2LBFB

Solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
molecule keywords 60S acidic ribosomal protein P1
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2011-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lbfB01
2LBFB 2W1OA 4BEHA 3A1YA 4BEHB 2LBFA
chains in the Genus database with same CATH superfamily
1LUJB 3BTIA 2HPIA 3C2BA 3EYYA 2BBYA 1PUFB 5D8KB 1MBJA 3NWSA 4CCNA 4UXNA 5GAGJ 3GTGJ 4A93J 1Y0UA 1T38A 2DFEA 3LSHA 1Y1VJ 4YFNF 3DXJF 5FGMA 2IS6A 4AC0A 1F1ZA 3OMYA 1P6RA 2NS8A 1ZRFA 2RNGA 2LG4A 3L09A 5DCFA 1HSTA 1VQLI 5C4XJ 4BKXA 1BOAA 4A3FJ 2JSCA 1DPUA 3M1CA 4NUBA 4ON0A 2I5UA 3VFZA 3HZJA 2H8WA 4OIRF 1R00A 2M34A 1BM9A 5FD5A 1X3ZB 1YLFA 4X6AJ 2V9VA 1FNNA 3NAUA 1YE9A 1LDDA 2QF7A 4R8HA 3WTUC 2XRNA 4U7DA 2R5ZA 2ZB9A 1XG1A 2E60A 5TISC 2QENA 5HNHA 4KJZA 3DLAA 3HTSB 2XAQA 4JK1X 1V54H 3GW2A 3O3KA 4LB6B 5D4RA 4QPQA 4A3EJ 5CPRB 2J5OA 3K1MA 2ISYA 4ZDLA 4BBSJ 3T8TA 1OQYA 1D0YA 1EA3A 3FF5A 2PJRA 3GFJA 4BACA 3AG2H 2ZXHA 2LFBA 1S5LC 3CQZJ 2AO9A 1SD5A 4PK4A 2BYVE 2P5LC 3GLXA 5LGTA 4FTHA 3FMRA 4B8XA 3BPXA 3O2PE 2M87A 2RV8A 3J7YJ 2B63J 2WAEA 4YELA 2WWYA 4BH9A 4L0ZB 2DOAA 3PIOF 2NVUB 4XKWA 1WGXA 2Y2ZA 3F8CA 5FJ8J 1L3LA 3GVAA 5FO5A 1IC8A 1UB9A 2VJ4A 1S3JA 4EM0B 4G94A 1R22A 3ZMZA 1WWXA 5J8FA 3HSRA 2HXIA 4A6DA 3KP3A 4LD5A 3CCEI 2K02A 4E7IA 1DUXC 3LSMA 2R7WA 3RQ4A 2HVSA 1FJLA 1L0OC 1R5ID 2DK8A 1FIPA 1B59A 3ROUA 4LB5A 2ZFUA 2K85A 1XDUA 3WGGA 2VPLA 2FF4A 2XAJA 4II3A 1W5TA 2EFWA 2VB6A 4PSXA 1O4XA 2IT0A 3AL0B 4RB2C 1W0TA 3LNQA 5DD4A 3ZMTA 5M3FJ 2M9HA 3P5JA 3VYTB 2KQRA 2LBFB 5LBQA 2A05A 1JJ8C 2K4BA 3DFGA 4C30A 2VBZA 2TDXA 1OCRH 2BOLA 2Y0SN 1LQ1A 1MKMA 1AWCA 3HL2A 1SMTA 4X0GA 5D6FA 3LFUA 5FLXZ 3HOVJ 4RLFA 5EG0B 3EUAA 3PSFA 1I5ZA 1CGPA 3RDIA 4CSWA 4RB0A 3GFLA 3I56I 5CVJA 3SFZA 3KFWX 2MABA 2P7VB 2X48A 2PX9A 3KX2A 4M3DA 3UKGA 1T0FA 1YW7A 2VXZA 3OL3A 2VJIA 2LBFA 4ZYDA 3KPHA 1TT5B 3CUQB 3TO9A 1LKXA 2PLYA 2DODA 5D5UB 5LHHA 2E5ZA 3U1KA 1MJ9A 3IC7A 2AQFA 2KP6A 1N75A 2DW4A 3CUQA 3PNYA 1WHUA 1LB2A 3ZP5A 1U5TC 4Q48A 3EUHC 4B4CA 3OS2A 4MTDA 4PJMA 4N4NB 2VKDA 5HLTA 3HTUA 4EJVA 2V1XA 2E2HJ 2GBYA 3LSGA 3CCJI 2XF5A 3HRUA 3JRDA 3L2CA 1R1VA 1ZG5A 3JCUC 2DT7B 4EJWA 1TZLA 1YW8A 2IAIA 3HSEA 3MFKA 4LG0A 3VB2A 2IJLA 4WCGA 3P9CA 2XKOA 3GUDA 3RQIA 1BI3A 1Y6IA 2K27A 3EUKL 2O8KA 1JKQC 3I64A 4MEXF 4GRIA 3IWZA 3BT9A 1VQ9I 4NC6A 3R60A 4KT6A 1U8RA 3OYBA 2L7FP 2Y48A 1STZA 2EZKA 5K7HA 4GYGA 1ZYRF 5LRSA 1LNWA 5HODA 2DA3A 2RNJA 2E1OA 2PQ8A 3JSPA 3S1RJ 1HLVA 4A3LJ 4OIPF 2VJJA 3I55I 2J5PA 5LD2C 2ZJRF 2FJ1A 2R5YB 1OLTA 2XB0X 4UV9A 2HKXA 3Q9SA 4N9IA 3E0JB 1HW1A 2M0CA 1M1EB 3GTPJ 2PMZN 5F1JA 2ELHA 3SDBA 3QYFA 3BC8A 3H3UA 4I02A 2XGDA 4AWXB 4HNVA 1ZRCA 3M3YJ 1ZKGA 3P7NA 4LIUA 4AUXA 3D0SA 1TQMA 3AG4H 4UB6C 4E7SA 2B0LA 2L9VA 3CJQB 1D8JA 2KJCA 4XQFA 4M3GA 3C18A 3Q0WA 2E35A 4PCQA 4MFEA 3K1PA 2DTZA 1XMXA 4HAMA 4I01A 3ZN1A 2HXOA 4AYBA 3U9GA 2VC0A 4RAGA 1SFUA 1SEUA 2FBIA 1XDSA 1R1TA 2IXSA 2O7OA 3HGGA 2KMUA 2OCEA 4IF4A 5ERIA 2RC4A 4U0VA 2V9KA 4HQMA 2EFNA 5HS8A 2VQLA 2R7QA 1BL0A 2M8EA 2WY7Q 2W57A 2CO5A 1LEAA 4M6VA 2OCCH 1X1BA 4AD9A 4HF0A 2XIGA 2JZYA 2W25A 2CSOA 1QNTA 4M6XA 2A68F 2VPRA 4Q4ZF 2Z9OA 1YTYA 1OCPA 1ETXA 4HG2A 3QAHA 1VQ5I 2QQAA 5DTDA 3LSIA 4PFOA 2V4JC 1D3YA 1OR7C 2HTJA 5D6EA 3OYJA 3PUFA 3W6KB 3TW7A 3MQ0A 4HDUA 1WKMA 2MH2A 1K83J 3ZQ7A 3ABUA 1IN4A 3WHCA 2HQNA 2P6SA 3DF8A 1X3UA 5J1YA 1F43A 2Y31A 4ANJA 1E3OC 3KZYA 1QQIA 1VQNI 1LFBA 1X1AA 4A69C 3HKZA 1J09A 3JRBA 2H6CA 2KHMA 2HNHA 1V5EA 2H27A 1OISA 2XRLA 2HYFA 4LITA 3K4LA 4L9TA 4IQJA 5LGUA 5JHUA 1VFCA 4RBOA 2IS4A 2G0EA 3FM5A 4PJNA 4XIDA 4XKVA 2JA7J 2CUEA 2DLLA 2KIQA 3ONQA 1XPXA 2XSJC 2Y30A 1FSEA 2NOGA 2K3FA 3LAPA 5DM7F 1KQ9A 2ESHA 3ZPLA 2A6HF 3FXKA 2W7NA 3L2QA 3BG7A 4HLXA 2RN7A 4M6YA 4DOZA 4PUSA 3VDXA 3WGHA 1KYZA 2BY2A 3CUQC 2O3FA 3LWFA 3BWGA 1TW2A 3CMYA 3JAMZ 1BIAA 1VF9A 3BY6A 1DGRM 1RKWA 2CW7A 4CH7A 4E70A 4UHTA 4BHPA 4KNYA 2WC2A 2Z99A 3FBNB 4Y4RA 2HYJA 1GXPA 3GX4X 1QZZA 3VWBA 2Q1ZB 2EZHA 3LMMA 4C9YA 3HOYJ 2AXTC 1SANA 2O9LA 1R58A 5HS7A 3BJOA 5FKNA 4RGSA 4U7BA 4OMZA 2EV0A 5LRRA 4XM3A 1ZH5A 5LGNA 2MH9A 3IAS2 3CD6I 1YYVA 4FE4A 2OC6A 1P4XA 3JRFA 5F0FA 2KJBA 2XAGA 1ZGAA 3I71A 2L7MP 2LLKA 3ERMA 5KHDA 1DU6A 3BG5A 5E3OA 1AOYA 2M4GA 5FD6A 2O6GE 4KDPA 2L7KA 3IWFA 2P8TA 4ESFA 2HYGD 4KIBA 1TT0A 5CVUA 5D5WB 1XMKA 4ITVA 4CCMA 5ICCA 2NVXJ 2D1VA 1K78B 3QU3A 4TV7A 3H35A 2W85A 1OKRA 3H5NA 2E1NA 2LK2A 3E97A 1UZCA 5IYCJ 3L1PA 3CCUI 1S9HA 4QPOA 4DGWB 4WK8F 4CGZA 3RI4A 3T0YA 1NK2P 2ACJA 1ODDA 4W1UA 4ZYGA 2JQ7A 3TO7A 1FWZA 1IUYA 5GADJ 2GLOA 4HV6A 1XX5A 3KE2A 3F72A 2DA4A 4B48A 3KLOA 1LVAA 2R92J 2E1MB 2L02A 2MC3A 3PQJA 4DQ2A 3PO2J 2PEXA 5K5OA 3S17J 3MKLA 1X1DA 3K10A 2RAEA 3EDPA 4WXDA 2Q2EB 4G6QA 3VPRA 5LLQA 2QQ8A 2G7UA 1T8IA 3H36A 3P9KA 4XN3A 3OYNA 1MW7A 1W5SA 1NH3A 3WU0A 4EVIA 2DOEA 3FKJA 3TO6A 3PFIA 4ZYHA 4WXCA 3ZGKA 3HOZJ 1E0EA 1QHGA 3DTKA 4YRVA 4F91B 2E7WA 1VNDA 5C3EJ 2Z33A 4E7KA 3ECOA 3IL2A 2XB5A 3KYDB 4OWRB 1F5TA 2KKOA 4I99C 3FWEA 4MHGA 2NVTJ 2FOKA 1YQAA 3LA2A 3AG3H 4KMFA 3WTSC 3DTIA 1X1PA 1MZBA 2DA2A 3ESWB 2FMLA 1YOVB 3ABLH 5BS6A 3TEDA 4AM3A 2ICWG 4GYIA 1JGGA 1TWAJ 1VI0A 4GO1A 1J75A 1TQIA 5DDGA 4MLOA 4XR6A 2NAZA 2CQXA 4KT5C 1JUSA 4XLCA 2X85A 2D45A 4HOBA 1FTTA 3CTAA 3G1MA 5EGOB 2KISA 1VTNC 2K7LA 3CMAI 4QWQA 2HS5A 4P96A 4J19A 1AKHA 4XN0A 2XUBA 4F3QA 1BI0A 1V55H 2WB1N 2CJJA 3S1NJ 3LSJA 3GTMJ 4RB3C 3OIOA 1K4SA 4NC7A 2IBDA 2DDBA 2YX4A 4NDLA 5JLWA 4XBFA 4PGGA 4XKBA 2KPMA 1PVEA 1PUEE 3ISPA 5M5WJ 2M45A 1QA6A 4IVNA 3RCOA 2RKHA 1WFXA 4CCJA 3MCZA 2NS0A 1HSJA 2CV1A 1MBHA 4UV8A 2L9SA 2EA2A 2XAHA 3FXJA 3KYCB 2ZNYA 5JLXA 5LHIA 2IA2A 1TWFJ 1OPCA 4CYDA 2OV7A 4UVBA 1WRJA 2Y0SA 3GBGA 1FBUA 3ZXSA 3TL4X 2ZSHB 4LFUA 2FUG2 2XAFA 3J7ZI 1JT6A 4E7ZA 3K69A 3SZPA 2E5NA 3LA3A 4DYQA 3JRCA 2M30A 1WJDA 4B09A 2V6EA 3F8MA 3U21A 3QYEA 1GVDA 3Q0UA 2L54A 5IOZA 4EQQA 3V7CA 1XGMA 5L3GA 2BEOA 2ZCWA 4XORA 2DA1A 1OR7A 2K5CA 3E3VA 4I09A 3ZOBA 1U0JA 2Y75A 3G73A 2RDPA 4P5OA 4FX4A 2M2EA 4D1QA 1YX5A 1UCRA 1Z1DA 3G4SI 1DGWY 3SXYA 2DA7A 5IT9K 1YJNI 3Q5FA 1BW5A 2A3SA 2HOEA 3DBLB 3OR2C 5F64A 4Z2YA 4A5MA 4CCLA 4DYCA 3UNGC 3R0JA 3RKWA 5K7FA 2CS3A 1XS9A 3WTXC 3OY9A 4HQEA 4CO8A 4NNJA 1SVLA 5ICFA 1ZG3A 2LC2A 1D1AA 1WJAA 4A3DJ 2V79A 1BC8C 2ZSIB 4RAZA 1XMAA 1W4MA 3MZYA 4F52A 1MMSA 5CVIA 4ZDOA 1FMWA 4BHCA 5BNGA 1EH6A 2MC4A 4RMNA 4I0BA 3PFYA 1Z21A 1I3QJ 5E1XA 3D5LA 1TP4A 1IV8A 1W7PA 2FX0A 5BPIA 4QTRA 2M5WA 4CXFA 4H0EA 2X1DA 1FP1D 1V5GA 2LMDA 2K3PA 4NBQA 3WU2C 2XROA 1IDYA 3ZQGA 4EM2A 2HZTA 3GFIA 2HI3A 2X1CA 5L3DA 2F5CA 3BP8A 1Z6RA 4MIMA 5E8GA 3OIPA 3VODA 4AVPA 2CQQA 2ZBKA 4MQVA 1SD7A 1HKQA 2CW0F 3IUOA 2QEXI 2NNYA 1BN5A 4Y17A 2YX7A 3K6GA 1J9IA 1RESA 3IHUA 1I1GA 1JKOC 1LEBA 1D1CA 1HQCA 2FE3A 5E17F 3ABTA 2C6YA 2KRFA 4IRGA 2E1CA 1HXDA 5BOXA 3R61A 2XVCA 3CP8A 4S05A 2VI6A 3B6AA 1ERDA 1I6XA 4J01A 3GCMA 3OYMA 2W84A 2ZNZA 2Z3YA 3QWLA 2LF8A 1FY7A 2VBWA 1TNTA 3SYTA 3ZQCA 1F9NA 2XPUA 2IRFG 1I3AA 2JN6A 1JHFA 2XGEA 4XOTA 1Z91A 3ELKA 1FYMA 5EEGA 3H5RA 3K4MA 3REOA 3OYFA 1CF7B 2LTPA 2W1OA 3RYRA 2LF7A 2EV5A 3HB9A 1TW3A 2H1LA 4XNFA 5GPCA 4A12A 5HOOA 1H89C 2LY2A 1IN7A 3CZ6A 4Y52J 2RQPA 2IPQX 2STWA 2LP0A 4M3BA 2OTLI 1K78A 1NK3P 3W6VA 3NARA 4ESBA 3SQNA 2JRMA 1T6SA 3D1NI 4LLLA 3DWLE 2QUFA 1GLNA 2EJRA 2R7FA 2RREA 3F3XA 3S3NA 2BHZA 1B8IB 3V8KA 4BJ6C 3FX3A 3BR5A 1KU9A 1JHHA 2ME0A 4B1RA 4IZZA 2DBBA 3BQZA 4N0BA 2DFIA 1IV6A 2YPRA 1T0FC 1OYWA 1OCOH 3NQOA 1S6LA 4RGUA 3MVPA 3IH2A 2I10A 1SMYF 2QBYA 5L3CA 1VQKI 1E3PA 3OS0A 3FZVA 3D5SC 1DU0A 4Y33A 3BROA 2MD5A 4DZPA 1P2FA 3VOEA 3F22A 3HKZN 2OJED 3QODA 1I27A 1FIAA 4O3MA 3BR1A 5K5QA 3WHBA 1SD6A 3RIRA 4PDKA 4ZZLA 3F8FA 3DBRB 4ENKA 2R7TA 4UVCA 4A0YA 1QBJA 3I4NJ 3C2GA 2QSFX 3BJAA 4PSWA 5B1AH 3W3CA 2CFOA 1B1BA 1U8BA 2FD5A 2MFZA 1SFKA 1GXQA 3LL7A 3BG6A 1BJAA 2ZO4A 3A1YA 1A6IA 3PNTA 5CVVA 4B3AA 2E19A 3CLQA 1XSXA 1RNLA 1CQTA 4B47A 4M72A 3WTZA 1IJWC 1HBXG 3BTLA 3TP0A 1HCRA 1MMNA 3T1BA 4DYRA 2IGMA 3CCQI 1EH7A 1ACIA 4UVAA 1N25A 1UJ8A 1DQUA 2BY1A 2O61A 2L9RA 4CDGA 2NVQJ 4D7NA 3CCRI 4MO7A 1J5YA 3L00A 3G71I 1H0MA 1MIJA 4OIOF 4L5IA 1VQ6I 3I9V2 4LJZF 3PM1A 4XOPA 1FTZA 2VASA 4D0PA 4JX4A 2ZXIA 2D2WA 1Z9CA 5IYDJ 2BZTA 4LLGF 2W82A 1UG0A 5KNLA 2EINH 1W5CC 4KUMA 1RI7A 2BXZA 3S1QJ 4OINF 2WY8Q 4BQQA 3HEFA 4G7ZF 1Y56A 2DA6A 4Y15A 4YIFA 3O8HA 2A5WA 2X9DA 4M9SA 4C2TA 2FA5A 3CMEI 2O03A 4A0XA 2Q2EA 4BXUA 3BR2A 1MMDA 5KAIC 3SEQA 1P7IA 5EZHA 4MGRA 2WADA 1XC5A 4MNUA 2VLAA 5J4VA 2R5ZB 1O3TA 5B3SH 2MG4A 3K9TA 1EH8A 4HX8A 2EK5A 2MW8A 4P55A 5J1RA 1K7AA 1TWCJ 1BIBA 3U1DA 1WQ2A 1NG7A 2CFXA 1YG2A 3K4JA 5E79C 4GFBA 2MSYA 2NYXA 2OQGA 5E1WA 2QKMB 3E5QA 1Z67A 1WPKA 1X4PA 2X6OA 3S93A 4C3IJ 1SC7A 2DXIA 2ZMEB 2BW3B 3S8PA 3QQAA 4JBAA 3DU5A 1GV2A 1X3WB 3HPHA 4K2EA 5EZGA 5FLMJ 4B43A 5B5EC 2YU3A 2PBIA 4BU2A 1SVOA 4E6KG 2IEKA 2KIFA 5J3LA 3IP4B 4E4HA 5DM6F 3GTLJ 1FSHA 3WTYC 3CCVI 1IAWA 4BQAA 1MNDA 5EGOA 2G9WA 2MLGA 2Z1DA 1IXRC 1YI2I 3PNVA 2JUGA 5TRDA 3LOCA 4AIJA 1UFMA 2R7SA 1PUFA 4MTEA 3BJ6A 5AIQA 1A5JA 3KETA 3RPUA 3HPGA 1XSVA 3DQVC 1YRNA 1I1SA 5EYRA 5IP7J 3DCFA 2QGUA 1OMIA 3A03A 2IW5A 2DO7A 2H6BA 4GGGA 3ML6A 4E7LA 3FM3A 4DZJA 1R36A 3X2QH 1T95A 5CJ9A 3AG1H 3QP6A 4IHXA 1R9TJ 5F27A 4A5NA 2F6CA 4DJAA 1S29A 2AQEA 2P4WA 4M74A 4P1WA 2ME6A 3CO7C 9ANTA 1X19A 4KA4A 2V9PA 2R7ZJ 2FNAA 2LYCA 4KIGA 1U9NA 2EH3A 5F04A 2EBIA 2DDAA 1B6AA 5FFZA 4X1EA 1AA7A 2PN6A 4YFXF 1Z3YA 3FIWA 2JPBA 3A01B 1FC3A 3GMEA 2F5DA 3B02A 1EV7A 1YO5C 4HPQA 2EA4A 4D7MA 4IKFA 5C4JJ 1MH4A 1H9GA 3E6CC 3RZOJ 3BTCA 1LE8B 1DP3A 1D1BA 2V7FA 3RSNA 4IL6C 1D5YA 5L3BA 1IN6A 3CDLA 3MKYB 3Q3SA 2R5YA 1XTAA 2Z16A 4BE2A 4A0ZA 2F4IA 3ZQQA 5ILVA 3HXLA 3ZCOA 2PMZA 3O8GA 4OOIA 4WWCA 1P92A 1G2HA 2VODA 2Q0OA 3OYIA 2YSRA 3CC7I 2IS1A 3MAJA 4NQWB 5BPDA 4JYKA 2DOFA 4OAZA 5EEHA 5CKTA 2DMQA 1KGSA 4BL0B 1YJWI 1EJ9A 2GZWA 3DU6A 5F6FA 3CC4I 1G59A 3H0GJ 5JFRA 2DI3A 3S2HJ 1RUOA 1PJRA 2HTSA 5EJCA 2VUMJ 2JT1A 4IHVA 1RPWA 2Y69H 1JE8A 2Y9ZA 1RRJA 3HOUJ 2JA8J 5H6RA 5J8CA 3L2RA 1OCTC 4HV5A 2BY0A 2XPWA 1ORKA 4HYEA 1NG6A 5D5VB 5DEQA 3LAJA 4M3EA 4BQNA 4QLCU 3NEUA 2X6YA 4XONA 5DCMB 1S8NA 1WJ5A 4BGDA 2OU2A 2LR8A 2GOXB 4G12A 1IXSB 1E2XA 3LA7A 4N9HA 3JRIA 5B1BH 3JREA 1YRNB 1SD4A 4JQFA 3QYBA 2E1MC 1GVJA 1U6GA 3MMYB 1DP7P 3OWTA 2VBXA 1XCVA 2M7AA 1H8AC 2QQBA 5HVQC 2HVQA 4HSRA 2DJNA 1TTYA 4ZTJA 2KLOA 2JVHA 1VQ7I 2JA2A 2ECBA 2WTEA 3BZ6A 2V1DA 3V42A 2XPVA 5JVGF 4O6JA 2UUZA 2KZVA 3GF2A 2DN0A 4BUPA 5E3NA 2VE8A 3KLNA 3JTHA 2VOPA 3CP2A 5FRNA 3SDGA 4IRIA 3J81Z 2H09A 1SVMA 3BR6A 2ZMEA 4M73A 1FZPB 3IV5A 1IF1A 5ILSA 4BDYA 4D9JA 1UHMA 1IO2A 5HNFA 2H1KA 1BBYA 4BAYA 1MBGA 3LQRA 4XLEA 4XICA 3TKYA 4CYCB 3I59B 3CF2A 4RS8A 2EV6A 1V3FA 1IRGA 3K7AJ 3H9GA 2BHYA 2D1HA 1KU3A 1IG7A 3PIPF 2DAOA 1ZG1A 1IN8A 1R4NB 1OCCH 1T33A 1ZLKA 3L2VA 2EZLA 1J0RA 1POGA 3M1EA 1WCMJ 3C7JA 5IP6A 1OJLA 3TMOA 3GLLA 1IUFA 4F93B 4GXOA 4UY8I 3V7SA 2IVMA 2KZGA 1WVRA 2WA0A 4FASD 4F92B 1D0XA 2P6TA 2PFBA 3KEYA 1W7PB 1VQPI 5F08A 3RTRA 2GIZA 3HHHA 3LSTA 1NHAA 2R7RA 4OAYA 4ABZA 4KMUX 2VKEA 3VEPA 5M3MJ 1I6HJ 2KIUA 4D5FA 1KYWA 3S3OA 1G3WA 3L2WA 2EQRA 2DA5A 1R49A 1G6NA 4KFCA 1Y39A 1KQ0A 3V8LA 4AVZA 2XAUA 3ZMVA 4O5VA 2AHQA 2M0MA 2DQRA 4Y7NJ 5A2QK 1UG2A 4IPAA 3OOPA 4IHSA 2K9QA 1JI8A 2ZXJA 1I50J 3PUBA 1W1WE 1LDKB 3V4GA 3I58A 2QA4I 1O3QA 1EF4A 3DP7A 3OYEA 3FXLA 1RIOH 1Z6TA 4IOAF 2PMUA 2JJ7A 2UXNA 3RJPA 4ZTFA 3HGYA 4II2A 4IO9F 2EILH 2ZXWH 1TQPA 4XK4A 2LDUA 3M8JA 3KZZA 1CF7A 1T56A 3E5XA 1BR1A 3LSRA 3ULQB 2XF6A 1ULYA 2FBKA 2VN2A 3F0CA 2EIJH 2HDCA 3OOUA 2ID6A 2W48A 1A35A 2K4JA 5B66C 4EEFG 1KA8A 3G6EI 4L5JA 3B6CA 4FHTA 5E18F 3M4OJ 4C2MJ 1BJZA 2BW3A 1ZK8A 2CUJA 4IXAA 1HKSA 2JUCA 3OV8A 3Q9VA 3RPUD 3T8RA 2VBYA 3I53A 5DUKA 4XRSA 1LDJA 2OBPA 4BBRJ 3CF5F 1TC3C 1KU7A 4C3HJ 3K1NA 2PG4A 3OIQA 3E6BA 3TOBA 3HOXJ 1S7EA 1BI2A 2PMHA 2XDVA 2HQ5A 4RDUA 1ENHA 5D4SA 5FB2A 4RLQA 1OFCX 1WJFA 2OZUA 1LVKA 3OR1C 5D5XB 3BZCA 5F0CA 4RB1A 4EGZA 1VQ8I 1F36A 1ZAOA 2DMPA 1H88C 3BLYA 4CICA 2YUSA 4LIVA 2BY3A 2DQLA 3HSFA 1MSEC 1J59A 5FLVA 3RPQA 4BEHB 3F23A 3WE3A 1HDPA 1ONVA 1HDDC 4ZJZA 2P81A 3JRAA 3Q0VA 2DFFA 1A36A 4HZFA 1MMAA 3HIFA 1BW6A 2X1EA 1WSUA 2A5YB 1P4WA 3L2UA 3SZTA 4DBQA 3FHNA 3CCSI 3B73A 3FBIB 4KYWA 1ZQ3P 2TCTA 4DNCA 4L9JA 1YFHA 5J47A 3MKWB 2O8XA 1QRYA 5GTHC 1QO0D 1U78A 4UNOA 3SEZA 1R4MB 4GDFA 1RKTA 3IKTA 3VYUB 1Z7UA 5H20A 3E7LA 3OS1A 4ENNA 3OSGA 4D5CA 3SHFA 4EJUA 2F5FA 3HRMA 1WH5A 4FETA 1KU2A 1XCBA 2KT0A 2UZKA 2DT6A 2W4SA 3FXUA 3ZQFA 1R23A 1JTXA 1AKHB 3A4CA 4JX6A 3MWMA 4WF2A 3CO6C 4FT8A 3OYHA 4I2OA 1XD7A 2YS9A 4QSHA 1C0WA 2HQAA 2HDDA 3RYPA 3CJNA 2LKPA 2ZC2A 3BOQA 2E71A 5HLIA 1E3HA 3ABKH 3QPLA 3UR3C 3CC2I 4KISA 4I0AA 1T08B 1JUMA 3S2DJ 4LMYA 3CCLI 4RGXA 5BQTA 3OYDA 4S0HB 3G2BA 3KP4A 5ILUA 3FDYA 2MGQA 2R7UA 4G9YA 3AKZA 3HRTA 4W97A 1REPC 4M9XA 1P7JA 3LSKA 4RM3A 2HPMA 4BS9A 3CCYA 4KITB 1LFUP 1ETQA 2JTVA 3U2RA 3RKXA 4V19K 1RZ4A 1ZRDA 3N05A 3OYGA 2A69F 2NRAC 5IOYA 1OCZH 3RKQA 4PZJA 2K40A 5EF6A 1IXCA 1MBEA 4LOCA 3L9FA 3I4PA 1U2WA 1YIOA 4KICA 3DEWA 3GWZA 2A61A 1XGOA 3FXOA 1UHWA 3CMMA 3HUGA 3I3LA 1XGSA 3EQLF 1R6RA 5K1YA 2OUMA 2X6WA 3R4KA 3E5UA 3GYHX 2R3SA 3QRFF 4EGYA 3OYKA 3DKXA 1Y1WJ 3V7RA 5IY5H 4U0YA 1ZLJA 1HA8A 2ECCA 1EKEA 2VJ5A 2WV0A 2PJRB 2OD5A 1P9QC 4YEJA 1TWGJ 2DCEA 2KFDA 3JRGA 4XRFA 4HLYA 2KL4A 2ZKZA 1MBKA 1RETA 3MZHA 2IP2A 2NVYJ 1LE8A 2M1BA 5HDNA 5FLXK 3PO3J 2R7OA 3FMSA 3WTTC 1FOYA 3BTJA 3EYIA 5E3LA 3MZ8A 3KEOA 2GOMA 3KEQA 5H6QA 3A01A 2CUZA 1YS7A 3FHZA 5JVTA 1TL8A 3I4MJ 1J2XA 4BXXJ 2E2JJ 4YIRX 4IJAA 2IS2A 3K70D 4UB8C 4N4OB 3GZ5A 2Y9YA 3F9KA 3W2WA 2YU9J 2VXDA 4HA8A 4Y3OA 2EFPA 5AIPA 2ID3A 5F1RA 4V2GA 1FOKA 2JRTA 1W36D 4BYYA 1RR7A 3S3MA 3A0BC 3H9JA 3V8JA 1B9NA 1XN7A 1G3YA 2XGCA 4DBRA 3ABMH 5BMZA 4BE0A 1UHSA 1JT0A 3EPZA 4A3BJ 1O3RA 3DBHB 2M4KA 3F8BA 1Z05A 3K0LA 2CYYA 2HEOA 3M9AA 3F6VA 4WX9A 2A07F 3G1LA 5J1UA 2B7EA 2RGVA 2KRHA 1FT9A 3EETA 4BEHA 4XL9A 2L2OA 2FU4A 1MBFA 4FX0A 2HOAA 3A0HC 4ZC3A 1ON1A 2GA1A 2L5QA 1ZN2A 4AIKA 1G3TA 2P7CB 4ASNA 1HKTA 3VSLA 1FOXA 4PJLA 1IRZA 1W0UA 1FOWA 2GIVA 5LEKA 3F21A 4E7HA 2NS7A 3BCBA 1K4TA 3NWTA 2K9MA 4RAFA 2VKVA 4ZH4F 2CV0A 2P0WA 4L0YB 2R7DA 2PJPA 1ZGWA 3DPTA 1FEXA 3ZMSA 2FSWA 2LKSA 4AIDA 3FK7A 1FLIA 2NXNB 3S32A 1W7PD 2O5RA 2CRGA 1ITYA 4HDVA 2F4MB 2OAZA 2MYSA 1B72A 3ERED 4G7OF 2L3DA 2F5VA 2KDZA 1G8XA 1JKRC 5E20A 2KIMA 1ZR4A 4NQWA 3I54A 3M7GA 3A2KA 1LFPA 3DEUA 3VSKA 4H4KC 3IRQA 3R6SA 4LG0B 2EPFA 3ZR8X 5A2QZ 2A6EF 3CDIA 3ZQHA 2HZDA 5FKKA 5KAFC 4UUSB 1PDNC 2DYRH 5ICGA 1MNEA 2B9SA 3DV8A 2LRDA 4XSXF 3K4KA 1UELB 5M5XJ 2R0QC 1R71A 4BNCA 3BR3A 2EB7A 4GCVA 2I8DA 3MN2A 1U9OA 2FOWA 2CGPA 5CQGA 4HX7A 3BR0A 4IHYA 3IH4A 3GTKJ 5DCMA 5HLGA 2PI0A 4IHTA 2CWEA 5J4YA 4ESJA 2GXAA 3T5XA 2YR2A 1J7KA 1UMQA 4I76A 2HGCA 4MQ9F 2FQ3A 4NHJA 3ZQLA 3F8NA 3CCMI 4U87A 4R79A 3H5AA 3KYLA 2VOOA 4S04A 2VC1A 4XLAA 2R7VA 5M5YJ 4M71A 1YJ9I 1FYLA 4EM1A 1LJ9A 1O3SA 2DJIA 1K79A 1O57A 5E8IA 2ZFWA 4HNUA 5HS9A 4CZZA 1JTYA 3IAM2 3AL0C 2ESNA 2FBHA 2NNNA 1JUPA 2CMPA 5JR3A 1Q1HA 1QVUA 5LFAA 1QPIA 3LFKA 2XV4S 3PSIA 4M9ZA 2M3AA 4G8XA 5D8LB 3GTOJ 2WBMA 1Z3XA 2GWRA 2QM3A 3BG9A 1YX3A 3ZQIA 5CQEA 4XSZF 1YHQI 3WODF 4G6TB 3RKYA 5KK1A 4CHUA 2QCOA 1V4RA 1YW9A 3LQQA 4BJTA 3SFIA 2OQRA 4XMYA 4DIQA 4U88A 2GXGA 3GTJJ 1MSFC 4ZDPA 5IP9J 2QBYB 5HDKA 4XLNF 3I59A 1DPRA 4A3GJ 4XRMA 5LEJA 4IOCF 2H8RA 4ZZDA 5HLHA 3BPVA 2CH0A 4EV0A 4E7JA 4JOMA 3TP3A 2DFHA 2JA5J 5C44J 3HHGA 2EIMH 2X6XA 3JW4A 3FXRA 1B8IA 3O6BB 3K4CA 2KDOA 1GHCA 2ELKA 2IA0A 2P5VA 3JAMK 4BE1A 1B4AA 3CJTB 4XLFA 3F6OA 1BR2A 3AFHA 3KZIC 3WTVC 2UV1A 1D5VA 4HSTA 1YS6A 4OU0A 2R4GA 2VT2A 1A6QA 4IEJA 1S72I 4HF1A 1QU3A 4XRSG 3K4BA 2EWNA 3J7AY 3ZMUA 1XB4A 1IZ1A 1U3EM 1MJBA 4BXFA 3LSPA 4LG3A 1H9TA 3J7AO 4ENJA 1IRFA 4HW0A 4LK1F 1NTCA 1U5TA 3QPHA 5DD8A 1HC8A 4P9UA 2GXBA 2F48A 2QVOA 4ZYEA 5AONA 3H0DA 5EG0A 2DMTA 3ZN0A 4C3JJ 2MBFA 2ADUA 1MD0A 3DLLF 1KONA 1ETWA 3K70C 3WE2A 1B9MA 4RA2A 3JTGA 4A3CJ 2BGCA 3EUHA 4G7HF 1ETYA 1MMGA 1UAAA 2JSPA 4EMSA 2FEZA 1W36C 1ZARA 5DYMA 3R0AA 3W2VA 4RAYA 2BXYA 3HC7A 3BZKA 2UWMA 1Z0XA 4OMYA 2DTRA 2MLKA 3N4MA 2QYOA 1U5TB 3QPTA 1Y0NA 4BHBA 4KIFA 1GUUA 4PGHA 5E3MA 1R5HA 2W00A 1HF0A 1FYKA 2K86A 5IYBJ 2IGOA 1GV5A 3MKZA 2Y0MA 3QP5A 2ZJ2A 2Q8KA 1AU7A 4OIQF 2V1UA 3WG9A 3TDUC 4UUTA 2TRTA 3C3WA 3GXOA 2M8GX 2F2EA 4ETSA 4CA0A 1DDNA 2F4OB 2FXAA 3KP2A 4PJ0C 5JHFA 1K61A 1ZREA 1WI3A 3QOPA 3J80Z 1PP8F 4Q5SF 1JXSA 2ISZA 4WXHA 2V26A 4L9VA 4BY7J 1YITI 4U0WA 2VONA 2EFQA 2VL8A 2NOJB 3S2WA 1D8KA 2BVMA 4BJ5C 4Z6YA 5ICEA 2QSHX 2IGNA 1SFXA 2VKHA 5GAHJ 1HOMA 3I5UA 3QOEA 2L01A 4G6DA 4NC8A 2IA1A 2HVRA 2CQNA 1R5GA 3P9IA 3HBLA 2STTA 3HUGB 1PYVA 2K9SA 2E34A 2V6CA 2LNBA 4IX7A 5F0HA 1TNSA 2UXXA 2ELJA 3ASOH 4AYBN 3WGIA 4PFPA 1T39A 2HKOA 2VE9A 3GEZA 3ASNH 3TOAA 3TBIA 2GAUA 1WI9A 1K6YA 2COMA 3WG7H 5DUIA 3RZDJ 3CDHA 4B44A 2JMWA 2L4AA 5CYVA 1S7OA 4EJOA 1BC7C 2WV1A 4A3MJ 3KIOA 3E6MA 3DPLC 3J80K 5H2FC 2A6TA 4A3KJ 4JP0A 2DMNA 2DMUA 3D5RC 3S14J 3CJRB 1FMVA 4YG2F 4KN4X 1ETOA 1VQOI 3J81K 1IW7F 3M07A 2FMYA 3C2HA 5LHGA 4UUSA 3FXMA 2K9NA 1YIJI 3S16J 1XGNA 4J00A 1KQ8A 4L18B 3TW6A 4HEA2 3KP7A 3OSFA 1N77A 1USTA 3KCCA 2DPUA 4BY1J 2LD5A 2WAQA 4R1HA 4Y13A 1HW2A 3L7WA 3PJRA 5E1ZB 1RUNA 1R7JA 2CQKA 2EZIA 3GTQJ 2WB1A 1VQ4I 3AAFA 3HOTA 2HQRA 4CYCA 4A3JJ 2H94A 5K7ZA 2OTJI 1N78A 4NB5A 2BVLA 5TGTA 3M8FA 3W6JB 4CUGA 3HM5A 5GP9A 4XKCA 4I98B 1IGNA 3K2AA 4Q47A 1X2MA 2GQQA 5CVRA 1ETVA 2K9LA 2IGKA 2QWWA 1K6OA 4F55A 2DPDA 1VQMI 3N97A 2BE5F 3G3ZA 4IQ4A 3HG9A 2HDWA 2LSOA 2QZ8A 3MEXA 2D5VA 1RC9A 2E36A 3VYRB 5GPAA 2CQ7A 4YIIA 1X58A 2MD0A 3TDZC 3FK6A 3PL8A 2CV2A 3H92A 3GO5A 2WAFA 1X1CA 4XLPF 4DW6A 5DS9A 2M7BA 3BQYA 5EEAA 2XHKA 4ZYAA 2XC7A 5GAEJ 1FPQA 2RVCA 5J6XA 2JA6J 2R93J 3M8EA 4P9FA 3JR9A 2HOSA 2VIXA 1BI1A 3DPUA 6PAXA 2Z2SB 5IPAA 3FKIJ 4FQGA 1SFOJ 2BV6A 2QLZA 4M3FA 3MD2A 4EATA 2X51A 2JVGA 1ON2A 2Z5UA 1JKPC 2OA4A 2V1NA 4JX5A 3IRRA 2LH9A 2VQGA 4IHWA 2HFHA 1QPMA 1BA5A 4XLHA 2XSDC 2VQHA 5IT3A 2E7XA 4MEYF 2N8GA 3HDDA 1ZGJA 3W2AA 4QIWN 3DTEA 1G4DA 3S1MJ 3QU6A 3S15J 2QSGX 5L3FA 4EJTA 2L0KA 1HW5A 5FKOA 3HOSA 3DEEA 4RM2A 2OPTA 2X4HA 1O7FA 5JI6A 4HX4A 3VYSB 1ETKA 3A02A 5FFXA 4HRIA 2CG4A 1QZEA 2L4MA 5KVRA 3E6DA 5L3EA 3NRVA 4AIHA 5GTIC 5EDNA 1A04A 3PQKA 1Y8QB 1G3SA 3K2ZA 2OF7A 4CCKA 2CUFA 4F7ZA 1FBQA 4L5EA 3TQNA 3GFMA 2R7XA 3DKYA 3IKVA 2JPCA 3FXQA 3DKWA 5KCMA 1QVTA 2DT5A 3I0TA 2ZMEC 4V2FA 1BR4A 2CW8A 3QPSA 2WAQN 4A6EA 1FX7A 1BOBA 2VT3A 1TWHJ 3BG3A 2XF7A 2MA3A 1X4OA 5CLSA 1D0ZA 3BCAA 1RR8C 3BDDA 1B72B 4I6ZA 2GM4A 1E17A 1ZR2A 5J40A 4IRHA 1IN5A 1I39A 2LY1A 3C1DA 2ETHA 2XGXA 3GZ6A 3FISA 4HF2A 2XASA 3H3VK 3K4NA 4BDZA 2EIKH 3H9QA 4FE7A 3ZRGA 2QQ9A 1T2KA 5ED4A 1JJ6C 1IRXA 2X0LA 4AU7A 1MNMC 1QGPA 2AS5F 1USSA 4HNTA 1SAXA 1SAUA 1TBXA 1WZ2A 1APLC 1Z77A 1GDTA 4CZCA 1VZ0A 3CESA 4LK0F 1O7LA 4MFDA 1PP7U 2FRHA 2G7HA 1WJBA 3SZGA 3OYAA 2LKXA 2GA2A 2O0YA 3HRSA 2JWTA 4HBLA 2EFOA 1JGSA 1WJEA 3HJEA 2CU7A 3HOWJ 1TLHB 2DK5A 2ZJQF 5FKMA 1GT0C 2E2IJ 2OZ6A 5K5RA 5FRMA 1ZELA 2JK3A 3H1CA 3HYIA 3KP5A 4RGRA 4YFKF 4FCYA 1IDZA 1XSDA 3E1SA 2HU9A 1KZHA 4B3XA 1LPQA 1ZHFA 2HWVA 2QKLB 2LOOA 4A3IJ 2P5KA 2COBA 1R1UA 4C2UA 1MGTA 2L9NA 4L9NA 3ZMDA 2XKPA 1ZTRA 2AXLA 5FKLA 2LY9A 1FP2A 1MH3A 3CUOA 1X2NA 2FNPA 2W24A 4A2UA 4BQOA 2LREA 3KP6A 4FISA 3SJMA 3H3ZA 4I7HA 1S7AA 5DV5A 1Z7LA 3JSOA 4LLNA 2DYSH 1MJAA 3COAC 1A31A 2KRCA 5HDGA 1QZYA 2RQQA 1WJCA 4ENMA 1FBSA 3ECHA 3OYLA 5IT9Z 1P4AA 1AHDP 3G1OA 1F4KA 2VQCA 3WU1B 2ZJPF 1SFEA 1QHHD 2FQ4A 2HOTA 2DU9A 2L7ZA 5TJJA 3WTWC 2LVSA 1Y8RB 4PJJA 3CLOA 5FROA 1T98A 1V5FA 3GZNB 2F5EA 3OL4A 3FMQA 3IH3A 1MDMB 1WH7A 3OYCA 4KN7X 3TGNA 1OYIA 3JRHA 4LGWA 4CCOA 2HR3A 1Q1VA 1MDMA 4UUVA 1OYYA
chains in the Genus database with same CATH topology
3MMYB 4HNUA 3OWTA 3IAM2 2HPIA 3AL0C 4XN0A 4F3QA 2M7AA 2CMPA 5LFAA 3NWSA 4CCNA 2HVQA 4HSRA 5HVQC 4ZTJA 2KLOA 2JVHA 2JA2A 3PSIA 3V42A 3LSHA 2M3AA 4NC7A 2WBMA 2UUZA 1Z3XA 2KZVA 2IS6A 1YX3A 3OMYA 4BUPA 5CQEA 2RNGA 2LG4A 4XKBA 2KPMA 3CP2A 4G6TB 5FRNA 3M1CA 4NUBA 4BJTA 4XMYA 4DIQA 3RCOA 4ZDPA 1WFXA 4CCJA 2CV1A 2L9SA 1YE9A 4BDYA 4D9JA 5HNFA 4XLEA 2CH0A 4E7JA 2E60A 2OV7A 4JOMA 5HNHA 3CF2A 3DLAA 2Y0SA 4KJZA 3GBGA 2X6XA 3H9GA 3ZXSA 3TL4X 3K4CA 2KDOA 2ZSHB 4BE1A 2FUG2 4QPQA 4E7ZA 5CPRB 2E5NA 1WJDA 4XLFA 4ZDLA 3L2VA 2V6EA 3AFHA 1BR2A 1D0YA 3U21A 1EA3A 2UV1A 3QYEA 4HSTA 2R4GA 3TMOA 2PJRA 4F93B 1QU3A 4BACA 3K4BA 3J7AY 2ZXHA 4XORA 2K5CA 2WA0A 4FASD 1D0XA 4BXFA 3KEYA 4F92B 1U0JA 4PK4A 3RTRA 4LG3A 4P5OA 4D1QA 1YX5A 1DGWY 2R7RA 4OAYA 2WAEA 4YELA 4CCLA 3OR2C 2DOAA 3UNGC 2CS3A 4XKWA 3S3OA 3OY9A 3H0DA 4NNJA 3L2WA 2LC2A 1D1AA 1WJAA 2ZSIB 2VJ4A 1KONA 4F52A 4AVZA 3K70C 4ZDOA 1FMWA 2XAUA 2MC4A 4RMNA 2M0MA 3PFYA 1Z21A 1MMGA 4E7IA 1UAAA 3LSMA 2JSPA 3D5LA 2R7WA 3RQ4A 1W36C 2HVSA 3W2VA 1JI8A 2X1DA 1V5GA 3HC7A 3PUBA 2K3PA 1LDKB 2UWMA 2ZFUA 2X1CA 2VPLA 4II3A 2VB6A 4PSXA 3AL0B 2W00A 3OYEA 3OIPA 2IGOA 3VYTB 2KQRA 3IUOA 2LBFB 3MKZA 4ZTFA 4II2A 3K6GA 3M8JA 1D1CA 4C30A 1BR1A 2XF6A 2BOLA 4CA0A 3HL2A 3CP8A 5JHFA 4X0GA 3LFUA 3OOUA 4RLFA 1ERDA 3EUAA 2V26A 3PSFA 2VL8A 4CSWA 2NOJB 2BVMA 4BJ5C 4J01A 3OYMA 2IGNA 2MABA 2VKHA 2BW3A 2CUJA 3RPUD 3QOEA 3KX2A 3SYTA 4NC8A 2VXZA 3OL3A 2HVRA 2VJIA 3OIQA 2LBFA 4XOTA 3HUGB 1PYVA 1LKXA 3H5RA 2XDVA 3K4MA 2E5ZA 3OYFA 4IX7A 2AQFA 2KP6A 1N75A 2W1OA 4XNFA 4RLQA 3PNYA 1WJFA 2ELJA 5HOOA 1LVKA 3OR1C 2LY2A 4PFPA 3CZ6A 3EUHC 3OS2A 3TBIA 4PJMA 4N4NB 2VKDA 5HLTA 1K6YA 3BLYA 3LSGA 4LIVA 2XF5A 4B44A 4BEHB 2DT7B 1TZLA 3DPLC 4ZJZA 3DWLE 1GLNA 2A6TA 1MMAA 2X1EA 2RREA 3D5RC 1Y6IA 3CJRB 1FMVA 3EUKL 3L2UA 3S3NA 4DBQA 3FHNA 4BJ6C 4GRIA 3FBIB 3C2HA 4IZZA 4J00A 4KT6A 4HEA2 3MKWB 1T0FC 3OYBA 1N77A 3SEZA 2WAQA 3VYUB 3OS0A 3PJRA 3OS1A 3D5SC 2VJJA 2WB1A 4Y33A 5LD2C 4FETA 3HOTA 1N78A 2DT6A 2BVLA 2W4SA 1OLTA 5TGTA 3QODA 4CUGA 3A4CA 3E0JB 3OYHA 4XKCA 2HQAA 3SDBA 3QYFA 2R7TA 2K9LA 2IGKA 3BC8A 4F55A 3C2GA 4PSWA 4IQ4A 3W3CA 2CFOA 4LIUA 3HG9A 3UR3C 2HDWA 2MFZA 4KISA 4E7SA 1SFKA 3LL7A 3CJQB 3BG6A 4XQFA 3A1YA 3PNTA 3VYRB 3OYDA 2MD0A 4B47A 3G2BA 3FDYA 3PL8A 2R7UA 2CV2A 4AYBA 3AKZA 2WAFA 1X1CA 1MMNA 3LSKA 4RM3A 2HPMA 2M7BA 4BS9A 2IGMA 4ZYAA 4KITB 2XC7A 2IXSA 2KMUA 1DQUA 3N05A 3OYGA 2VIXA 2V9KA 3DPUA 2VQLA 2R7QA 2Z2SB 2WY7Q 1X1BA 3I9V2 3MD2A 4XOPA 4EATA 2VASA 2X51A 2ZXIA 3I3LA 2JVGA 3CMMA 2W82A 1UG0A 5KNLA 1R6RA 4HG2A 2V1NA 2OUMA 3LSIA 2X6WA 2VQGA 2LH9A 2WY8Q 4PFOA 2V4JC 4BQQA 1OR7C 1Y56A 4XLHA 3OYKA 2VQHA 3DKXA 3OYJA 2A5WA 4C2TA 3W2AA 3DTEA 1HA8A 1MMDA 2VJ5A 3SEQA 4ANJA 3HOSA 3DEEA 4RM2A 2PJRB 1P9QC 4YEJA 2DCEA 1X1AA 2WADA 3HKZA 1J09A 2VLAA 2KHMA 3VYSB 2KL4A 2HNHA 4HRIA 1V5EA 4LITA 3K4LA 4IQJA 1NG7A 3K4JA 2IS4A 4PJNA 2R7OA 4XKVA 2QKMB 1X4PA 3ONQA 3S93A 4CCKA 2XSJC 2DXIA 2BW3B 2GOMA 3S8PA 2CUZA 3DU5A 3HPHA 4B43A 2R7XA 4BU2A 3DKYA 4E6KG 2W7NA 3K70D 3L2QA 3BG7A 2IS2A 4N4OB 5KCMA 3IP4B 4E4HA 3F9KA 3W2WA 2VXDA 4DOZA 4PUSA 3VDXA 1BR4A 2CW8A 1MNDA 4Y3OA 2Z1DA 1BOBA 2JUGA 3PNVA 1W36D 2XF7A 1DGRM 1X4OA 2CW7A 1D0ZA 3BCAA 4CH7A 3S3MA 3FBNB 3H9JA 2R7SA 4Y4RA 4DBRA 3VWBA 2Q1ZB 3LMMA 2LY1A 4C9YA 4BE0A 3EPZA 2M4KA 3HPGA 3DQVC 4U7BA 3K4NA 4BDZA 2KRHA 4BEHA 3H9QA 4XL9A 4XM3A 3ZRGA 2L2OA 3IAS2 2OC6A 1IRXA 4ZC3A 4AU7A 4E7LA 4HNTA 2L5QA 5KHDA 1T95A 1SAUA 2M4GA 2L7KA 3VSLA 4PJLA 4CZCA 1TT0A 2F6CA 2AQEA 1VZ0A 4ITVA 3CESA 4P1WA 4CCMA 4DJAA 1X19A 2LYCA 4E7HA 3BCBA 1WJBA 3H35A 3SZGA 3NWTA 2K9MA 1AA7A 3OYAA 3H5NA 1Z3YA 1S9HA 4QPOA 2P0WA 2CV0A 4DGWB 4HPQA 1WJEA 4IKFA 3DPTA 5FRMA 1DP3A 1D1BA 1ZELA 2V7FA 3S32A 4B48A 2O5RA 3RSNA 3MKYB 3E1SA 2E1MB 2Z16A 2MYSA 2HU9A 4B3XA 4BE2A 2F4IA 1X1DA 2F5VA 3K10A 1G8XA 2LOOA 2QKLB 3ZQQA 2Q2EB 3HXLA 3ZCOA 2PMZA 4C2UA 2L9NA 4XN3A 1LFPA 3A2KA 3VSKA 1MW7A 4H4KC 3OYNA 3ZR8X 3FKJA 3OYIA 2HZDA 2IS1A 3ZGKA 1E0EA 1QHGA 1MNEA 3DTKA 4NQWB 4YRVA 2LRDA 4F91B 3K4KA 1UELB 4BQOA 4E7KA 2LREA 1Z7LA 4OAZA 4OWRB 5CKTA 4BL0B 2I8DA 3DU6A 1G59A 2KRCA 2RQQA 1WJCA 1PJRA 5CQGA 3OYLA 3L2RA 3DTIA 2VQCA 1NG6A 1QHHD 4BQNA 2X6YA 4XONA 4PJJA 1WJ5A 5FROA 1V5FA 3OL4A 4BGDA 2GOXB 4MLOA 4XR6A 3OYCA 4U87A 4R79A 3H5AA 3KYLA 4XLAA 4XLCA 2X85A 2R7VA 4CCOA 4JQFA 3QYBA 2E1MC 2DJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBF B;  2W1O A;  4BEH A;  3A1Y A;  4BEH B;  2LBF A; 
#chains in the Genus database with same CATH topology
 1LUJ B;  3BTI A;  2HPI A;  3C2B A;  3EYY A;  2BBY A;  1PUF B;  5D8K B;  1MBJ A;  3NWS A;  4CCN A;  4UXN A;  5GAG J;  3GTG J;  4A93 J;  1Y0U A;  1T38 A;  2DFE A;  3LSH A;  1Y1V J;  4YFN F;  3DXJ F;  5FGM A;  2IS6 A;  4AC0 A;  1F1Z A;  3OMY A;  1P6R A;  2NS8 A;  1ZRF A;  2RNG A;  2LG4 A;  3L09 A;  5DCF A;  1HST A;  1VQL I;  5C4X J;  4BKX A;  1BOA A;  4A3F J;  2JSC A;  1DPU A;  3M1C A;  4NUB A;  4ON0 A;  2I5U A;  3VFZ A;  3HZJ A;  2H8W A;  4OIR F;  1R00 A;  2M34 A;  1BM9 A;  5FD5 A;  1X3Z B;  1YLF A;  4X6A J;  2V9V A;  1FNN A;  3NAU A;  1YE9 A;  1LDD A;  2QF7 A;  4R8H A;  3WTU C;  2XRN A;  4U7D A;  2R5Z A;  2ZB9 A;  1XG1 A;  2E60 A;  5TIS C;  2QEN A;  5HNH A;  4KJZ A;  3DLA A;  3HTS B;  2XAQ A;  4JK1 X;  1V54 H;  3GW2 A;  3O3K A;  4LB6 B;  5D4R A;  4QPQ A;  4A3E J;  5CPR B;  2J5O A;  3K1M A;  2ISY A;  4ZDL A;  4BBS J;  3T8T A;  1OQY A;  1D0Y A;  1EA3 A;  3FF5 A;  2PJR A;  3GFJ A;  4BAC A;  3AG2 H;  2ZXH A;  2LFB A;  1S5L C;  3CQZ J;  2AO9 A;  1SD5 A;  4PK4 A;  2BYV E;  2P5L C;  3GLX A;  5LGT A;  4FTH A;  3FMR A;  4B8X A;  3BPX A;  3O2P E;  2M87 A;  2RV8 A;  3J7Y J;  2B63 J;  2WAE A;  4YEL A;  2WWY A;  4BH9 A;  4L0Z B;  2DOA A;  3PIO F;  2NVU B;  4XKW A;  1WGX A;  2Y2Z A;  3F8C A;  5FJ8 J;  1L3L A;  3GVA A;  5FO5 A;  1IC8 A;  1UB9 A;  2VJ4 A;  1S3J A;  4EM0 B;  4G94 A;  1R22 A;  3ZMZ A;  1WWX A;  5J8F A;  3HSR A;  2HXI A;  4A6D A;  3KP3 A;  4LD5 A;  3CCE I;  2K02 A;  4E7I A;  1DUX C;  3LSM A;  2R7W A;  3RQ4 A;  2HVS A;  1FJL A;  1L0O C;  1R5I D;  2DK8 A;  1FIP A;  1B59 A;  3ROU A;  4LB5 A;  2ZFU A;  2K85 A;  1XDU A;  3WGG A;  2VPL A;  2FF4 A;  2XAJ A;  4II3 A;  1W5T A;  2EFW A;  2VB6 A;  4PSX A;  1O4X A;  2IT0 A;  3AL0 B;  4RB2 C;  1W0T A;  3LNQ A;  5DD4 A;  3ZMT A;  5M3F J;  2M9H A;  3P5J A;  3VYT B;  2KQR A;  2LBF B;  5LBQ A;  2A05 A;  1JJ8 C;  2K4B A;  3DFG A;  4C30 A;  2VBZ A;  2TDX A;  1OCR H;  2BOL A;  2Y0S N;  1LQ1 A;  1MKM A;  1AWC A;  3HL2 A;  1SMT A;  4X0G A;  5D6F A;  3LFU A;  5FLX Z;  3HOV J;  4RLF A;  5EG0 B;  3EUA A;  3PSF A;  1I5Z A;  1CGP A;  3RDI A;  4CSW A;  4RB0 A;  3GFL A;  3I56 I;  5CVJ A;  3SFZ A;  3KFW X;  2MAB A;  2P7V B;  2X48 A;  2PX9 A;  3KX2 A;  4M3D A;  3UKG A;  1T0F A;  1YW7 A;  2VXZ A;  3OL3 A;  2VJI A;  2LBF A;  4ZYD A;  3KPH A;  1TT5 B;  3CUQ B;  3TO9 A;  1LKX A;  2PLY A;  2DOD A;  5D5U B;  5LHH A;  2E5Z A;  3U1K A;  1MJ9 A;  3IC7 A;  2AQF A;  2KP6 A;  1N75 A;  2DW4 A;  3CUQ A;  3PNY A;  1WHU A;  1LB2 A;  3ZP5 A;  1U5T C;  4Q48 A;  3EUH C;  4B4C A;  3OS2 A;  4MTD A;  4PJM A;  4N4N B;  2VKD A;  5HLT A;  3HTU A;  4EJV A;  2V1X A;  2E2H J;  2GBY A;  3LSG A;  3CCJ I;  2XF5 A;  3HRU A;  3JRD A;  3L2C A;  1R1V A;  1ZG5 A;  3JCU C;  2DT7 B;  4EJW A;  1TZL A;  1YW8 A;  2IAI A;  3HSE A;  3MFK A;  4LG0 A;  3VB2 A;  2IJL A;  4WCG A;  3P9C A;  2XKO A;  3GUD A;  3RQI A;  1BI3 A;  1Y6I A;  2K27 A;  3EUK L;  2O8K A;  1JKQ C;  3I64 A;  4MEX F;  4GRI A;  3IWZ A;  3BT9 A;  1VQ9 I;  4NC6 A;  3R60 A;  4KT6 A;  1U8R A;  3OYB A;  2L7F P;  2Y48 A;  1STZ A;  2EZK A;  5K7H A;  4GYG A;  1ZYR F;  5LRS A;  1LNW A;  5HOD A;  2DA3 A;  2RNJ A;  2E1O A;  2PQ8 A;  3JSP A;  3S1R J;  1HLV A;  4A3L J;  4OIP F;  2VJJ A;  3I55 I;  2J5P A;  5LD2 C;  2ZJR F;  2FJ1 A;  2R5Y B;  1OLT A;  2XB0 X;  4UV9 A;  2HKX A;  3Q9S A;  4N9I A;  3E0J B;  1HW1 A;  2M0C A;  1M1E B;  3GTP J;  2PMZ N;  5F1J A;  2ELH A;  3SDB A;  3QYF A;  3BC8 A;  3H3U A;  4I02 A;  2XGD A;  4AWX B;  4HNV A;  1ZRC A;  3M3Y J;  1ZKG A;  3P7N A;  4LIU A;  4AUX A;  3D0S A;  1TQM A;  3AG4 H;  4UB6 C;  4E7S A;  2B0L A;  2L9V A;  3CJQ B;  1D8J A;  2KJC A;  4XQF A;  4M3G A;  3C18 A;  3Q0W A;  2E35 A;  4PCQ A;  4MFE A;  3K1P A;  2DTZ A;  1XMX A;  4HAM A;  4I01 A;  3ZN1 A;  2HXO A;  4AYB A;  3U9G A;  2VC0 A;  4RAG A;  1SFU A;  1SEU A;  2FBI A;  1XDS A;  1R1T A;  2IXS A;  2O7O A;  3HGG A;  2KMU A;  2OCE A;  4IF4 A;  5ERI A;  2RC4 A;  4U0V A;  2V9K A;  4HQM A;  2EFN A;  5HS8 A;  2VQL A;  2R7Q A;  1BL0 A;  2M8E A;  2WY7 Q;  2W57 A;  2CO5 A;  1LEA A;  4M6V A;  2OCC H;  1X1B A;  4AD9 A;  4HF0 A;  2XIG A;  2JZY A;  2W25 A;  2CSO A;  1QNT A;  4M6X A;  2A68 F;  2VPR A;  4Q4Z F;  2Z9O A;  1YTY A;  1OCP A;  1ETX A;  4HG2 A;  3QAH A;  1VQ5 I;  2QQA A;  5DTD A;  3LSI A;  4PFO A;  2V4J C;  1D3Y A;  1OR7 C;  2HTJ A;  5D6E A;  3OYJ A;  3PUF A;  3W6K B;  3TW7 A;  3MQ0 A;  4HDU A;  1WKM A;  2MH2 A;  1K83 J;  3ZQ7 A;  3ABU A;  1IN4 A;  3WHC A;  2HQN A;  2P6S A;  3DF8 A;  1X3U A;  5J1Y A;  1F43 A;  2Y31 A;  4ANJ A;  1E3O C;  3KZY A;  1QQI A;  1VQN I;  1LFB A;  1X1A A;  4A69 C;  3HKZ A;  1J09 A;  3JRB A;  2H6C A;  2KHM A;  2HNH A;  1V5E A;  2H27 A;  1OIS A;  2XRL A;  2HYF A;  4LIT A;  3K4L A;  4L9T A;  4IQJ A;  5LGU A;  5JHU A;  1VFC A;  4RBO A;  2IS4 A;  2G0E A;  3FM5 A;  4PJN A;  4XID A;  4XKV A;  2JA7 J;  2CUE A;  2DLL A;  2KIQ A;  3ONQ A;  1XPX A;  2XSJ C;  2Y30 A;  1FSE A;  2NOG A;  2K3F A;  3LAP A;  5DM7 F;  1KQ9 A;  2ESH A;  3ZPL A;  2A6H F;  3FXK A;  2W7N A;  3L2Q A;  3BG7 A;  4HLX A;  2RN7 A;  4M6Y A;  4DOZ A;  4PUS A;  3VDX A;  3WGH A;  1KYZ A;  2BY2 A;  3CUQ C;  2O3F A;  3LWF A;  3BWG A;  1TW2 A;  3CMY A;  3JAM Z;  1BIA A;  1VF9 A;  3BY6 A;  1DGR M;  1RKW A;  2CW7 A;  4CH7 A;  4E70 A;  4UHT A;  4BHP A;  4KNY A;  2WC2 A;  2Z99 A;  3FBN B;  4Y4R A;  2HYJ A;  1GXP A;  3GX4 X;  1QZZ A;  3VWB A;  2Q1Z B;  2EZH A;  3LMM A;  4C9Y A;  3HOY J;  2AXT C;  1SAN A;  2O9L A;  1R58 A;  5HS7 A;  3BJO A;  5FKN A;  4RGS A;  4U7B A;  4OMZ A;  2EV0 A;  5LRR A;  4XM3 A;  1ZH5 A;  5LGN A;  2MH9 A;  3IAS 2;  3CD6 I;  1YYV A;  4FE4 A;  2OC6 A;  1P4X A;  3JRF A;  5F0F A;  2KJB A;  2XAG A;  1ZGA A;  3I71 A;  2L7M P;  2LLK A;  3ERM A;  5KHD A;  1DU6 A;  3BG5 A;  5E3O A;  1AOY A;  2M4G A;  5FD6 A;  2O6G E;  4KDP A;  2L7K A;  3IWF A;  2P8T A;  4ESF A;  2HYG D;  4KIB A;  1TT0 A;  5CVU A;  5D5W B;  1XMK A;  4ITV A;  4CCM A;  5ICC A;  2NVX J;  2D1V A;  1K78 B;  3QU3 A;  4TV7 A;  3H35 A;  2W85 A;  1OKR A;  3H5N A;  2E1N A;  2LK2 A;  3E97 A;  1UZC A;  5IYC J;  3L1P A;  3CCU I;  1S9H A;  4QPO A;  4DGW B;  4WK8 F;  4CGZ A;  3RI4 A;  3T0Y A;  1NK2 P;  2ACJ A;  1ODD A;  4W1U A;  4ZYG A;  2JQ7 A;  3TO7 A;  1FWZ A;  1IUY A;  5GAD J;  2GLO A;  4HV6 A;  1XX5 A;  3KE2 A;  3F72 A;  2DA4 A;  4B48 A;  3KLO A;  1LVA A;  2R92 J;  2E1M B;  2L02 A;  2MC3 A;  3PQJ A;  4DQ2 A;  3PO2 J;  2PEX A;  5K5O A;  3S17 J;  3MKL A;  1X1D A;  3K10 A;  2RAE A;  3EDP A;  4WXD A;  2Q2E B;  4G6Q A;  3VPR A;  5LLQ A;  2QQ8 A;  2G7U A;  1T8I A;  3H36 A;  3P9K A;  4XN3 A;  3OYN A;  1MW7 A;  1W5S A;  1NH3 A;  3WU0 A;  4EVI A;  2DOE A;  3FKJ A;  3TO6 A;  3PFI A;  4ZYH A;  4WXC A;  3ZGK A;  3HOZ J;  1E0E A;  1QHG A;  3DTK A;  4YRV A;  4F91 B;  2E7W A;  1VND A;  5C3E J;  2Z33 A;  4E7K A;  3ECO A;  3IL2 A;  2XB5 A;  3KYD B;  4OWR B;  1F5T A;  2KKO A;  4I99 C;  3FWE A;  4MHG A;  2NVT J;  2FOK A;  1YQA A;  3LA2 A;  3AG3 H;  4KMF A;  3WTS C;  3DTI A;  1X1P A;  1MZB A;  2DA2 A;  3ESW B;  2FML A;  1YOV B;  3ABL H;  5BS6 A;  3TED A;  4AM3 A;  2ICW G;  4GYI A;  1JGG A;  1TWA J;  1VI0 A;  4GO1 A;  1J75 A;  1TQI A;  5DDG A;  4MLO A;  4XR6 A;  2NAZ A;  2CQX A;  4KT5 C;  1JUS A;  4XLC A;  2X85 A;  2D45 A;  4HOB A;  1FTT A;  3CTA A;  3G1M A;  5EGO B;  2KIS A;  1VTN C;  2K7L A;  3CMA I;  4QWQ A;  2HS5 A;  4P96 A;  4J19 A;  1AKH A;  4XN0 A;  2XUB A;  4F3Q A;  1BI0 A;  1V55 H;  2WB1 N;  2CJJ A;  3S1N J;  3LSJ A;  3GTM J;  4RB3 C;  3OIO A;  1K4S A;  4NC7 A;  2IBD A;  2DDB A;  2YX4 A;  4NDL A;  5JLW A;  4XBF A;  4PGG A;  4XKB A;  2KPM A;  1PVE A;  1PUE E;  3ISP A;  5M5W J;  2M45 A;  1QA6 A;  4IVN A;  3RCO A;  2RKH A;  1WFX A;  4CCJ A;  3MCZ A;  2NS0 A;  1HSJ A;  2CV1 A;  1MBH A;  4UV8 A;  2L9S A;  2EA2 A;  2XAH A;  3FXJ A;  3KYC B;  2ZNY A;  5JLX A;  5LHI A;  2IA2 A;  1TWF J;  1OPC A;  4CYD A;  2OV7 A;  4UVB A;  1WRJ A;  2Y0S A;  3GBG A;  1FBU A;  3ZXS A;  3TL4 X;  2ZSH B;  4LFU A;  2FUG 2;  2XAF A;  3J7Z I;  1JT6 A;  4E7Z A;  3K69 A;  3SZP A;  2E5N A;  3LA3 A;  4DYQ A;  3JRC A;  2M30 A;  1WJD A;  4B09 A;  2V6E A;  3F8M A;  3U21 A;  3QYE A;  1GVD A;  3Q0U A;  2L54 A;  5IOZ A;  4EQQ A;  3V7C A;  1XGM A;  5L3G A;  2BEO A;  2ZCW A;  4XOR A;  2DA1 A;  1OR7 A;  2K5C A;  3E3V A;  4I09 A;  3ZOB A;  1U0J A;  2Y75 A;  3G73 A;  2RDP A;  4P5O A;  4FX4 A;  2M2E A;  4D1Q A;  1YX5 A;  1UCR A;  1Z1D A;  3G4S I;  1DGW Y;  3SXY A;  2DA7 A;  5IT9 K;  1YJN I;  3Q5F A;  1BW5 A;  2A3S A;  2HOE A;  3DBL B;  3OR2 C;  5F64 A;  4Z2Y A;  4A5M A;  4CCL A;  4DYC A;  3UNG C;  3R0J A;  3RKW A;  5K7F A;  2CS3 A;  1XS9 A;  3WTX C;  3OY9 A;  4HQE A;  4CO8 A;  4NNJ A;  1SVL A;  5ICF A;  1ZG3 A;  2LC2 A;  1D1A A;  1WJA A;  4A3D J;  2V79 A;  1BC8 C;  2ZSI B;  4RAZ A;  1XMA A;  1W4M A;  3MZY A;  4F52 A;  1MMS A;  5CVI A;  4ZDO A;  1FMW A;  4BHC A;  5BNG A;  1EH6 A;  2MC4 A;  4RMN A;  4I0B A;  3PFY A;  1Z21 A;  1I3Q J;  5E1X A;  3D5L A;  1TP4 A;  1IV8 A;  1W7P A;  2FX0 A;  5BPI A;  4QTR A;  2M5W A;  4CXF A;  4H0E A;  2X1D A;  1FP1 D;  1V5G A;  2LMD A;  2K3P A;  4NBQ A;  3WU2 C;  2XRO A;  1IDY A;  3ZQG A;  4EM2 A;  2HZT A;  3GFI A;  2HI3 A;  2X1C A;  5L3D A;  2F5C A;  3BP8 A;  1Z6R A;  4MIM A;  5E8G A;  3OIP A;  3VOD A;  4AVP A;  2CQQ A;  2ZBK A;  4MQV A;  1SD7 A;  1HKQ A;  2CW0 F;  3IUO A;  2QEX I;  2NNY A;  1BN5 A;  4Y17 A;  2YX7 A;  3K6G A;  1J9I A;  1RES A;  3IHU A;  1I1G A;  1JKO C;  1LEB A;  1D1C A;  1HQC A;  2FE3 A;  5E17 F;  3ABT A;  2C6Y A;  2KRF A;  4IRG A;  2E1C A;  1HXD A;  5BOX A;  3R61 A;  2XVC A;  3CP8 A;  4S05 A;  2VI6 A;  3B6A A;  1ERD A;  1I6X A;  4J01 A;  3GCM A;  3OYM A;  2W84 A;  2ZNZ A;  2Z3Y A;  3QWL A;  2LF8 A;  1FY7 A;  2VBW A;  1TNT A;  3SYT A;  3ZQC A;  1F9N A;  2XPU A;  2IRF G;  1I3A A;  2JN6 A;  1JHF A;  2XGE A;  4XOT A;  1Z91 A;  3ELK A;  1FYM A;  5EEG A;  3H5R A;  3K4M A;  3REO A;  3OYF A;  1CF7 B;  2LTP A;  2W1O A;  3RYR A;  2LF7 A;  2EV5 A;  3HB9 A;  1TW3 A;  2H1L A;  4XNF A;  5GPC A;  4A12 A;  5HOO A;  1H89 C;  2LY2 A;  1IN7 A;  3CZ6 A;  4Y52 J;  2RQP A;  2IPQ X;  2STW A;  2LP0 A;  4M3B A;  2OTL I;  1K78 A;  1NK3 P;  3W6V A;  3NAR A;  4ESB A;  3SQN A;  2JRM A;  1T6S A;  3D1N I;  4LLL A;  3DWL E;  2QUF A;  1GLN A;  2EJR A;  2R7F A;  2RRE A;  3F3X A;  3S3N A;  2BHZ A;  1B8I B;  3V8K A;  4BJ6 C;  3FX3 A;  3BR5 A;  1KU9 A;  1JHH A;  2ME0 A;  4B1R A;  4IZZ A;  2DBB A;  3BQZ A;  4N0B A;  2DFI A;  1IV6 A;  2YPR A;  1T0F C;  1OYW A;  1OCO H;  3NQO A;  1S6L A;  4RGU A;  3MVP A;  3IH2 A;  2I10 A;  1SMY F;  2QBY A;  5L3C A;  1VQK I;  1E3P A;  3OS0 A;  3FZV A;  3D5S C;  1DU0 A;  4Y33 A;  3BRO A;  2MD5 A;  4DZP A;  1P2F A;  3VOE A;  3F22 A;  3HKZ N;  2OJE D;  3QOD A;  1I27 A;  1FIA A;  4O3M A;  3BR1 A;  5K5Q A;  3WHB A;  1SD6 A;  3RIR A;  4PDK A;  4ZZL A;  3F8F A;  3DBR B;  4ENK A;  2R7T A;  4UVC A;  4A0Y A;  1QBJ A;  3I4N J;  3C2G A;  2QSF X;  3BJA A;  4PSW A;  5B1A H;  3W3C A;  2CFO A;  1B1B A;  1U8B A;  2FD5 A;  2MFZ A;  1SFK A;  1GXQ A;  3LL7 A;  3BG6 A;  1BJA A;  2ZO4 A;  3A1Y A;  1A6I A;  3PNT A;  5CVV A;  4B3A A;  2E19 A;  3CLQ A;  1XSX A;  1RNL A;  1CQT A;  4B47 A;  4M72 A;  3WTZ A;  1IJW C;  1HBX G;  3BTL A;  3TP0 A;  1HCR A;  1MMN A;  3T1B A;  4DYR A;  2IGM A;  3CCQ I;  1EH7 A;  1ACI A;  4UVA A;  1N25 A;  1UJ8 A;  1DQU A;  2BY1 A;  2O61 A;  2L9R A;  4CDG A;  2NVQ J;  4D7N A;  3CCR I;  4MO7 A;  1J5Y A;  3L00 A;  3G71 I;  1H0M A;  1MIJ A;  4OIO F;  4L5I A;  1VQ6 I;  3I9V 2;  4LJZ F;  3PM1 A;  4XOP A;  1FTZ A;  2VAS A;  4D0P A;  4JX4 A;  2ZXI A;  2D2W A;  1Z9C A;  5IYD J;  2BZT A;  4LLG F;  2W82 A;  1UG0 A;  5KNL A;  2EIN H;  1W5C C;  4KUM A;  1RI7 A;  2BXZ A;  3S1Q J;  4OIN F;  2WY8 Q;  4BQQ A;  3HEF A;  4G7Z F;  1Y56 A;  2DA6 A;  4Y15 A;  4YIF A;  3O8H A;  2A5W A;  2X9D A;  4M9S A;  4C2T A;  2FA5 A;  3CME I;  2O03 A;  4A0X A;  2Q2E A;  4BXU A;  3BR2 A;  1MMD A;  5KAI C;  3SEQ A;  1P7I A;  5EZH A;  4MGR A;  2WAD A;  1XC5 A;  4MNU A;  2VLA A;  5J4V A;  2R5Z B;  1O3T A;  5B3S H;  2MG4 A;  3K9T A;  1EH8 A;  4HX8 A;  2EK5 A;  2MW8 A;  4P55 A;  5J1R A;  1K7A A;  1TWC J;  1BIB A;  3U1D A;  1WQ2 A;  1NG7 A;  2CFX A;  1YG2 A;  3K4J A;  5E79 C;  4GFB A;  2MSY A;  2NYX A;  2OQG A;  5E1W A;  2QKM B;  3E5Q A;  1Z67 A;  1WPK A;  1X4P A;  2X6O A;  3S93 A;  4C3I J;  1SC7 A;  2DXI A;  2ZME B;  2BW3 B;  3S8P A;  3QQA A;  4JBA A;  3DU5 A;  1GV2 A;  1X3W B;  3HPH A;  4K2E A;  5EZG A;  5FLM J;  4B43 A;  5B5E C;  2YU3 A;  2PBI A;  4BU2 A;  1SVO A;  4E6K G;  2IEK A;  2KIF A;  5J3L A;  3IP4 B;  4E4H A;  5DM6 F;  3GTL J;  1FSH A;  3WTY C;  3CCV I;  1IAW A;  4BQA A;  1MND A;  5EGO A;  2G9W A;  2MLG A;  2Z1D A;  1IXR C;  1YI2 I;  3PNV A;  2JUG A;  5TRD A;  3LOC A;  4AIJ A;  1UFM A;  2R7S A;  1PUF A;  4MTE A;  3BJ6 A;  5AIQ A;  1A5J A;  3KET A;  3RPU A;  3HPG A;  1XSV A;  3DQV C;  1YRN A;  1I1S A;  5EYR A;  5IP7 J;  3DCF A;  2QGU A;  1OMI A;  3A03 A;  2IW5 A;  2DO7 A;  2H6B A;  4GGG A;  3ML6 A;  4E7L A;  3FM3 A;  4DZJ A;  1R36 A;  3X2Q H;  1T95 A;  5CJ9 A;  3AG1 H;  3QP6 A;  4IHX A;  1R9T J;  5F27 A;  4A5N A;  2F6C A;  4DJA A;  1S29 A;  2AQE A;  2P4W A;  4M74 A;  4P1W A;  2ME6 A;  3CO7 C;  9ANT A;  1X19 A;  4KA4 A;  2V9P A;  2R7Z J;  2FNA A;  2LYC A;  4KIG A;  1U9N A;  2EH3 A;  5F04 A;  2EBI A;  2DDA A;  1B6A A;  5FFZ A;  4X1E A;  1AA7 A;  2PN6 A;  4YFX F;  1Z3Y A;  3FIW A;  2JPB A;  3A01 B;  1FC3 A;  3GME A;  2F5D A;  3B02 A;  1EV7 A;  1YO5 C;  4HPQ A;  2EA4 A;  4D7M A;  4IKF A;  5C4J J;  1MH4 A;  1H9G A;  3E6C C;  3RZO J;  3BTC A;  1LE8 B;  1DP3 A;  1D1B A;  2V7F A;  3RSN A;  4IL6 C;  1D5Y A;  5L3B A;  1IN6 A;  3CDL A;  3MKY B;  3Q3S A;  2R5Y A;  1XTA A;  2Z16 A;  4BE2 A;  4A0Z A;  2F4I A;  3ZQQ A;  5ILV A;  3HXL A;  3ZCO A;  2PMZ A;  3O8G A;  4OOI A;  4WWC A;  1P92 A;  1G2H A;  2VOD A;  2Q0O A;  3OYI A;  2YSR A;  3CC7 I;  2IS1 A;  3MAJ A;  4NQW B;  5BPD A;  4JYK A;  2DOF A;  4OAZ A;  5EEH A;  5CKT A;  2DMQ A;  1KGS A;  4BL0 B;  1YJW I;  1EJ9 A;  2GZW A;  3DU6 A;  5F6F A;  3CC4 I;  1G59 A;  3H0G J;  5JFR A;  2DI3 A;  3S2H J;  1RUO A;  1PJR A;  2HTS A;  5EJC A;  2VUM J;  2JT1 A;  4IHV A;  1RPW A;  2Y69 H;  1JE8 A;  2Y9Z A;  1RRJ A;  3HOU J;  2JA8 J;  5H6R A;  5J8C A;  3L2R A;  1OCT C;  4HV5 A;  2BY0 A;  2XPW A;  1ORK A;  4HYE A;  1NG6 A;  5D5V B;  5DEQ A;  3LAJ A;  4M3E A;  4BQN A;  4QLC U;  3NEU A;  2X6Y A;  4XON A;  5DCM B;  1S8N A;  1WJ5 A;  4BGD A;  2OU2 A;  2LR8 A;  2GOX B;  4G12 A;  1IXS B;  1E2X A;  3LA7 A;  4N9H A;  3JRI A;  5B1B H;  3JRE A;  1YRN B;  1SD4 A;  4JQF A;  3QYB A;  2E1M C;  1GVJ A;  1U6G A;  3MMY B;  1DP7 P;  3OWT A;  2VBX A;  1XCV A;  2M7A A;  1H8A C;  2QQB A;  5HVQ C;  2HVQ A;  4HSR A;  2DJN A;  1TTY A;  4ZTJ A;  2KLO A;  2JVH A;  1VQ7 I;  2JA2 A;  2ECB A;  2WTE A;  3BZ6 A;  2V1D A;  3V42 A;  2XPV A;  5JVG F;  4O6J A;  2UUZ A;  2KZV A;  3GF2 A;  2DN0 A;  4BUP A;  5E3N A;  2VE8 A;  3KLN A;  3JTH A;  2VOP A;  3CP2 A;  5FRN A;  3SDG A;  4IRI A;  3J81 Z;  2H09 A;  1SVM A;  3BR6 A;  2ZME A;  4M73 A;  1FZP B;  3IV5 A;  1IF1 A;  5ILS A;  4BDY A;  4D9J A;  1UHM A;  1IO2 A;  5HNF A;  2H1K A;  1BBY A;  4BAY A;  1MBG A;  3LQR A;  4XLE A;  4XIC A;  3TKY A;  4CYC B;  3I59 B;  3CF2 A;  4RS8 A;  2EV6 A;  1V3F A;  1IRG A;  3K7A J;  3H9G A;  2BHY A;  2D1H A;  1KU3 A;  1IG7 A;  3PIP F;  2DAO A;  1ZG1 A;  1IN8 A;  1R4N B;  1OCC H;  1T33 A;  1ZLK A;  3L2V A;  2EZL A;  1J0R A;  1POG A;  3M1E A;  1WCM J;  3C7J A;  5IP6 A;  1OJL A;  3TMO A;  3GLL A;  1IUF A;  4F93 B;  4GXO A;  4UY8 I;  3V7S A;  2IVM A;  2KZG A;  1WVR A;  2WA0 A;  4FAS D;  4F92 B;  1D0X A;  2P6T A;  2PFB A;  3KEY A;  1W7P B;  1VQP I;  5F08 A;  3RTR A;  2GIZ A;  3HHH A;  3LST A;  1NHA A;  2R7R A;  4OAY A;  4ABZ A;  4KMU X;  2VKE A;  3VEP A;  5M3M J;  1I6H J;  2KIU A;  4D5F A;  1KYW A;  3S3O A;  1G3W A;  3L2W A;  2EQR A;  2DA5 A;  1R49 A;  1G6N A;  4KFC A;  1Y39 A;  1KQ0 A;  3V8L A;  4AVZ A;  2XAU A;  3ZMV A;  4O5V A;  2AHQ A;  2M0M A;  2DQR A;  4Y7N J;  5A2Q K;  1UG2 A;  4IPA A;  3OOP A;  4IHS A;  2K9Q A;  1JI8 A;  2ZXJ A;  1I50 J;  3PUB A;  1W1W E;  1LDK B;  3V4G A;  3I58 A;  2QA4 I;  1O3Q A;  1EF4 A;  3DP7 A;  3OYE A;  3FXL A;  1RIO H;  1Z6T A;  4IOA F;  2PMU A;  2JJ7 A;  2UXN A;  3RJP A;  4ZTF A;  3HGY A;  4II2 A;  4IO9 F;  2EIL H;  2ZXW H;  1TQP A;  4XK4 A;  2LDU A;  3M8J A;  3KZZ A;  1CF7 A;  1T56 A;  3E5X A;  1BR1 A;  3LSR A;  3ULQ B;  2XF6 A;  1ULY A;  2FBK A;  2VN2 A;  3F0C A;  2EIJ H;  2HDC A;  3OOU A;  2ID6 A;  2W48 A;  1A35 A;  2K4J A;  5B66 C;  4EEF G;  1KA8 A;  3G6E I;  4L5J A;  3B6C A;  4FHT A;  5E18 F;  3M4O J;  4C2M J;  1BJZ A;  2BW3 A;  1ZK8 A;  2CUJ A;  4IXA A;  1HKS A;  2JUC A;  3OV8 A;  3Q9V A;  3RPU D;  3T8R A;  2VBY A;  3I53 A;  5DUK A;  4XRS A;  1LDJ A;  2OBP A;  4BBR J;  3CF5 F;  1TC3 C;  1KU7 A;  4C3H J;  3K1N A;  2PG4 A;  3OIQ A;  3E6B A;  3TOB A;  3HOX J;  1S7E A;  1BI2 A;  2PMH A;  2XDV A;  2HQ5 A;  4RDU A;  1ENH A;  5D4S A;  5FB2 A;  4RLQ A;  1OFC X;  1WJF A;  2OZU A;  1LVK A;  3OR1 C;  5D5X B;  3BZC A;  5F0C A;  4RB1 A;  4EGZ A;  1VQ8 I;  1F36 A;  1ZAO A;  2DMP A;  1H88 C;  3BLY A;  4CIC A;  2YUS A;  4LIV A;  2BY3 A;  2DQL A;  3HSF A;  1MSE C;  1J59 A;  5FLV A;  3RPQ A;  4BEH B;  3F23 A;  3WE3 A;  1HDP A;  1ONV A;  1HDD C;  4ZJZ A;  2P81 A;  3JRA A;  3Q0V A;  2DFF A;  1A36 A;  4HZF A;  1MMA A;  3HIF A;  1BW6 A;  2X1E A;  1WSU A;  2A5Y B;  1P4W A;  3L2U A;  3SZT A;  4DBQ A;  3FHN A;  3CCS I;  3B73 A;  3FBI B;  4KYW A;  1ZQ3 P;  2TCT A;  4DNC A;  4L9J A;  1YFH A;  5J47 A;  3MKW B;  2O8X A;  1QRY A;  5GTH C;  1QO0 D;  1U78 A;  4UNO A;  3SEZ A;  1R4M B;  4GDF A;  1RKT A;  3IKT A;  3VYU B;  1Z7U A;  5H20 A;  3E7L A;  3OS1 A;  4ENN A;  3OSG A;  4D5C A;  3SHF A;  4EJU A;  2F5F A;  3HRM A;  1WH5 A;  4FET A;  1KU2 A;  1XCB A;  2KT0 A;  2UZK A;  2DT6 A;  2W4S A;  3FXU A;  3ZQF A;  1R23 A;  1JTX A;  1AKH B;  3A4C A;  4JX6 A;  3MWM A;  4WF2 A;  3CO6 C;  4FT8 A;  3OYH A;  4I2O A;  1XD7 A;  2YS9 A;  4QSH A;  1C0W A;  2HQA A;  2HDD A;  3RYP A;  3CJN A;  2LKP A;  2ZC2 A;  3BOQ A;  2E71 A;  5HLI A;  1E3H A;  3ABK H;  3QPL A;  3UR3 C;  3CC2 I;  4KIS A;  4I0A A;  1T08 B;  1JUM A;  3S2D J;  4LMY A;  3CCL I;  4RGX A;  5BQT A;  3OYD A;  4S0H B;  3G2B A;  3KP4 A;  5ILU A;  3FDY A;  2MGQ A;  2R7U A;  4G9Y A;  3AKZ A;  3HRT A;  4W97 A;  1REP C;  4M9X A;  1P7J A;  3LSK A;  4RM3 A;  2HPM A;  4BS9 A;  3CCY A;  4KIT B;  1LFU P;  1ETQ A;  2JTV A;  3U2R A;  3RKX A;  4V19 K;  1RZ4 A;  1ZRD A;  3N05 A;  3OYG A;  2A69 F;  2NRA C;  5IOY A;  1OCZ H;  3RKQ A;  4PZJ A;  2K40 A;  5EF6 A;  1IXC A;  1MBE A;  4LOC A;  3L9F A;  3I4P A;  1U2W A;  1YIO A;  4KIC A;  3DEW A;  3GWZ A;  2A61 A;  1XGO A;  3FXO A;  1UHW A;  3CMM A;  3HUG A;  3I3L A;  1XGS A;  3EQL F;  1R6R A;  5K1Y A;  2OUM A;  2X6W A;  3R4K A;  3E5U A;  3GYH X;  2R3S A;  3QRF F;  4EGY A;  3OYK A;  3DKX A;  1Y1W J;  3V7R A;  5IY5 H;  4U0Y A;  1ZLJ A;  1HA8 A;  2ECC A;  1EKE A;  2VJ5 A;  2WV0 A;  2PJR B;  2OD5 A;  1P9Q C;  4YEJ A;  1TWG J;  2DCE A;  2KFD A;  3JRG A;  4XRF A;  4HLY A;  2KL4 A;  2ZKZ A;  1MBK A;  1RET A;  3MZH A;  2IP2 A;  2NVY J;  1LE8 A;  2M1B A;  5HDN A;  5FLX K;  3PO3 J;  2R7O A;  3FMS A;  3WTT C;  1FOY A;  3BTJ A;  3EYI A;  5E3L A;  3MZ8 A;  3KEO A;  2GOM A;  3KEQ A;  5H6Q A;  3A01 A;  2CUZ A;  1YS7 A;  3FHZ A;  5JVT A;  1TL8 A;  3I4M J;  1J2X A;  4BXX J;  2E2J J;  4YIR X;  4IJA A;  2IS2 A;  3K70 D;  4UB8 C;  4N4O B;  3GZ5 A;  2Y9Y A;  3F9K A;  3W2W A;  2YU9 J;  2VXD A;  4HA8 A;  4Y3O A;  2EFP A;  5AIP A;  2ID3 A;  5F1R A;  4V2G A;  1FOK A;  2JRT A;  1W36 D;  4BYY A;  1RR7 A;  3S3M A;  3A0B C;  3H9J A;  3V8J A;  1B9N A;  1XN7 A;  1G3Y A;  2XGC A;  4DBR A;  3ABM H;  5BMZ A;  4BE0 A;  1UHS A;  1JT0 A;  3EPZ A;  4A3B J;  1O3R A;  3DBH B;  2M4K A;  3F8B A;  1Z05 A;  3K0L A;  2CYY A;  2HEO A;  3M9A A;  3F6V A;  4WX9 A;  2A07 F;  3G1L A;  5J1U A;  2B7E A;  2RGV A;  2KRH A;  1FT9 A;  3EET A;  4BEH A;  4XL9 A;  2L2O A;  2FU4 A;  1MBF A;  4FX0 A;  2HOA A;  3A0H C;  4ZC3 A;  1ON1 A;  2GA1 A;  2L5Q A;  1ZN2 A;  4AIK A;  1G3T A;  2P7C B;  4ASN A;  1HKT A;  3VSL A;  1FOX A;  4PJL A;  1IRZ A;  1W0U A;  1FOW A;  2GIV A;  5LEK A;  3F21 A;  4E7H A;  2NS7 A;  3BCB A;  1K4T A;  3NWT A;  2K9M A;  4RAF A;  2VKV A;  4ZH4 F;  2CV0 A;  2P0W A;  4L0Y B;  2R7D A;  2PJP A;  1ZGW A;  3DPT A;  1FEX A;  3ZMS A;  2FSW A;  2LKS A;  4AID A;  3FK7 A;  1FLI A;  2NXN B;  3S32 A;  1W7P D;  2O5R A;  2CRG A;  1ITY A;  4HDV A;  2F4M B;  2OAZ A;  2MYS A;  1B72 A;  3ERE D;  4G7O F;  2L3D A;  2F5V A;  2KDZ A;  1G8X A;  1JKR C;  5E20 A;  2KIM A;  1ZR4 A;  4NQW A;  3I54 A;  3M7G A;  3A2K A;  1LFP A;  3DEU A;  3VSK A;  4H4K C;  3IRQ A;  3R6S A;  4LG0 B;  2EPF A;  3ZR8 X;  5A2Q Z;  2A6E F;  3CDI A;  3ZQH A;  2HZD A;  5FKK A;  5KAF C;  4UUS B;  1PDN C;  2DYR H;  5ICG A;  1MNE A;  2B9S A;  3DV8 A;  2LRD A;  4XSX F;  3K4K A;  1UEL B;  5M5X J;  2R0Q C;  1R71 A;  4BNC A;  3BR3 A;  2EB7 A;  4GCV A;  2I8D A;  3MN2 A;  1U9O A;  2FOW A;  2CGP A;  5CQG A;  4HX7 A;  3BR0 A;  4IHY A;  3IH4 A;  3GTK J;  5DCM A;  5HLG A;  2PI0 A;  4IHT A;  2CWE A;  5J4Y A;  4ESJ A;  2GXA A;  3T5X A;  2YR2 A;  1J7K A;  1UMQ A;  4I76 A;  2HGC A;  4MQ9 F;  2FQ3 A;  4NHJ A;  3ZQL A;  3F8N A;  3CCM I;  4U87 A;  4R79 A;  3H5A A;  3KYL A;  2VOO A;  4S04 A;  2VC1 A;  4XLA A;  2R7V A;  5M5Y J;  4M71 A;  1YJ9 I;  1FYL A;  4EM1 A;  1LJ9 A;  1O3S A;  2DJI A;  1K79 A;  1O57 A;  5E8I A;  2ZFW A;  4HNU A;  5HS9 A;  4CZZ A;  1JTY A;  3IAM 2;  3AL0 C;  2ESN A;  2FBH A;  2NNN A;  1JUP A;  2CMP A;  5JR3 A;  1Q1H A;  1QVU A;  5LFA A;  1QPI A;  3LFK A;  2XV4 S;  3PSI A;  4M9Z A;  2M3A A;  4G8X A;  5D8L B;  3GTO J;  2WBM A;  1Z3X A;  2GWR A;  2QM3 A;  3BG9 A;  1YX3 A;  3ZQI A;  5CQE A;  4XSZ F;  1YHQ I;  3WOD F;  4G6T B;  3RKY A;  5KK1 A;  4CHU A;  2QCO A;  1V4R A;  1YW9 A;  3LQQ A;  4BJT A;  3SFI A;  2OQR A;  4XMY A;  4DIQ A;  4U88 A;  2GXG A;  3GTJ J;  1MSF C;  4ZDP A;  5IP9 J;  2QBY B;  5HDK A;  4XLN F;  3I59 A;  1DPR A;  4A3G J;  4XRM A;  5LEJ A;  4IOC F;  2H8R A;  4ZZD A;  5HLH A;  3BPV A;  2CH0 A;  4EV0 A;  4E7J A;  4JOM A;  3TP3 A;  2DFH A;  2JA5 J;  5C44 J;  3HHG A;  2EIM H;  2X6X A;  3JW4 A;  3FXR A;  1B8I A;  3O6B B;  3K4C A;  2KDO A;  1GHC A;  2ELK A;  2IA0 A;  2P5V A;  3JAM K;  4BE1 A;  1B4A A;  3CJT B;  4XLF A;  3F6O A;  1BR2 A;  3AFH A;  3KZI C;  3WTV C;  2UV1 A;  1D5V A;  4HST A;  1YS6 A;  4OU0 A;  2R4G A;  2VT2 A;  1A6Q A;  4IEJ A;  1S72 I;  4HF1 A;  1QU3 A;  4XRS G;  3K4B A;  2EWN A;  3J7A Y;  3ZMU A;  1XB4 A;  1IZ1 A;  1U3E M;  1MJB A;  4BXF A;  3LSP A;  4LG3 A;  1H9T A;  3J7A O;  4ENJ A;  1IRF A;  4HW0 A;  4LK1 F;  1NTC A;  1U5T A;  3QPH A;  5DD8 A;  1HC8 A;  4P9U A;  2GXB A;  2F48 A;  2QVO A;  4ZYE A;  5AON A;  3H0D A;  5EG0 A;  2DMT A;  3ZN0 A;  4C3J J;  2MBF A;  2ADU A;  1MD0 A;  3DLL F;  1KON A;  1ETW A;  3K70 C;  3WE2 A;  1B9M A;  4RA2 A;  3JTG A;  4A3C J;  2BGC A;  3EUH A;  4G7H F;  1ETY A;  1MMG A;  1UAA A;  2JSP A;  4EMS A;  2FEZ A;  1W36 C;  1ZAR A;  5DYM A;  3R0A A;  3W2V A;  4RAY A;  2BXY A;  3HC7 A;  3BZK A;  2UWM A;  1Z0X A;  4OMY A;  2DTR A;  2MLK A;  3N4M A;  2QYO A;  1U5T B;  3QPT A;  1Y0N A;  4BHB A;  4KIF A;  1GUU A;  4PGH A;  5E3M A;  1R5H A;  2W00 A;  1HF0 A;  1FYK A;  2K86 A;  5IYB J;  2IGO A;  1GV5 A;  3MKZ A;  2Y0M A;  3QP5 A;  2ZJ2 A;  2Q8K A;  1AU7 A;  4OIQ F;  2V1U A;  3WG9 A;  3TDU C;  4UUT A;  2TRT A;  3C3W A;  3GXO A;  2M8G X;  2F2E A;  4ETS A;  4CA0 A;  1DDN A;  2F4O B;  2FXA A;  3KP2 A;  4PJ0 C;  5JHF A;  1K61 A;  1ZRE A;  1WI3 A;  3QOP A;  3J80 Z;  1PP8 F;  4Q5S F;  1JXS A;  2ISZ A;  4WXH A;  2V26 A;  4L9V A;  4BY7 J;  1YIT I;  4U0W A;  2VON A;  2EFQ A;  2VL8 A;  2NOJ B;  3S2W A;  1D8K A;  2BVM A;  4BJ5 C;  4Z6Y A;  5ICE A;  2QSH X;  2IGN A;  1SFX A;  2VKH A;  5GAH J;  1HOM A;  3I5U A;  3QOE A;  2L01 A;  4G6D A;  4NC8 A;  2IA1 A;  2HVR A;  2CQN A;  1R5G A;  3P9I A;  3HBL A;  2STT A;  3HUG B;  1PYV A;  2K9S A;  2E34 A;  2V6C A;  2LNB A;  4IX7 A;  5F0H A;  1TNS A;  2UXX A;  2ELJ A;  3ASO H;  4AYB N;  3WGI A;  4PFP A;  1T39 A;  2HKO A;  2VE9 A;  3GEZ A;  3ASN H;  3TOA A;  3TBI A;  2GAU A;  1WI9 A;  1K6Y A;  2COM A;  3WG7 H;  5DUI A;  3RZD J;  3CDH A;  4B44 A;  2JMW A;  2L4A A;  5CYV A;  1S7O A;  4EJO A;  1BC7 C;  2WV1 A;  4A3M J;  3KIO A;  3E6M A;  3DPL C;  3J80 K;  5H2F C;  2A6T A;  4A3K J;  4JP0 A;  2DMN A;  2DMU A;  3D5R C;  3S14 J;  3CJR B;  1FMV A;  4YG2 F;  4KN4 X;  1ETO A;  1VQO I;  3J81 K;  1IW7 F;  3M07 A;  2FMY A;  3C2H A;  5LHG A;  4UUS A;  3FXM A;  2K9N A;  1YIJ I;  3S16 J;  1XGN A;  4J00 A;  1KQ8 A;  4L18 B;  3TW6 A;  4HEA 2;  3KP7 A;  3OSF A;  1N77 A;  1UST A;  3KCC A;  2DPU A;  4BY1 J;  2LD5 A;  2WAQ A;  4R1H A;  4Y13 A;  1HW2 A;  3L7W A;  3PJR A;  5E1Z B;  1RUN A;  1R7J A;  2CQK A;  2EZI A;  3GTQ J;  2WB1 A;  1VQ4 I;  3AAF A;  3HOT A;  2HQR A;  4CYC A;  4A3J J;  2H94 A;  5K7Z A;  2OTJ I;  1N78 A;  4NB5 A;  2BVL A;  5TGT A;  3M8F A;  3W6J B;  4CUG A;  3HM5 A;  5GP9 A;  4XKC A;  4I98 B;  1IGN A;  3K2A A;  4Q47 A;  1X2M A;  2GQQ A;  5CVR A;  1ETV A;  2K9L A;  2IGK A;  2QWW A;  1K6O A;  4F55 A;  2DPD A;  1VQM I;  3N97 A;  2BE5 F;  3G3Z A;  4IQ4 A;  3HG9 A;  2HDW A;  2LSO A;  2QZ8 A;  3MEX A;  2D5V A;  1RC9 A;  2E36 A;  3VYR B;  5GPA A;  2CQ7 A;  4YII A;  1X58 A;  2MD0 A;  3TDZ C;  3FK6 A;  3PL8 A;  2CV2 A;  3H92 A;  3GO5 A;  2WAF A;  1X1C A;  4XLP F;  4DW6 A;  5DS9 A;  2M7B A;  3BQY A;  5EEA A;  2XHK A;  4ZYA A;  2XC7 A;  5GAE J;  1FPQ A;  2RVC A;  5J6X A;  2JA6 J;  2R93 J;  3M8E A;  4P9F A;  3JR9 A;  2HOS A;  2VIX A;  1BI1 A;  3DPU A;  6PAX A;  2Z2S B;  5IPA A;  3FKI J;  4FQG A;  1SFO J;  2BV6 A;  2QLZ A;  4M3F A;  3MD2 A;  4EAT A;  2X51 A;  2JVG A;  1ON2 A;  2Z5U A;  1JKP C;  2OA4 A;  2V1N A;  4JX5 A;  3IRR A;  2LH9 A;  2VQG A;  4IHW A;  2HFH A;  1QPM A;  1BA5 A;  4XLH A;  2XSD C;  2VQH A;  5IT3 A;  2E7X A;  4MEY F;  2N8G A;  3HDD A;  1ZGJ A;  3W2A A;  4QIW N;  3DTE A;  1G4D A;  3S1M J;  3QU6 A;  3S15 J;  2QSG X;  5L3F A;  4EJT A;  2L0K A;  1HW5 A;  5FKO A;  3HOS A;  3DEE A;  4RM2 A;  2OPT A;  2X4H A;  1O7F A;  5JI6 A;  4HX4 A;  3VYS B;  1ETK A;  3A02 A;  5FFX A;  4HRI A;  2CG4 A;  1QZE A;  2L4M A;  5KVR A;  3E6D A;  5L3E A;  3NRV A;  4AIH A;  5GTI C;  5EDN A;  1A04 A;  3PQK A;  1Y8Q B;  1G3S A;  3K2Z A;  2OF7 A;  4CCK A;  2CUF A;  4F7Z A;  1FBQ A;  4L5E A;  3TQN A;  3GFM A;  2R7X A;  3DKY A;  3IKV A;  2JPC A;  3FXQ A;  3DKW A;  5KCM A;  1QVT A;  2DT5 A;  3I0T A;  2ZME C;  4V2F A;  1BR4 A;  2CW8 A;  3QPS A;  2WAQ N;  4A6E A;  1FX7 A;  1BOB A;  2VT3 A;  1TWH J;  3BG3 A;  2XF7 A;  2MA3 A;  1X4O A;  5CLS A;  1D0Z A;  3BCA A;  1RR8 C;  3BDD A;  1B72 B;  4I6Z A;  2GM4 A;  1E17 A;  1ZR2 A;  5J40 A;  4IRH A;  1IN5 A;  1I39 A;  2LY1 A;  3C1D A;  2ETH A;  2XGX A;  3GZ6 A;  3FIS A;  4HF2 A;  2XAS A;  3H3V K;  3K4N A;  4BDZ A;  2EIK H;  3H9Q A;  4FE7 A;  3ZRG A;  2QQ9 A;  1T2K A;  5ED4 A;  1JJ6 C;  1IRX A;  2X0L A;  4AU7 A;  1MNM C;  1QGP A;  2AS5 F;  1USS A;  4HNT A;  1SAX A;  1SAU A;  1TBX A;  1WZ2 A;  1APL C;  1Z77 A;  1GDT A;  4CZC A;  1VZ0 A;  3CES A;  4LK0 F;  1O7L A;  4MFD A;  1PP7 U;  2FRH A;  2G7H A;  1WJB A;  3SZG A;  3OYA A;  2LKX A;  2GA2 A;  2O0Y A;  3HRS A;  2JWT A;  4HBL A;  2EFO A;  1JGS A;  1WJE A;  3HJE A;  2CU7 A;  3HOW J;  1TLH B;  2DK5 A;  2ZJQ F;  5FKM A;  1GT0 C;  2E2I J;  2OZ6 A;  5K5R A;  5FRM A;  1ZEL A;  2JK3 A;  3H1C A;  3HYI A;  3KP5 A;  4RGR A;  4YFK F;  4FCY A;  1IDZ A;  1XSD A;  3E1S A;  2HU9 A;  1KZH A;  4B3X A;  1LPQ A;  1ZHF A;  2HWV A;  2QKL B;  2LOO A;  4A3I J;  2P5K A;  2COB A;  1R1U A;  4C2U A;  1MGT A;  2L9N A;  4L9N A;  3ZMD A;  2XKP A;  1ZTR A;  2AXL A;  5FKL A;  2LY9 A;  1FP2 A;  1MH3 A;  3CUO A;  1X2N A;  2FNP A;  2W24 A;  4A2U A;  4BQO A;  2LRE A;  3KP6 A;  4FIS A;  3SJM A;  3H3Z A;  4I7H A;  1S7A A;  5DV5 A;  1Z7L A;  3JSO A;  4LLN A;  2DYS H;  1MJA A;  3COA C;  1A31 A;  2KRC A;  5HDG A;  1QZY A;  2RQQ A;  1WJC A;  4ENM A;  1FBS A;  3ECH A;  3OYL A;  5IT9 Z;  1P4A A;  1AHD P;  3G1O A;  1F4K A;  2VQC A;  3WU1 B;  2ZJP F;  1SFE A;  1QHH D;  2FQ4 A;  2HOT A;  2DU9 A;  2L7Z A;  5TJJ A;  3WTW C;  2LVS A;  1Y8R B;  4PJJ A;  3CLO A;  5FRO A;  1T98 A;  1V5F A;  3GZN B;  2F5E A;  3OL4 A;  3FMQ A;  3IH3 A;  1MDM B;  1WH7 A;  3OYC A;  4KN7 X;  3TGN A;  1OYI A;  3JRH A;  4LGW A;  4CCO A;  2HR3 A;  1Q1V A;  1MDM A;  4UUV A;  1OYY A; 
#chains in the Genus database with same CATH homology
 3MMY B;  4HNU A;  3OWT A;  3IAM 2;  2HPI A;  3AL0 C;  4XN0 A;  4F3Q A;  2M7A A;  2CMP A;  5LFA A;  3NWS A;  4CCN A;  2HVQ A;  4HSR A;  5HVQ C;  4ZTJ A;  2KLO A;  2JVH A;  2JA2 A;  3PSI A;  3V42 A;  3LSH A;  2M3A A;  4NC7 A;  2WBM A;  2UUZ A;  1Z3X A;  2KZV A;  2IS6 A;  1YX3 A;  3OMY A;  4BUP A;  5CQE A;  2RNG A;  2LG4 A;  4XKB A;  2KPM A;  3CP2 A;  4G6T B;  5FRN A;  3M1C A;  4NUB A;  4BJT A;  4XMY A;  4DIQ A;  3RCO A;  4ZDP A;  1WFX A;  4CCJ A;  2CV1 A;  2L9S A;  1YE9 A;  4BDY A;  4D9J A;  5HNF A;  4XLE A;  2CH0 A;  4E7J A;  2E60 A;  2OV7 A;  4JOM A;  5HNH A;  3CF2 A;  3DLA A;  2Y0S A;  4KJZ A;  3GBG A;  2X6X A;  3H9G A;  3ZXS A;  3TL4 X;  3K4C A;  2KDO A;  2ZSH B;  4BE1 A;  2FUG 2;  4QPQ A;  4E7Z A;  5CPR B;  2E5N A;  1WJD A;  4XLF A;  4ZDL A;  3L2V A;  2V6E A;  3AFH A;  1BR2 A;  1D0Y A;  3U21 A;  1EA3 A;  2UV1 A;  3QYE A;  4HST A;  2R4G A;  3TMO A;  2PJR A;  4F93 B;  1QU3 A;  4BAC A;  3K4B A;  3J7A Y;  2ZXH A;  4XOR A;  2K5C A;  2WA0 A;  4FAS D;  1D0X A;  4BXF A;  3KEY A;  4F92 B;  1U0J A;  4PK4 A;  3RTR A;  4LG3 A;  4P5O A;  4D1Q A;  1YX5 A;  1DGW Y;  2R7R A;  4OAY A;  2WAE A;  4YEL A;  4CCL A;  3OR2 C;  2DOA A;  3UNG C;  2CS3 A;  4XKW A;  3S3O A;  3OY9 A;  3H0D A;  4NNJ A;  3L2W A;  2LC2 A;  1D1A A;  1WJA A;  2ZSI B;  2VJ4 A;  1KON A;  4F52 A;  4AVZ A;  3K70 C;  4ZDO A;  1FMW A;  2XAU A;  2MC4 A;  4RMN A;  2M0M A;  3PFY A;  1Z21 A;  1MMG A;  4E7I A;  1UAA A;  3LSM A;  2JSP A;  3D5L A;  2R7W A;  3RQ4 A;  1W36 C;  2HVS A;  3W2V A;  1JI8 A;  2X1D A;  1V5G A;  3HC7 A;  3PUB A;  2K3P A;  1LDK B;  2UWM A;  2ZFU A;  2X1C A;  2VPL A;  4II3 A;  2VB6 A;  4PSX A;  3AL0 B;  2W00 A;  3OYE A;  3OIP A;  2IGO A;  3VYT B;  2KQR A;  3IUO A;  2LBF B;  3MKZ A;  4ZTF A;  4II2 A;  3K6G A;  3M8J A;  1D1C A;  4C30 A;  1BR1 A;  2XF6 A;  2BOL A;  4CA0 A;  3HL2 A;  3CP8 A;  5JHF A;  4X0G A;  3LFU A;  3OOU A;  4RLF A;  1ERD A;  3EUA A;  2V26 A;  3PSF A;  2VL8 A;  4CSW A;  2NOJ B;  2BVM A;  4BJ5 C;  4J01 A;  3OYM A;  2IGN A;  2MAB A;  2VKH A;  2BW3 A;  2CUJ A;  3RPU D;  3QOE A;  3KX2 A;  3SYT A;  4NC8 A;  2VXZ A;  3OL3 A;  2HVR A;  2VJI A;  3OIQ A;  2LBF A;  4XOT A;  3HUG B;  1PYV A;  1LKX A;  3H5R A;  2XDV A;  3K4M A;  2E5Z A;  3OYF A;  4IX7 A;  2AQF A;  2KP6 A;  1N75 A;  2W1O A;  4XNF A;  4RLQ A;  3PNY A;  1WJF A;  2ELJ A;  5HOO A;  1LVK A;  3OR1 C;  2LY2 A;  4PFP A;  3CZ6 A;  3EUH C;  3OS2 A;  3TBI A;  4PJM A;  4N4N B;  2VKD A;  5HLT A;  1K6Y A;  3BLY A;  3LSG A;  4LIV A;  2XF5 A;  4B44 A;  4BEH B;  2DT7 B;  1TZL A;  3DPL C;  4ZJZ A;  3DWL E;  1GLN A;  2A6T A;  1MMA A;  2X1E A;  2RRE A;  3D5R C;  1Y6I A;  3CJR B;  1FMV A;  3EUK L;  3L2U A;  3S3N A;  4DBQ A;  3FHN A;  4BJ6 C;  4GRI A;  3FBI B;  3C2H A;  4IZZ A;  4J00 A;  4KT6 A;  4HEA 2;  3MKW B;  1T0F C;  3OYB A;  1N77 A;  3SEZ A;  2WAQ A;  3VYU B;  3OS0 A;  3PJR A;  3OS1 A;  3D5S C;  2VJJ A;  2WB1 A;  4Y33 A;  5LD2 C;  4FET A;  3HOT A;  1N78 A;  2DT6 A;  2BVL A;  2W4S A;  1OLT A;  5TGT A;  3QOD A;  4CUG A;  3A4C A;  3E0J B;  3OYH A;  4XKC A;  2HQA A;  3SDB A;  3QYF A;  2R7T A;  2K9L A;  2IGK A;  3BC8 A;  4F55 A;  3C2G A;  4PSW A;  4IQ4 A;  3W3C A;  2CFO A;  4LIU A;  3HG9 A;  3UR3 C;  2HDW A;  2MFZ A;  4KIS A;  4E7S A;  1SFK A;  3LL7 A;  3CJQ B;  3BG6 A;  4XQF A;  3A1Y A;  3PNT A;  3VYR B;  3OYD A;  2MD0 A;  4B47 A;  3G2B A;  3FDY A;  3PL8 A;  2R7U A;  2CV2 A;  4AYB A;  3AKZ A;  2WAF A;  1X1C A;  1MMN A;  3LSK A;  4RM3 A;  2HPM A;  2M7B A;  4BS9 A;  2IGM A;  4ZYA A;  4KIT B;  2XC7 A;  2IXS A;  2KMU A;  1DQU A;  3N05 A;  3OYG A;  2VIX A;  2V9K A;  3DPU A;  2VQL A;  2R7Q A;  2Z2S B;  2WY7 Q;  1X1B A;  3I9V 2;  3MD2 A;  4XOP A;  4EAT A;  2VAS A;  2X51 A;  2ZXI A;  3I3L A;  2JVG A;  3CMM A;  2W82 A;  1UG0 A;  5KNL A;  1R6R A;  4HG2 A;  2V1N A;  2OUM A;  3LSI A;  2X6W A;  2VQG A;  2LH9 A;  2WY8 Q;  4PFO A;  2V4J C;  4BQQ A;  1OR7 C;  1Y56 A;  4XLH A;  3OYK A;  2VQH A;  3DKX A;  3OYJ A;  2A5W A;  4C2T A;  3W2A A;  3DTE A;  1HA8 A;  1MMD A;  2VJ5 A;  3SEQ A;  4ANJ A;  3HOS A;  3DEE A;  4RM2 A;  2PJR B;  1P9Q C;  4YEJ A;  2DCE A;  1X1A A;  2WAD A;  3HKZ A;  1J09 A;  2VLA A;  2KHM A;  3VYS B;  2KL4 A;  2HNH A;  4HRI A;  1V5E A;  4LIT A;  3K4L A;  4IQJ A;  1NG7 A;  3K4J A;  2IS4 A;  4PJN A;  2R7O A;  4XKV A;  2QKM B;  1X4P A;  3ONQ A;  3S93 A;  4CCK A;  2XSJ C;  2DXI A;  2BW3 B;  2GOM A;  3S8P A;  2CUZ A;  3DU5 A;  3HPH A;  4B43 A;  2R7X A;  4BU2 A;  3DKY A;  4E6K G;  2W7N A;  3K70 D;  3L2Q A;  3BG7 A;  2IS2 A;  4N4O B;  5KCM A;  3IP4 B;  4E4H A;  3F9K A;  3W2W A;  2VXD A;  4DOZ A;  4PUS A;  3VDX A;  1BR4 A;  2CW8 A;  1MND A;  4Y3O A;  2Z1D A;  1BOB A;  2JUG A;  3PNV A;  1W36 D;  2XF7 A;  1DGR M;  1X4O A;  2CW7 A;  1D0Z A;  3BCA A;  4CH7 A;  3S3M A;  3FBN B;  3H9J A;  2R7S A;  4Y4R A;  4DBR A;  3VWB A;  2Q1Z B;  3LMM A;  2LY1 A;  4C9Y A;  4BE0 A;  3EPZ A;  2M4K A;  3HPG A;  3DQV C;  4U7B A;  3K4N A;  4BDZ A;  2KRH A;  4BEH A;  3H9Q A;  4XL9 A;  4XM3 A;  3ZRG A;  2L2O A;  3IAS 2;  2OC6 A;  1IRX A;  4ZC3 A;  4AU7 A;  4E7L A;  4HNT A;  2L5Q A;  5KHD A;  1T95 A;  1SAU A;  2M4G A;  2L7K A;  3VSL A;  4PJL A;  4CZC A;  1TT0 A;  2F6C A;  2AQE A;  1VZ0 A;  4ITV A;  3CES A;  4P1W A;  4CCM A;  4DJA A;  1X19 A;  2LYC A;  4E7H A;  3BCB A;  1WJB A;  3H35 A;  3SZG A;  3NWT A;  2K9M A;  1AA7 A;  3OYA A;  3H5N A;  1Z3Y A;  1S9H A;  4QPO A;  2P0W A;  2CV0 A;  4DGW B;  4HPQ A;  1WJE A;  4IKF A;  3DPT A;  5FRM A;  1DP3 A;  1D1B A;  1ZEL A;  2V7F A;  3S32 A;  4B48 A;  2O5R A;  3RSN A;  3MKY B;  3E1S A;  2E1M B;  2Z16 A;  2MYS A;  2HU9 A;  4B3X A;  4BE2 A;  2F4I A;  1X1D A;  2F5V A;  3K10 A;  1G8X A;  2LOO A;  2QKL B;  3ZQQ A;  2Q2E B;  3HXL A;  3ZCO A;  2PMZ A;  4C2U A;  2L9N A;  4XN3 A;  1LFP A;  3A2K A;  3VSK A;  1MW7 A;  4H4K C;  3OYN A;  3ZR8 X;  3FKJ A;  3OYI A;  2HZD A;  2IS1 A;  3ZGK A;  1E0E A;  1QHG A;  1MNE A;  3DTK A;  4NQW B;  4YRV A;  2LRD A;  4F91 B;  3K4K A;  1UEL B;  4BQO A;  4E7K A;  2LRE A;  1Z7L A;  4OAZ A;  4OWR B;  5CKT A;  4BL0 B;  2I8D A;  3DU6 A;  1G59 A;  2KRC A;  2RQQ A;  1WJC A;  1PJR A;  5CQG A;  3OYL A;  3L2R A;  3DTI A;  2VQC A;  1NG6 A;  1QHH D;  4BQN A;  2X6Y A;  4XON A;  4PJJ A;  1WJ5 A;  5FRO A;  1V5F A;  3OL4 A;  4BGD A;  2GOX B;  4MLO A;  4XR6 A;  3OYC A;  4U87 A;  4R79 A;  3H5A A;  3KYL A;  4XLA A;  4XLC A;  2X85 A;  2R7V A;  4CCO A;  4JQF A;  3QYB A;  2E1M C;  2DJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...