R26A 1Q1KA 1B1HA 4QFLA 2FNCA 4DXUA 2X7QA 2GRVA 3V5AA 3FATA 1SYHA 2H25A 4P11A 1MM7A 3EHTA 3T9VA 1BIYA 4GLIA 1AH5A 1LFIA 2NUVA 5H8FA 2I4BA 4O3AA 1Q35A 3JZJA 1I6AA 2QRYA 3KG2A 3MQ9A 1RYXA 5ICTA 3Q28A 1FQCA 4RYAA 4PP0A 1HSEA 1NNFA 3K1PA 3H06B 1MPBA 3IAZA 1H43A 3K00A 1QUIA 1P1QA 1LFGA 3GXAA 1OLAA 4YKKA 4NF8B 2GHBA 3OSRA 4E0WA 4AQ4A 2F34A 4DLDA 3FUZA 3IJOB 1VR5A 5JTYA 1S9TA 3UP9A 1B3EA 2Y7WA 1NH7A 1I69A 1N0TA 2DVCA 3DP6A 4QRZA 5AA4A 1GVCA 3MP8A 3MVXA 2XD2A 2F35A 3VDFA 4PQJA 5KDTA 2V25A 2DXRA 2V3QA 2RKMA 2PT2A 4BDRA 3IO6A 4HCWA 1D9YA 3DLNA 1HSJA 3FIRA 5FHMA 4LP2B 3Q29A 4OTEA 1ZMGA 4ZEKA 3C33A 5EHMA 1B05A 1MY0A 3H6WA 3M3KA 2YJPA 3UIFA 1B3LA 3FVNA 4XIGQ 3AXFA 4FECA 3IB1A 4E0XA 1I6QA 3B7DA 1BLFA 2DSFA 1EH3A 4Q30B 3L6HA 4JBZA 1A7LA 3EHUA 1N04A 3U1OA 4TLMB 3S4UA 1SDXA 3TODA 1JQFA 5KCJB 3IOTA 3M3FA 3IJXB 2F7BA 2ZNUA 3TTNA 3HN0A 4XXUA 3Q26A 4FEBA 2XHDA 3DP8A 1A55A 5FTHA 4OERA 4F22A 3KJ7A 1POTA 2F6PA 3LUYA 1LAXA 1NNTA 1II5A 3FVKA 4RXLA 5DVIA 2RC7A 4NF8A 3TELA 4G68A 3IO4A 1USYH 2HZLA 4KFQA 4O3CA 5H8NA 1BKAA 3C9HA 4LZ7A 3IORA 5AA2B 4KD5A 4YMBA 2XX7A 2A5TA 4FORA 2Q88A 4GL8A 4FAJA 2IA4A 5I2KA 3KBRA 1IIWA 2DOJA 3V8XB 4FEDA 1B0LA 3OO7A 3EN3A 3PMVA 1IXGA 3QUFA 4JSDA 4NEDA 3IK6B 4RJZA 1A54A 2F6GA 2O1MA 4BLAA 1TWYA 5F1QA 3GLBA 3SEUA 2B3BA 4JWYA 2ALUA 3OO8A 2DWHA 5CMKA 4NF4A 2ONSA 3TCFA 3MC2A 3RN8A 5M2VA 2Y84A 2V93A 4YKIA 1A8FA 4DXCA 4Z7EA 5KCJA 2QMWA 1IXCA 3E13X 4U1OA 2THIA 3HCQA 3V83A 3O97A 1LB8A 4OEUA 1M5FA 1GGGA 3K6UA 5CBRA 4ELQA 2HZKA 4LQ5A 4OFOA 3ILUB 5ELVA 3HHFA 1WODA 4NTLA 2DE2A 1VSOA 3H6TA 1JNFA 1MXXA 5AA2A 1IXIA 4EF1A 2X26A 1N3XA 3FV1A 4H8IA 3CVGA 5TPAA 1B58A 3PUVE 3D4CA 5I2NB 3EQ1A 1QKAA 4U1ZA 2NWJA 1OIBA 1P1NA 3OD7A 4YKPA 4LZ8A 3BFTA 2GHAA 2ZYKA 3IB0A 4LA9A 1JVYA 2ZYNA 2UVJA 4C0RA 4WKMA 3UN6A 1IXHA 3MZ9A 3PU5A 3H7MA 3N26A 1SBPA 2OWSA 3D4GA 2Z8DA 3LC8A 4PFUA 1PDAA 3QIMA 1XHYA 2P1SA 1POY1 2XXVA 2E0SA 3RUMA 1B7UA 1SVXB 1B0HA 2Z8EA 4RY1A 3OXNA 1QUJA 1H45A 1JVXA 4ONYA 4IO6A 3KN7A 4TLLB 3VV5A 4I62A 4OFJA 4MLQA 4DDDA 1WVJA 2I0CA 3LR1A 1R9LA 4THIA 4IO2A 2H98A 2NOOA 5DTBA 1EU8A 4KCCA 4MF3A 5CMMA 4DCYA 5H8HB 4POXA 4RA1A 3Q27A 3HPIA 4RNSA 2V3UA 4JDFA 4R9GA 3UGWA 4H8JA 4LUBA 4DCXA 3LSWA 4WEDA 1MY2A 1S50A 4M4GA 2PX1A 3T9HB 1SQYA 1VFEA 2I4CA 3KGCA 1JW1A 1Y3NA 4F3PA 1HSLA 1Y3PA 1ZTYA 3WAEA 5I84A 1XOCA 2DS9A 5I2NA 4PFWA 3PD9A 3MBPA 1YAEA 4QFNA 2UXAA 4KHZE 4Q0CA 1O63A 2ONKE 4KI0E 1M5EA 1LBCA 1MQDA 4ESWA 3N5LA 2UYEA 1JW5A 1OVBA 4ZEFA 1B4ZA 4PETA 4OETA 4P0GA 1YTVA 2GH9A 1EZOA 3TTMA 4ZEDA 2DWJA 1DSNA 4BDNA 4H1XA 1ZBMA 5I57A 2NXOA 1ELJA 1ZJLA 3PGFA 4RPOA 5FHOA 1N76A 4EF2A 2UVHA 3TCGA 2VOZA 4OESA 1NH8A 1US5A 2I49A 4G4PA 4OENA 3CI8A 2XXWA 2I0BA 2QSXA 3B6WA 3PMXA 4QF9A 3RGYA 1SW5A 5I58A 5H8HA 4OQOA 3ZSFA 3RPWA 2P0SA 1URSA 4R72A 2HCAA 3PUZE 1UTHB 1FTJA 1FTLA 2ESNA 3G3HA 2O69A 1B4HA 1MM6A 4QSEA 3UA8A 4JWXA 4IGRA 1QVSA 2QMXA 1FQFA 5CM6A 4LATA 5AA1A 3PUYE 2QS1A 1QKBA 4H65A 4I8CA 2QS3A 3VVEA 3U72A 3DP4A 4GL0A 3MVZA 3BBRA 2UVGA 2I6EA 3T9XB 3E3KA 3PMWA 2O6AA 1UTBB 4G77A 1Y1ZA 4GWOA 2G93A 4ELRA 2UVIA 2F7CA 3K02A 4YKJA 1OVTA 5EYFA 1QUKA 3KFMA 4C1UA 3TTKA 3TKDA 3K2DA 3ODBA 4NMYA 2I3WA 4OZ9A 1DPPA 1IUDA 1MY3A 2O7UA 1FQEA 5I56B 3SEVA 2QS2A 2REGA 3PPNA 1UIVA 1UTHA 3MW0A 3T9UA 4QFOA 3M3LA 4YU0A 2QJEA 4AB5A 1RYOA 2ABHA 2Q9TA 3VLVA 1B52A 2Y7PA 3R7XA 3T22A 4I9DA 4QSDA 4GFRA 2HAUA 1Z7ME 3CFXA 2DYXA 5BWJA 1IITA 1SD3A 4OHNA 3IX1A 1LB9A 3SEYA 4R6YA 1WDNA 2PYYA 3OEMA 2XXYA 5IKBA 1JETA 4ZE9A 3FXRA 4OEVA 4YMAA 2XD3A 3TYHA 4N13A 4EDPA 4F1UA 4G2ZA 2Z23A 2Q8JA 1B40A 2A5SA 4R2FA 3FVOA 3RQTA 1Y4CA 2OZZA 2RC9A 1LAGE 2XXPA 1UTBA 2E1SA 1Y20A 2WKYA 4ZEBA 4H5FA 3TMGA 2VGQA 1O7TA 4XKRA 3S9EA 4FATA 3T66A 1AIVA 3FXUA 1Y3QA 4N07A 1T0KA 5HBCA 4ELOA 3U92A 4ZE8A 2PBWA 3SETA 4OWDA 5FHNA 4QHQA 4RK9A 3K6WA 4AB6A 3KOSA 5L9OA 3HHGA 1OQHA 4L17A 4XKQA 4G68C 3CIJA 3CSGA 3K6VA 3C32A 3M8UA 1FQAA 4U21A 3VFJA 4MLVA 1TFDA 1ANFA 4Z0IA 1B1XA 2Q2CA 1TFAA 4K3FA 3TCHA 1PC3A 1DOTA 4KQPA 4XKPA 2I3VA 1B2HA 3OOAA 2R9JA 5KZTA 2F8DA 3RLFE 4KYEA 3FXQA 2VP1A 5FTIA 5HPQA 1SW1A 1MQHA 1N7XA 4GRKA 4H6DA 3F11A 4ISUA 4ZZAA 1B5IA 4ELPA 3H4ZA 2ANJA 4EQ9A 4F29A 1B9JA 1OQGA 3TAJA 2Q2AA 1PBQA 4I1DA 3B6QA 1OMPA 1UQWA 4X9TA 4Q5TA 5EHSA 4KYSA 4R74A 4YB7A 4IY6A 1NFTA 3FJMA 5K2YA 3RTWB 2KLFA 1MS7A 2ZMBA 1NNPA 3U93A 1MDP1 3EHSA 1B6HA 3O29A 2F97A 2VHAA 4NF5B 5ISUA 3KN8A 4GXAA 4GOTA 1J1NA 3MVWA 3O2AA 1H44A 3RT8A 2OJTA 5IAIA 2HFBA 4LQ2A 2O51A 4LONB 3MP6A 4QFPA 3H03A 3VLUA 3PPRA 1B32A 1M5CA 1FW0A 1MXUA 4YAHX 1URGA 3OEKA 5F7VA 1VFDA 4R9FA 3H6UA 2OK2A 3R6UA 4R73A 5DEXB 2XXTA 1O64A 3G3JA 2CZLA 1EZPA 4N6PA 5JK4A 4JWOA 3FVGA 4KYDA 2Y7KA 3BFUA 1NNKA 4WEPA 1B5JA 3ZKLA 3O6GA 3VXBA 1A99A 2GFEA 1AL3A 3H3GA 3N6UA 3RT6B 3IOUA 3Q25A 3OENA 2QL3A 3C35A 4QSCA 1JEUA 3K0VA 1PB7A 4R6HA 4U22A 1FQBA 1YPNA 4F1VA 1R9QA 3TUSA 2AYSA 3K1NA 1LSTA 1QJMA 1I6BA 4X1BA 3TPAA 3N6TA 4KR5A 1MQIA 4GD5A 4IB2A 3G3KA 4GXSB 2B65A 1BTJA 3OSQA 3PD8A 3KSXA 1TT1A 3CRBA 1Y4TA 2ONRA 3G3FA 4H0WA 5AA3A 2DXYA 4ESXA 4WXJA 2Y7RA 1OLCA 4H67A 3GBBA 5LOMA 1MDQA 1MXWA 2M8CA 3CFZA 5HM4B 2VD3A 1SI0A 1MQJA 2D5WA 3IL1B 2XX9A 4EXLA 5AE4A 2RCAA 5CMBA 3I6VA 3G3GA 2RCBA 2PVUA 3FJ7A 5L9SA 3LBSA 5TU0A 3T93B 5DEXA 4F3SA 2HEUA 4FIMA 5I59B 4PFYA 1CE2A 3SESA 4TQUQ 3V89B 3A3UA 5H8FB 1EZ9A 2XXHA 2RF1A 3K1MA 2OLBA 4YB6A 1XVYA 5CC2A 4ZZEA 4H5GA 3MP1A 2ZYMA 2OWTA 2YPNA 1LAFE 1FQDA 5CRYA 3KN3A 2FYIA 2HXWA 1LGBC 3U94A 1SI1A 5JEIA 1JEVA 4XTCQ 4F1YA 2B3FA 4YZZA 2F7AA 4G8MA 3FZVA 3QSLA 2XX8A 4BDQA 4RPNA 3OO9A 4F2QA 3O28A 1FTKA 4IO3A 5AA4B 2F36A 3A09A 3MZ1A 1UIUA 4F2OA 4BDLA 2D21A 1SW4A 2O1LA 5KDTB 5CMCA 3TEPA 1KWHA 3DM0A 3VXCA 2I58A 2Z8FA 3USDA 1N3WA 3BKIB 4DZ1A 5I59A 4U23A 2QS4A 4DXBA 4IO4A 3O9PA 2XXQA 1URDA 3S9LC 4KCDA 5DYHA 2DE3A 3HSTA 4XKNA 4F18A 4Q8RA 1BP5A 1MPCA 3OMBA 3S2VA 2X7PA 3MPLA 2RC8A 1ZLQA 1P1UA 3SKPA 5DVFA 3GBAA 2V84A 2O84X 4IO7A 3CG3A 3IOWA 2R71A 4NWDA 4IY5A 3VVDA 4G68B 4HTGA 3VLWA 4DE8A 1PEBA 3ZKKA 4UACA 1ZKBA 3KSJA 3UK4A 5H8NB 3OELA 1IQ7A 2I48A 5K2XA 4EQ7A 3QAXA 1DTGA 2A5TB 3U8QA 2H4IA 1S7YA 5CI5A 5I2KB 4IGTA 3JYRA 3GZGA 1H76A 5ITPA 3C34A 1P99A 4G8HA 1LCFA 2W7YA 2Z22A 3K4UA 2AL5A 4MBPA 3C36A 5B70A 1MPDA 2UYFA 4YB5A 3OO6A 1PB9A 1H3DA 4TOZA 4EUOA 3CFLA 4NF4B 3E4RA 1GTKA 1XT8A 3PPOA 2QPQA 4PFTA 3TQLA 3KEIA 3THIA 1F9BA 2XXXA 3HV1A 5I56A 1B7HA 3PPPA 5L9MA 2DE4A 2RINA 2Y7IA 1B51A 4OYVA 4X48A 4MFIA 1FTOA 4NWCA 1R1NA 2VD2A 1LLSA 2F78A 5DVJA 2H5YA 3FD3A 3QYTA 5BUUA 4KPTA 5ITOA 2ZXTA 1L5TA 1A40A 2H9BA 2XXUA 3TTLA 3O66A 5B7DA 5ICQA 3KZGA 4M1VA 3IOVA 3ZS6A 5H8QB 2YLNA 2P2AA 1D9VA 4NE4A 1B7ZA 3JV9A 5CBSA 4ND9A 3KOTA 1MY4A 3LSFB 1AMFA 4U4SA 5TPAB 3G3IA 3C31A 3IB2A 1YCJA 4EXKA 3SEXA 1N84A 5DT6A 4C1TA 2HQ0A 1MXYA 1MG1A 3VVFA 4ZECA 1DTZA 1ZU0A 3N94A 3RNNA 4FJPA 5L8DA 3TTRA 4GQOA 4PE5B 4U2RA 3I3VA 4QFKA 4R2BA 4P0IA 1D4NA 1VE4A 4DIGA 4MH5A 4BDMA 1SW2A 3E9XA 1B5HA 3A3CA 1GR2A 4POWA 2Q89A 1Y1MA 1FCKA 4UA8A 3SDFA 3ECRA 3TQWA 3I5OA 5J1DA 2LAOA 2XXIA 2F5XA 1PB8A 3O6IA 5H8QA 2ZYOA 1MXZA 3QK6A 4R75A 3B6TA 2CMOA 2OCUA 4GIZA 1XC1A 3SERA 3TZAA 1LFHA 3PUWE 4HS7A 1QULA 1US4A 3KJTA 1FTMA 4LVQA 3LSLA 3TFLA 3S9NC 1MH4A 1DMBA 1MRPA 5A5XB 4RK2A 4ZEIA 4NF6B 1PBPA 4HW8A 3QUJA 4OMBA 3HO7A 3C4MA 3QXMA 1XS5A 2REJA 3PUXE 2BJJX 3VE1B 5TP9B 1M5BA 2HAVA 1NL5A 1LCTA 2XXRA 3MJNA 4OXVA 4F31B 2NVUB 4ZDMA 3RY3A 3WAFA 4OVJA 2DQVA 1CB6A 5I57B 4X1DA 1TXFA 1IZ1A 4F39A 4GVOA 1N7WA 1D3KA 1RKMA 1B46A 4HCYA 1P1WA 4JXIA 3MUQA 4ECFA 5H8SA 3W9VA 1NKXA 5I58B 3G7WA 4U4XA 1QW0A 3RTFB 4F3BA 4NF5A 2V3TA 1ATGA 1R6ZA 3L6GA 2O7IA 2ZNTA 3H6VA 3FGSA 3EPEA 1IEJA 1B3HA 1JW4A 3SEWA 1AOVA 1A8EA 5A5XA 1LAHE 4NF6A
chains in the Genus database with same CATH superfamily
1M5DA 4JSOA 4LZ5A 3MZBA 3TDJA 2PMSA 4OFLA 1LBBA 4X8RA 2R8TA 3MPKA 1KZ8A 1MY1A 2R6GE 1MQGA 1MH3A 1SYIA 5TP9A 1YZ0A 3CR9A 4YICA 4BDOA 2FA7A 1USYE 2OBGA 3MVYA 1VDWA 2DP8A 3ONMA 4FE8A 4F3GA 5IZ3B 3FBPA 2DWIA 4R6KA 2AIXA 4N91A 3P7IA 3ILTB 4ZS9A 3EF7A 3FASA 4GWYA 2IEEA 1MXVA 1GV8A 1LEVA 1XI6A 2DVZA 1ZIUA 2O68A 4I3YA 2DWAA 3W9WA 1NUWA 4F19A 2D3IA 3DELB 2CZKA 1Z7NE 1NUXA 4NGUA 3UORA 4JVCA 5ET8A 3PPQA 1NMUA 3K6XA 1XVXA 2ZNSA 1B3FA 2Q8MA 2GQ1A 2G29A 5JTYB 5AA2D 5F24A 3O6HA 1B3GA 1DPEA 3FV2A 3T96B 4NN3A 2AL4A 4IO5A 4GF8A 3LSXA 3FJGA 3KC0A 3CSBA 3K01A 1P1OA 3IR1A 3PV0E 2H99A 4OVSA 3CG1A 3W15C 4O3BA 1Y9UA 4EQBA 4QBAA 3MWBA 3S9MC 3MAMA 2PT1A 4G8NA 4JB7A 3R26A 1Q1KA 1B1HA 4QFLA 2FNCA 4DXUA 2X7QA 2GRVA 3V5AA 3FATA 5ET5A 1SYHA 2H25A 4P11A 1MM7A 3EHTA 3BIGA 3T9VA 1BIYA 4GLIA 1AH5A 1LFIA 2NUVA 5H8FA 5IZ3A 2I4BA 3IFAA 4MIJA 4O3AA 1Q35A 4QXDA 3JZJA 1I6AA 2QRYA 3KG2A 3MQ9A 1RYXA 2XWIA 5ICTA 3Q28A 1FQCA 4RYAA 4PP0A 1HSEA 1NNFA 3K1PA 3H06B 1MPBA 3IAZA 1RDYA 1H43A 3K00A 1QUIA 2CZHA 1P1QA 1LFGA 3GXAA 1OLAA 4YKKA 2L5VA 4NF8B 2GHBA 3OSRA 4E0WA 4AQ4A 2F34A 4DLDA 3FUZA 3IJOB 1VR5A 5JTYA 1S9TA 3UP9A 1B3EA 2Y7WA 1NH7A 1I69A 1N0TA 2DVCA 3DP6A 4QRZA 5AA4A 1GVCA 3MP8A 3MVXA 2XD2A 2F35A 3VDFA 1YXIA 4PQJA 5KDTA 5EQ8A 2V25A 2DXRA 2V3QA 4NX1A 2RKMA 2PT2A 4BDRA 3IO6A 4HCWA 1D9YA 1FBCA 3DLNA 1HSJA 3FIRA 5FHMA 4LP2B 3Q29A 4OTEA 1ZMGA 4ZEKA 1NV2A 3C33A 5EHMA 1B05A 1MY0A 3H6WA 2FHYA 3M3KA 2YJPA 3UIFA 1B3LA 3FVNA 4XIGQ 3AXFA 4FECA 5LTCA 1KA1A 3IB1A 4E0XA 1I6QA 3B7DA 1BLFA 2DSFA 1EH3A 4Q30B 3L6HA 4JBZA 1A7LA 3EHUA 1N04A 3U1OA 4TLMB 3S4UA 1SDXA 3TODA 1JQFA 5KCJB 3MSTA 3IOTA 3M3FA 3IJXB 2F7BA 2ZNUA 3TTNA 3HN0A 4XXUA 3Q26A 2FIEA 4FEBA 2XHDA 3DP8A 1A55A 5FTHA 4OERA 5ESYA 4F22A 3KJ7A 1POTA 2F6PA 3LUYA 1LAXA 1NNTA 2XA5A 1II5A 3FVKA 4RXLA 5DVIA 1NV5A 5FBPA 3E78A 2RC7A 4NF8A 3TELA 4G68A 3IO4A 1USYH 2HZLA 4GX4A 4KFQA 4O3CA 5H8NA 1BKAA 3C9HA 4LZ7A 3IORA 1NV1A 5AA2B 4KD5A 4YMBA 2XX7A 2A5TA 4FORA 2Q88A 1KA0A 4GL8A 4FAJA 2JJKA 2IA4A 5I2KA 3NOHA 3KBRA 1IIWA 2DOJA 3V8XB 4FEDA 1B0LA 3OO7A 3EN3A 3PMVA 1IXGA 2Q74A 3QUFA 4JSDA 4NEDA 3IK6B 4RJZA 1A54A 2F6GA 2O1MA 5ET6A 4BLAA 1TWYA 5F1QA 3GLBA 3SEUA 2WX9A 2B3BA 1LBYA 4JWYA 2ALUA 3OO8A 4GBWA 2DWHA 3FXBA 3HFUA 5CMKA 4NF4A 2ONSA 2P3VA 3TCFA 3MC2A 4MJOA 4P1EA 3RN8A 5M2VA 2Y84A 2V93A 4YKIA 3A29A 1A8FA 4DXCA 4Z7EA 5KCJA 2QMWA 1IXCA 3E13X 1EYJA 4U1OA 5I7IA 2THIA 3HCQA 1FSAA 3V83A 3O97A 3QMFA 1LB8A 4OEUA 1M5FA 1GGGA 3RYDA 3K6UA 5CBRA 2VT5A 4ELQA 1FTAA 4MNPA 2HZKA 4LQ5A 4OFOA 3ILUB 5ELVA 3HHFA 1WODA 4NTLA 2XWOA 2DE2A 2CZIA 4MNCA 1FBFA 1VSOA 2F3DA 3H6TA 1JNFA 1MXXA 5AA2A 1IXIA 4AS4A 4EF1A 4IR8A 2X26A 1N3XA 1IMEA 2PFYA 3FV1A 4H8IA 3CVGA 5TPAA 1B58A 3PUVE 4XEQA 3D4CA 5I2NB 3EQ1A 1QKAA 4PFBA 4U1ZA 2NWJA 1OIBA 1P1NA 3OD7A 4YKPA 2KQZA 4LZ8A 3BFTA 2GHAA 2ZYKA 3IB0A 4LA9A 1JVYA 2ZYNA 2UVJA 4C0RA 4WKMA 3UN6A 1IXHA 3MZ9A 3PU5A 3H7MA 3N26A 1SBPA 2OWSA 3D4GA 2Z8DA 3LC8A 4OVPA 2WYKA 4PFUA 1PDAA 3QIMA 1XHYA 2P1SA 4N8GA 4MAGA 1POY1 2XXVA 2E0SA 3RUMA 1B7UA 1SVXB 1B0HA 2Z8EA 4NHBA 4RY1A 3OXNA 1QUJA 5ET7A 1H45A 1JVXA 4ONYA 4XF5A 4IO6A 3KN7A 4TLLB 3VV5A 2OX3A 4N17A 4I62A 4OFJA 4MLQA 4DDDA 1WVJA 2I0CA 2QVRA 3LR1A 1R9LA 4THIA 4IO2A 2H98A 2NOOA 5DTBA 1EU8A 4KCCA 4MF3A 5CMMA 4DCYA 5H8HB 4POXA 4RA1A 3Q27A 3HPIA 4RNSA 2V3UA 4JDFA 4R9GA 3UGWA 4H8JA 4LUBA 4DCXA 3LSWA 4WEDA 1MY2A 1S50A 4M4GA 2PX1A 3T9HB 1SQYA 1VFEA 2I4CA 1FBHA 3KGCA 1JW1A 1Y3NA 4F3PA 1HSLA 1Y3PA 1ZTYA 3WAEA 5I84A 1XOCA 2DS9A 5I2NA 4PFWA 3PD9A 3MBPA 4GWWA 1YAEA 4QFNA 2UXAA 4KHZE 4Q0CA 1O63A 2ONKE 4KI0E 5EQ7A 2WBDA 1M5EA 1LBCA 1Q9DA 1MQDA 4ESWA 3N5LA 1G0IA 2UYEA 1JW5A 1OVBA 4ZEFA 1DCUA 1B4ZA 4PETA 4OETA 1NV6A 4P0GA 1YTVA 2GH9A 1EZOA 3TTMA 2HXRA 4ZEDA 4XFEA 2DWJA 1DSNA 3GYYA 4BDNA 4H1XA 1ZBMA 5I57A 2NXOA 1ELJA 1ZJLA 3PGFA 4RPOA 5FHOA 5IGAA 1N76A 4EF2A 2UVHA 3TCGA 2VOZA 4OESA 4PGNA 1NH8A 1US5A 4GWUA 2I49A 2ZZWA 4G4PA 4OENA 3CI8A 2XXWA 2I0BA 2QSXA 3B6WA 3PMXA 4QF9A 3RGYA 2PCRA 1SW5A 5I58A 5H8HA 4OQOA 3ZSFA 4PF8A 3RPWA 2P0SA 1URSA 4R72A 2HCAA 3PUZE 1UTHB 1FTJA 1FTLA 2ESNA 3G3HA 2O69A 1B4HA 4O7MA 4DI3D 1MM6A 4QSEA 3UA8A 4JWXA 4IGRA 1QVSA 2QMXA 4OVTA 1FQFA 5CM6A 4LATA 5AA1A 3PUYE 2QS1A 1QKBA 4H65A 1LBWA 4P1LA 4I8CA 2QS3A 4HE2A 3VVEA 3U72A 3DP4A 4GL0A 3MVZA 4PDHA 3BBRA 2UVGA 4FBPA 3PTYA 2I6EA 3T9XB 3E3KA 3PMWA 2O6AA 1FPIA 1UTBB 4G77A 1Y1ZA 4GWOA 2G93A 4ELRA 2UVIA 2F7CA 3K02A 4YKJA 1IMBA 1OVTA 5EYFA 1QUKA 3KFMA 4C1UA 3TTKA 3TKDA 3K2DA 3ODBA 2Y5KA 4NMYA 2I3WA 4OZ9A 1DPPA 1IUDA 1MY3A 2O7UA 1FQEA 5I56B 3SEVA 2QS2A 2REGA 3PPNA 1UIVA 1UTHA 3MW0A 3T9UA 2WEFA 1NV3A 4QFOA 3M3LA 4YU0A 2QJEA 1QGXA 4PBQA 4AB5A 1RYOA 2ABHA 2Q9TA 3VLVA 1B52A 2Y7PA 3R7XA 3T22A 4I9DA 4QSDA 4GFRA 4GWSA 2HAUA 1Z7ME 3CFXA 4N8YA 2DYXA 5BWJA 4PC9A 1IITA 1SD3A 3KC1A 4OHNA 3IX1A 1LB9A 4OANA 3SEYA 4R6YA 1WDNA 2PYYA 3OEMA 2XXYA 5IKBA 1JETA 4ZE9A 3FXRA 4OEVA 4YMAA 2XD3A 3TYHA 4N13A 4EDPA 4F1UA 4G2ZA 2Z23A 2Q8JA 1B40A 1INPA 2A5SA 4R2FA 3FVOA 3RQTA 1Y4CA 2OZZA 2RC9A 1LAGE 2QVUA 2XXPA 5I5PA 1UTBA 2E1SA 1Y20A 1BK4A 1DBZA 2WKYA 4ZEBA 4H5FA 4PF6A 3TMGA 2VGQA 1O7TA 4XKRA 3S9EA 4FATA 3T66A 1AIVA 3FXUA 1Y3QA 4N07A 1T0KA 5HBCA 5EQAA 4JVDA 4ELOA 3RPLB 1NI9A 2F3BA 3U92A 4ZE8A 1JP4A 2PBWA 2ZZXA 3SETA 4OWDA 5FHNA 5A5LA 5EYGA 4QHQA 4P3LA 4MMPA 4RK9A 2OWZA 4HXVA 3K6WA 4AB6A 3KOSA 5L9OA 3HHGA 1OQHA 4L17A 4XKQA 2B4MA 4G68C 3CIJA 3CSGA 3M8UA 2DDKA 3C32A 1FQAA 3K6VA 1FPEA 4U21A 3VFJA 4MLVA 1TFDA 1ANFA 4Z0IA 1B1XA 2Q2CA 1TFAA 4K3FA 1G0HA 3TCHA 1FJ6A 1PC3A 1DOTA 4KQPA 5LDZA 4XKPA 2I3VA 1B2HA 3OOAA 3LUZA 2R9JA 5KZTA 2F8DA 3RLFE 4KYEA 3FXQA 2VP1A 5FTIA 5HPQA 1SW1A 1MQHA 1N7XA 4GRKA 4H6DA 3F11A 4ISUA 4ZZAA 1B5IA 4ELPA 3H4ZA 2ANJA 4EQ9A 4F29A 1B9JA 1OQGA 3TAJA 2VPNA 2Q2AA 4P47A 1PBQA 3RPLA 4I1DA 4PDDA 3B6QA 1OMPA 1UQWA 4X9TA 2FBPA 4Q5TA 5EHSA 4KYSA 4R74A 4YB7A 4IY6A 1NFTA 1FPLA 3FJMA 5K2YA 3RTWB 2KLFA 1MS7A 2ZMBA 1NNPA 3U93A 1MDP1 3EHSA 1B6HA 3O29A 2F97A 2VHAA 4NF5B 5ISUA 1EYKA 3KN8A 4GOTA 4GXAA 1D9QA 1J1NA 3T0JA 3MVWA 3O2AA 1NUYA 1H44A 3RT8A 2OJTA 1DK4A 5IAIA 2HFBA 4LQ2A 2O51A 3B50A 4LONB 3MP6A 4QFPA 3H03A 3VLUA 3PPRA 1B32A 1M5CA 1FW0A 4MNIA 1MXUA 4YAHX 1URGA 3OEKA 5F7VA 1VFDA 4R9FA 3H6UA 2OK2A 3R6UA 4R73A 5DEXB 2XXTA 1O64A 3G3JA 2CZLA 1EZPA 4N6PA 4LN5A 5JK4A 4JWOA 3FVGA 4KYDA 2Y7KA 3BFUA 1NNKA 4WEPA 1B5JA 3ZKLA 3O6GA 1FJ9A 4N6KA 4P9KA 3BIHA 3VXBA 1A99A 1FRPA 2GFEA 1AL3A 3H3GA 3N6UA 3RT6B 3IOUA 3Q25A 3OENA 2QL3A 2MKZA 4QSCA 3C35A 1FBEA 2CEYA 1JEUA 4G61A 3K0VA 1PB7A 4R6HA 4U22A 1FQBA 4GBVA 1YPNA 4F1VA 1R9QA 3TUSA 4NF0A 2AYSA 3K1NA 4GWZA 1LSTA 1QJMA 4P56A 1I6BA 4X1BA 3TPAA 3N6TA 3LV0A 4KR5A 1MQIA 4GD5A 4IB2A 3G3KA 4GXSB 2B65A 1BTJA 3OSQA 3PD8A 3KSXA 1TT1A 3CRBA 1Y4TA 2ONRA 3G3FA 4H0WA 5AA3A 2DXYA 4ESXA 2ZZVA 4KXPA 4WXJA 2Y7RA 1FBGA 1OLCA 4H67A 3GBBA 5LOMA 1MDQA 1MXWA 2M8CA 3CFZA 5HM4B 2VD3A 1SI0A 1MQJA 5EYHA 2D5WA 3IL1B 2XX9A 4EXLA 5AE4A 1IMFA 2RCAA 5CMBA 3I6VA 3G3GA 2RCBA 2PVUA 3FJ7A 5L9SA 2P3NA 3LBSA 5TU0A 3T93B 5DEXA 4F3SA 2HEUA 4FIMA 5I59B 4PFYA 4HE1A 1CE2A 3SESA 4TQUQ 3V89B 3A3UA 5H8FB 1EZ9A 3EKIA 2XXHA 3MYUA 2RF1A 3K1MA 2OLBA 2WBBA 4YB6A 1XVYA 5CC2A 1FBDA 3KBZA 4ZZEA 4H5GA 3MP1A 2ZYMA 2OWTA 1IMCA 2XXKA 2YPNA 1NUZA 1LAFE 2QFLA 1FQDA 5CRYA 3KN3A 2FYIA 2HXWA 1LGBC 3U94A 1SI1A 5JEIA 1K9YA 1JEVA 4XTCQ 4F1YA 2B3FA 4YZZA 2F7AA 4G8MA 3FZVA 3QSLA 2XX8A 4PAKA 2HPGA 4BDQA 4RPNA 3OO9A 4F2QA 3O28A 1FTKA 4IO3A 2FIXA 5AA4B 2F36A 3A09A 3MZ1A 1UIUA 4F2OA 4BDLA 2D21A 1SW4A 2O1LA 4PFRA 5KDTB 5CMCA 3TEPA 1KWHA 3DM0A 3VXCA 1FPDA 2I58A 2Z8FA 4NAPA 3USDA 1N3WA 5T3JA 3BKIB 1K9ZA 4DZ1A 5I59A 4U23A 2QS4A 2XWVA 4DXBA 4IO4A 1EYIA 3O9PA 4UABA 2V4CA 2XXQA 3D1RA 1URDA 3S9LC 4KCDA 5DYHA 2DE3A 3HSTA 4XKNA 4F18A 4Q8RA 1BP5A 1MPCA 3OMBA 3S2VA 2X7PA 3MPLA 2RC8A 1ZLQA 1P1UA 3SKPA 5DVFA 3GBAA 2V84A 2O84X 4IO7A 3CG3A 3IOWA 2R71A 4NWDA 4IY5A 3VVDA 4N6DA 4G68B 4HTGA 3VLWA 4DE8A 1PEBA 3ZKKA 4UACA 1ZKBA 1NV4A 3KSJA 3UK4A 5H8NB 3OELA 1IQ7A 2I48A 5K2XA 4EQ7A 3QAXA 1DTGA 2A5TB 3U8QA 2H4IA 1S7YA 5CI5A 5I2KB 4OVQA 4N81A 4PFIA 4IGTA 3JYRA 3GZGA 1H76A 5ITPA 3C34A 1RDZA 1P99A 5I3SA 4G8HA 4HE0A 4OA4A 1LCFA 2W7YA 2CEXA 2Z22A 3K4UA 2AL5A 4MBPA 3C36A 5B70A 1MPDA 2UYFA 2BJIA 4YB5A 3OO6A 1PB9A 1H3DA 4TOZA 4EUOA 1FPGA 4GX6A 3CFLA 4NF4B 3E4RA 1IMDA 1GTKA 4PTKA 1XT8A 3PPOA 2QPQA 4PFTA 3TQLA 3KEIA 3THIA 1F9BA 2XXXA 3HV1A 5I56A 1B7HA 3PPPA 5L9MA 2DE4A 2RINA 2Y7IA 1B51A 2WYPA 4OYVA 3E79A 4X48A 4MFIA 1FTOA 4NWCA 1R1NA 2VD2A 1LLSA 2F78A 5DVJA 2H5YA 3FD3A 3QYTA 5BUUA 5IZ1A 4KPTA 5ITOA 4N4UA 2ZXTA 4NG7A 1L5TA 1A40A 2H9BA 2XXUA 2Y5LA 3O66A 3TTLA 5B7DA 5ICQA 3KZGA 1LBZA 2B4LA 3IOVA 4M1VA 3ZS6A 5H8QB 4GX3A 2YLNA 2P2AA 4N15A 1D9VA 4NE4A 4O8MA 4I3EA 1NV7A 1B7ZA 4OVRA 3JV9A 5CBSA 4ND9A 5IM2A 3KOTA 1MY4A 3LSFB 1AMFA 4U4SA 5TPAB 3G3IA 3B8BA 5IZZA 3C31A 3IB2A 4H45A 1YCJA 4EXKA 3SEXA 1N84A 2HHMA 5DT6A 4C1TA 2HQ0A 1MXYA 1MG1A 2PFZA 3VVFA 4ZECA 1DTZA 1ZU0A 3N94A 3RNNA 4FJPA 5L8DA 3TTRA 4X04A 4PAIA 4GQOA 2KR0A 4O94A 4PAFA 4PE5B 4U2RA 4H46A 3I3VA 3SZPA 4P8BA 4QFKA 4R2BA 4P0IA 1D4NA 3IFCA 4PCDA 1VE4A 4DIGA 4MH5A 4BDMA 1SW2A 3U65A 3E9XA 1B5HA 5DW8A 3A3CA 4O7IA 1SPIA 1GR2A 4POWA 2Q89A 1Y1MA 1FCKA 4UA8A 3SDFA 3ECRA 3TQWA 3I5OA 3CHGA 5J1DA 1IMAA 2LAOA 5J16A 2XXIA 2F5XA 1PB8A 3O6IA 5H8QA 2ZYOA 1MXZA 3QK6A 4R75A 3B6TA 2XWKA 2CMOA 2OCUA 4NQ8A 4I40A 4GIZA 1XC1A 3SERA 3TZAA 1LFHA 2FVZA 3PUWE 4JVIA 4HS7A 1QULA 1US4A 3KJTA 4MCOA 4AS5A 1FTMA 4LVQA 3LSLA 3TFLA 3S9NC 1MH4A 1FPBA 1DMBA 1MRPA 5A5XB 4RK2A 1CNQA 4NF6B 4ZEIA 1PBPA 4HW8A 3QUJA 1YYZA 4OMBA 3HO7A 3C4MA 3QXMA 1XS5A 2REJA 3PUXE 2BJJX 3VE1B 5TP9B 4GWXA 1M5BA 2HAVA 4MEVA 1NV0A 3ROJA 1NL5A 5EQ9A 3T1BA 1FPJA 1LBXA 1LCTA 2XXRA 3MJNA 4OXVA 4PBHA 4F31B 2NVUB 4ZDMA 1AWBA 3RY3A 3WAFA 4OVJA 2DQVA 3ISPA 1CB6A 5I57B 1LBVA 4MHFA 4X1DA 4PE3A 1TXFA 1IZ1A 4F39A 4GVOA 1N7WA 1D3KA 1RKMA 1B46A 4HCYA 1P1WA 4JXIA 3MUQA 2QVVA 4ECFA 5H8SA 3W9VA 1NKXA 5I58B 3G7WA 4U4XA 1QW0A 3RTFB 4F3BA 4NF5A 4DI4B 4PGPA 2V3TA 1ATGA 4MX6A 1FPKA 1RDXA 1R6ZA 3L6GA 2O7IA 2ZNTA 3H6VA 3FGSA 3EPEA 1FPFA 1IEJA 1B3HA 1FBPA 1JW4A 3SEWA 1AOVA 1A8EA 5A5XA 1LAHE 4NF6A 2VPOA
chains in the Genus database with same CATH topology
1M5DA 4JSOA 4LZ5A 3MZBA 3TDJA 2PMSA 4OFLA 1LBBA 3MPKA 1MY1A 2R6GE 1MQGA 1MH3A 1SYIA 5TP9A 3CR9A 4YICA 4BDOA 2FA7A 1USYE 2OBGA 3MVYA 2DP8A 3ONMA 4FE8A 4F3GA 2DWIA 4R6KA 2AIXA 3P7IA 3ILTB 4ZS9A 3EF7A 3FASA 2IEEA 1MXVA 1GV8A 2DVZA 1ZIUA 2O68A 2DWAA 3W9WA 4F19A 2D3IA 3DELB 1Z7NE 3UORA 3PPQA 1NMUA 3K6XA 1XVXA 2ZNSA 1B3FA 2G29A 5JTYB 5AA2D 3O6HA 1B3GA 1DPEA 3FV2A 3T96B 2AL4A 4GF8A 4IO5A 3LSXA 3FJGA 3CSBA 3K01A 1P1OA 3IR1A 3PV0E 2H99A 3CG1A 3W15C 4O3BA 1Y9UA 4EQBA 3S9MC 3MWBA 3MAMA 2PT1A 4G8NA 4JB7A 3R26A 1Q1KA 1B1HA 4QFLA 2FNCA 4DXUA 2X7QA 2GRVA 3V5AA 3FATA 1SYHA 2H25A 4P11A 1MM7A 3EHTA 3T9VA 1BIYA 4GLIA 1AH5A 1LFIA 2NUVA 5H8FA 2I4BA 4O3AA 1Q35A 3JZJA 1I6AA 2QRYA 3KG2A 3MQ9A 1RYXA 5ICTA 3Q28A 1FQCA 4RYAA 4PP0A 1HSEA 1NNFA 3K1PA 3H06B 1MPBA 3IAZA 1H43A 3K00A 1QUIA 1P1QA 1LFGA 3GXAA 1OLAA 4YKKA 4NF8B 2GHBA 3OSRA 4E0WA 4AQ4A 2F34A 4DLDA 3FUZA 3IJOB 1VR5A 5JTYA 1S9TA 3UP9A 1B3EA 2Y7WA 1NH7A 1I69A 1N0TA 2DVCA 3DP6A 4QRZA 5AA4A 1GVCA 3MP8A 3MVXA 2XD2A 2F35A 3VDFA 4PQJA 5KDTA 2V25A 2DXRA 2V3QA 2RKMA 2PT2A 4BDRA 3IO6A 4HCWA 1D9YA 3DLNA 1HSJA 3FIRA 5FHMA 4LP2B 3Q29A 4OTEA 1ZMGA 4ZEKA 3C33A 5EHMA 1B05A 1MY0A 3H6WA 3M3KA 2YJPA 3UIFA 1B3LA 3FVNA 4XIGQ 3AXFA 4FECA 3IB1A 4E0XA 1I6QA 3B7DA 1BLFA 2DSFA 1EH3A 4Q30B 3L6HA 4JBZA 1A7LA 3EHUA 1N04A 3U1OA 4TLMB 3S4UA 1SDXA 3TODA 1JQFA 5KCJB 3IOTA 3M3FA 3IJXB 2F7BA 2ZNUA 3TTNA 3HN0A 4XXUA 3Q26A 4FEBA 2XHDA 3DP8A 1A55A 5FTHA 4OERA 4F22A 3KJ7A 1POTA 2F6PA 3LUYA 1LAXA 1NNTA 1II5A 3FVKA 4RXLA 5DVIA 2RC7A 4NF8A 3TELA 4G68A 3IO4A 1USYH 2HZLA 4KFQA 4O3CA 5H8NA 1BKAA 3C9HA 4LZ7A 3IORA 5AA2B 4KD5A 4YMBA 2XX7A 2A5TA 4FORA 2Q88A 4GL8A 4FAJA 2IA4A 5I2KA 3KBRA 1IIWA 2DOJA 3V8XB 4FEDA 1B0LA 3OO7A 3EN3A 3PMVA 1IXGA 3QUFA 4JSDA 4NEDA 3IK6B 4RJZA 1A54A 2F6GA 2O1MA 4BLAA 1TWYA 5F1QA 3GLBA 3SEUA 2B3BA 4JWYA 2ALUA 3OO8A 2DWHA 5CMKA 4NF4A 2ONSA 3TCFA 3MC2A 3RN8A 5M2VA 2Y84A 2V93A 4YKIA 1A8FA 4DXCA 4Z7EA 5KCJA 2QMWA 1IXCA 3E13X 4U1OA 2THIA 3HCQA 3V83A 3O97A 1LB8A 4OEUA 1M5FA 1GGGA 3K6UA 5CBRA 4ELQA 2HZKA 4LQ5A 4OFOA 3ILUB 5ELVA 3HHFA 1WODA 4NTLA 2DE2A 1VSOA 3H6TA 1JNFA 1MXXA 5AA2A 1IXIA 4EF1A 2X26A 1N3XA 3FV1A 4H8IA 3CVGA 5TPAA 1B58A 3PUVE 3D4CA 5I2NB 3EQ1A 1QKAA 4U1ZA 2NWJA 1OIBA 1P1NA 3OD7A 4YKPA 4LZ8A 3BFTA 2GHAA 2ZYKA 3IB0A 4LA9A 1JVYA 2ZYNA 2UVJA 4C0RA 4WKMA 3UN6A 1IXHA 3MZ9A 3PU5A 3H7MA 3N26A 1SBPA 2OWSA 3D4GA 2Z8DA 3LC8A 4PFUA 1PDAA 3QIMA 1XHYA 2P1SA 1POY1 2XXVA 2E0SA 3RUMA 1B7UA 1SVXB 1B0HA 2Z8EA 4RY1A 3OXNA 1QUJA 1H45A 1JVXA 4ONYA 4IO6A 3KN7A 4TLLB 3VV5A 4I62A 4OFJA 4MLQA 4DDDA 1WVJA 2I0CA 3LR1A 1R9LA 4THIA 4IO2A 2H98A 2NOOA 5DTBA 1EU8A 4KCCA 4MF3A 5CMMA 4DCYA 5H8HB 4POXA 4RA1A 3Q27A 3HPIA 4RNSA 2V3UA 4JDFA 4R9GA 3UGWA 4H8JA 4LUBA 4DCXA 3LSWA 4WEDA 1MY2A 1S50A 4M4GA 2PX1A 3T9HB 1SQYA 1VFEA 2I4CA 3KGCA 1JW1A 1Y3NA 4F3PA 1HSLA 1Y3PA 1ZTYA 3WAEA 5I84A 1XOCA 2DS9A 5I2NA 4PFWA 3PD9A 3MBPA 1YAEA 4QFNA 2UXAA 4KHZE 4Q0CA 1O63A 2ONKE 4KI0E 1M5EA 1LBCA 1MQDA 4ESWA 3N5LA 2UYEA 1JW5A 1OVBA 4ZEFA 1B4ZA 4PETA 4OETA 4P0GA 1YTVA 2GH9A 1EZOA 3TTMA 4ZEDA 2DWJA 1DSNA 4BDNA 4H1XA 1ZBMA 5I57A 2NXOA 1ELJA 1ZJLA 3PGFA 4RPOA 5FHOA 1N76A 4EF2A 2UVHA 3TCGA 2VOZA 4OESA 1NH8A 1US5A 2I49A 4G4PA 4OENA 3CI8A 2XXWA 2I0BA 2QSXA 3B6WA 3PMXA 4QF9A 3RGYA 1SW5A 5I58A 5H8HA 4OQOA 3ZSFA 3RPWA 2P0SA 1URSA 4R72A 2HCAA 3PUZE 1UTHB 1FTJA 1FTLA 2ESNA 3G3HA 2O69A 1B4HA 1MM6A 4QSEA 3UA8A 4JWXA 4IGRA 1QVSA 2QMXA 1FQFA 5CM6A 4LATA 5AA1A 3PUYE 2QS1A 1QKBA 4H65A 4I8CA 2QS3A 3VVEA 3U72A 3DP4A 4GL0A 3MVZA 3BBRA 2UVGA 2I6EA 3T9XB 3E3KA 3PMWA 2O6AA 1UTBB 4G77A 1Y1ZA 4GWOA 2G93A 4ELRA 2UVIA 2F7CA 3K02A 4YKJA 1OVTA 5EYFA 1QUKA 3KFMA 4C1UA 3TTKA 3TKDA 3K2DA 3ODBA 4NMYA 2I3WA 4OZ9A 1DPPA 1IUDA 1MY3A 2O7UA 1FQEA 5I56B 3SEVA 2QS2A 2REGA 3PPNA 1UIVA 1UTHA 3MW0A 3T9UA 4QFOA 3M3LA 4YU0A 2QJEA 4AB5A 1RYOA 2ABHA 2Q9TA 3VLVA 1B52A 2Y7PA 3R7XA 3T22A 4I9DA 4QSDA 4GFRA 2HAUA 1Z7ME 3CFXA 2DYXA 5BWJA 1IITA 1SD3A 4OHNA 3IX1A 1LB9A 3SEYA 4R6YA 1WDNA 2PYYA 3OEMA 2XXYA 5IKBA 1JETA 4ZE9A 3FXRA 4OEVA 4YMAA 2XD3A 3TYHA 4N13A 4EDPA 4F1UA 4G2ZA 2Z23A 2Q8JA 1B40A 2A5SA 4R2FA 3FVOA 3RQTA 1Y4CA 2OZZA 2RC9A 1LAGE 2XXPA 1UTBA 2E1SA 1Y20A 2WKYA 4ZEBA 4H5FA 3TMGA 2VGQA 1O7TA 4XKRA 3S9EA 4FATA 3T66A 1AIVA 3FXUA 1Y3QA 4N07A 1T0KA 5HBCA 4ELOA 3U92A 4ZE8A 2PBWA 3SETA 4OWDA 5FHNA 4QHQA 4RK9A 3K6WA 4AB6A 3KOSA 5L9OA 3HHGA 1OQHA 4L17A 4XKQA 4G68C 3CIJA 3CSGA 3K6VA 3C32A 3M8UA 1FQAA 4U21A 3VFJA 4MLVA 1TFDA 1ANFA 4Z0IA 1B1XA 2Q2CA 1TFAA 4K3FA 3TCHA 1PC3A 1DOTA 4KQPA 4XKPA 2I3VA 1B2HA 3OOAA 2R9JA 5KZTA 2F8DA 3RLFE 4KYEA 3FXQA 2VP1A 5FTIA 5HPQA 1SW1A 1MQHA 1N7XA 4GRKA 4H6DA 3F11A 4ISUA 4ZZAA 1B5IA 4ELPA 3H4ZA 2ANJA 4EQ9A 4F29A 1B9JA 1OQGA 3TAJA 2Q2AA 1PBQA 4I1DA 3B6QA 1OMPA 1UQWA 4X9TA 4Q5TA 5EHSA 4KYSA 4R74A 4YB7A 4IY6A 1NFTA 3FJMA 5K2YA 3RTWB 2KLFA 1MS7A 2ZMBA 1NNPA 3U93A 1MDP1 3EHSA 1B6HA 3O29A 2F97A 2VHAA 4NF5B 5ISUA 3KN8A 4GXAA 4GOTA 1J1NA 3MVWA 3O2AA 1H44A 3RT8A 2OJTA 5IAIA 2HFBA 4LQ2A 2O51A 4LONB 3MP6A 4QFPA 3H03A 3VLUA 3PPRA 1B32A 1M5CA 1FW0A 1MXUA 4YAHX 1URGA 3OEKA 5F7VA 1VFDA 4R9FA 3H6UA 2OK2A 3R6UA 4R73A 5DEXB 2XXTA 1O64A 3G3JA 2CZLA 1EZPA 4N6PA 5JK4A 4JWOA 3FVGA 4KYDA 2Y7KA 3BFUA 1NNKA 4WEPA 1B5JA 3ZKLA 3O6GA 3VXBA 1A99A 2GFEA 1AL3A 3H3GA 3N6UA 3RT6B 3IOUA 3Q25A 3OENA 2QL3A 3C35A 4QSCA 1JEUA 3K0VA 1PB7A 4R6HA 4U22A 1FQBA 1YPNA 4F1VA 1R9QA 3TUSA 2AYSA 3K1NA 1LSTA 1QJMA 1I6BA 4X1BA 3TPAA 3N6TA 4KR5A 1MQIA 4GD5A 4IB2A 3G3KA 4GXSB 2B65A 1BTJA 3OSQA 3PD8A 3KSXA 1TT1A 3CRBA 1Y4TA 2ONRA 3G3FA 4H0WA 5AA3A 2DXYA 4ESXA 4WXJA 2Y7RA 1OLCA 4H67A 3GBBA 5LOMA 1MDQA 1MXWA 2M8CA 3CFZA 5HM4B 2VD3A 1SI0A 1MQJA 2D5WA 3IL1B 2XX9A 4EXLA 5AE4A 2RCAA 5CMBA 3I6VA 3G3GA 2RCBA 2PVUA 3FJ7A 5L9SA 3LBSA 5TU0A 3T93B 5DEXA 4F3SA 2HEUA 4FIMA 5I59B 4PFYA 1CE2A 3SESA 4TQUQ 3V89B 3A3UA 5H8FB 1EZ9A 2XXHA 2RF1A 3K1MA 2OLBA 4YB6A 1XVYA 5CC2A 4ZZEA 4H5GA 3MP1A 2ZYMA 2OWTA 2YPNA 1LAFE 1FQDA 5CRYA 3KN3A 2FYIA 2HXWA 1LGBC 3U94A 1SI1A 5JEIA 1JEVA 4XTCQ 4F1YA 2B3FA 4YZZA 2F7AA 4G8MA 3FZVA 3QSLA 2XX8A 4BDQA 4RPNA 3OO9A 4F2QA 3O28A 1FTKA 4IO3A 5AA4B 2F36A 3A09A 3MZ1A 1UIUA 4F2OA 4BDLA 2D21A 1SW4A 2O1LA 5KDTB 5CMCA 3TEPA 1KWHA 3DM0A 3VXCA 2I58A 2Z8FA 3USDA 1N3WA 3BKIB 4DZ1A 5I59A 4U23A 2QS4A 4DXBA 4IO4A 3O9PA 2XXQA 1URDA 3S9LC 4KCDA 5DYHA 2DE3A 3HSTA 4XKNA 4F18A 4Q8RA 1BP5A 1MPCA 3OMBA 3S2VA 2X7PA 3MPLA 2RC8A 1ZLQA 1P1UA 3SKPA 5DVFA 3GBAA 2V84A 2O84X 4IO7A 3CG3A 3IOWA 2R71A 4NWDA 4IY5A 3VVDA 4G68B 4HTGA 3VLWA 4DE8A 1PEBA 3ZKKA 4UACA 1ZKBA 3KSJA 3UK4A 5H8NB 3OELA 1IQ7A 2I48A 5K2XA 4EQ7A 3QAXA 1DTGA 2A5TB 3U8QA 2H4IA 1S7YA 5CI5A 5I2KB 4IGTA 3JYRA 3GZGA 1H76A 5ITPA 3C34A 1P99A 4G8HA 1LCFA 2W7YA 2Z22A 3K4UA 2AL5A 4MBPA 3C36A 5B70A 1MPDA 2UYFA 4YB5A 3OO6A 1PB9A 1H3DA 4TOZA 4EUOA 3CFLA 4NF4B 3E4RA 1GTKA 1XT8A 3PPOA 2QPQA 4PFTA 3TQLA 3KEIA 3THIA 1F9BA 2XXXA 3HV1A 5I56A 1B7HA 3PPPA 5L9MA 2DE4A 2RINA 2Y7IA 1B51A 4OYVA 4X48A 4MFIA 1FTOA 4NWCA 1R1NA 2VD2A 1LLSA 2F78A 5DVJA 2H5YA 3FD3A 3QYTA 5BUUA 4KPTA 5ITOA 2ZXTA 1L5TA 1A40A 2H9BA 2XXUA 3TTLA 3O66A 5B7DA 5ICQA 3KZGA 4M1VA 3IOVA 3ZS6A 5H8QB 2YLNA 2P2AA 1D9VA 4NE4A 1B7ZA 3JV9A 5CBSA 4ND9A 3KOTA 1MY4A 3LSFB 1AMFA 4U4SA 5TPAB 3G3IA 3C31A 3IB2A 1YCJA 4EXKA 3SEXA 1N84A 5DT6A 4C1TA 2HQ0A 1MXYA 1MG1A 3VVFA 4ZECA 1DTZA 1ZU0A 3N94A 3RNNA 4FJPA 5L8DA 3TTRA 4GQOA 4PE5B 4U2RA 3I3VA 4QFKA 4R2BA 4P0IA 1D4NA 1VE4A 4DIGA 4MH5A 4BDMA 1SW2A 3E9XA 1B5HA 3A3CA 1GR2A 4POWA 2Q89A 1Y1MA 1FCKA 4UA8A 3SDFA 3ECRA 3TQWA 3I5OA 5J1DA 2LAOA 2XXIA 2F5XA 1PB8A 3O6IA 5H8QA 2ZYOA 1MXZA 3QK6A 4R75A 3B6TA 2CMOA 2OCUA 4GIZA 1XC1A 3SERA 3TZAA 1LFHA 3PUWE 4HS7A 1QULA 1US4A 3KJTA 1FTMA 4LVQA 3LSLA 3TFLA 3S9NC 1MH4A 1DMBA 1MRPA 5A5XB 4RK2A 4ZEIA 4NF6B 1PBPA 4HW8A 3QUJA 4OMBA 3HO7A 3C4MA 3QXMA 1XS5A 2REJA 3PUXE 2BJJX 3VE1B 5TP9B 1M5BA 2HAVA 1NL5A 1LCTA 2XXRA 3MJNA 4OXVA 4F31B 2NVUB 4ZDMA 3RY3A 3WAFA 4OVJA 2DQVA 1CB6A 5I57B 4X1DA 1TXFA 1IZ1A 4F39A 4GVOA 1N7WA 1D3KA 1RKMA 1B46A 4HCYA 1P1WA 4JXIA 3MUQA 4ECFA 5H8SA 3W9VA 1NKXA 5I58B 3G7WA 4U4XA 1QW0A 3RTFB 4F3BA 4NF5A 2V3TA 1ATGA 1R6ZA 3L6GA 2O7IA 2ZNTA 3H6VA 3FGSA 3EPEA 1IEJA 1B3HA 1JW4A 3SEWA 1AOVA 1A8EA 5A5XA 1LAHE 4NF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5D A;  4JSO A;  4LZ5 A;  3MZB A;  3TDJ A;  2PMS A;  4OFL A;  1LBB A;  3MPK A;  1MY1 A;  2R6G E;  1MQG A;  1MH3 A;  1SYI A;  5TP9 A;  3CR9 A;  4YIC A;  4BDO A;  2FA7 A;  1USY E;  2OBG A;  3MVY A;  2DP8 A;  3ONM A;  4FE8 A;  4F3G A;  2DWI A;  4R6K A;  2AIX A;  3P7I A;  3ILT B;  4ZS9 A;  3EF7 A;  3FAS A;  2IEE A;  1MXV A;  1GV8 A;  2DVZ A;  1ZIU A;  2O68 A;  2DWA A;  3W9W A;  4F19 A;  2D3I A;  3DEL B;  1Z7N E;  3UOR A;  3PPQ A;  1NMU A;  3K6X A;  1XVX A;  2ZNS A;  1B3F A;  2G29 A;  5JTY B;  5AA2 D;  3O6H A;  1B3G A;  1DPE A;  3FV2 A;  3T96 B;  2AL4 A;  4GF8 A;  4IO5 A;  3LSX A;  3FJG A;  3CSB A;  3K01 A;  1P1O A;  3IR1 A;  3PV0 E;  2H99 A;  3CG1 A;  3W15 C;  4O3B A;  1Y9U A;  4EQB A;  3S9M C;  3MWB A;  3MAM A;  2PT1 A;  4G8N A;  4JB7 A;  3R26 A;  1Q1K A;  1B1H A;  4QFL A;  2FNC A;  4DXU A;  2X7Q A;  2GRV A;  3V5A A;  3FAT A;  1SYH A;  2H25 A;  4P11 A;  1MM7 A;  3EHT A;  3T9V A;  1BIY A;  4GLI A;  1AH5 A;  1LFI A;  2NUV A;  5H8F A;  2I4B A;  4O3A A;  1Q35 A;  3JZJ A;  1I6A A;  2QRY A;  3KG2 A;  3MQ9 A;  1RYX A;  5ICT A;  3Q28 A;  1FQC A;  4RYA A;  4PP0 A;  1HSE A;  1NNF A;  3K1P A;  3H06 B;  1MPB A;  3IAZ A;  1H43 A;  3K00 A;  1QUI A;  1P1Q A;  1LFG A;  3GXA A;  1OLA A;  4YKK A;  4NF8 B;  2GHB A;  3OSR A;  4E0W A;  4AQ4 A;  2F34 A;  4DLD A;  3FUZ A;  3IJO B;  1VR5 A;  5JTY A;  1S9T A;  3UP9 A;  1B3E A;  2Y7W A;  1NH7 A;  1I69 A;  1N0T A;  2DVC A;  3DP6 A;  4QRZ A;  5AA4 A;  1GVC A;  3MP8 A;  3MVX A;  2XD2 A;  2F35 A;  3VDF A;  4PQJ A;  5KDT A;  2V25 A;  2DXR A;  2V3Q A;  2RKM A;  2PT2 A;  4BDR A;  3IO6 A;  4HCW A;  1D9Y A;  3DLN A;  1HSJ A;  3FIR A;  5FHM A;  4LP2 B;  3Q29 A;  4OTE A;  1ZMG A;  4ZEK A;  3C33 A;  5EHM A;  1B05 A;  1MY0 A;  3H6W A;  3M3K A;  2YJP A;  3UIF A;  1B3L A;  3FVN A;  4XIG Q;  3AXF A;  4FEC A;  3IB1 A;  4E0X A;  1I6Q A;  3B7D A;  1BLF A;  2DSF A;  1EH3 A;  4Q30 B;  3L6H A;  4JBZ A;  1A7L A;  3EHU A;  1N04 A;  3U1O A;  4TLM B;  3S4U A;  1SDX A;  3TOD A;  1JQF A;  5KCJ B;  3IOT A;  3M3F A;  3IJX B;  2F7B A;  2ZNU A;  3TTN A;  3HN0 A;  4XXU A;  3Q26 A;  4FEB A;  2XHD A;  3DP8 A;  1A55 A;  5FTH A;  4OER A;  4F22 A;  3KJ7 A;  1POT A;  2F6P A;  3LUY A;  1LAX A;  1NNT A;  1II5 A;  3FVK A;  4RXL A;  5DVI A;  2RC7 A;  4NF8 A;  3TEL A;  4G68 A;  3IO4 A;  1USY H;  2HZL A;  4KFQ A;  4O3C A;  5H8N A;  1BKA A;  3C9H A;  4LZ7 A;  3IOR A;  5AA2 B;  4KD5 A;  4YMB A;  2XX7 A;  2A5T A;  4FOR A;  2Q88 A;  4GL8 A;  4FAJ A;  2IA4 A;  5I2K A;  3KBR A;  1IIW A;  2DOJ A;  3V8X B;  4FED A;  1B0L A;  3OO7 A;  3EN3 A;  3PMV A;  1IXG A;  3QUF A;  4JSD A;  4NED A;  3IK6 B;  4RJZ A;  1A54 A;  2F6G A;  2O1M A;  4BLA A;  1TWY A;  5F1Q A;  3GLB A;  3SEU A;  2B3B A;  4JWY A;  2ALU A;  3OO8 A;  2DWH A;  5CMK A;  4NF4 A;  2ONS A;  3TCF A;  3MC2 A;  3RN8 A;  5M2V A;  2Y84 A;  2V93 A;  4YKI A;  1A8F A;  4DXC A;  4Z7E A;  5KCJ A;  2QMW A;  1IXC A;  3E13 X;  4U1O A;  2THI A;  3HCQ A;  3V83 A;  3O97 A;  1LB8 A;  4OEU A;  1M5F A;  1GGG A;  3K6U A;  5CBR A;  4ELQ A;  2HZK A;  4LQ5 A;  4OFO A;  3ILU B;  5ELV A;  3HHF A;  1WOD A;  4NTL A;  2DE2 A;  1VSO A;  3H6T A;  1JNF A;  1MXX A;  5AA2 A;  1IXI A;  4EF1 A;  2X26 A;  1N3X A;  3FV1 A;  4H8I A;  3CVG A;  5TPA A;  1B58 A;  3PUV E;  3D4C A;  5I2N B;  3EQ1 A;  1QKA A;  4U1Z A;  2NWJ A;  1OIB A;  1P1N A;  3OD7 A;  4YKP A;  4LZ8 A;  3BFT A;  2GHA A;  2ZYK A;  3IB0 A;  4LA9 A;  1JVY A;  2ZYN A;  2UVJ A;  4C0R A;  4WKM A;  3UN6 A;  1IXH A;  3MZ9 A;  3PU5 A;  3H7M A;  3N26 A;  1SBP A;  2OWS A;  3D4G A;  2Z8D A;  3LC8 A;  4PFU A;  1PDA A;  3QIM A;  1XHY A;  2P1S A;  1POY 1;  2XXV A;  2E0S A;  3RUM A;  1B7U A;  1SVX B;  1B0H A;  2Z8E A;  4RY1 A;  3OXN A;  1QUJ A;  1H45 A;  1JVX A;  4ONY A;  4IO6 A;  3KN7 A;  4TLL B;  3VV5 A;  4I62 A;  4OFJ A;  4MLQ A;  4DDD A;  1WVJ A;  2I0C A;  3LR1 A;  1R9L A;  4THI A;  4IO2 A;  2H98 A;  2NOO A;  5DTB A;  1EU8 A;  4KCC A;  4MF3 A;  5CMM A;  4DCY A;  5H8H B;  4POX A;  4RA1 A;  3Q27 A;  3HPI A;  4RNS A;  2V3U A;  4JDF A;  4R9G A;  3UGW A;  4H8J A;  4LUB A;  4DCX A;  3LSW A;  4WED A;  1MY2 A;  1S50 A;  4M4G A;  2PX1 A;  3T9H B;  1SQY A;  1VFE A;  2I4C A;  3KGC A;  1JW1 A;  1Y3N A;  4F3P A;  1HSL A;  1Y3P A;  1ZTY A;  3WAE A;  5I84 A;  1XOC A;  2DS9 A;  5I2N A;  4PFW A;  3PD9 A;  3MBP A;  1YAE A;  4QFN A;  2UXA A;  4KHZ E;  4Q0C A;  1O63 A;  2ONK E;  4KI0 E;  1M5E A;  1LBC A;  1MQD A;  4ESW A;  3N5L A;  2UYE A;  1JW5 A;  1OVB A;  4ZEF A;  1B4Z A;  4PET A;  4OET A;  4P0G A;  1YTV A;  2GH9 A;  1EZO A;  3TTM A;  4ZED A;  2DWJ A;  1DSN A;  4BDN A;  4H1X A;  1ZBM A;  5I57 A;  2NXO A;  1ELJ A;  1ZJL A;  3PGF A;  4RPO A;  5FHO A;  1N76 A;  4EF2 A;  2UVH A;  3TCG A;  2VOZ A;  4OES A;  1NH8 A;  1US5 A;  2I49 A;  4G4P A;  4OEN A;  3CI8 A;  2XXW A;  2I0B A;  2QSX A;  3B6W A;  3PMX A;  4QF9 A;  3RGY A;  1SW5 A;  5I58 A;  5H8H A;  4OQO A;  3ZSF A;  3RPW A;  2P0S A;  1URS A;  4R72 A;  2HCA A;  3PUZ E;  1UTH B;  1FTJ A;  1FTL A;  2ESN A;  3G3H A;  2O69 A;  1B4H A;  1MM6 A;  4QSE A;  3UA8 A;  4JWX A;  4IGR A;  1QVS A;  2QMX A;  1FQF A;  5CM6 A;  4LAT A;  5AA1 A;  3PUY E;  2QS1 A;  1QKB A;  4H65 A;  4I8C A;  2QS3 A;  3VVE A;  3U72 A;  3DP4 A;  4GL0 A;  3MVZ A;  3BBR A;  2UVG A;  2I6E A;  3T9X B;  3E3K A;  3PMW A;  2O6A A;  1UTB B;  4G77 A;  1Y1Z A;  4GWO A;  2G93 A;  4ELR A;  2UVI A;  2F7C A;  3K02 A;  4YKJ A;  1OVT A;  5EYF A;  1QUK A;  3KFM A;  4C1U A;  3TTK A;  3TKD A;  3K2D A;  3ODB A;  4NMY A;  2I3W A;  4OZ9 A;  1DPP A;  1IUD A;  1MY3 A;  2O7U A;  1FQE A;  5I56 B;  3SEV A;  2QS2 A;  2REG A;  3PPN A;  1UIV A;  1UTH A;  3MW0 A;  3T9U A;  4QFO A;  3M3L A;  4YU0 A;  2QJE A;  4AB5 A;  1RYO A;  2ABH A;  2Q9T A;  3VLV A;  1B52 A;  2Y7P A;  3R7X A;  3T22 A;  4I9D A;  4QSD A;  4GFR A;  2HAU A;  1Z7M E;  3CFX A;  2DYX A;  5BWJ A;  1IIT A;  1SD3 A;  4OHN A;  3IX1 A;  1LB9 A;  3SEY A;  4R6Y A;  1WDN A;  2PYY A;  3OEM A;  2XXY A;  5IKB A;  1JET A;  4ZE9 A;  3FXR A;  4OEV A;  4YMA A;  2XD3 A;  3TYH A;  4N13 A;  4EDP A;  4F1U A;  4G2Z A;  2Z23 A;  2Q8J A;  1B40 A;  2A5S A;  4R2F A;  3FVO A;  3RQT A;  1Y4C A;  2OZZ A;  2RC9 A;  1LAG E;  2XXP A;  1UTB A;  2E1S A;  1Y20 A;  2WKY A;  4ZEB A;  4H5F A;  3TMG A;  2VGQ A;  1O7T A;  4XKR A;  3S9E A;  4FAT A;  3T66 A;  1AIV A;  3FXU A;  1Y3Q A;  4N07 A;  1T0K A;  5HBC A;  4ELO A;  3U92 A;  4ZE8 A;  2PBW A;  3SET A;  4OWD A;  5FHN A;  4QHQ A;  4RK9 A;  3K6W A;  4AB6 A;  3KOS A;  5L9O A;  3HHG A;  1OQH A;  4L17 A;  4XKQ A;  4G68 C;  3CIJ A;  3CSG A;  3K6V A;  3C32 A;  3M8U A;  1FQA A;  4U21 A;  3VFJ A;  4MLV A;  1TFD A;  1ANF A;  4Z0I A;  1B1X A;  2Q2C A;  1TFA A;  4K3F A;  3TCH A;  1PC3 A;  1DOT A;  4KQP A;  4XKP A;  2I3V A;  1B2H A;  3OOA A;  2R9J A;  5KZT A;  2F8D A;  3RLF E;  4KYE A;  3FXQ A;  2VP1 A;  5FTI A;  5HPQ A;  1SW1 A;  1MQH A;  1N7X A;  4GRK A;  4H6D A;  3F11 A;  4ISU A;  4ZZA A;  1B5I A;  4ELP A;  3H4Z A;  2ANJ A;  4EQ9 A;  4F29 A;  1B9J A;  1OQG A;  3TAJ A;  2Q2A A;  1PBQ A;  4I1D A;  3B6Q A;  1OMP A;  1UQW A;  4X9T A;  4Q5T A;  5EHS A;  4KYS A;  4R74 A;  4YB7 A;  4IY6 A;  1NFT A;  3FJM A;  5K2Y A;  3RTW B;  2KLF A;  1MS7 A;  2ZMB A;  1NNP A;  3U93 A;  1MDP 1;  3EHS A;  1B6H A;  3O29 A;  2F97 A;  2VHA A;  4NF5 B;  5ISU A;  3KN8 A;  4GXA A;  4GOT A;  1J1N A;  3MVW A;  3O2A A;  1H44 A;  3RT8 A;  2OJT A;  5IAI A;  2HFB A;  4LQ2 A;  2O51 A;  4LON B;  3MP6 A;  4QFP A;  3H03 A;  3VLU A;  3PPR A;  1B32 A;  1M5C A;  1FW0 A;  1MXU A;  4YAH X;  1URG A;  3OEK A;  5F7V A;  1VFD A;  4R9F A;  3H6U A;  2OK2 A;  3R6U A;  4R73 A;  5DEX B;  2XXT A;  1O64 A;  3G3J A;  2CZL A;  1EZP A;  4N6P A;  5JK4 A;  4JWO A;  3FVG A;  4KYD A;  2Y7K A;  3BFU A;  1NNK A;  4WEP A;  1B5J A;  3ZKL A;  3O6G A;  3VXB A;  1A99 A;  2GFE A;  1AL3 A;  3H3G A;  3N6U A;  3RT6 B;  3IOU A;  3Q25 A;  3OEN A;  2QL3 A;  3C35 A;  4QSC A;  1JEU A;  3K0V A;  1PB7 A;  4R6H A;  4U22 A;  1FQB A;  1YPN A;  4F1V A;  1R9Q A;  3TUS A;  2AYS A;  3K1N A;  1LST A;  1QJM A;  1I6B A;  4X1B A;  3TPA A;  3N6T A;  4KR5 A;  1MQI A;  4GD5 A;  4IB2 A;  3G3K A;  4GXS B;  2B65 A;  1BTJ A;  3OSQ A;  3PD8 A;  3KSX A;  1TT1 A;  3CRB A;  1Y4T A;  2ONR A;  3G3F A;  4H0W A;  5AA3 A;  2DXY A;  4ESX A;  4WXJ A;  2Y7R A;  1OLC A;  4H67 A;  3GBB A;  5LOM A;  1MDQ A;  1MXW A;  2M8C A;  3CFZ A;  5HM4 B;  2VD3 A;  1SI0 A;  1MQJ A;  2D5W A;  3IL1 B;  2XX9 A;  4EXL A;  5AE4 A;  2RCA A;  5CMB A;  3I6V A;  3G3G A;  2RCB A;  2PVU A;  3FJ7 A;  5L9S A;  3LBS A;  5TU0 A;  3T93 B;  5DEX A;  4F3S A;  2HEU A;  4FIM A;  5I59 B;  4PFY A;  1CE2 A;  3SES A;  4TQU Q;  3V89 B;  3A3U A;  5H8F B;  1EZ9 A;  2XXH A;  2RF1 A;  3K1M A;  2OLB A;  4YB6 A;  1XVY A;  5CC2 A;  4ZZE A;  4H5G A;  3MP1 A;  2ZYM A;  2OWT A;  2YPN A;  1LAF E;  1FQD A;  5CRY A;  3KN3 A;  2FYI A;  2HXW A;  1LGB C;  3U94 A;  1SI1 A;  5JEI A;  1JEV A;  4XTC Q;  4F1Y A;  2B3F A;  4YZZ A;  2F7A A;  4G8M A;  3FZV A;  3QSL A;  2XX8 A;  4BDQ A;  4RPN A;  3OO9 A;  4F2Q A;  3O28 A;  1FTK A;  4IO3 A;  5AA4 B;  2F36 A;  3A09 A;  3MZ1 A;  1UIU A;  4F2O A;  4BDL A;  2D21 A;  1SW4 A;  2O1L A;  5KDT B;  5CMC A;  3TEP A;  1KWH A;  3DM0 A;  3VXC A;  2I58 A;  2Z8F A;  3USD A;  1N3W A;  3BKI B;  4DZ1 A;  5I59 A;  4U23 A;  2QS4 A;  4DXB A;  4IO4 A;  3O9P A;  2XXQ A;  1URD A;  3S9L C;  4KCD A;  5DYH A;  2DE3 A;  3HST A;  4XKN A;  4F18 A;  4Q8R A;  1BP5 A;  1MPC A;  3OMB A;  3S2V A;  2X7P A;  3MPL A;  2RC8 A;  1ZLQ A;  1P1U A;  3SKP A;  5DVF A;  3GBA A;  2V84 A;  2O84 X;  4IO7 A;  3CG3 A;  3IOW A;  2R71 A;  4NWD A;  4IY5 A;  3VVD A;  4G68 B;  4HTG A;  3VLW A;  4DE8 A;  1PEB A;  3ZKK A;  4UAC A;  1ZKB A;  3KSJ A;  3UK4 A;  5H8N B;  3OEL A;  1IQ7 A;  2I48 A;  5K2X A;  4EQ7 A;  3QAX A;  1DTG A;  2A5T B;  3U8Q A;  2H4I A;  1S7Y A;  5CI5 A;  5I2K B;  4IGT A;  3JYR A;  3GZG A;  1H76 A;  5ITP A;  3C34 A;  1P99 A;  4G8H A;  1LCF A;  2W7Y A;  2Z22 A;  3K4U A;  2AL5 A;  4MBP A;  3C36 A;  5B70 A;  1MPD A;  2UYF A;  4YB5 A;  3OO6 A;  1PB9 A;  1H3D A;  4TOZ A;  4EUO A;  3CFL A;  4NF4 B;  3E4R A;  1GTK A;  1XT8 A;  3PPO A;  2QPQ A;  4PFT A;  3TQL A;  3KEI A;  3THI A;  1F9B A;  2XXX A;  3HV1 A;  5I56 A;  1B7H A;  3PPP A;  5L9M A;  2DE4 A;  2RIN A;  2Y7I A;  1B51 A;  4OYV A;  4X48 A;  4MFI A;  1FTO A;  4NWC A;  1R1N A;  2VD2 A;  1LLS A;  2F78 A;  5DVJ A;  2H5Y A;  3FD3 A;  3QYT A;  5BUU A;  4KPT A;  5ITO A;  2ZXT A;  1L5T A;  1A40 A;  2H9B A;  2XXU A;  3TTL A;  3O66 A;  5B7D A;  5ICQ A;  3KZG A;  4M1V A;  3IOV A;  3ZS6 A;  5H8Q B;  2YLN A;  2P2A A;  1D9V A;  4NE4 A;  1B7Z A;  3JV9 A;  5CBS A;  4ND9 A;  3KOT A;  1MY4 A;  3LSF B;  1AMF A;  4U4S A;  5TPA B;  3G3I A;  3C31 A;  3IB2 A;  1YCJ A;  4EXK A;  3SEX A;  1N84 A;  5DT6 A;  4C1T A;  2HQ0 A;  1MXY A;  1MG1 A;  3VVF A;  4ZEC A;  1DTZ A;  1ZU0 A;  3N94 A;  3RNN A;  4FJP A;  5L8D A;  3TTR A;  4GQO A;  4PE5 B;  4U2R A;  3I3V A;  4QFK A;  4R2B A;  4P0I A;  1D4N A;  1VE4 A;  4DIG A;  4MH5 A;  4BDM A;  1SW2 A;  3E9X A;  1B5H A;  3A3C A;  1GR2 A;  4POW A;  2Q89 A;  1Y1M A;  1FCK A;  4UA8 A;  3SDF A;  3ECR A;  3TQW A;  3I5O A;  5J1D A;  2LAO A;  2XXI A;  2F5X A;  1PB8 A;  3O6I A;  5H8Q A;  2ZYO A;  1MXZ A;  3QK6 A;  4R75 A;  3B6T A;  2CMO A;  2OCU A;  4GIZ A;  1XC1 A;  3SER A;  3TZA A;  1LFH A;  3PUW E;  4HS7 A;  1QUL A;  1US4 A;  3KJT A;  1FTM A;  4LVQ A;  3LSL A;  3TFL A;  3S9N C;  1MH4 A;  1DMB A;  1MRP A;  5A5X B;  4RK2 A;  4ZEI A;  4NF6 B;  1PBP A;  4HW8 A;  3QUJ A;  4OMB A;  3HO7 A;  3C4M A;  3QXM A;  1XS5 A;  2REJ A;  3PUX E;  2BJJ X;  3VE1 B;  5TP9 B;  1M5B A;  2HAV A;  1NL5 A;  1LCT A;  2XXR A;  3MJN A;  4OXV A;  4F31 B;  2NVU B;  4ZDM A;  3RY3 A;  3WAF A;  4OVJ A;  2DQV A;  1CB6 A;  5I57 B;  4X1D A;  1TXF A;  1IZ1 A;  4F39 A;  4GVO A;  1N7W A;  1D3K A;  1RKM A;  1B46 A;  4HCY A;  1P1W A;  4JXI A;  3MUQ A;  4ECF A;  5H8S A;  3W9V A;  1NKX A;  5I58 B;  3G7W A;  4U4X A;  1QW0 A;  3RTF B;  4F3B A;  4NF5 A;  2V3T A;  1ATG A;  1R6Z A;  3L6G A;  2O7I A;  2ZNT A;  3H6V A;  3FGS A;  3EPE A;  1IEJ A;  1B3H A;  1JW4 A;  3SEW A;  1AOV A;  1A8E A;  5A5X A;  1LAH E;  4NF6 A; 
#chains in the Genus database with same CATH topology
 1M5D A;  4JSO A;  4LZ5 A;  3MZB A;  3TDJ A;  2PMS A;  4OFL A;  1LBB A;  4X8R A;  2R8T A;  3MPK A;  1KZ8 A;  1MY1 A;  2R6G E;  1MQG A;  1MH3 A;  1SYI A;  5TP9 A;  1YZ0 A;  3CR9 A;  4YIC A;  4BDO A;  2FA7 A;  1USY E;  2OBG A;  3MVY A;  1VDW A;  2DP8 A;  3ONM A;  4FE8 A;  4F3G A;  5IZ3 B;  3FBP A;  2DWI A;  4R6K A;  2AIX A;  4N91 A;  3P7I A;  3ILT B;  4ZS9 A;  3EF7 A;  3FAS A;  4GWY A;  2IEE A;  1MXV A;  1GV8 A;  1LEV A;  1XI6 A;  2DVZ A;  1ZIU A;  2O68 A;  4I3Y A;  2DWA A;  3W9W A;  1NUW A;  4F19 A;  2D3I A;  3DEL B;  2CZK A;  1Z7N E;  1NUX A;  4NGU A;  3UOR A;  4JVC A;  5ET8 A;  3PPQ A;  1NMU A;  3K6X A;  1XVX A;  2ZNS A;  1B3F A;  2Q8M A;  2GQ1 A;  2G29 A;  5JTY B;  5AA2 D;  5F24 A;  3O6H A;  1B3G A;  1DPE A;  3FV2 A;  3T96 B;  4NN3 A;  2AL4 A;  4IO5 A;  4GF8 A;  3LSX A;  3FJG A;  3KC0 A;  3CSB A;  3K01 A;  1P1O A;  3IR1 A;  3PV0 E;  2H99 A;  4OVS A;  3CG1 A;  3W15 C;  4O3B A;  1Y9U A;  4EQB A;  4QBA A;  3MWB A;  3S9M C;  3MAM A;  2PT1 A;  4G8N A;  4JB7 A;  3R26 A;  1Q1K A;  1B1H A;  4QFL A;  2FNC A;  4DXU A;  2X7Q A;  2GRV A;  3V5A A;  3FAT A;  5ET5 A;  1SYH A;  2H25 A;  4P11 A;  1MM7 A;  3EHT A;  3BIG A;  3T9V A;  1BIY A;  4GLI A;  1AH5 A;  1LFI A;  2NUV A;  5H8F A;  5IZ3 A;  2I4B A;  3IFA A;  4MIJ A;  4O3A A;  1Q35 A;  4QXD A;  3JZJ A;  1I6A A;  2QRY A;  3KG2 A;  3MQ9 A;  1RYX A;  2XWI A;  5ICT A;  3Q28 A;  1FQC A;  4RYA A;  4PP0 A;  1HSE A;  1NNF A;  3K1P A;  3H06 B;  1MPB A;  3IAZ A;  1RDY A;  1H43 A;  3K00 A;  1QUI A;  2CZH A;  1P1Q A;  1LFG A;  3GXA A;  1OLA A;  4YKK A;  2L5V A;  4NF8 B;  2GHB A;  3OSR A;  4E0W A;  4AQ4 A;  2F34 A;  4DLD A;  3FUZ A;  3IJO B;  1VR5 A;  5JTY A;  1S9T A;  3UP9 A;  1B3E A;  2Y7W A;  1NH7 A;  1I69 A;  1N0T A;  2DVC A;  3DP6 A;  4QRZ A;  5AA4 A;  1GVC A;  3MP8 A;  3MVX A;  2XD2 A;  2F35 A;  3VDF A;  1YXI A;  4PQJ A;  5KDT A;  5EQ8 A;  2V25 A;  2DXR A;  2V3Q A;  4NX1 A;  2RKM A;  2PT2 A;  4BDR A;  3IO6 A;  4HCW A;  1D9Y A;  1FBC A;  3DLN A;  1HSJ A;  3FIR A;  5FHM A;  4LP2 B;  3Q29 A;  4OTE A;  1ZMG A;  4ZEK A;  1NV2 A;  3C33 A;  5EHM A;  1B05 A;  1MY0 A;  3H6W A;  2FHY A;  3M3K A;  2YJP A;  3UIF A;  1B3L A;  3FVN A;  4XIG Q;  3AXF A;  4FEC A;  5LTC A;  1KA1 A;  3IB1 A;  4E0X A;  1I6Q A;  3B7D A;  1BLF A;  2DSF A;  1EH3 A;  4Q30 B;  3L6H A;  4JBZ A;  1A7L A;  3EHU A;  1N04 A;  3U1O A;  4TLM B;  3S4U A;  1SDX A;  3TOD A;  1JQF A;  5KCJ B;  3MST A;  3IOT A;  3M3F A;  3IJX B;  2F7B A;  2ZNU A;  3TTN A;  3HN0 A;  4XXU A;  3Q26 A;  2FIE A;  4FEB A;  2XHD A;  3DP8 A;  1A55 A;  5FTH A;  4OER A;  5ESY A;  4F22 A;  3KJ7 A;  1POT A;  2F6P A;  3LUY A;  1LAX A;  1NNT A;  2XA5 A;  1II5 A;  3FVK A;  4RXL A;  5DVI A;  1NV5 A;  5FBP A;  3E78 A;  2RC7 A;  4NF8 A;  3TEL A;  4G68 A;  3IO4 A;  1USY H;  2HZL A;  4GX4 A;  4KFQ A;  4O3C A;  5H8N A;  1BKA A;  3C9H A;  4LZ7 A;  3IOR A;  1NV1 A;  5AA2 B;  4KD5 A;  4YMB A;  2XX7 A;  2A5T A;  4FOR A;  2Q88 A;  1KA0 A;  4GL8 A;  4FAJ A;  2JJK A;  2IA4 A;  5I2K A;  3NOH A;  3KBR A;  1IIW A;  2DOJ A;  3V8X B;  4FED A;  1B0L A;  3OO7 A;  3EN3 A;  3PMV A;  1IXG A;  2Q74 A;  3QUF A;  4JSD A;  4NED A;  3IK6 B;  4RJZ A;  1A54 A;  2F6G A;  2O1M A;  5ET6 A;  4BLA A;  1TWY A;  5F1Q A;  3GLB A;  3SEU A;  2WX9 A;  2B3B A;  1LBY A;  4JWY A;  2ALU A;  3OO8 A;  4GBW A;  2DWH A;  3FXB A;  3HFU A;  5CMK A;  4NF4 A;  2ONS A;  2P3V A;  3TCF A;  3MC2 A;  4MJO A;  4P1E A;  3RN8 A;  5M2V A;  2Y84 A;  2V93 A;  4YKI A;  3A29 A;  1A8F A;  4DXC A;  4Z7E A;  5KCJ A;  2QMW A;  1IXC A;  3E13 X;  1EYJ A;  4U1O A;  5I7I A;  2THI A;  3HCQ A;  1FSA A;  3V83 A;  3O97 A;  3QMF A;  1LB8 A;  4OEU A;  1M5F A;  1GGG A;  3RYD A;  3K6U A;  5CBR A;  2VT5 A;  4ELQ A;  1FTA A;  4MNP A;  2HZK A;  4LQ5 A;  4OFO A;  3ILU B;  5ELV A;  3HHF A;  1WOD A;  4NTL A;  2XWO A;  2DE2 A;  2CZI A;  4MNC A;  1FBF A;  1VSO A;  2F3D A;  3H6T A;  1JNF A;  1MXX A;  5AA2 A;  1IXI A;  4AS4 A;  4EF1 A;  4IR8 A;  2X26 A;  1N3X A;  1IME A;  2PFY A;  3FV1 A;  4H8I A;  3CVG A;  5TPA A;  1B58 A;  3PUV E;  4XEQ A;  3D4C A;  5I2N B;  3EQ1 A;  1QKA A;  4PFB A;  4U1Z A;  2NWJ A;  1OIB A;  1P1N A;  3OD7 A;  4YKP A;  2KQZ A;  4LZ8 A;  3BFT A;  2GHA A;  2ZYK A;  3IB0 A;  4LA9 A;  1JVY A;  2ZYN A;  2UVJ A;  4C0R A;  4WKM A;  3UN6 A;  1IXH A;  3MZ9 A;  3PU5 A;  3H7M A;  3N26 A;  1SBP A;  2OWS A;  3D4G A;  2Z8D A;  3LC8 A;  4OVP A;  2WYK A;  4PFU A;  1PDA A;  3QIM A;  1XHY A;  2P1S A;  4N8G A;  4MAG A;  1POY 1;  2XXV A;  2E0S A;  3RUM A;  1B7U A;  1SVX B;  1B0H A;  2Z8E A;  4NHB A;  4RY1 A;  3OXN A;  1QUJ A;  5ET7 A;  1H45 A;  1JVX A;  4ONY A;  4XF5 A;  4IO6 A;  3KN7 A;  4TLL B;  3VV5 A;  2OX3 A;  4N17 A;  4I62 A;  4OFJ A;  4MLQ A;  4DDD A;  1WVJ A;  2I0C A;  2QVR A;  3LR1 A;  1R9L A;  4THI A;  4IO2 A;  2H98 A;  2NOO A;  5DTB A;  1EU8 A;  4KCC A;  4MF3 A;  5CMM A;  4DCY A;  5H8H B;  4POX A;  4RA1 A;  3Q27 A;  3HPI A;  4RNS A;  2V3U A;  4JDF A;  4R9G A;  3UGW A;  4H8J A;  4LUB A;  4DCX A;  3LSW A;  4WED A;  1MY2 A;  1S50 A;  4M4G A;  2PX1 A;  3T9H B;  1SQY A;  1VFE A;  2I4C A;  1FBH A;  3KGC A;  1JW1 A;  1Y3N A;  4F3P A;  1HSL A;  1Y3P A;  1ZTY A;  3WAE A;  5I84 A;  1XOC A;  2DS9 A;  5I2N A;  4PFW A;  3PD9 A;  3MBP A;  4GWW A;  1YAE A;  4QFN A;  2UXA A;  4KHZ E;  4Q0C A;  1O63 A;  2ONK E;  4KI0 E;  5EQ7 A;  2WBD A;  1M5E A;  1LBC A;  1Q9D A;  1MQD A;  4ESW A;  3N5L A;  1G0I A;  2UYE A;  1JW5 A;  1OVB A;  4ZEF A;  1DCU A;  1B4Z A;  4PET A;  4OET A;  1NV6 A;  4P0G A;  1YTV A;  2GH9 A;  1EZO A;  3TTM A;  2HXR A;  4ZED A;  4XFE A;  2DWJ A;  1DSN A;  3GYY A;  4BDN A;  4H1X A;  1ZBM A;  5I57 A;  2NXO A;  1ELJ A;  1ZJL A;  3PGF A;  4RPO A;  5FHO A;  5IGA A;  1N76 A;  4EF2 A;  2UVH A;  3TCG A;  2VOZ A;  4OES A;  4PGN A;  1NH8 A;  1US5 A;  4GWU A;  2I49 A;  2ZZW A;  4G4P A;  4OEN A;  3CI8 A;  2XXW A;  2I0B A;  2QSX A;  3B6W A;  3PMX A;  4QF9 A;  3RGY A;  2PCR A;  1SW5 A;  5I58 A;  5H8H A;  4OQO A;  3ZSF A;  4PF8 A;  3RPW A;  2P0S A;  1URS A;  4R72 A;  2HCA A;  3PUZ E;  1UTH B;  1FTJ A;  1FTL A;  2ESN A;  3G3H A;  2O69 A;  1B4H A;  4O7M A;  4DI3 D;  1MM6 A;  4QSE A;  3UA8 A;  4JWX A;  4IGR A;  1QVS A;  2QMX A;  4OVT A;  1FQF A;  5CM6 A;  4LAT A;  5AA1 A;  3PUY E;  2QS1 A;  1QKB A;  4H65 A;  1LBW A;  4P1L A;  4I8C A;  2QS3 A;  4HE2 A;  3VVE A;  3U72 A;  3DP4 A;  4GL0 A;  3MVZ A;  4PDH A;  3BBR A;  2UVG A;  4FBP A;  3PTY A;  2I6E A;  3T9X B;  3E3K A;  3PMW A;  2O6A A;  1FPI A;  1UTB B;  4G77 A;  1Y1Z A;  4GWO A;  2G93 A;  4ELR A;  2UVI A;  2F7C A;  3K02 A;  4YKJ A;  1IMB A;  1OVT A;  5EYF A;  1QUK A;  3KFM A;  4C1U A;  3TTK A;  3TKD A;  3K2D A;  3ODB A;  2Y5K A;  4NMY A;  2I3W A;  4OZ9 A;  1DPP A;  1IUD A;  1MY3 A;  2O7U A;  1FQE A;  5I56 B;  3SEV A;  2QS2 A;  2REG A;  3PPN A;  1UIV A;  1UTH A;  3MW0 A;  3T9U A;  2WEF A;  1NV3 A;  4QFO A;  3M3L A;  4YU0 A;  2QJE A;  1QGX A;  4PBQ A;  4AB5 A;  1RYO A;  2ABH A;  2Q9T A;  3VLV A;  1B52 A;  2Y7P A;  3R7X A;  3T22 A;  4I9D A;  4QSD A;  4GFR A;  4GWS A;  2HAU A;  1Z7M E;  3CFX A;  4N8Y A;  2DYX A;  5BWJ A;  4PC9 A;  1IIT A;  1SD3 A;  3KC1 A;  4OHN A;  3IX1 A;  1LB9 A;  4OAN A;  3SEY A;  4R6Y A;  1WDN A;  2PYY A;  3OEM A;  2XXY A;  5IKB A;  1JET A;  4ZE9 A;  3FXR A;  4OEV A;  4YMA A;  2XD3 A;  3TYH A;  4N13 A;  4EDP A;  4F1U A;  4G2Z A;  2Z23 A;  2Q8J A;  1B40 A;  1INP A;  2A5S A;  4R2F A;  3FVO A;  3RQT A;  1Y4C A;  2OZZ A;  2RC9 A;  1LAG E;  2QVU A;  2XXP A;  5I5P A;  1UTB A;  2E1S A;  1Y20 A;  1BK4 A;  1DBZ A;  2WKY A;  4ZEB A;  4H5F A;  4PF6 A;  3TMG A;  2VGQ A;  1O7T A;  4XKR A;  3S9E A;  4FAT A;  3T66 A;  1AIV A;  3FXU A;  1Y3Q A;  4N07 A;  1T0K A;  5HBC A;  5EQA A;  4JVD A;  4ELO A;  3RPL B;  1NI9 A;  2F3B A;  3U92 A;  4ZE8 A;  1JP4 A;  2PBW A;  2ZZX A;  3SET A;  4OWD A;  5FHN A;  5A5L A;  5EYG A;  4QHQ A;  4P3L A;  4MMP A;  4RK9 A;  2OWZ A;  4HXV A;  3K6W A;  4AB6 A;  3KOS A;  5L9O A;  3HHG A;  1OQH A;  4L17 A;  4XKQ A;  2B4M A;  4G68 C;  3CIJ A;  3CSG A;  3M8U A;  2DDK A;  3C32 A;  1FQA A;  3K6V A;  1FPE A;  4U21 A;  3VFJ A;  4MLV A;  1TFD A;  1ANF A;  4Z0I A;  1B1X A;  2Q2C A;  1TFA A;  4K3F A;  1G0H A;  3TCH A;  1FJ6 A;  1PC3 A;  1DOT A;  4KQP A;  5LDZ A;  4XKP A;  2I3V A;  1B2H A;  3OOA A;  3LUZ A;  2R9J A;  5KZT A;  2F8D A;  3RLF E;  4KYE A;  3FXQ A;  2VP1 A;  5FTI A;  5HPQ A;  1SW1 A;  1MQH A;  1N7X A;  4GRK A;  4H6D A;  3F11 A;  4ISU A;  4ZZA A;  1B5I A;  4ELP A;  3H4Z A;  2ANJ A;  4EQ9 A;  4F29 A;  1B9J A;  1OQG A;  3TAJ A;  2VPN A;  2Q2A A;  4P47 A;  1PBQ A;  3RPL A;  4I1D A;  4PDD A;  3B6Q A;  1OMP A;  1UQW A;  4X9T A;  2FBP A;  4Q5T A;  5EHS A;  4KYS A;  4R74 A;  4YB7 A;  4IY6 A;  1NFT A;  1FPL A;  3FJM A;  5K2Y A;  3RTW B;  2KLF A;  1MS7 A;  2ZMB A;  1NNP A;  3U93 A;  1MDP 1;  3EHS A;  1B6H A;  3O29 A;  2F97 A;  2VHA A;  4NF5 B;  5ISU A;  1EYK A;  3KN8 A;  4GOT A;  4GXA A;  1D9Q A;  1J1N A;  3T0J A;  3MVW A;  3O2A A;  1NUY A;  1H44 A;  3RT8 A;  2OJT A;  1DK4 A;  5IAI A;  2HFB A;  4LQ2 A;  2O51 A;  3B50 A;  4LON B;  3MP6 A;  4QFP A;  3H03 A;  3VLU A;  3PPR A;  1B32 A;  1M5C A;  1FW0 A;  4MNI A;  1MXU A;  4YAH X;  1URG A;  3OEK A;  5F7V A;  1VFD A;  4R9F A;  3H6U A;  2OK2 A;  3R6U A;  4R73 A;  5DEX B;  2XXT A;  1O64 A;  3G3J A;  2CZL A;  1EZP A;  4N6P A;  4LN5 A;  5JK4 A;  4JWO A;  3FVG A;  4KYD A;  2Y7K A;  3BFU A;  1NNK A;  4WEP A;  1B5J A;  3ZKL A;  3O6G A;  1FJ9 A;  4N6K A;  4P9K A;  3BIH A;  3VXB A;  1A99 A;  1FRP A;  2GFE A;  1AL3 A;  3H3G A;  3N6U A;  3RT6 B;  3IOU A;  3Q25 A;  3OEN A;  2QL3 A;  2MKZ A;  4QSC A;  3C35 A;  1FBE A;  2CEY A;  1JEU A;  4G61 A;  3K0V A;  1PB7 A;  4R6H A;  4U22 A;  1FQB A;  4GBV A;  1YPN A;  4F1V A;  1R9Q A;  3TUS A;  4NF0 A;  2AYS A;  3K1N A;  4GWZ A;  1LST A;  1QJM A;  4P56 A;  1I6B A;  4X1B A;  3TPA A;  3N6T A;  3LV0 A;  4KR5 A;  1MQI A;  4GD5 A;  4IB2 A;  3G3K A;  4GXS B;  2B65 A;  1BTJ A;  3OSQ A;  3PD8 A;  3KSX A;  1TT1 A;  3CRB A;  1Y4T A;  2ONR A;  3G3F A;  4H0W A;  5AA3 A;  2DXY A;  4ESX A;  2ZZV A;  4KXP A;  4WXJ A;  2Y7R A;  1FBG A;  1OLC A;  4H67 A;  3GBB A;  5LOM A;  1MDQ A;  1MXW A;  2M8C A;  3CFZ A;  5HM4 B;  2VD3 A;  1SI0 A;  1MQJ A;  5EYH A;  2D5W A;  3IL1 B;  2XX9 A;  4EXL A;  5AE4 A;  1IMF A;  2RCA A;  5CMB A;  3I6V A;  3G3G A;  2RCB A;  2PVU A;  3FJ7 A;  5L9S A;  2P3N A;  3LBS A;  5TU0 A;  3T93 B;  5DEX A;  4F3S A;  2HEU A;  4FIM A;  5I59 B;  4PFY A;  4HE1 A;  1CE2 A;  3SES A;  4TQU Q;  3V89 B;  3A3U A;  5H8F B;  1EZ9 A;  3EKI A;  2XXH A;  3MYU A;  2RF1 A;  3K1M A;  2OLB A;  2WBB A;  4YB6 A;  1XVY A;  5CC2 A;  1FBD A;  3KBZ A;  4ZZE A;  4H5G A;  3MP1 A;  2ZYM A;  2OWT A;  1IMC A;  2XXK A;  2YPN A;  1NUZ A;  1LAF E;  2QFL A;  1FQD A;  5CRY A;  3KN3 A;  2FYI A;  2HXW A;  1LGB C;  3U94 A;  1SI1 A;  5JEI A;  1K9Y A;  1JEV A;  4XTC Q;  4F1Y A;  2B3F A;  4YZZ A;  2F7A A;  4G8M A;  3FZV A;  3QSL A;  2XX8 A;  4PAK A;  2HPG A;  4BDQ A;  4RPN A;  3OO9 A;  4F2Q A;  3O28 A;  1FTK A;  4IO3 A;  2FIX A;  5AA4 B;  2F36 A;  3A09 A;  3MZ1 A;  1UIU A;  4F2O A;  4BDL A;  2D21 A;  1SW4 A;  2O1L A;  4PFR A;  5KDT B;  5CMC A;  3TEP A;  1KWH A;  3DM0 A;  3VXC A;  1FPD A;  2I58 A;  2Z8F A;  4NAP A;  3USD A;  1N3W A;  5T3J A;  3BKI B;  1K9Z A;  4DZ1 A;  5I59 A;  4U23 A;  2QS4 A;  2XWV A;  4DXB A;  4IO4 A;  1EYI A;  3O9P A;  4UAB A;  2V4C A;  2XXQ A;  3D1R A;  1URD A;  3S9L C;  4KCD A;  5DYH A;  2DE3 A;  3HST A;  4XKN A;  4F18 A;  4Q8R A;  1BP5 A;  1MPC A;  3OMB A;  3S2V A;  2X7P A;  3MPL A;  2RC8 A;  1ZLQ A;  1P1U A;  3SKP A;  5DVF A;  3GBA A;  2V84 A;  2O84 X;  4IO7 A;  3CG3 A;  3IOW A;  2R71 A;  4NWD A;  4IY5 A;  3VVD A;  4N6D A;  4G68 B;  4HTG A;  3VLW A;  4DE8 A;  1PEB A;  3ZKK A;  4UAC A;  1ZKB A;  1NV4 A;  3KSJ A;  3UK4 A;  5H8N B;  3OEL A;  1IQ7 A;  2I48 A;  5K2X A;  4EQ7 A;  3QAX A;  1DTG A;  2A5T B;  3U8Q A;  2H4I A;  1S7Y A;  5CI5 A;  5I2K B;  4OVQ A;  4N81 A;  4PFI A;  4IGT A;  3JYR A;  3GZG A;  1H76 A;  5ITP A;  3C34 A;  1RDZ A;  1P99 A;  5I3S A;  4G8H A;  4HE0 A;  4OA4 A;  1LCF A;  2W7Y A;  2CEX A;  2Z22 A;  3K4U A;  2AL5 A;  4MBP A;  3C36 A;  5B70 A;  1MPD A;  2UYF A;  2BJI A;  4YB5 A;  3OO6 A;  1PB9 A;  1H3D A;  4TOZ A;  4EUO A;  1FPG A;  4GX6 A;  3CFL A;  4NF4 B;  3E4R A;  1IMD A;  1GTK A;  4PTK A;  1XT8 A;  3PPO A;  2QPQ A;  4PFT A;  3TQL A;  3KEI A;  3THI A;  1F9B A;  2XXX A;  3HV1 A;  5I56 A;  1B7H A;  3PPP A;  5L9M A;  2DE4 A;  2RIN A;  2Y7I A;  1B51 A;  2WYP A;  4OYV A;  3E79 A;  4X48 A;  4MFI A;  1FTO A;  4NWC A;  1R1N A;  2VD2 A;  1LLS A;  2F78 A;  5DVJ A;  2H5Y A;  3FD3 A;  3QYT A;  5BUU A;  5IZ1 A;  4KPT A;  5ITO A;  4N4U A;  2ZXT A;  4NG7 A;  1L5T A;  1A40 A;  2H9B A;  2XXU A;  2Y5L A;  3O66 A;  3TTL A;  5B7D A;  5ICQ A;  3KZG A;  1LBZ A;  2B4L A;  3IOV A;  4M1V A;  3ZS6 A;  5H8Q B;  4GX3 A;  2YLN A;  2P2A A;  4N15 A;  1D9V A;  4NE4 A;  4O8M A;  4I3E A;  1NV7 A;  1B7Z A;  4OVR A;  3JV9 A;  5CBS A;  4ND9 A;  5IM2 A;  3KOT A;  1MY4 A;  3LSF B;  1AMF A;  4U4S A;  5TPA B;  3G3I A;  3B8B A;  5IZZ A;  3C31 A;  3IB2 A;  4H45 A;  1YCJ A;  4EXK A;  3SEX A;  1N84 A;  2HHM A;  5DT6 A;  4C1T A;  2HQ0 A;  1MXY A;  1MG1 A;  2PFZ A;  3VVF A;  4ZEC A;  1DTZ A;  1ZU0 A;  3N94 A;  3RNN A;  4FJP A;  5L8D A;  3TTR A;  4X04 A;  4PAI A;  4GQO A;  2KR0 A;  4O94 A;  4PAF A;  4PE5 B;  4U2R A;  4H46 A;  3I3V A;  3SZP A;  4P8B A;  4QFK A;  4R2B A;  4P0I A;  1D4N A;  3IFC A;  4PCD A;  1VE4 A;  4DIG A;  4MH5 A;  4BDM A;  1SW2 A;  3U65 A;  3E9X A;  1B5H A;  5DW8 A;  3A3C A;  4O7I A;  1SPI A;  1GR2 A;  4POW A;  2Q89 A;  1Y1M A;  1FCK A;  4UA8 A;  3SDF A;  3ECR A;  3TQW A;  3I5O A;  3CHG A;  5J1D A;  1IMA A;  2LAO A;  5J16 A;  2XXI A;  2F5X A;  1PB8 A;  3O6I A;  5H8Q A;  2ZYO A;  1MXZ A;  3QK6 A;  4R75 A;  3B6T A;  2XWK A;  2CMO A;  2OCU A;  4NQ8 A;  4I40 A;  4GIZ A;  1XC1 A;  3SER A;  3TZA A;  1LFH A;  2FVZ A;  3PUW E;  4JVI A;  4HS7 A;  1QUL A;  1US4 A;  3KJT A;  4MCO A;  4AS5 A;  1FTM A;  4LVQ A;  3LSL A;  3TFL A;  3S9N C;  1MH4 A;  1FPB A;  1DMB A;  1MRP A;  5A5X B;  4RK2 A;  1CNQ A;  4NF6 B;  4ZEI A;  1PBP A;  4HW8 A;  3QUJ A;  1YYZ A;  4OMB A;  3HO7 A;  3C4M A;  3QXM A;  1XS5 A;  2REJ A;  3PUX E;  2BJJ X;  3VE1 B;  5TP9 B;  4GWX A;  1M5B A;  2HAV A;  4MEV A;  1NV0 A;  3ROJ A;  1NL5 A;  5EQ9 A;  3T1B A;  1FPJ A;  1LBX A;  1LCT A;  2XXR A;  3MJN A;  4OXV A;  4PBH A;  4F31 B;  2NVU B;  4ZDM A;  1AWB A;  3RY3 A;  3WAF A;  4OVJ A;  2DQV A;  3ISP A;  1CB6 A;  5I57 B;  1LBV A;  4MHF A;  4X1D A;  4PE3 A;  1TXF A;  1IZ1 A;  4F39 A;  4GVO A;  1N7W A;  1D3K A;  1RKM A;  1B46 A;  4HCY A;  1P1W A;  4JXI A;  3MUQ A;  2QVV A;  4ECF A;  5H8S A;  3W9V A;  1NKX A;  5I58 B;  3G7W A;  4U4X A;  1QW0 A;  3RTF B;  4F3B A;  4NF5 A;  4DI4 B;  4PGP A;  2V3T A;  1ATG A;  4MX6 A;  1FPK A;  1RDX A;  1R6Z A;  3L6G A;  2O7I A;  2ZNT A;  3H6V A;  3FGS A;  3EPE A;  1FPF A;  1IEJ A;  1B3H A;  1FBP A;  1JW4 A;  3SEW A;  1AOV A;  1A8E A;  5A5X A;  1LAH E;  4NF6 A;  2VPO A; 
#chains in the Genus database with same CATH homology
 1M5D A;  4JSO A;  4LZ5 A;  3MZB A;  3TDJ A;  2PMS A;  4OFL A;  1LBB A;  3MPK A;  1MY1 A;  2R6G E;  1MQG A;  1MH3 A;  1SYI A;  5TP9 A;  3CR9 A;  4YIC A;  4BDO A;  2FA7 A;  1USY E;  2OBG A;  3MVY A;  2DP8 A;  3ONM A;  4FE8 A;  4F3G A;  2DWI A;  4R6K A;  2AIX A;  3P7I A;  3ILT B;  4ZS9 A;  3EF7 A;  3FAS A;  2IEE A;  1MXV A;  1GV8 A;  2DVZ A;  1ZIU A;  2O68 A;  2DWA A;  3W9W A;  4F19 A;  2D3I A;  3DEL B;  1Z7N E;  3UOR A;  3PPQ A;  1NMU A;  3K6X A;  1XVX A;  2ZNS A;  1B3F A;  2G29 A;  5JTY B;  5AA2 D;  3O6H A;  1B3G A;  1DPE A;  3FV2 A;  3T96 B;  2AL4 A;  4GF8 A;  4IO5 A;  3LSX A;  3FJG A;  3CSB A;  3K01 A;  1P1O A;  3IR1 A;  3PV0 E;  2H99 A;  3CG1 A;  3W15 C;  4O3B A;  1Y9U A;  4EQB A;  3S9M C;  3MWB A;  3MAM A;  2PT1 A;  4G8N A;  4JB7 A;  3R26 A;  1Q1K A;  1B1H A;  4QFL A;  2FNC A;  4DXU A;  2X7Q A;  2GRV A;  3V5A A;  3FAT A;  1SYH A;  2H25 A;  4P11 A;  1MM7 A;  3EHT A;  3T9V A;  1BIY A;  4GLI A;  1AH5 A;  1LFI A;  2NUV A;  5H8F A;  2I4B A;  4O3A A;  1Q35 A;  3JZJ A;  1I6A A;  2QRY A;  3KG2 A;  3MQ9 A;  1RYX A;  5ICT A;  3Q28 A;  1FQC A;  4RYA A;  4PP0 A;  1HSE A;  1NNF A;  3K1P A;  3H06 B;  1MPB A;  3IAZ A;  1H43 A;  3K00 A;  1QUI A;  1P1Q A;  1LFG A;  3GXA A;  1OLA A;  4YKK A;  4NF8 B;  2GHB A;  3OSR A;  4E0W A;  4AQ4 A;  2F34 A;  4DLD A;  3FUZ A;  3IJO B;  1VR5 A;  5JTY A;  1S9T A;  3UP9 A;  1B3E A;  2Y7W A;  1NH7 A;  1I69 A;  1N0T A;  2DVC A;  3DP6 A;  4QRZ A;  5AA4 A;  1GVC A;  3MP8 A;  3MVX A;  2XD2 A;  2F35 A;  3VDF A;  4PQJ A;  5KDT A;  2V25 A;  2DXR A;  2V3Q A;  2RKM A;  2PT2 A;  4BDR A;  3IO6 A;  4HCW A;  1D9Y A;  3DLN A;  1HSJ A;  3FIR A;  5FHM A;  4LP2 B;  3Q29 A;  4OTE A;  1ZMG A;  4ZEK A;  3C33 A;  5EHM A;  1B05 A;  1MY0 A;  3H6W A;  3M3K A;  2YJP A;  3UIF A;  1B3L A;  3FVN A;  4XIG Q;  3AXF A;  4FEC A;  3IB1 A;  4E0X A;  1I6Q A;  3B7D A;  1BLF A;  2DSF A;  1EH3 A;  4Q30 B;  3L6H A;  4JBZ A;  1A7L A;  3EHU A;  1N04 A;  3U1O A;  4TLM B;  3S4U A;  1SDX A;  3TOD A;  1JQF A;  5KCJ B;  3IOT A;  3M3F A;  3IJX B;  2F7B A;  2ZNU A;  3TTN A;  3HN0 A;  4XXU A;  3Q26 A;  4FEB A;  2XHD A;  3DP8 A;  1A55 A;  5FTH A;  4OER A;  4F22 A;  3KJ7 A;  1POT A;  2F6P A;  3LUY A;  1LAX A;  1NNT A;  1II5 A;  3FVK A;  4RXL A;  5DVI A;  2RC7 A;  4NF8 A;  3TEL A;  4G68 A;  3IO4 A;  1USY H;  2HZL A;  4KFQ A;  4O3C A;  5H8N A;  1BKA A;  3C9H A;  4LZ7 A;  3IOR A;  5AA2 B;  4KD5 A;  4YMB A;  2XX7 A;  2A5T A;  4FOR A;  2Q88 A;  4GL8 A;  4FAJ A;  2IA4 A;  5I2K A;  3KBR A;  1IIW A;  2DOJ A;  3V8X B;  4FED A;  1B0L A;  3OO7 A;  3EN3 A;  3PMV A;  1IXG A;  3QUF A;  4JSD A;  4NED A;  3IK6 B;  4RJZ A;  1A54 A;  2F6G A;  2O1M A;  4BLA A;  1TWY A;  5F1Q A;  3GLB A;  3SEU A;  2B3B A;  4JWY A;  2ALU A;  3OO8 A;  2DWH A;  5CMK A;  4NF4 A;  2ONS A;  3TCF A;  3MC2 A;  3RN8 A;  5M2V A;  2Y84 A;  2V93 A;  4YKI A;  1A8F A;  4DXC A;  4Z7E A;  5KCJ A;  2QMW A;  1IXC A;  3E13 X;  4U1O A;  2THI A;  3HCQ A;  3V83 A;  3O97 A;  1LB8 A;  4OEU A;  1M5F A;  1GGG A;  3K6U A;  5CBR A;  4ELQ A;  2HZK A;  4LQ5 A;  4OFO A;  3ILU B;  5ELV A;  3HHF A;  1WOD A;  4NTL A;  2DE2 A;  1VSO A;  3H6T A;  1JNF A;  1MXX A;  5AA2 A;  1IXI A;  4EF1 A;  2X26 A;  1N3X A;  3FV1 A;  4H8I A;  3CVG A;  5TPA A;  1B58 A;  3PUV E;  3D4C A;  5I2N B;  3EQ1 A;  1QKA A;  4U1Z A;  2NWJ A;  1OIB A;  1P1N A;  3OD7 A;  4YKP A;  4LZ8 A;  3BFT A;  2GHA A;  2ZYK A;  3IB0 A;  4LA9 A;  1JVY A;  2ZYN A;  2UVJ A;  4C0R A;  4WKM A;  3UN6 A;  1IXH A;  3MZ9 A;  3PU5 A;  3H7M A;  3N26 A;  1SBP A;  2OWS A;  3D4G A;  2Z8D A;  3LC8 A;  4PFU A;  1PDA A;  3QIM A;  1XHY A;  2P1S A;  1POY 1;  2XXV A;  2E0S A;  3RUM A;  1B7U A;  1SVX B;  1B0H A;  2Z8E A;  4RY1 A;  3OXN A;  1QUJ A;  1H45 A;  1JVX A;  4ONY A;  4IO6 A;  3KN7 A;  4TLL B;  3VV5 A;  4I62 A;  4OFJ A;  4MLQ A;  4DDD A;  1WVJ A;  2I0C A;  3LR1 A;  1R9L A;  4THI A;  4IO2 A;  2H98 A;  2NOO A;  5DTB A;  1EU8 A;  4KCC A;  4MF3 A;  5CMM A;  4DCY A;  5H8H B;  4POX A;  4RA1 A;  3Q27 A;  3HPI A;  4RNS A;  2V3U A;  4JDF A;  4R9G A;  3UGW A;  4H8J A;  4LUB A;  4DCX A;  3LSW A;  4WED A;  1MY2 A;  1S50 A;  4M4G A;  2PX1 A;  3T9H B;  1SQY A;  1VFE A;  2I4C A;  3KGC A;  1JW1 A;  1Y3N A;  4F3P A;  1HSL A;  1Y3P A;  1ZTY A;  3WAE A;  5I84 A;  1XOC A;  2DS9 A;  5I2N A;  4PFW A;  3PD9 A;  3MBP A;  1YAE A;  4QFN A;  2UXA A;  4KHZ E;  4Q0C A;  1O63 A;  2ONK E;  4KI0 E;  1M5E A;  1LBC A;  1MQD A;  4ESW A;  3N5L A;  2UYE A;  1JW5 A;  1OVB A;  4ZEF A;  1B4Z A;  4PET A;  4OET A;  4P0G A;  1YTV A;  2GH9 A;  1EZO A;  3TTM A;  4ZED A;  2DWJ A;  1DSN A;  4BDN A;  4H1X A;  1ZBM A;  5I57 A;  2NXO A;  1ELJ A;  1ZJL A;  3PGF A;  4RPO A;  5FHO A;  1N76 A;  4EF2 A;  2UVH A;  3TCG A;  2VOZ A;  4OES A;  1NH8 A;  1US5 A;  2I49 A;  4G4P A;  4OEN A;  3CI8 A;  2XXW A;  2I0B A;  2QSX A;  3B6W A;  3PMX A;  4QF9 A;  3RGY A;  1SW5 A;  5I58 A;  5H8H A;  4OQO A;  3ZSF A;  3RPW A;  2P0S A;  1URS A;  4R72 A;  2HCA A;  3PUZ E;  1UTH B;  1FTJ A;  1FTL A;  2ESN A;  3G3H A;  2O69 A;  1B4H A;  1MM6 A;  4QSE A;  3UA8 A;  4JWX A;  4IGR A;  1QVS A;  2QMX A;  1FQF A;  5CM6 A;  4LAT A;  5AA1 A;  3PUY E;  2QS1 A;  1QKB A;  4H65 A;  4I8C A;  2QS3 A;  3VVE A;  3U72 A;  3DP4 A;  4GL0 A;  3MVZ A;  3BBR A;  2UVG A;  2I6E A;  3T9X B;  3E3K A;  3PMW A;  2O6A A;  1UTB B;  4G77 A;  1Y1Z A;  4GWO A;  2G93 A;  4ELR A;  2UVI A;  2F7C A;  3K02 A;  4YKJ A;  1OVT A;  5EYF A;  1QUK A;  3KFM A;  4C1U A;  3TTK A;  3TKD A;  3K2D A;  3ODB A;  4NMY A;  2I3W A;  4OZ9 A;  1DPP A;  1IUD A;  1MY3 A;  2O7U A;  1FQE A;  5I56 B;  3SEV A;  2QS2 A;  2REG A;  3PPN A;  1UIV A;  1UTH A;  3MW0 A;  3T9U A;  4QFO A;  3M3L A;  4YU0 A;  2QJE A;  4AB5 A;  1RYO A;  2ABH A;  2Q9T A;  3VLV A;  1B52 A;  2Y7P A;  3R7X A;  3T22 A;  4I9D A;  4QSD A;  4GFR A;  2HAU A;  1Z7M E;  3CFX A;  2DYX A;  5BWJ A;  1IIT A;  1SD3 A;  4OHN A;  3IX1 A;  1LB9 A;  3SEY A;  4R6Y A;  1WDN A;  2PYY A;  3OEM A;  2XXY A;  5IKB A;  1JET A;  4ZE9 A;  3FXR A;  4OEV A;  4YMA A;  2XD3 A;  3TYH A;  4N13 A;  4EDP A;  4F1U A;  4G2Z A;  2Z23 A;  2Q8J A;  1B40 A;  2A5S A;  4R2F A;  3FVO A;  3RQT A;  1Y4C A;  2OZZ A;  2RC9 A;  1LAG E;  2XXP A;  1UTB A;  2E1S A;  1Y20 A;  2WKY A;  4ZEB A;  4H5F A;  3TMG A;  2VGQ A;  1O7T A;  4XKR A;  3S9E A;  4FAT A;  3T66 A;  1AIV A;  3FXU A;  1Y3Q A;  4N07 A;  1T0K A;  5HBC A;  4ELO A;  3U92 A;  4ZE8 A;  2PBW A;  3SET A;  4OWD A;  5FHN A;  4QHQ A;  4RK9 A;  3K6W A;  4AB6 A;  3KOS A;  5L9O A;  3HHG A;  1OQH A;  4L17 A;  4XKQ A;  4G68 C;  3CIJ A;  3CSG A;  3K6V A;  3C32 A;  3M8U A;  1FQA A;  4U21 A;  3VFJ A;  4MLV A;  1TFD A;  1ANF A;  4Z0I A;  1B1X A;  2Q2C A;  1TFA A;  4K3F A;  3TCH A;  1PC3 A;  1DOT A;  4KQP A;  4XKP A;  2I3V A;  1B2H A;  3OOA A;  2R9J A;  5KZT A;  2F8D A;  3RLF E;  4KYE A;  3FXQ A;  2VP1 A;  5FTI A;  5HPQ A;  1SW1 A;  1MQH A;  1N7X A;  4GRK A;  4H6D A;  3F11 A;  4ISU A;  4ZZA A;  1B5I A;  4ELP A;  3H4Z A;  2ANJ A;  4EQ9 A;  4F29 A;  1B9J A;  1OQG A;  3TAJ A;  2Q2A A;  1PBQ A;  4I1D A;  3B6Q A;  1OMP A;  1UQW A;  4X9T A;  4Q5T A;  5EHS A;  4KYS A;  4R74 A;  4YB7 A;  4IY6 A;  1NFT A;  3FJM A;  5K2Y A;  3RTW B;  2KLF A;  1MS7 A;  2ZMB A;  1NNP A;  3U93 A;  1MDP 1;  3EHS A;  1B6H A;  3O29 A;  2F97 A;  2VHA A;  4NF5 B;  5ISU A;  3KN8 A;  4GXA A;  4GOT A;  1J1N A;  3MVW A;  3O2A A;  1H44 A;  3RT8 A;  2OJT A;  5IAI A;  2HFB A;  4LQ2 A;  2O51 A;  4LON B;  3MP6 A;  4QFP A;  3H03 A;  3VLU A;  3PPR A;  1B32 A;  1M5C A;  1FW0 A;  1MXU A;  4YAH X;  1URG A;  3OEK A;  5F7V A;  1VFD A;  4R9F A;  3H6U A;  2OK2 A;  3R6U A;  4R73 A;  5DEX B;  2XXT A;  1O64 A;  3G3J A;  2CZL A;  1EZP A;  4N6P A;  5JK4 A;  4JWO A;  3FVG A;  4KYD A;  2Y7K A;  3BFU A;  1NNK A;  4WEP A;  1B5J A;  3ZKL A;  3O6G A;  3VXB A;  1A99 A;  2GFE A;  1AL3 A;  3H3G A;  3N6U A;  3RT6 B;  3IOU A;  3Q25 A;  3OEN A;  2QL3 A;  3C35 A;  4QSC A;  1JEU A;  3K0V A;  1PB7 A;  4R6H A;  4U22 A;  1FQB A;  1YPN A;  4F1V A;  1R9Q A;  3TUS A;  2AYS A;  3K1N A;  1LST A;  1QJM A;  1I6B A;  4X1B A;  3TPA A;  3N6T A;  4KR5 A;  1MQI A;  4GD5 A;  4IB2 A;  3G3K A;  4GXS B;  2B65 A;  1BTJ A;  3OSQ A;  3PD8 A;  3KSX A;  1TT1 A;  3CRB A;  1Y4T A;  2ONR A;  3G3F A;  4H0W A;  5AA3 A;  2DXY A;  4ESX A;  4WXJ A;  2Y7R A;  1OLC A;  4H67 A;  3GBB A;  5LOM A;  1MDQ A;  1MXW A;  2M8C A;  3CFZ A;  5HM4 B;  2VD3 A;  1SI0 A;  1MQJ A;  2D5W A;  3IL1 B;  2XX9 A;  4EXL A;  5AE4 A;  2RCA A;  5CMB A;  3I6V A;  3G3G A;  2RCB A;  2PVU A;  3FJ7 A;  5L9S A;  3LBS A;  5TU0 A;  3T93 B;  5DEX A;  4F3S A;  2HEU A;  4FIM A;  5I59 B;  4PFY A;  1CE2 A;  3SES A;  4TQU Q;  3V89 B;  3A3U A;  5H8F B;  1EZ9 A;  2XXH A;  2RF1 A;  3K1M A;  2OLB A;  4YB6 A;  1XVY A;  5CC2 A;  4ZZE A;  4H5G A;  3MP1 A;  2ZYM A;  2OWT A;  2YPN A;  1LAF E;  1FQD A;  5CRY A;  3KN3 A;  2FYI A;  2HXW A;  1LGB C;  3U94 A;  1SI1 A;  5JEI A;  1JEV A;  4XTC Q;  4F1Y A;  2B3F A;  4YZZ A;  2F7A A;  4G8M A;  3FZV A;  3QSL A;  2XX8 A;  4BDQ A;  4RPN A;  3OO9 A;  4F2Q A;  3O28 A;  1FTK A;  4IO3 A;  5AA4 B;  2F36 A;  3A09 A;  3MZ1 A;  1UIU A;  4F2O A;  4BDL A;  2D21 A;  1SW4 A;  2O1L A;  5KDT B;  5CMC A;  3TEP A;  1KWH A;  3DM0 A;  3VXC A;  2I58 A;  2Z8F A;  3USD A;  1N3W A;  3BKI B;  4DZ1 A;  5I59 A;  4U23 A;  2QS4 A;  4DXB A;  4IO4 A;  3O9P A;  2XXQ A;  1URD A;  3S9L C;  4KCD A;  5DYH A;  2DE3 A;  3HST A;  4XKN A;  4F18 A;  4Q8R A;  1BP5 A;  1MPC A;  3OMB A;  3S2V A;  2X7P A;  3MPL A;  2RC8 A;  1ZLQ A;  1P1U A;  3SKP A;  5DVF A;  3GBA A;  2V84 A;  2O84 X;  4IO7 A;  3CG3 A;  3IOW A;  2R71 A;  4NWD A;  4IY5 A;  3VVD A;  4G68 B;  4HTG A;  3VLW A;  4DE8 A;  1PEB A;  3ZKK A;  4UAC A;  1ZKB A;  3KSJ A;  3UK4 A;  5H8N B;  3OEL A;  1IQ7 A;  2I48 A;  5K2X A;  4EQ7 A;  3QAX A;  1DTG A;  2A5T B;  3U8Q A;  2H4I A;  1S7Y A;  5CI5 A;  5I2K B;  4IGT A;  3JYR A;  3GZG A;  1H76 A;  5ITP A;  3C34 A;  1P99 A;  4G8H A;  1LCF A;  2W7Y A;  2Z22 A;  3K4U A;  2AL5 A;  4MBP A;  3C36 A;  5B70 A;  1MPD A;  2UYF A;  4YB5 A;  3OO6 A;  1PB9 A;  1H3D A;  4TOZ A;  4EUO A;  3CFL A;  4NF4 B;  3E4R A;  1GTK A;  1XT8 A;  3PPO A;  2QPQ A;  4PFT A;  3TQL A;  3KEI A;  3THI A;  1F9B A;  2XXX A;  3HV1 A;  5I56 A;  1B7H A;  3PPP A;  5L9M A;  2DE4 A;  2RIN A;  2Y7I A;  1B51 A;  4OYV A;  4X48 A;  4MFI A;  1FTO A;  4NWC A;  1R1N A;  2VD2 A;  1LLS A;  2F78 A;  5DVJ A;  2H5Y A;  3FD3 A;  3QYT A;  5BUU A;  4KPT A;  5ITO A;  2ZXT A;  1L5T A;  1A40 A;  2H9B A;  2XXU A;  3TTL A;  3O66 A;  5B7D A;  5ICQ A;  3KZG A;  4M1V A;  3IOV A;  3ZS6 A;  5H8Q B;  2YLN A;  2P2A A;  1D9V A;  4NE4 A;  1B7Z A;  3JV9 A;  5CBS A;  4ND9 A;  3KOT A;  1MY4 A;  3LSF B;  1AMF A;  4U4S A;  5TPA B;  3G3I A;  3C31 A;  3IB2 A;  1YCJ A;  4EXK A;  3SEX A;  1N84 A;  5DT6 A;  4C1T A;  2HQ0 A;  1MXY A;  1MG1 A;  3VVF A;  4ZEC A;  1DTZ A;  1ZU0 A;  3N94 A;  3RNN A;  4FJP A;  5L8D A;  3TTR A;  4GQO A;  4PE5 B;  4U2R A;  3I3V A;  4QFK A;  4R2B A;  4P0I A;  1D4N A;  1VE4 A;  4DIG A;  4MH5 A;  4BDM A;  1SW2 A;  3E9X A;  1B5H A;  3A3C A;  1GR2 A;  4POW A;  2Q89 A;  1Y1M A;  1FCK A;  4UA8 A;  3SDF A;  3ECR A;  3TQW A;  3I5O A;  5J1D A;  2LAO A;  2XXI A;  2F5X A;  1PB8 A;  3O6I A;  5H8Q A;  2ZYO A;  1MXZ A;  3QK6 A;  4R75 A;  3B6T A;  2CMO A;  2OCU A;  4GIZ A;  1XC1 A;  3SER A;  3TZA A;  1LFH A;  3PUW E;  4HS7 A;  1QUL A;  1US4 A;  3KJT A;  1FTM A;  4LVQ A;  3LSL A;  3TFL A;  3S9N C;  1MH4 A;  1DMB A;  1MRP A;  5A5X B;  4RK2 A;  4ZEI A;  4NF6 B;  1PBP A;  4HW8 A;  3QUJ A;  4OMB A;  3HO7 A;  3C4M A;  3QXM A;  1XS5 A;  2REJ A;  3PUX E;  2BJJ X;  3VE1 B;  5TP9 B;  1M5B A;  2HAV A;  1NL5 A;  1LCT A;  2XXR A;  3MJN A;  4OXV A;  4F31 B;  2NVU B;  4ZDM A;  3RY3 A;  3WAF A;  4OVJ A;  2DQV A;  1CB6 A;  5I57 B;  4X1D A;  1TXF A;  1IZ1 A;  4F39 A;  4GVO A;  1N7W A;  1D3K A;  1RKM A;  1B46 A;  4HCY A;  1P1W A;  4JXI A;  3MUQ A;  4ECF A;  5H8S A;  3W9V A;  1NKX A;  5I58 B;  3G7W A;  4U4X A;  1QW0 A;  3RTF B;  4F3B A;  4NF5 A;  2V3T A;  1ATG A;  1R6Z A;  3L6G A;  2O7I A;  2ZNT A;  3H6V A;  3FGS A;  3EPE A;  1IEJ A;  1B3H A;  1JW4 A;  3SEW A;  1AOV A;  1A8E A;  5A5X A;  1LAH E;  4NF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...