2LBFB

Solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 60S acidic ribosomal protein P1
publication title Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2011-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lbfB01
4BEHA 2LBFB 2W1OA 3A1YA 2LBFA 4BEHB
chains in the Genus database with same CATH superfamily
2O8KA 4M3BA 4RGSA 4XKBA 1MGTA 4CCKA 2KIUA 4GRIA 4M6XA 5L3CA 5HODA 4EV0A 1R71A 5L3BA 1ONVA 1G3YA 2L7MP 1U3EM 3GTMJ 5HDNA 3P5JA 5E3NA 5CVUA 1P4WA 5LD2C 1SD4A 4FISA 1Z1DA 2HKOA 5LBQA 4A3MJ 2L9SA 3BG6A 4G7ZF 1OCOH 1R5GA 5KNLA 3I4NJ 4BAYA 2IGMA 2YU3A 1LJ9A 2OZ6A 3D5LA 2EFWA 2XV4S 3VYRB 4XR6A 3NAUA 1DP3A 2V7FA 2DYSH 1I5ZA 2VOOA 1BI0A 3BTJA 2CFOA 2ZNZA 2L4MA 1SAXA 2LLKA 1V5EA 1NH3A 2NVQJ 2I10A 3WTUC 4D5FA 5C3EJ 4WXCA 1A31A 1D1CA 5J40A 1FOWA 2ECBA 3KZZA 3CMAI 1XDUA 2DFHA 2HR3A 5J6XA 3JREA 4UUVA 3F22A 5D5WB 1R9TJ 1E2XA 2K86A 1ENHA 5IT3A 3KFWX 5DV5A 3FXKA 4MFDA 1T38A 5E8GA 4MFEA 4M6VA 1MMAA 2Z9OA 1R4NB 1JUPA 3NRVA 1MSEC 1KU9A 3FX3A 3HRSA 5EDNA 1X19A 4ESJA 3FK7A 4D5CA 2RAEA 1S72I 4HX4A 4FT8A 4BU2A 5BQTA 2DMTA 4RAFA 1KGSA 3PIPF 3GVAA 1J59A 1XC5A 2BYVE 5E3LA 2MLGA 1GV5A 4HX8A 1P7IA 3IH3A 3DBLB 4XLEA 5TGTA 1QU3A 2BY0A 3CUQC 4L5JA 4XKWA 3B6AA 5F1RA 3DLAA 5KVRA 1KQ9A 6PAXA 3K10A 1XGMA 1XMAA 3BR2A 2E2IJ 5DCMB 3GBGA 5D5UB 1QBJA 2LRDA 1FMWA 2QZ8A 3EUHC 1SD6A 1RIOH 3I59B 1K6YA 3WE2A 4PGGA 4RLFA 1FC3A 1U9OA 4EATA 1IN5A 4AVPA 4G9YA 2QQBA 3C7JA 3CCYA 3MZ8A 1ZLKA 1ZR2A 1HDPA 1ZARA 4FHTA 3D5SC 3ECHA 1QVUA 3MKYB 3HTUA 1ZHFA 3H9GA 3IL2A 3EYIA 2K85A 3S32A 1QNTA 4XLCA 3U21A 2V1NA 2E34A 3M3YJ 3S1RJ 5FLXK 2XAFA 3U1DA 2CH0A 1VQ4I 2E71A 3OR2C 5F04A 1Z0XA 1X58A 3FMQA 3OSGA 5K7HA 3OYNA 2KDZA 4U88A 3RJPA 3WE3A 5F64A 1FOKA 3CCEI 3M1CA 4XSZF 4F52A 2JA5J 2LKPA 2W25A 3N05A 3L7WA 2HGCA 4OIRF 2DXIA 5D8LB 2YS9A 3KPHA 2WB1N 1HQCA 2VKDA 3MKZA 3BDDA 3I71A 4JK1X 3BR0A 5DUIA 3J7ZI 1I27A 3G71I 1AKHB 4P55A 1WHUA 1MD0A 4ITVA 1F5TA 2R7ZJ 4CICA 4M9XA 1X2NA 1K4TA 3B73A 3TP3A 4BHCA 2FF4A 3IKVA 2HYJA 3HRMA 2K9QA 4XMYA 4XRFA 5J47A 5ILUA 2XKPA 3ONQA 4AYBN 3TO7A 4IRHA 2X4HA 1G3SA 1SAUA 1FWZA 4ENJA 3IAS2 1Z7LA 4EQQA 4BY1J 3A0BC 2Y69H 3BJ6A 2KL4A 2VQGA 1QQIA 1RKTA 2O8XA 1UJ8A 1PVEA 3BG5A 3BCBA 3FZVA 3CDLA 4NB5A 2FQ4A 3FXUA 1JHFA 1B8IB 1E3HA 4XQFA 4CUGA 5J1YA 2WTEA 3JTGA 2BE5F 3N97A 4AM3A 1YX3A 3BG3A 4C9YA 1UZCA 3FMRA 3QODA 3CCMI 1G59A 2ME6A 3LQRA 2EBIA 2ZMEA 4KT5C 2BEOA 2LF8A 3RKQA 2BY1A 1F1ZA 1O3QA 2Y30A 3U1KA 3WHCA 1TW2A 2ME0A 3OOUA 5C44J 4O3MA 1AKHA 1USSA 3VWBA 2LNBA 4IEJA 4IVNA 5HDKA 2HOTA 4HF1A 4FASD 4KJZA 1SVOA 1PYVA 1PDNC 2H09A 3NWTA 1K78B 1NTCA 2KIFA 1FX7A 3HUGB 4HZFA 4B8XA 3F72A 4HA8A 3UKGA 4MLOA 2X6XA 4B3AA 2P6TA 4PSWA 2DMNA 3OYCA 3DBRB 1PUFB 1AHDP 2JQ7A 1HW5A 2ZXJA 1WJFA 2WAEA 3S8PA 2FX0A 1LFPA 2E1NA 5ILSA 3S17J 2R3SA 3KP6A 3BTIA 2BHZA 2DN0A 2IGOA 4KN4X 1NK3P 2KRHA 3BC8A 1SMYF 3QAHA 3WU1B 2E5NA 1Z6RA 1V3FA 3V4GA 1J75A 4A0XA 2FNAA 4OU0A 3C2HA 2KZGA 3HOXJ 2K02A 3JAMZ 1YS7A 3HOTA 2R7XA 2BV6A 1FBUA 2JRTA 3SZTA 4YFXF 1S9HA 2TDXA 2R7WA 1J9IA 2MH9A 2CS3A 1OFCX 2LY9A 3G1LA 1DGWY 1XSDA 2QENA 2L5QA 5CVIA 2ETHA 2WY7Q 3SHFA 4XICA 3K4BA 2XGCA 4HNUA 1TNTA 2GOXB 1DGRM 3GZNB 2DA2A 4PDKA 1TC3C 1K78A 3J80Z 4ZZLA 4EJTA 2MW8A 3I56I 4E7IA 1OCPA 2HQAA 4GYGA 1TT0A 2VQLA 4KN7X 1WFXA 5EF6A 4IHXA 2MH2A 2JRMA 3CJTB 2LTPA 1KU2A 2YPRA 3DKXA 4HLYA 3HB9A 4UUTA 3FIWA 2K4JA 2L7FP 3OYMA 4MTDA 4CHUA 3A4CA 1F43A 1UMQA 1Z67A 3QP6A 2W48A 4BQOA 2IXSA 1WWXA 2A3SA 5H20A 1RR7A 2CW8A 3RIRA 3I4PA 1WH5A 2X1CA 4PGHA 4A6EA 4YIRX 3ZN1A 2P81A 3FXQA 2F4MB 2X6OA 2GAUA 3RKXA 5E17F 1N75A 1MW7A 2Q1ZB 2DPDA 3HOWJ 4RGUA 3HYIA 1ON1A 3LA2A 2K9NA 3AG2H 1XCBA 4Z2YA 3RYRA 2GZWA 1QPIA 4OMZA 4WXDA 2DFFA 3CF5F 4E4HA 4ZYEA 1H8AC 4B4CA 4MQ9F 1LB2A 1W1WE 2WY8Q 4KNYA 2ESNA 4C2MJ 2Z1DA 4FE4A 4MGRA 3S93A 3COAC 2WB1A 4A3IJ 4E6KG 3EYYA 5CKTA 2L02A 4G7OF 1Z91A 4CA0A 2HS5A 1T08B 3PSFA 2HZTA 3JRDA 1T39A 1MSFC 3ABUA 4XSXF 1JTXA 1TLHB 4BDZA 4ESFA 2OQGA 1SFXA 4AYBA 3G1OA 1SC7A 3CJRB 4IQ4A 1K4SA 2WA0A 1VQKI 2NVXJ 2H6CA 1Y8RB 2CG4A 3MZYA 3VSLA 4RDUA 3FKIJ 1D3YA 1X3WB 3M8EA 4IRGA 3VYSB 4DYCA 1VI0A 3K2ZA 4RAGA 4M3GA 2DO7A 3C1DA 2VBYA 3TP0A 3AG3H 2UUZA 3NWSA 2VONA 2BW3B 1ZG1A 3CC4I 3KP7A 2EFPA 5IT9Z 5DDGA 1X1PA 3JRCA 5FJ8J 4IL6C 2CSOA 1A6QA 2HOEA 5IP6A 4BE1A 1CF7A 4C30A 1WH7A 4UXNA 1F4KA 2XB0X 3HOVJ 2WV0A 1DPUA 3TW7A 5E18F 2QVOA 3Q9SA 2VUMJ 4HYEA 4UV8A 1S3JA 2XGXA 4H0EA 3OYEA 3BTCA 4QPOA 1I50J 2A68F 1YE9A 1D0XA 2XF7A 5IY5H 2FJ1A 2M30A 2W57A 3FISA 4MTEA 3ZQ7A 3ZQFA 3OL4A 4CGZA 4B1RA 1DQUA 5EJCA 2XHKA 1L0OC 4JYKA 2HVSA 2HEOA 2CV1A 1GHCA 1BJZA 1R7JA 5M5WJ 4LIVA 2XGEA 4LB5A 2DA1A 3HOYJ 2CJJA 3ABKH 4QSHA 2O0YA 5J1RA 1MMDA 4EGYA 1MJ9A 4U0YA 3F6OA 2NS8A 2M0CA 3LWFA 3WTVC 3RZDJ 4M72A 2VXZA 2NXNB 4AWXB 2R5ZA 2OZUA 4DZPA 5J8FA 3TQNA 2R7OA 5HLTA 1YJ9I 1X1BA 3S3NA 4I2OA 1MKMA 1XB4A 3GTKJ 1BJAA 4JP0A 1SMTA 2BY3A 2QF7A 1J09A 2W1OA 3VOEA 4M6YA 2P7VB 5ERIA 5M3MJ 4RS8A 3DU5A 3E1SA 2Q8KA 4BXFA 5JI6A 3CJQB 1BBYA 4DNCA 3DTKA 1FIPA 3HBLA 3SZPA 1BIAA 2RNJA 1MJBA 4A3JJ 2B9SA 1BC8C 2DQRA 4BBSJ 2JA7J 3I55I 3ABMH 4RAZA 2GXAA 3I53A 2ELJA 3MWMA 3W2WA 3C2BA 2OJED 2VBWA 4S04A 3PNVA 4P9FA 5GADJ 3K1MA 3WGIA 3LA3A 2E1MC 5LFAA 2Y75A 2ELHA 3QU6A 5KAFC 1UAAA 1CGPA 1U9NA 4I0AA 2DPUA 2QLZA 1GVDA 3HOSA 4GCVA 2IS2A 2W7NA 2FNPA 2DCEA 1XX5A 2FU4A 3QU3A 2NAZA 5KK1A 4BGDA 2DMUA 2YUSA 3F0CA 4A2UA 4DIQA 2W24A 4HW0A 2I5UA 1EKEA 4BQNA 1FTZA 2X85A 2HTJA 2JWTA 4RBOA 3U2RA 1IXSB 2V6CA 4M3EA 3RZOJ 2JVGA 2DT5A 3OIOA 3T8RA 3PO3J 2DBBA 2H94A 3C18A 2KHMA 4EJUA 5EGOA 4NQWB 2VKHA 2WAFA 3K6GA 2ZNYA 2ICWG 2DTZA 2F4OB 3HM5A 1B6AA 1JUMA 5FROA 3WODF 1ACIA 3BLYA 1OQYA 4LIUA 5A2QZ 4CSWA 3TOBA 1Y56A 1WRJA 1BM9A 2NNYA 2F48A 1YX5A 2X9DA 4XORA 2IT0A 2QSHX 2VE8A 2W4SA 3BOQA 2DLLA 2Y0MA 1ZTRA 1I6HJ 1RESA 3GFMA 2CGPA 3KYDB 4U7BA 4M71A 1VQPI 5F1JA 1T0FA 4ON0A 3CESA 2A5YB 4BE2A 5EG0B 5L3DA 2RVCA 2DT6A 1I3AA 4BEHA 4XN0A 1ETOA 4CYCB 1ULYA 1JXSA 2OA4A 2NVTJ 3OYJA 3O3KA 3MN2A 4A5MA 2QGUA 2QUFA 4RM3A 2X6WA 4KISA 2Q2EB 1ZH5A 1VQMI 2DOAA 5GPAA 2JVHA 4A0YA 3GCMA 4KMFA 1BW6A 5HS9A 2VPRA 1I1GA 5LLQA 2EILH 2KP6A 5L3EA 2RNGA 1KU3A 2D2WA 1ZK8A 4A5NA 4J01A 3CLOA 4WF2A 3BY6A 1IW7F 4Y7NJ 5F0CA 1BW5A 4EMSA 1FPQA 3BP8A 2LK2A 3DFGA 5IPAA 4F93B 3J7AO 1HLVA 3IH2A 2W84A 2O6GE 2O9LA 3FK6A 4ENKA 3AG1H 4HV6A 3OS1A 1YYVA 3V8LA 1CQTA 1SVMA 2AHQA 1DU6A 5B66C 3ROUA 2LVSA 1B59A 2L0KA 3ABLH 4LMYA 3S3MA 1MBHA 3D1NI 4YFNF 2LFBA 1S8NA 2CV2A 2FRHA 1R23A 3EDPA 2VB6A 2H1LA 4CYCA 4WXHA 1BC7C 3BZKA 2TRTA 4ZDPA 2YSRA 3IH4A 3VFZA 1N77A 4HV5A 3ZQIA 5LEKA 1Y0NA 2Q2EA 3HG9A 3ERED 4DYQA 3E5UA 3JAMK 1B1BA 3J7YJ 2A6EF 4YRVA 4II3A 3ZCOA 1FIAA 2F5DA 1X3UA 3F3XA 2LSOA 4GDFA 3JRBA 2F5VA 2ZKZA 1UG0A 2IBDA 1QVTA 4QIWN 1Z7UA 1JKPC 3H5RA 1XSXA 4E7SA 3LSIA 3G3ZA 3QPLA 2YX7A 2V6EA 3E5QA 3HEFA 4LLGF 4U87A 3F23A 1BR2A 4KDPA 2M87A 5CVRA 4HPQA 3K70D 3GLXA 4CZCA 3MZHA 1ITYA 3HKZN 4KT6A 5HDGA 5L3GA 1IUFA 4R79A 3J80K 3SDGA 1D8KA 2DA6A 2J5PA 2GWRA 2Y2ZA 2H8WA 5CQGA 1H9GA 2NOJB 5HLHA 3K4CA 2OF7A 4JX4A 1HOMA 3RI4A 3CMYA 2P0WA 1NG6A 1LE8B 1WJEA 4BACA 4A3CJ 3OWTA 4BQAA 5EEGA 4A3FJ 2ESHA 1O4XA 3PO2J 3MKLA 1IRZA 5H2FC 1RKWA 2XRNA 3Q0VA 2ISYA 5BOXA 5ICEA 1UFMA 2OD5A 1XDSA 1TTYA 3H5NA 3S2DJ 1LEBA 2FQ3A 3CCJI 4A12A 1FYMA 1ETXA 4ZYDA 4IQJA 1OR7C 2HZDA 3R6SA 3HC7A 1S5LC 2MABA 4CO8A 3RCOA 5HLIA 2E2HJ 2PX9A 1EH6A 3OMYA 4EVIA 2MYSA 3RSNA 3BCAA 1OCCH 2A6HF 4Y13A 3PFIA 1G3TA 2YU9J 5F0HA 3CUQA 1T8IA 1SFUA 4A93J 1U78A 4Z6YA 2CFXA 2Z99A 1P4XA 4XL9A 2K9LA 4HDVA 3M8FA 1U8BA 1FP1D 5BS6A 3BT9A 3O8GA 1GXQA 2FE3A 3HRTA 4G8XA 3UNGC 2OAZA 3S2HJ 4II2A 1ZRFA 3I3LA 2FEZA 3OYIA 2R7RA 1YRNB 3RTRA 2P5LC 3EUHA 3WGHA 3EQLF 1LE8A 4F3QA 2Y0SN 3LSPA 1PJRA 4M74A 1J0RA 3ZN0A 3WG9A 2BVLA 5IYDJ 2HQRA 4PJJA 1Z77A 1SANA 3JSOA 4HQMA 1BR1A 1BI1A 1RRJA 2R7UA 1NK2P 3KCCA 2HQNA 2JA6J 2XAUA 3H3UA 2LH9A 1MBFA 4A3GJ 1NHAA 1N25A 3OYAA 4UVCA 2RQQA 3FXOA 5E1WA 3GFLA 3RKWA 1TWGJ 2L3DA 2PEXA 4HSTA 4XNFA 3RQIA 2ZCWA 1K79A 1XG1A 1QA6A 2IPQX 2L2OA 3S15J 1HKQA 4A6DA 4LK1F 5FD5A 2IA0A 5LHGA 3R0JA 2VOPA 2E1OA 2N8GA 4IJAA 5KHDA 2B0LA 2OTLI 5FKLA 1IN8A 4OOIA 2B63J 3H36A 1T95A 5IT9K 2DK5A 2PJPA 5K7FA 4NC8A 1Y39A 5CLSA 3LAJA 4NC6A 3KEYA 5K5RA 3JR9A 3JW4A 4HNTA 5FO5A 4XKCA 1YRNA 1G6NA 1M1EB 4BBRJ 2ZMEB 4EM1A 5HOOA 3W3CA 1Y1VJ 2OTJI 5J1UA 1D1BA 2LREA 5M5XJ 1XGNA 3I58A 4E70A 3C2GA 1ZLJA 3RPUA 4IHYA 1B9MA 2XAQA 2IS4A 3IP4B 2M7AA 4C2UA 2TCTA 1JGGA 1X4OA 1FMVA 3REOA 1O3RA 4Q48A 2LBFB 2QA4I 3P9IA 4XLFA 2PN6A 3A03A 4MO7A 3E97A 5D5VB 2E5ZA 5FKKA 3SYTA 5EZHA 2WWYA 3OS0A 4BNCA 4CYDA 2HU9A 2QM3A 4X0GA 3FBIB 5BPIA 1EH8A 1ZKGA 3CMEI 3K70C 2EIJH 4B09A 1A35A 5FRMA 3Q5FA 4E7KA 5FRNA 2L9VA 2Y31A 1VQ5I 4CXFA 1W7PB 1IO2A 2VT3A 4XOTA 1YIJI 4I0BA 3GXOA 4HOBA 4DQ2A 1D5VA 5J4YA 3PFYA 1XMKA 1D5YA 3AL0B 4HLXA 3CCLI 3WHBA 4A3BJ 1GVJA 2CQQA 2GA2A 1MIJA 1R1VA 4O5VA 2GA1A 1OCTC 4BL0B 3HSEA 2P7CB 2Z5UA 3H0GJ 5H6RA 3LOCA 3T5XA 2K3FA 3HKZA 2IJLA 5LEJA 2XUBA 2RC4A 3ECOA 3I9V2 1MH3A 2LBFA 4CCLA 4UV9A 3BPXA 2AQEA 3S2WA 4LLNA 2VJIA 1U0JA 4A69C 2XIGA 1HW2A 1DP7P 2EB7A 3FDYA 3CD6I 3OYKA 2P4WA 4PUSA 4XLNF 2FBHA 4QPQA 1MMSA 5FD6A 2OPTA 2F5FA 4YELA 3CCVI 1YITI 1B9NA 3GWZA 4IOCF 1BR4A 1T33A 2JA2A 1W7PA 4M3DA 4E7HA 1AU7A 2PMZN 2NS0A 2B7EA 3O6BB 2K3PA 2O5RA 1YW9A 4RLQA 3K2AA 5GTHC 2NNNA 4LITA 3M9AA 2F5EA 4C3IJ 1JUSA 4MHGA 1X1CA 4W97A 2WAQN 1JT0A 1MMGA 3FM3A 2HNHA 1DU0A 1J2XA 1U2WA 2GXGA 2HI3A 3EETA 5D4SA 2EJRA 3MVPA 5A2QK 1ETVA 4QTRA 3N4MA 5E8IA 3GO5A 4L5EA 1XMXA 2VASA 5JHUA 1GV2A 4C2TA 1ETYA 2KIQA 1IXRC 5ICGA 2ADUA 2DFEA 3PQKA 5CVVA 4KFCA 1STZA 5GAEJ 4A3DJ 4IHTA 3GLLA 1V55H 3G1MA 3HSFA 3ML6A 4KITB 4IXAA 1BIBA 2C6YA 4WCGA 2Y0SA 1N78A 3DPLC 3L1PA 2GBYA 2VLAA 2R7SA 3CCQI 1F36A 3ABTA 3PJRA 2FOKA 5TRDA 3K4JA 3KP3A 3PQJA 5EYRA 2JSCA 3GFJA 2IS1A 2ELKA 2XAGA 3LSGA 3BR5A 2O03A 2AQFA 2P8TA 1OLTA 2XPUA 5FKMA 5BNGA 4DBRA 2E7XA 4UVAA 1K83J 2CQKA 4BH9A 2XC7A 4FX0A 4B48A 4CDGA 1IF1A 2XASA 3IWFA 4E7ZA 2COMA 2EIMH 1V5FA 4X6AJ 5C4XJ 4OWRB 1OKRA 3HZJA 1VQ8I 2P5VA 2L4AA 3CO6C 1VQ7I 1KZHA 3L2VA 1FOXA 1IN6A 2KJCA 1U5TC 2JUCA 2KT0A 1MNDA 5E3OA 1YFHA 4M9ZA 2CQNA 5F0FA 4NHJA 4V19K 1QHGA 1QO0D 3IUOA 4L9VA 4BXUA 2O3FA 3ESWB 3LL7A 2PI0A 4NNJA 1LDKB 5F6FA 1WSUA 5K7ZA 3S1NJ 1P4AA 1OYYA 3H3ZA 1EF4A 1CF7B 4HSRA 2EINH 4XLPF 3TDZC 3OYDA 4CZZA 1WJAA 3CDHA 3QQAA 4U0WA 2ZJQF 4Q4ZF 3T8TA 3DPTA 1YW7A 3KP2A 3ISPA 2L9RA 3HXLA 3VB2A 5JLXA 1FBSA 2HWVA 4L9NA 4ASNA 1VQ6I 1RPWA 3VYUB 1MBJA 3AAFA 5DUKA 1R58A 4NC7A 3KETA 1ETKA 2DA5A 1FTTA 2KMUA 2VBXA 2PJRB 2E60A 3QOPA 5DM7F 4DJAA 3S1MJ 2EV0A 5EEAA 2VC1A 1KQ0A 3JTHA 3OYGA 3MCZA 3SJMA 4ZJZA 2Z33A 1R22A 1WZ2A 4I01A 1VQOI 1R5HA 1E3OC 1YO5C 2R5ZB 1ZQ3P 2QBYA 3FXJA 1BN5A 1BI3A 2PQ8A 2M7BA 2VC0A 5FKNA 1PP7U 1POGA 2HQ5A 5KCMA 3HTSB 4B47A 5GP9A 2ECCA 1QRYA 2PMUA 3TBIA 2CV0A 2JZYA 4RMNA 1V4RA 3F8NA 4I09A 1JKQC 1Q1HA 1Z3XA 4F7ZA 5M5YJ 3I4MJ 4G6QA 2EZIA 3J81Z 3NEUA 1YTYA 3H92A 1F9NA 5KAIC 1BA5A 4ZZDA 1RI7A 3ULQB 4BY7J 2ZO4A 4XBFA 5J3LA 2MGQA 4HBLA 3PIOF 4FE7A 5ICCA 5B5EC 4JBAA 5TJJA 2H8RA 4IHVA 3ZP5A 1A6IA 3KIOA 3LAPA 4P9UA 3OSFA 1RUOA 1FLIA 2RKHA 1LKXA 3HRUA 3WU2C 2JUGA 4OMYA 1YI2I 2FD5A 1WPKA 5FKOA 1TQIA 1TW3A 3TEDA 5E20A 2W82A 2PJRA 2QKMB 3LQQA 1UB9A 1ZRCA 2DOFA 2CUZA 2JPBA 2PLYA 3DKYA 2R7DA 4BHPA 5IOZA 2PMZA 1VTNC 2JPCA 3GEZA 4RM2A 3IAM2 2CUJA 3S14J 2QKLB 2MLKA 3AKZA 1A36A 4L9JA 4PJMA 2V1UA 4E7JA 1OJLA 1ETQA 4OINF 2VJJA 4XLAA 1VFCA 2WAQA 3IRRA 2FUG2 1V54H 4N0BA 1NG7A 4XLHA 1KYZA 3HDDA 3LNQA 3KE2A 3G2BA 5GTIC 5EGOB 4I99C 2JSPA 3GTQJ 2ZC2A 4JX6A 1TBXA 3S16J 4O6JA 4RB0A 4LG0B 1UHWA 4ENNA 1YW8A 2LP0A 2XPWA 2UZKA 2CWEA 1U6GA 3H9JA 3CF2A 4FCYA 2E2JJ 1H0MA 1MZBA 2XF5A 3D0SA 2STTA 3A0HC 3PL8A 3E6BA 4MEYF 4PFPA 2XAHA 4DZJA 3LFUA 3K4KA 4BEHB 3I0TA 4HX7A 5EZGA 2JN6A 1J5YA 1LFUP 2WC2A 3TDUC 2EPFA 4LD5A 2ZBKA 2VE9A 1L3LA 2DJNA 2XF6A 2X51A 2FBIA 1ZG3A 1OPCA 5D8KB 3ZOBA 4XRMA 2LMDA 3F6VA 3WGGA 2E7WA 5DS9A 3ZQCA 1H9TA 3HGGA 3P9CA 5D6FA 3MQ0A 1B4AA 2EIKH 2PFBA 3DQVC 2R7VA 4L0ZB 4F92B 3VPRA 5BMZA 4LG0A 2ID6A 2ACJA 4PZJA 1HSJA 3MEXA 4FQGA 3DEUA 3CP2A 5TISC 4B3XA 2K40A 3DEEA 2JK3A 1Q1VA 1BI2A 4EM2A 4XKVA 2QYOA 5HS7A 2WV1A 2LD5A 1IRGA 5ILVA 3V8JA 3IWZA 3ZMDA 4S0HB 2W00A 5DM6F 3TO9A 2GIVA 5JVTA 2ZSIB 1FOYA 2HXIA 2K5CA 3QYBA 4V2FA 2Y9YA 1QHHD 2DA7A 3W2AA 2E36A 3ZQLA 2Y9ZA 4CH7A 1KYWA 1LUJB 3CCRI 3GTPJ 2RN7A 3QYFA 3I5UA 4KUMA 2DA3A 3ZMZA 4TV7A 5DCFA 4DYRA 3SEZA 3TL4X 4F91B 5LHIA 2K4BA 3FXRA 1B72A 3V7SA 2ZB9A 3TMOA 3QWLA 4L9TA 1R00A 2ZFUA 3EUKL 4NBQA 1KONA 4IPAA 2QQAA 1G2HA 5C4JJ 3ZMSA 1Z21A 2HKXA 2LDUA 5AIQA 3H0DA 1T56A 3R61A 4AIKA 1GLNA 1OMIA 4ZC3A 3Q9VA 4DW6A 3R4KA 5K1YA 5IYCJ 3KX2A 2GIZA 1O3TA 3QPTA 1C0WA 1Y8QB 2KRCA 3F21A 1ZR4A 2VJ5A 3HGYA 2STWA 4BXXJ 2IAIA 5ICFA 1HKTA 1X2MA 4BUPA 3BQZA 2DK8A 2HFHA 4U0VA 1O3SA 4KMUX 2NVUB 4MEXF 3DBHB 2KQRA 4ZTFA 2LKSA 1I39A 2G7HA 3QRFF 1OYWA 1D8JA 2DQLA 2QEXI 3GYHX 2WADA 3DV8A 1E17A 3L2WA 3E7LA 1RUNA 1G8XA 3W6KB 1G4DA 5CQEA 1IC8A 4PCQA 4KICA 1G3WA 3OOPA 2GM4A 3WTXC 5DD4A 2A61A 2XSDC 1GXPA 2EZKA 3JRHA 3L00A 1RZ4A 2F6CA 2KISA 2BGCA 1FNNA 3KLOA 2NS7A 2LF7A 2R5YA 3WU0A 4BDYA 5DTDA 3ZR8X 3FKJA 2ZJRF 3RPQA 3AG4H 4BJ6C 2BVMA 2JMWA 2NVYJ 3CUQB 2DOEA 1ERDA 2K9SA 2GXBA 3M7GA 4MIMA 4JOMA 2OCCH 2RREA 4N4OB 4P1WA 4UB6C 2G0EA 2V79A 4RA2A 3V8KA 4EJVA 4IZZA 4BQQA 4EEFG 1AOYA 2V9VA 3OYHA 3E6MA 4WK8F 1H89C 4N9HA 4HAMA 3L2CA 3CC7I 1DPRA 3RPUD 2R7QA 1LDJA 3OY9A 1IN7A 4BE0A 2A6TA 4Y33A 1K61A 4CCNA 4DOZA 2L7KA 3SDBA 2HOAA 1TP4A 5FFZA 1J7KA 2P6SA 1W5TA 1YS6A 4MNUA 3VDXA 1WVRA 4LGWA 5JLWA 4ZYHA 1MDMA 1OR7A 3ZMVA 3PSIA 1QZZA 4ZYAA 1QZEA 2E35A 1YG2A 2EA2A 3OR1C 1IGNA 1O7LA 3CCUI 4IF4A 3BPVA 4HF0A 1SFOJ 2JA8J 2DDAA 1LQ1A 2MC3A 3ZRGA 1K7AA 1S7EA 3E3VA 2M1BA 2ZJ2A 1XN7A 4G7HF 4Y52J 2ZFWA 1Z9CA 1IG7A 4KYWA 2VKEA 1X4PA 5K5QA 1S7OA 1WJCA 2IW5A 1ON2A 1SFEA 3K1NA 5J4VA 4QWQA 3JRIA 3P7NA 4IRIA 2DYRH 2V9KA 1LVAA 4PFOA 2VKVA 1AA7A 2MA3A 2JT1A 1YJNI 4W1UA 2M4GA 3A2KA 2RGVA 1HBXG 2KPMA 3DEWA 1RC9A 3HJEA 3ZMUA 4S05A 1S6LA 4EM0B 4BYYA 1ZRDA 4R1HA 2HDDA 5D5XB 1ZAOA 1R1UA 1VQ9I 1T98A 4MQVA 2VQCA 1MBEA 3G4SI 1JGSA 3CZ6A 2HDWA 4B43A 4LOCA 3IV5A 4J00A 4GFBA 4WX9A 3JCUC 2MC4A 1HC8A 1TT5B 1ZGWA 4I02A 2M34A 1XSVA 1SD5A 4Y3OA 2XPVA 2D5VA 2V1XA 4UUSB 1SEUA 1W7PD 2H1KA 5D4RA 2EZHA 2IVMA 1EV7A 2V9PA 3LFKA 3CUOA 4YEJA 1KQ8A 2IRFG 5CPRB 3GTGJ 4OIPF 2DODA 1Z6TA 1T6SA 1QGPA 3BG9A 2DDBA 4L5IA 2O61A 2HXOA 3CTAA 2L54A 2EV6A 3HL2A 2G7UA 2H27A 4XRSG 2FMYA 2LC2A 1Y0UA 3RKYA 4AUXA 3TOAA 2M9HA 1HKSA 4RGXA 2DA4A 2EZLA 4DGWB 2O7OA 4YIFA 3J81K 3M07A 4V2GA 2JTVA 2DJIA 2ZJPF 3M4OJ 4QLCU 4GO1A 3EUAA 1MBKA 1TWCJ 5BPDA 2PMHA 1APLC 1UHMA 4LK0F 2DMPA 3E5XA 2QSGX 3SXYA 4OIOF 3K69A 5JVGF 3ELKA 5FFXA 2V4JC 1O57A 1R5ID 4EJWA 1ZG5A 4G12A 1AWCA 4ZTJA 2AO9A 2EFOA 4ETSA 1FJLA 5M3FJ 1KU7A 4L0YB 4CCMA 1P6RA 4PJNA 4A3KJ 1FP2A 2QQ9A 3PNYA 4HF2A 3HSRA 2MFZA 2M8GX 3DKWA 4H4KC 3W6JB 4AIHA 5HLGA 2NYXA 5JR3A 3BR3A 1XGOA 4UUSA 1P7JA 1GUUA 1X3ZB 4RB3C 2M5WA 4GXOA 2MG4A 5DCMA 4BJ5C 4BJTA 3ASOH 5E1XA 1MNEA 3GFIA 1QPMA 4RGRA 3L2UA 3V42A 3W2VA 2M8EA 2OCEA 3I59A 4PK4A 4WWCA 3HOUJ 3VSKA 2R93J 1A5JA 2DT7B 1RNLA 1WCMJ 1ZELA 5J8CA 1ZREA 3ZPLA 3RYPA 3PNTA 3Q0UA 3J7AY 2X48A 3JRGA 3GTJJ 3CC2I 3GZ6A 2HPIA 4I6ZA 3OYLA 1HCRA 5CJ9A 2LKXA 1TNSA 1H88C 2EWNA 1HXDA 4M9SA 2V26A 2ZSHB 2XROA 3ASNH 3DXJF 1R49A 1REPC 2CW0F 4OAZA 4ENMA 2XSJC 2J5OA 4P5OA 4R8HA 9ANTA 2XB5A 3DWLE 3UR3C 4IX7A 1VQNI 3K4MA 4N9IA 5JFRA 5CVJA 5LRRA 1O7FA 4I7HA 2EFQA 2DMQA 2Q0OA 1VQLI 3LSHA 3BG7A 3U9GA 1FYKA 2R7TA 4HNVA 4Q47A 2EQRA 1UG2A 3O8HA 4LJZF 2CQXA 2PBIA 5HS8A 2ZMEC 1A04A 3DPUA 1LNWA 3CQZJ 4LG3A 3SEQA 1WQ2A 2F5CA 1HW1A 4D7NA 3FHNA 2I8DA 3K4NA 1USTA 2QSFX 3DCFA 3H9QA 3T1BA 1U5TB 2M45A 1JT6A 3OYBA 3I64A 3OL3A 2Z3YA 3HPHA 2R0QC 1LFBA 3LSKA 3QP5A 3K4LA 2E1CA 3MAJA 2UXXA 2P5KA 3OV8A 3V7CA 3V7RA 4UVBA 1TZLA 1HF0A 2JJ7A 4M73A 1B8IA 3KEQA 2IGNA 1YJWI 2NRAC 3RDIA 2QCOA 5FGMA 4IOAF 2LY1A 3KEOA 3OIQA 3F8MA 1E0EA 3K0LA 1FZPB 1XD7A 2CMPA 3AFHA 4M3FA 3SFZA 4U7DA 1JJ8C 5LGUA 1R36A 5AONA 1JHHA 2ZXHA 3S3OA 3CJNA 1YLFA 3DF8A 4F55A 4PSXA 1FY7A 3CO7C 1YHQI 2OC6A 2BBYA 1HA8A 3AL0C 4GYIA 2VI6A 1FT9A 4AIJA 1W0UA 2WBMA 1GT0C 2M4KA 2FMLA 3KZYA 1EJ9A 3BR1A 1IUYA 2KDOA 4C3JJ 1HSTA 2XRLA 2X1EA 2FOWA 3PUBA 5E3MA 3KYLA 5H6QA 2MD5A 1ETWA 1UELB 3HUGA 3GF2A 4YIIA 2OQRA 1U5TA 1QZYA 2CQ7A 3NARA 5DYMA 4P96A 5IYBJ 3G6EI 4EGZA 4FTHA 1PUFA 1IJWC 1IV6A 3IKTA 1W5CC 3BZCA 2H6BA 2MD0A 2VL8A 3QYEA 1W5SA 2L01A 3R60A 4DBQA 1TL8A 2NOGA 1TWHJ 2DFIA 1BL0A 5B1BH 1I3QJ 1VZ0A 5GAHJ 2AXLA 5IOYA 1I6XA 2R7FA 2FA5A 3E6DA 3MMYB 4CCOA 3L9FA 1BOBA 3TGNA 1HDDC 4D9JA 2LY2A 1VF9A 1P9QC 3JRAA 1SD7A 2BXZA 4AD9A 2UWMA 2QBYB 3JRFA 4AVZA 3X2QH 4PJ0C 1TWFJ 4ZH4F 3GTOJ 3F8FA 2XVCA 4LB6B 3ZXSA 3BJAA 2Y48A 4Y15A 2AS5F 3LSTA 4D7MA 1LVKA 3EPZA 1MMNA 4UB8C 3W6VA 5LGTA 2VT2A 1WGXA 1ZYRF 2EA4A 4IHWA 3Q3SA 3MFKA 1BOAA 3H1CA 2F4IA 4IO9F 4JQFA 2ZXWH 2VIXA 2KIMA 2GOMA 3WTYC 1IAWA 1TQMA 1OCRH 1YIOA 2HYGD 4X1EA 1WJDA 2A05A 4ZDLA 3KP4A 4BHBA 3Q0WA 2LG4A 3K1PA 3OYFA 4FETA 5HVQC 1VNDA 3CLQA 2X1DA 4BS9A 1SVLA 1PUEE 3O2PE 4HDUA 5LGNA 2KLOA 1LDDA 4NDLA 2EV5A 3BZ6A 3H5AA 3BROA 3QPSA 1XGSA 2BOLA 1IRXA 4ABZA 3HPGA 3CCSI 5GAGJ 5B1AH 1WI9A 2DTRA 5FB2A 3GTLJ 3BTLA 2M0MA 2BHYA 2KRFA 2A07F 1MJAA 4AC0A 2X0LA 3DLLF 2E1MB 2MSYA 2OBPA 1IRFA 1OYIA 3I54A 1U8RA 3L09A 2YR2A 2EFNA 3HHGA 3BWGA 1ZGAA 5DEQA 3FXLA 5IP7J 5FLXZ 2D45A 2QQ8A 5IP9J 3BJOA 5F08A 1FYLA 1FBQA 1XCVA 4I76A 2D1HA 1MBGA 4BKXA 2XGDA 3SFIA 1DDNA 2DAOA 1Y6IA 3FM5A 4IHSA 3CDIA 3MKWB 1IDYA 4D1QA 3ZQGA 4KIGA 2HDCA 1YOVB 2RDPA 1X1DA 1WJBA 2VQHA 3L2QA 2VN2A 1JTYA 1LPQA 3B6CA 1GDTA 1XPXA 2BY2A 2RQPA 2HYFA 3KYCB 4N4NB 3A1YA 1I1SA 2ZXIA 4L18B 3HOZJ 2D1VA 2VXDA 4HQEA 3JSPA 1MH4A 4RB1A 3SQNA 3P9KA 2L7ZA 1UHSA 4Q5SF 2FSWA 1WJ5A 5ED4A 1OISA 2Z16A 1WKMA 1IDZA 2X6YA 3H35A 2V1DA 1D1AA 5LHHA 3ZQQA 4XRSA 2A69F 2HPMA 2VBZA 1IN4A 4ESBA 4XN3A 2XKOA 3ZGKA 3K7AJ 2BW3A 5FLVA 3BR6A 1W36D 1FSHA 4KA4A 2IA1A 2W85A 2BZTA 2CRGA 4ZYGA 2K9MA 4XM3A 3DTIA 2LOOA 2CYYA 5EEHA 4UNOA 4G94A 1D0YA 5K5OA 1Z3YA 2HVRA 3IRQA 3ZMTA 2HVQA 2KZVA 1EA3A 3F9KA 2IEKA 1X1AA 3D5RC 3NQOA 1R1TA 4G6TB 3F8BA 4D0PA 1RETA 1TWAJ 2XAJA 1JI8A 2IS6A 2M3AA 2YX4A 3FMSA 3A01B 5D6EA 1R4MB 1ORKA 2E19A 1R6RA 5CYVA 2KKOA 1W4MA 4A3EJ 1ODDA 3VEPA 1IV8A 3GW2A 3FBNB 3QPHA 2LYCA 1FSEA 3GX4X 1JE8A 1B72B 2F2EA 2M2EA 3KLNA 1SFKA 2CW7A 5FLMJ 2DI3A 2GQQA 4OAYA 1JKRC 4UY8I 3IHUA 1P2FA 3KZIC 4ZDOA 5HNFA 4FX4A 2VPLA 2FXAA 4UHTA 1S7AA 1JJ6C 4E7LA 2A5WA 2CO5A 1S29A 2QWWA 1W0TA 1UCRA 5B3SH 3K9TA 2DU9A 4C3HJ 2RV8A 1LEAA 5DD8A 4LLLA 2OU2A 4NUBA 1P92A 1JKOC 2CU7A 3F8CA 3KP5A 3S1QJ 3PM1A 4RAYA 2LR8A 4XOPA 5HNHA 2UXNA 1MNMC 3WTZA 4AIDA 3TKYA 2EH3A 3LSJA 2IA2A 2FBKA 2K7LA 4YFKF 1KA8A 3A01A 1XS9A 3E6CC 4EJOA 3WTWC 3GMEA 1OCZH 1DUXC 3WTSC 1IZ1A 3QOEA 2CUFA 4XIDA 3WTTC 3VODA 2R92J 4OIQF 1TQPA 3L2RA 3G73A 3WG7H 4XONA 4HG2A 2KJBA 3FHZA 3MD2A 4IKFA 3VYTB 1T2KA 3DP7A 3CMMA 2Z2SB 4YG2F 4RB2C 3ERMA 4G6DA 3DU6A 2R5YB 1E3PA 3FXMA 1PP8F 5AIPA 2IGKA 5E79C 1XTAA 4Y17A 3FWEA 1T0FC 5L3FA 1Y1WJ 3M1EA 4A0ZA 2XDVA 3LSRA 4J19A 3BQYA 3OIPA 1Z05A 4GGGA 4HEA2 3GZ5A 2OV7A 2OUMA 3T0YA 5JHFA 3B02A 3R0AA 1K6OA 3LMMA 3M8JA 3PUFA 1FEXA 3HIFA 4KIBA 4NQWA 2VJ4A 3IC7A 2EK5A 2G9WA 2KFDA 4ANJA 3TO6A 4JX5A 2K27A 1MDMB 2HTSA 4XK4A 2BXYA 2UV1A 3HHHA 3RQ4A 1RR8C 3SZGA 5LRSA 2DW4A 3FF5A 4LFUA 4AU7A 2HOSA 3GUDA 3LSMA 3H3VK 5F27A 3CP8A 5GPCA 3C3WA 3DTEA 3LA7A 1WI3A 1IXCA 4CCJA 3TW6A 5EG0A 4B44A 2COBA 4Y4RA 5E1ZB 4HRIA 3OS2A 2IP2A 1YQAA 1ZN2A 2PG4A 2L9NA 1W36C 1ZGJA 4PJLA 4I98B 3A02A 4A3LJ 2CUEA 3E0JB 4KIFA 2ID3A 2AXTC 4K2EA 2ISZA 1D0ZA 1V5GA 2GLOA 3ZQHA 2MBFA 1EH7A 2R4GA 2VODA
chains in the Genus database with same CATH topology
2ELJA 4XKBA 3W2WA 4CCKA 3PNVA 4GRIA 1MNDA 4BJ5C 4BJTA 2E1MC 1MNEA 1QHGA 3L2UA 3IUOA 3V42A 3W2VA 5LFAA 4PK4A 3LL7A 3VSKA 4NNJA 1LDKB 1UAAA 3HOSA 2DT7B 2IS2A 2W7NA 2DCEA 1ZELA 5LD2C 4BGDA 3PNTA 4HSRA 3J7AY 2L9SA 3BG6A 4DIQA 5KNLA 2HPIA 3OYDA 2IGMA 3D5LA 4BQNA 1WJAA 3OYLA 2X85A 3VYRB 4XR6A 1DP3A 2V7FA 3DPTA 2CFOA 2JVGA 3HXLA 2V26A 2ZSHB 1V5EA 2KHMA 4NQWB 2VKHA 2XSJC 2WAFA 4OAZA 3VYUB 3K6GA 4P5OA 4NC7A 1D1CA 5FROA 3UR3C 3DWLE 4IX7A 3BLYA 3K4MA 4LIUA 4CSWA 1Y56A 2KMUA 2PJRB 2E60A 4DJAA 1YX5A 4XORA 3LSHA 3BG7A 2W4SA 2R7TA 3OYGA 4ZJZA 3DPUA 1MMAA 4U7BA 1X19A 4LG3A 2M7BA 3SEQA 3CESA 4BE2A 2DT6A 5KCMA 4BEHA 4XN0A 4B47A 4BU2A 3TBIA 3OYJA 3FHNA 2I8DA 3K4NA 2CV0A 3H9QA 4RMNA 4KISA 4RM3A 2X6WA 1Z3XA 2Q2EB 3OYBA 3OL3A 3HPHA 2DOAA 5TGTA 1QU3A 3LSKA 2JVHA 4XLEA 3K4LA 4XKWA 3DLAA 1TZLA 2KP6A 2RNGA 3K10A 2IGNA 2LY1A 3GBGA 1LKXA 3OIQA 1E0EA 2JUGA 2LRDA 1FMWA 4J01A 3EUHC 2CMPA 3AFHA 1K6YA 4RLFA 4EATA 2W82A 2ZXHA 3S3OA 2PJRA 2QKMB 4F93B 4F55A 4PSXA 2OC6A 2CUZA 3OS1A 1HA8A 3DKYA 3AL0C 2PMZA 3S3MA 2WBMA 2M4KA 3IAM2 2CUJA 3D5SC 4RM2A 3MKYB 2QKLB 3H9GA 2KDOA 3AKZA 3S32A 4PJMA 2CV2A 4E7JA 2VB6A 2X1EA 3PUBA 4XLCA 3U21A 2V1NA 3KYLA 2VJJA 4XLAA 4ZDPA 1UELB 2WAQA 2FUG2 1N77A 2CH0A 1NG7A 4XLHA 3OR2C 3OYNA 3HG9A 3G2BA 2JSPA 3M1CA 4F52A 4YRVA 4II3A 3N05A 3ZCOA 2MD0A 2VL8A 3QYEA 4DBQA 2DXIA 2VKDA 1VZ0A 2F5VA 3H9JA 3MKZA 1UG0A 3CF2A 3H5RA 4E7SA 3LSIA 3MMYB 4CCOA 2XF5A 1BOBA 4ITVA 2V6EA 4D9JA 2LY2A 4U87A 1BR2A 3PL8A 1P9QC 4HPQA 3K70D 2UWMA 4XMYA 4PFPA 4CZCA 4KT6A 4AVZA 4R79A 3LFUA 3ONQA 3K4KA 4BEHB 1SAUA 5CQGA 3IAS2 1Z7LA 2NOJB 3ZXSA 3K4CA 1LVKA 2KL4A 1MMNA 2VQGA 2XF6A 3EPZA 2X51A 2P0WA 1NG6A 1WJEA 2F4IA 4BACA 3BCBA 4JQFA 3OWTA 2VIXA 2GOMA 4XQFA 4CUGA 1YX3A 3DQVC 4C9YA 3QODA 2R7VA 1G59A 4F92B 1WJDA 4ZDLA 3H5NA 2LG4A 3OYFA 4FETA 5HVQC 3CP2A 4IQJA 4B3XA 2X1DA 1OR7C 4BS9A 3DEEA 2HZDA 3OOUA 3HC7A 2MABA 3RCOA 2KLOA 3OMYA 2MYSA 4XKVA 3RSNA 3BCAA 3VWBA 3H5AA 4FASD 4KJZA 1PYVA 2BOLA 1IRXA 3NWTA 2W00A 3HPGA 4XL9A 2K9LA 3HUGB 2M0MA 2ZSIB 3UNGC 4MLOA 2X6XA 2K5CA 3QYBA 4II2A 4PSWA 3OYCA 3I3LA 2E1MB 3OYIA 1QHHD 2R7RA 3RTRA 3W2AA 1WJFA 2WAEA 3S8PA 4CH7A 4F3QA 1LFPA 3QYFA 1PJRA 2BVLA 2IGOA 4PJJA 4F91B 2KRHA 3BC8A 3SEZA 3TL4X 1BR1A 2E5NA 2R7UA 2XAUA 3C2HA 3TMOA 2LH9A 2ZFUA 3EUKL 3OYAA 1KONA 3HOTA 2R7XA 2RQQA 1Y6IA 3MKWB 1Z21A 4HSTA 3H0DA 1S9HA 4XNFA 4D1QA 2R7WA 1X1DA 2CS3A 1WJBA 1DGWY 1GLNA 2VQHA 3L2QA 4ZC3A 2L5QA 2L2OA 3KX2A 2WY7Q 2KRCA 4N4NB 3A1YA 3K4BA 4HNUA 2ZXIA 2GOXB 2VJ5A 2VXDA 1DGRM 5KHDA 4BUPA 1T95A 4E7IA 2KQRA 2HQAA 1WJ5A 4NC8A 4ZTFA 1TT0A 2VQLA 2Z16A 3KEYA 2X6YA 1WFXA 3H35A 4HNTA 1D1AA 3ZQQA 4XKCA 2HPMA 2WADA 3DKXA 4XN3A 5HOOA 3ZGKA 3L2WA 2BW3A 3W3CA 1G8XA 1W36D 5CQEA 1D1BA 2LREA 3OYMA 3A4CA 3C2GA 2K9MA 4XM3A 4BQOA 3DTIA 2IXSA 2LOOA 3IP4B 2IS4A 2M7AA 2F6CA 4C2UA 1D0YA 1Z3YA 2HVRA 2CW8A 4BDYA 3ZR8X 1X4OA 3FKJA 1FMVA 2HVQA 2X1CA 2LBFB 4XLFA 2KZVA 1EA3A 3F9KA 4BJ6C 2BVMA 2E5ZA 3SYTA 1X1AA 1ERDA 3D5RC 3OS0A 4JOMA 4G6TB 4N4OB 2RREA 2HU9A 4P1WA 4IZZA 1N75A 4X0GA 1MW7A 3FBIB 2Q1ZB 2M3AA 4BQQA 3OYHA 2IS6A 1JI8A 3K70C 1R6RA 3RPUD 2R7QA 3OY9A 4BE0A 2A6TA 4Y33A 5FRMA 4E7KA 4CCNA 5FRNA 3FBNB 4DOZA 2L7KA 3SDBA 2LYCA 4E4HA 3VDXA 4XOTA 2WY8Q 1SFKA 2CW7A 3PSIA 4ZYAA 2Z1DA 4OAYA 3PFYA 3S93A 3OR1C 3AL0B 2WB1A 4ZDOA 4E6KG 5HNFA 2VPLA 5CKTA 4E7LA 4CA0A 2A5WA 3ZRGA 3PSFA 4BL0B 1X4PA 4NUBA 3HKZA 1WJCA 4BDZA 4AYBA 3I9V2 2LBFA 4CCLA 3CJRB 2V9KA 4XOPA 4IQ4A 2AQEA 5HNHA 4PFOA 2VJIA 2WA0A 1U0JA 1AA7A 3VSLA 3FDYA 3OYKA 2M4GA 4PUSA 3A2KA 2KPMA 4QPQA 3VYSB 3QOEA 4YELA 2UUZA 3NWSA 2BW3B 1BR4A 3L2RA 2VQCA 2JA2A 4XONA 4HG2A 3CZ6A 4E7HA 3MD2A 2HDWA 4IKFA 4B43A 3VYTB 2K3PA 3CMMA 2O5RA 4RLQA 4J00A 2Z2SB 4LITA 4BE1A 3DU6A 4C30A 2IGKA 2MC4A 1X1CA 1MMGA 2HNHA 1T0FC 4Y3OA 2XDVA 3OIPA 3OYEA 4HEA2 4QPOA 2OV7A 2OUMA 5JHFA 2VASA 1YE9A 1D0XA 2XF7A 4C2TA 4YEJA 3LMMA 3M8JA 3OL4A 5CPRB 1DQUA 2VJ4A 2HVSA 2CV1A 4ANJA 4LIVA 4KITB 3HL2A 2LC2A 1MMDA 2UV1A 2Y0SA 3RQ4A 1N78A 3SZGA 3DPLC 4DGWB 2VLAA 2R7SA 4AU7A 2DJIA 3LSMA 2VXZA 3PJRA 3EUAA 3K4JA 3CP8A 2IS1A 2R7OA 3DTEA 3LSGA 5HLTA 4CCJA 4B44A 2AQFA 1OLTA 1X1BA 3S3NA 4Y4RA 4DBRA 4HRIA 3OS2A 2XC7A 2V4JC 4B48A 4ZTJA 2L9NA 1J09A 2W1OA 4E7ZA 1W36C 4CCMA 4PJLA 3DU5A 3E1SA 4BXFA 4PJNA 3CJQB 1V5FA 3E0JB 3DTKA 3PNYA 4OWRB 1D0ZA 1V5GA 2MFZA 4H4KC 2R4GA 3L2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEH A;  2LBF B;  2W1O A;  3A1Y A;  2LBF A;  4BEH B; 
#chains in the Genus database with same CATH topology
 2O8K A;  4M3B A;  4RGS A;  4XKB A;  1MGT A;  4CCK A;  2KIU A;  4GRI A;  4M6X A;  5L3C A;  5HOD A;  4EV0 A;  1R71 A;  5L3B A;  1ONV A;  1G3Y A;  2L7M P;  1U3E M;  3GTM J;  5HDN A;  3P5J A;  5E3N A;  5CVU A;  1P4W A;  5LD2 C;  1SD4 A;  4FIS A;  1Z1D A;  2HKO A;  5LBQ A;  4A3M J;  2L9S A;  3BG6 A;  4G7Z F;  1OCO H;  1R5G A;  5KNL A;  3I4N J;  4BAY A;  2IGM A;  2YU3 A;  1LJ9 A;  2OZ6 A;  3D5L A;  2EFW A;  2XV4 S;  3VYR B;  4XR6 A;  3NAU A;  1DP3 A;  2V7F A;  2DYS H;  1I5Z A;  2VOO A;  1BI0 A;  3BTJ A;  2CFO A;  2ZNZ A;  2L4M A;  1SAX A;  2LLK A;  1V5E A;  1NH3 A;  2NVQ J;  2I10 A;  3WTU C;  4D5F A;  5C3E J;  4WXC A;  1A31 A;  1D1C A;  5J40 A;  1FOW A;  2ECB A;  3KZZ A;  3CMA I;  1XDU A;  2DFH A;  2HR3 A;  5J6X A;  3JRE A;  4UUV A;  3F22 A;  5D5W B;  1R9T J;  1E2X A;  2K86 A;  1ENH A;  5IT3 A;  3KFW X;  5DV5 A;  3FXK A;  4MFD A;  1T38 A;  5E8G A;  4MFE A;  4M6V A;  1MMA A;  2Z9O A;  1R4N B;  1JUP A;  3NRV A;  1MSE C;  1KU9 A;  3FX3 A;  3HRS A;  5EDN A;  1X19 A;  4ESJ A;  3FK7 A;  4D5C A;  2RAE A;  1S72 I;  4HX4 A;  4FT8 A;  4BU2 A;  5BQT A;  2DMT A;  4RAF A;  1KGS A;  3PIP F;  3GVA A;  1J59 A;  1XC5 A;  2BYV E;  5E3L A;  2MLG A;  1GV5 A;  4HX8 A;  1P7I A;  3IH3 A;  3DBL B;  4XLE A;  5TGT A;  1QU3 A;  2BY0 A;  3CUQ C;  4L5J A;  4XKW A;  3B6A A;  5F1R A;  3DLA A;  5KVR A;  1KQ9 A;  6PAX A;  3K10 A;  1XGM A;  1XMA A;  3BR2 A;  2E2I J;  5DCM B;  3GBG A;  5D5U B;  1QBJ A;  2LRD A;  1FMW A;  2QZ8 A;  3EUH C;  1SD6 A;  1RIO H;  3I59 B;  1K6Y A;  3WE2 A;  4PGG A;  4RLF A;  1FC3 A;  1U9O A;  4EAT A;  1IN5 A;  4AVP A;  4G9Y A;  2QQB A;  3C7J A;  3CCY A;  3MZ8 A;  1ZLK A;  1ZR2 A;  1HDP A;  1ZAR A;  4FHT A;  3D5S C;  3ECH A;  1QVU A;  3MKY B;  3HTU A;  1ZHF A;  3H9G A;  3IL2 A;  3EYI A;  2K85 A;  3S32 A;  1QNT A;  4XLC A;  3U21 A;  2V1N A;  2E34 A;  3M3Y J;  3S1R J;  5FLX K;  2XAF A;  3U1D A;  2CH0 A;  1VQ4 I;  2E71 A;  3OR2 C;  5F04 A;  1Z0X A;  1X58 A;  3FMQ A;  3OSG A;  5K7H A;  3OYN A;  2KDZ A;  4U88 A;  3RJP A;  3WE3 A;  5F64 A;  1FOK A;  3CCE I;  3M1C A;  4XSZ F;  4F52 A;  2JA5 J;  2LKP A;  2W25 A;  3N05 A;  3L7W A;  2HGC A;  4OIR F;  2DXI A;  5D8L B;  2YS9 A;  3KPH A;  2WB1 N;  1HQC A;  2VKD A;  3MKZ A;  3BDD A;  3I71 A;  4JK1 X;  3BR0 A;  5DUI A;  3J7Z I;  1I27 A;  3G71 I;  1AKH B;  4P55 A;  1WHU A;  1MD0 A;  4ITV A;  1F5T A;  2R7Z J;  4CIC A;  4M9X A;  1X2N A;  1K4T A;  3B73 A;  3TP3 A;  4BHC A;  2FF4 A;  3IKV A;  2HYJ A;  3HRM A;  2K9Q A;  4XMY A;  4XRF A;  5J47 A;  5ILU A;  2XKP A;  3ONQ A;  4AYB N;  3TO7 A;  4IRH A;  2X4H A;  1G3S A;  1SAU A;  1FWZ A;  4ENJ A;  3IAS 2;  1Z7L A;  4EQQ A;  4BY1 J;  3A0B C;  2Y69 H;  3BJ6 A;  2KL4 A;  2VQG A;  1QQI A;  1RKT A;  2O8X A;  1UJ8 A;  1PVE A;  3BG5 A;  3BCB A;  3FZV A;  3CDL A;  4NB5 A;  2FQ4 A;  3FXU A;  1JHF A;  1B8I B;  1E3H A;  4XQF A;  4CUG A;  5J1Y A;  2WTE A;  3JTG A;  2BE5 F;  3N97 A;  4AM3 A;  1YX3 A;  3BG3 A;  4C9Y A;  1UZC A;  3FMR A;  3QOD A;  3CCM I;  1G59 A;  2ME6 A;  3LQR A;  2EBI A;  2ZME A;  4KT5 C;  2BEO A;  2LF8 A;  3RKQ A;  2BY1 A;  1F1Z A;  1O3Q A;  2Y30 A;  3U1K A;  3WHC A;  1TW2 A;  2ME0 A;  3OOU A;  5C44 J;  4O3M A;  1AKH A;  1USS A;  3VWB A;  2LNB A;  4IEJ A;  4IVN A;  5HDK A;  2HOT A;  4HF1 A;  4FAS D;  4KJZ A;  1SVO A;  1PYV A;  1PDN C;  2H09 A;  3NWT A;  1K78 B;  1NTC A;  2KIF A;  1FX7 A;  3HUG B;  4HZF A;  4B8X A;  3F72 A;  4HA8 A;  3UKG A;  4MLO A;  2X6X A;  4B3A A;  2P6T A;  4PSW A;  2DMN A;  3OYC A;  3DBR B;  1PUF B;  1AHD P;  2JQ7 A;  1HW5 A;  2ZXJ A;  1WJF A;  2WAE A;  3S8P A;  2FX0 A;  1LFP A;  2E1N A;  5ILS A;  3S17 J;  2R3S A;  3KP6 A;  3BTI A;  2BHZ A;  2DN0 A;  2IGO A;  4KN4 X;  1NK3 P;  2KRH A;  3BC8 A;  1SMY F;  3QAH A;  3WU1 B;  2E5N A;  1Z6R A;  1V3F A;  3V4G A;  1J75 A;  4A0X A;  2FNA A;  4OU0 A;  3C2H A;  2KZG A;  3HOX J;  2K02 A;  3JAM Z;  1YS7 A;  3HOT A;  2R7X A;  2BV6 A;  1FBU A;  2JRT A;  3SZT A;  4YFX F;  1S9H A;  2TDX A;  2R7W A;  1J9I A;  2MH9 A;  2CS3 A;  1OFC X;  2LY9 A;  3G1L A;  1DGW Y;  1XSD A;  2QEN A;  2L5Q A;  5CVI A;  2ETH A;  2WY7 Q;  3SHF A;  4XIC A;  3K4B A;  2XGC A;  4HNU A;  1TNT A;  2GOX B;  1DGR M;  3GZN B;  2DA2 A;  4PDK A;  1TC3 C;  1K78 A;  3J80 Z;  4ZZL A;  4EJT A;  2MW8 A;  3I56 I;  4E7I A;  1OCP A;  2HQA A;  4GYG A;  1TT0 A;  2VQL A;  4KN7 X;  1WFX A;  5EF6 A;  4IHX A;  2MH2 A;  2JRM A;  3CJT B;  2LTP A;  1KU2 A;  2YPR A;  3DKX A;  4HLY A;  3HB9 A;  4UUT A;  3FIW A;  2K4J A;  2L7F P;  3OYM A;  4MTD A;  4CHU A;  3A4C A;  1F43 A;  1UMQ A;  1Z67 A;  3QP6 A;  2W48 A;  4BQO A;  2IXS A;  1WWX A;  2A3S A;  5H20 A;  1RR7 A;  2CW8 A;  3RIR A;  3I4P A;  1WH5 A;  2X1C A;  4PGH A;  4A6E A;  4YIR X;  3ZN1 A;  2P81 A;  3FXQ A;  2F4M B;  2X6O A;  2GAU A;  3RKX A;  5E17 F;  1N75 A;  1MW7 A;  2Q1Z B;  2DPD A;  3HOW J;  4RGU A;  3HYI A;  1ON1 A;  3LA2 A;  2K9N A;  3AG2 H;  1XCB A;  4Z2Y A;  3RYR A;  2GZW A;  1QPI A;  4OMZ A;  4WXD A;  2DFF A;  3CF5 F;  4E4H A;  4ZYE A;  1H8A C;  4B4C A;  4MQ9 F;  1LB2 A;  1W1W E;  2WY8 Q;  4KNY A;  2ESN A;  4C2M J;  2Z1D A;  4FE4 A;  4MGR A;  3S93 A;  3COA C;  2WB1 A;  4A3I J;  4E6K G;  3EYY A;  5CKT A;  2L02 A;  4G7O F;  1Z91 A;  4CA0 A;  2HS5 A;  1T08 B;  3PSF A;  2HZT A;  3JRD A;  1T39 A;  1MSF C;  3ABU A;  4XSX F;  1JTX A;  1TLH B;  4BDZ A;  4ESF A;  2OQG A;  1SFX A;  4AYB A;  3G1O A;  1SC7 A;  3CJR B;  4IQ4 A;  1K4S A;  2WA0 A;  1VQK I;  2NVX J;  2H6C A;  1Y8R B;  2CG4 A;  3MZY A;  3VSL A;  4RDU A;  3FKI J;  1D3Y A;  1X3W B;  3M8E A;  4IRG A;  3VYS B;  4DYC A;  1VI0 A;  3K2Z A;  4RAG A;  4M3G A;  2DO7 A;  3C1D A;  2VBY A;  3TP0 A;  3AG3 H;  2UUZ A;  3NWS A;  2VON A;  2BW3 B;  1ZG1 A;  3CC4 I;  3KP7 A;  2EFP A;  5IT9 Z;  5DDG A;  1X1P A;  3JRC A;  5FJ8 J;  4IL6 C;  2CSO A;  1A6Q A;  2HOE A;  5IP6 A;  4BE1 A;  1CF7 A;  4C30 A;  1WH7 A;  4UXN A;  1F4K A;  2XB0 X;  3HOV J;  2WV0 A;  1DPU A;  3TW7 A;  5E18 F;  2QVO A;  3Q9S A;  2VUM J;  4HYE A;  4UV8 A;  1S3J A;  2XGX A;  4H0E A;  3OYE A;  3BTC A;  4QPO A;  1I50 J;  2A68 F;  1YE9 A;  1D0X A;  2XF7 A;  5IY5 H;  2FJ1 A;  2M30 A;  2W57 A;  3FIS A;  4MTE A;  3ZQ7 A;  3ZQF A;  3OL4 A;  4CGZ A;  4B1R A;  1DQU A;  5EJC A;  2XHK A;  1L0O C;  4JYK A;  2HVS A;  2HEO A;  2CV1 A;  1GHC A;  1BJZ A;  1R7J A;  5M5W J;  4LIV A;  2XGE A;  4LB5 A;  2DA1 A;  3HOY J;  2CJJ A;  3ABK H;  4QSH A;  2O0Y A;  5J1R A;  1MMD A;  4EGY A;  1MJ9 A;  4U0Y A;  3F6O A;  2NS8 A;  2M0C A;  3LWF A;  3WTV C;  3RZD J;  4M72 A;  2VXZ A;  2NXN B;  4AWX B;  2R5Z A;  2OZU A;  4DZP A;  5J8F A;  3TQN A;  2R7O A;  5HLT A;  1YJ9 I;  1X1B A;  3S3N A;  4I2O A;  1MKM A;  1XB4 A;  3GTK J;  1BJA A;  4JP0 A;  1SMT A;  2BY3 A;  2QF7 A;  1J09 A;  2W1O A;  3VOE A;  4M6Y A;  2P7V B;  5ERI A;  5M3M J;  4RS8 A;  3DU5 A;  3E1S A;  2Q8K A;  4BXF A;  5JI6 A;  3CJQ B;  1BBY A;  4DNC A;  3DTK A;  1FIP A;  3HBL A;  3SZP A;  1BIA A;  2RNJ A;  1MJB A;  4A3J J;  2B9S A;  1BC8 C;  2DQR A;  4BBS J;  2JA7 J;  3I55 I;  3ABM H;  4RAZ A;  2GXA A;  3I53 A;  2ELJ A;  3MWM A;  3W2W A;  3C2B A;  2OJE D;  2VBW A;  4S04 A;  3PNV A;  4P9F A;  5GAD J;  3K1M A;  3WGI A;  3LA3 A;  2E1M C;  5LFA A;  2Y75 A;  2ELH A;  3QU6 A;  5KAF C;  1UAA A;  1CGP A;  1U9N A;  4I0A A;  2DPU A;  2QLZ A;  1GVD A;  3HOS A;  4GCV A;  2IS2 A;  2W7N A;  2FNP A;  2DCE A;  1XX5 A;  2FU4 A;  3QU3 A;  2NAZ A;  5KK1 A;  4BGD A;  2DMU A;  2YUS A;  3F0C A;  4A2U A;  4DIQ A;  2W24 A;  4HW0 A;  2I5U A;  1EKE A;  4BQN A;  1FTZ A;  2X85 A;  2HTJ A;  2JWT A;  4RBO A;  3U2R A;  1IXS B;  2V6C A;  4M3E A;  3RZO J;  2JVG A;  2DT5 A;  3OIO A;  3T8R A;  3PO3 J;  2DBB A;  2H94 A;  3C18 A;  2KHM A;  4EJU A;  5EGO A;  4NQW B;  2VKH A;  2WAF A;  3K6G A;  2ZNY A;  2ICW G;  2DTZ A;  2F4O B;  3HM5 A;  1B6A A;  1JUM A;  5FRO A;  3WOD F;  1ACI A;  3BLY A;  1OQY A;  4LIU A;  5A2Q Z;  4CSW A;  3TOB A;  1Y56 A;  1WRJ A;  1BM9 A;  2NNY A;  2F48 A;  1YX5 A;  2X9D A;  4XOR A;  2IT0 A;  2QSH X;  2VE8 A;  2W4S A;  3BOQ A;  2DLL A;  2Y0M A;  1ZTR A;  1I6H J;  1RES A;  3GFM A;  2CGP A;  3KYD B;  4U7B A;  4M71 A;  1VQP I;  5F1J A;  1T0F A;  4ON0 A;  3CES A;  2A5Y B;  4BE2 A;  5EG0 B;  5L3D A;  2RVC A;  2DT6 A;  1I3A A;  4BEH A;  4XN0 A;  1ETO A;  4CYC B;  1ULY A;  1JXS A;  2OA4 A;  2NVT J;  3OYJ A;  3O3K A;  3MN2 A;  4A5M A;  2QGU A;  2QUF A;  4RM3 A;  2X6W A;  4KIS A;  2Q2E B;  1ZH5 A;  1VQM I;  2DOA A;  5GPA A;  2JVH A;  4A0Y A;  3GCM A;  4KMF A;  1BW6 A;  5HS9 A;  2VPR A;  1I1G A;  5LLQ A;  2EIL H;  2KP6 A;  5L3E A;  2RNG A;  1KU3 A;  2D2W A;  1ZK8 A;  4A5N A;  4J01 A;  3CLO A;  4WF2 A;  3BY6 A;  1IW7 F;  4Y7N J;  5F0C A;  1BW5 A;  4EMS A;  1FPQ A;  3BP8 A;  2LK2 A;  3DFG A;  5IPA A;  4F93 B;  3J7A O;  1HLV A;  3IH2 A;  2W84 A;  2O6G E;  2O9L A;  3FK6 A;  4ENK A;  3AG1 H;  4HV6 A;  3OS1 A;  1YYV A;  3V8L A;  1CQT A;  1SVM A;  2AHQ A;  1DU6 A;  5B66 C;  3ROU A;  2LVS A;  1B59 A;  2L0K A;  3ABL H;  4LMY A;  3S3M A;  1MBH A;  3D1N I;  4YFN F;  2LFB A;  1S8N A;  2CV2 A;  2FRH A;  1R23 A;  3EDP A;  2VB6 A;  2H1L A;  4CYC A;  4WXH A;  1BC7 C;  3BZK A;  2TRT A;  4ZDP A;  2YSR A;  3IH4 A;  3VFZ A;  1N77 A;  4HV5 A;  3ZQI A;  5LEK A;  1Y0N A;  2Q2E A;  3HG9 A;  3ERE D;  4DYQ A;  3E5U A;  3JAM K;  1B1B A;  3J7Y J;  2A6E F;  4YRV A;  4II3 A;  3ZCO A;  1FIA A;  2F5D A;  1X3U A;  3F3X A;  2LSO A;  4GDF A;  3JRB A;  2F5V A;  2ZKZ A;  1UG0 A;  2IBD A;  1QVT A;  4QIW N;  1Z7U A;  1JKP C;  3H5R A;  1XSX A;  4E7S A;  3LSI A;  3G3Z A;  3QPL A;  2YX7 A;  2V6E A;  3E5Q A;  3HEF A;  4LLG F;  4U87 A;  3F23 A;  1BR2 A;  4KDP A;  2M87 A;  5CVR A;  4HPQ A;  3K70 D;  3GLX A;  4CZC A;  3MZH A;  1ITY A;  3HKZ N;  4KT6 A;  5HDG A;  5L3G A;  1IUF A;  4R79 A;  3J80 K;  3SDG A;  1D8K A;  2DA6 A;  2J5P A;  2GWR A;  2Y2Z A;  2H8W A;  5CQG A;  1H9G A;  2NOJ B;  5HLH A;  3K4C A;  2OF7 A;  4JX4 A;  1HOM A;  3RI4 A;  3CMY A;  2P0W A;  1NG6 A;  1LE8 B;  1WJE A;  4BAC A;  4A3C J;  3OWT A;  4BQA A;  5EEG A;  4A3F J;  2ESH A;  1O4X A;  3PO2 J;  3MKL A;  1IRZ A;  5H2F C;  1RKW A;  2XRN A;  3Q0V A;  2ISY A;  5BOX A;  5ICE A;  1UFM A;  2OD5 A;  1XDS A;  1TTY A;  3H5N A;  3S2D J;  1LEB A;  2FQ3 A;  3CCJ I;  4A12 A;  1FYM A;  1ETX A;  4ZYD A;  4IQJ A;  1OR7 C;  2HZD A;  3R6S A;  3HC7 A;  1S5L C;  2MAB A;  4CO8 A;  3RCO A;  5HLI A;  2E2H J;  2PX9 A;  1EH6 A;  3OMY A;  4EVI A;  2MYS A;  3RSN A;  3BCA A;  1OCC H;  2A6H F;  4Y13 A;  3PFI A;  1G3T A;  2YU9 J;  5F0H A;  3CUQ A;  1T8I A;  1SFU A;  4A93 J;  1U78 A;  4Z6Y A;  2CFX A;  2Z99 A;  1P4X A;  4XL9 A;  2K9L A;  4HDV A;  3M8F A;  1U8B A;  1FP1 D;  5BS6 A;  3BT9 A;  3O8G A;  1GXQ A;  2FE3 A;  3HRT A;  4G8X A;  3UNG C;  2OAZ A;  3S2H J;  4II2 A;  1ZRF A;  3I3L A;  2FEZ A;  3OYI A;  2R7R A;  1YRN B;  3RTR A;  2P5L C;  3EUH A;  3WGH A;  3EQL F;  1LE8 A;  4F3Q A;  2Y0S N;  3LSP A;  1PJR A;  4M74 A;  1J0R A;  3ZN0 A;  3WG9 A;  2BVL A;  5IYD J;  2HQR A;  4PJJ A;  1Z77 A;  1SAN A;  3JSO A;  4HQM A;  1BR1 A;  1BI1 A;  1RRJ A;  2R7U A;  1NK2 P;  3KCC A;  2HQN A;  2JA6 J;  2XAU A;  3H3U A;  2LH9 A;  1MBF A;  4A3G J;  1NHA A;  1N25 A;  3OYA A;  4UVC A;  2RQQ A;  3FXO A;  5E1W A;  3GFL A;  3RKW A;  1TWG J;  2L3D A;  2PEX A;  4HST A;  4XNF A;  3RQI A;  2ZCW A;  1K79 A;  1XG1 A;  1QA6 A;  2IPQ X;  2L2O A;  3S15 J;  1HKQ A;  4A6D A;  4LK1 F;  5FD5 A;  2IA0 A;  5LHG A;  3R0J A;  2VOP A;  2E1O A;  2N8G A;  4IJA A;  5KHD A;  2B0L A;  2OTL I;  5FKL A;  1IN8 A;  4OOI A;  2B63 J;  3H36 A;  1T95 A;  5IT9 K;  2DK5 A;  2PJP A;  5K7F A;  4NC8 A;  1Y39 A;  5CLS A;  3LAJ A;  4NC6 A;  3KEY A;  5K5R A;  3JR9 A;  3JW4 A;  4HNT A;  5FO5 A;  4XKC A;  1YRN A;  1G6N A;  1M1E B;  4BBR J;  2ZME B;  4EM1 A;  5HOO A;  3W3C A;  1Y1V J;  2OTJ I;  5J1U A;  1D1B A;  2LRE A;  5M5X J;  1XGN A;  3I58 A;  4E70 A;  3C2G A;  1ZLJ A;  3RPU A;  4IHY A;  1B9M A;  2XAQ A;  2IS4 A;  3IP4 B;  2M7A A;  4C2U A;  2TCT A;  1JGG A;  1X4O A;  1FMV A;  3REO A;  1O3R A;  4Q48 A;  2LBF B;  2QA4 I;  3P9I A;  4XLF A;  2PN6 A;  3A03 A;  4MO7 A;  3E97 A;  5D5V B;  2E5Z A;  5FKK A;  3SYT A;  5EZH A;  2WWY A;  3OS0 A;  4BNC A;  4CYD A;  2HU9 A;  2QM3 A;  4X0G A;  3FBI B;  5BPI A;  1EH8 A;  1ZKG A;  3CME I;  3K70 C;  2EIJ H;  4B09 A;  1A35 A;  5FRM A;  3Q5F A;  4E7K A;  5FRN A;  2L9V A;  2Y31 A;  1VQ5 I;  4CXF A;  1W7P B;  1IO2 A;  2VT3 A;  4XOT A;  1YIJ I;  4I0B A;  3GXO A;  4HOB A;  4DQ2 A;  1D5V A;  5J4Y A;  3PFY A;  1XMK A;  1D5Y A;  3AL0 B;  4HLX A;  3CCL I;  3WHB A;  4A3B J;  1GVJ A;  2CQQ A;  2GA2 A;  1MIJ A;  1R1V A;  4O5V A;  2GA1 A;  1OCT C;  4BL0 B;  3HSE A;  2P7C B;  2Z5U A;  3H0G J;  5H6R A;  3LOC A;  3T5X A;  2K3F A;  3HKZ A;  2IJL A;  5LEJ A;  2XUB A;  2RC4 A;  3ECO A;  3I9V 2;  1MH3 A;  2LBF A;  4CCL A;  4UV9 A;  3BPX A;  2AQE A;  3S2W A;  4LLN A;  2VJI A;  1U0J A;  4A69 C;  2XIG A;  1HW2 A;  1DP7 P;  2EB7 A;  3FDY A;  3CD6 I;  3OYK A;  2P4W A;  4PUS A;  4XLN F;  2FBH A;  4QPQ A;  1MMS A;  5FD6 A;  2OPT A;  2F5F A;  4YEL A;  3CCV I;  1YIT I;  1B9N A;  3GWZ A;  4IOC F;  1BR4 A;  1T33 A;  2JA2 A;  1W7P A;  4M3D A;  4E7H A;  1AU7 A;  2PMZ N;  2NS0 A;  2B7E A;  3O6B B;  2K3P A;  2O5R A;  1YW9 A;  4RLQ A;  3K2A A;  5GTH C;  2NNN A;  4LIT A;  3M9A A;  2F5E A;  4C3I J;  1JUS A;  4MHG A;  1X1C A;  4W97 A;  2WAQ N;  1JT0 A;  1MMG A;  3FM3 A;  2HNH A;  1DU0 A;  1J2X A;  1U2W A;  2GXG A;  2HI3 A;  3EET A;  5D4S A;  2EJR A;  3MVP A;  5A2Q K;  1ETV A;  4QTR A;  3N4M A;  5E8I A;  3GO5 A;  4L5E A;  1XMX A;  2VAS A;  5JHU A;  1GV2 A;  4C2T A;  1ETY A;  2KIQ A;  1IXR C;  5ICG A;  2ADU A;  2DFE A;  3PQK A;  5CVV A;  4KFC A;  1STZ A;  5GAE J;  4A3D J;  4IHT A;  3GLL A;  1V55 H;  3G1M A;  3HSF A;  3ML6 A;  4KIT B;  4IXA A;  1BIB A;  2C6Y A;  4WCG A;  2Y0S A;  1N78 A;  3DPL C;  3L1P A;  2GBY A;  2VLA A;  2R7S A;  3CCQ I;  1F36 A;  3ABT A;  3PJR A;  2FOK A;  5TRD A;  3K4J A;  3KP3 A;  3PQJ A;  5EYR A;  2JSC A;  3GFJ A;  2IS1 A;  2ELK A;  2XAG A;  3LSG A;  3BR5 A;  2O03 A;  2AQF A;  2P8T A;  1OLT A;  2XPU A;  5FKM A;  5BNG A;  4DBR A;  2E7X A;  4UVA A;  1K83 J;  2CQK A;  4BH9 A;  2XC7 A;  4FX0 A;  4B48 A;  4CDG A;  1IF1 A;  2XAS A;  3IWF A;  4E7Z A;  2COM A;  2EIM H;  1V5F A;  4X6A J;  5C4X J;  4OWR B;  1OKR A;  3HZJ A;  1VQ8 I;  2P5V A;  2L4A A;  3CO6 C;  1VQ7 I;  1KZH A;  3L2V A;  1FOX A;  1IN6 A;  2KJC A;  1U5T C;  2JUC A;  2KT0 A;  1MND A;  5E3O A;  1YFH A;  4M9Z A;  2CQN A;  5F0F A;  4NHJ A;  4V19 K;  1QHG A;  1QO0 D;  3IUO A;  4L9V A;  4BXU A;  2O3F A;  3ESW B;  3LL7 A;  2PI0 A;  4NNJ A;  1LDK B;  5F6F A;  1WSU A;  5K7Z A;  3S1N J;  1P4A A;  1OYY A;  3H3Z A;  1EF4 A;  1CF7 B;  4HSR A;  2EIN H;  4XLP F;  3TDZ C;  3OYD A;  4CZZ A;  1WJA A;  3CDH A;  3QQA A;  4U0W A;  2ZJQ F;  4Q4Z F;  3T8T A;  3DPT A;  1YW7 A;  3KP2 A;  3ISP A;  2L9R A;  3HXL A;  3VB2 A;  5JLX A;  1FBS A;  2HWV A;  4L9N A;  4ASN A;  1VQ6 I;  1RPW A;  3VYU B;  1MBJ A;  3AAF A;  5DUK A;  1R58 A;  4NC7 A;  3KET A;  1ETK A;  2DA5 A;  1FTT A;  2KMU A;  2VBX A;  2PJR B;  2E60 A;  3QOP A;  5DM7 F;  4DJA A;  3S1M J;  2EV0 A;  5EEA A;  2VC1 A;  1KQ0 A;  3JTH A;  3OYG A;  3MCZ A;  3SJM A;  4ZJZ A;  2Z33 A;  1R22 A;  1WZ2 A;  4I01 A;  1VQO I;  1R5H A;  1E3O C;  1YO5 C;  2R5Z B;  1ZQ3 P;  2QBY A;  3FXJ A;  1BN5 A;  1BI3 A;  2PQ8 A;  2M7B A;  2VC0 A;  5FKN A;  1PP7 U;  1POG A;  2HQ5 A;  5KCM A;  3HTS B;  4B47 A;  5GP9 A;  2ECC A;  1QRY A;  2PMU A;  3TBI A;  2CV0 A;  2JZY A;  4RMN A;  1V4R A;  3F8N A;  4I09 A;  1JKQ C;  1Q1H A;  1Z3X A;  4F7Z A;  5M5Y J;  3I4M J;  4G6Q A;  2EZI A;  3J81 Z;  3NEU A;  1YTY A;  3H92 A;  1F9N A;  5KAI C;  1BA5 A;  4ZZD A;  1RI7 A;  3ULQ B;  4BY7 J;  2ZO4 A;  4XBF A;  5J3L A;  2MGQ A;  4HBL A;  3PIO F;  4FE7 A;  5ICC A;  5B5E C;  4JBA A;  5TJJ A;  2H8R A;  4IHV A;  3ZP5 A;  1A6I A;  3KIO A;  3LAP A;  4P9U A;  3OSF A;  1RUO A;  1FLI A;  2RKH A;  1LKX A;  3HRU A;  3WU2 C;  2JUG A;  4OMY A;  1YI2 I;  2FD5 A;  1WPK A;  5FKO A;  1TQI A;  1TW3 A;  3TED A;  5E20 A;  2W82 A;  2PJR A;  2QKM B;  3LQQ A;  1UB9 A;  1ZRC A;  2DOF A;  2CUZ A;  2JPB A;  2PLY A;  3DKY A;  2R7D A;  4BHP A;  5IOZ A;  2PMZ A;  1VTN C;  2JPC A;  3GEZ A;  4RM2 A;  3IAM 2;  2CUJ A;  3S14 J;  2QKL B;  2MLK A;  3AKZ A;  1A36 A;  4L9J A;  4PJM A;  2V1U A;  4E7J A;  1OJL A;  1ETQ A;  4OIN F;  2VJJ A;  4XLA A;  1VFC A;  2WAQ A;  3IRR A;  2FUG 2;  1V54 H;  4N0B A;  1NG7 A;  4XLH A;  1KYZ A;  3HDD A;  3LNQ A;  3KE2 A;  3G2B A;  5GTI C;  5EGO B;  4I99 C;  2JSP A;  3GTQ J;  2ZC2 A;  4JX6 A;  1TBX A;  3S16 J;  4O6J A;  4RB0 A;  4LG0 B;  1UHW A;  4ENN A;  1YW8 A;  2LP0 A;  2XPW A;  2UZK A;  2CWE A;  1U6G A;  3H9J A;  3CF2 A;  4FCY A;  2E2J J;  1H0M A;  1MZB A;  2XF5 A;  3D0S A;  2STT A;  3A0H C;  3PL8 A;  3E6B A;  4MEY F;  4PFP A;  2XAH A;  4DZJ A;  3LFU A;  3K4K A;  4BEH B;  3I0T A;  4HX7 A;  5EZG A;  2JN6 A;  1J5Y A;  1LFU P;  2WC2 A;  3TDU C;  2EPF A;  4LD5 A;  2ZBK A;  2VE9 A;  1L3L A;  2DJN A;  2XF6 A;  2X51 A;  2FBI A;  1ZG3 A;  1OPC A;  5D8K B;  3ZOB A;  4XRM A;  2LMD A;  3F6V A;  3WGG A;  2E7W A;  5DS9 A;  3ZQC A;  1H9T A;  3HGG A;  3P9C A;  5D6F A;  3MQ0 A;  1B4A A;  2EIK H;  2PFB A;  3DQV C;  2R7V A;  4L0Z B;  4F92 B;  3VPR A;  5BMZ A;  4LG0 A;  2ID6 A;  2ACJ A;  4PZJ A;  1HSJ A;  3MEX A;  4FQG A;  3DEU A;  3CP2 A;  5TIS C;  4B3X A;  2K40 A;  3DEE A;  2JK3 A;  1Q1V A;  1BI2 A;  4EM2 A;  4XKV A;  2QYO A;  5HS7 A;  2WV1 A;  2LD5 A;  1IRG A;  5ILV A;  3V8J A;  3IWZ A;  3ZMD A;  4S0H B;  2W00 A;  5DM6 F;  3TO9 A;  2GIV A;  5JVT A;  2ZSI B;  1FOY A;  2HXI A;  2K5C A;  3QYB A;  4V2F A;  2Y9Y A;  1QHH D;  2DA7 A;  3W2A A;  2E36 A;  3ZQL A;  2Y9Z A;  4CH7 A;  1KYW A;  1LUJ B;  3CCR I;  3GTP J;  2RN7 A;  3QYF A;  3I5U A;  4KUM A;  2DA3 A;  3ZMZ A;  4TV7 A;  5DCF A;  4DYR A;  3SEZ A;  3TL4 X;  4F91 B;  5LHI A;  2K4B A;  3FXR A;  1B72 A;  3V7S A;  2ZB9 A;  3TMO A;  3QWL A;  4L9T A;  1R00 A;  2ZFU A;  3EUK L;  4NBQ A;  1KON A;  4IPA A;  2QQA A;  1G2H A;  5C4J J;  3ZMS A;  1Z21 A;  2HKX A;  2LDU A;  5AIQ A;  3H0D A;  1T56 A;  3R61 A;  4AIK A;  1GLN A;  1OMI A;  4ZC3 A;  3Q9V A;  4DW6 A;  3R4K A;  5K1Y A;  5IYC J;  3KX2 A;  2GIZ A;  1O3T A;  3QPT A;  1C0W A;  1Y8Q B;  2KRC A;  3F21 A;  1ZR4 A;  2VJ5 A;  3HGY A;  2STW A;  4BXX J;  2IAI A;  5ICF A;  1HKT A;  1X2M A;  4BUP A;  3BQZ A;  2DK8 A;  2HFH A;  4U0V A;  1O3S A;  4KMU X;  2NVU B;  4MEX F;  3DBH B;  2KQR A;  4ZTF A;  2LKS A;  1I39 A;  2G7H A;  3QRF F;  1OYW A;  1D8J A;  2DQL A;  2QEX I;  3GYH X;  2WAD A;  3DV8 A;  1E17 A;  3L2W A;  3E7L A;  1RUN A;  1G8X A;  3W6K B;  1G4D A;  5CQE A;  1IC8 A;  4PCQ A;  4KIC A;  1G3W A;  3OOP A;  2GM4 A;  3WTX C;  5DD4 A;  2A61 A;  2XSD C;  1GXP A;  2EZK A;  3JRH A;  3L00 A;  1RZ4 A;  2F6C A;  2KIS A;  2BGC A;  1FNN A;  3KLO A;  2NS7 A;  2LF7 A;  2R5Y A;  3WU0 A;  4BDY A;  5DTD A;  3ZR8 X;  3FKJ A;  2ZJR F;  3RPQ A;  3AG4 H;  4BJ6 C;  2BVM A;  2JMW A;  2NVY J;  3CUQ B;  2DOE A;  1ERD A;  2K9S A;  2GXB A;  3M7G A;  4MIM A;  4JOM A;  2OCC H;  2RRE A;  4N4O B;  4P1W A;  4UB6 C;  2G0E A;  2V79 A;  4RA2 A;  3V8K A;  4EJV A;  4IZZ A;  4BQQ A;  4EEF G;  1AOY A;  2V9V A;  3OYH A;  3E6M A;  4WK8 F;  1H89 C;  4N9H A;  4HAM A;  3L2C A;  3CC7 I;  1DPR A;  3RPU D;  2R7Q A;  1LDJ A;  3OY9 A;  1IN7 A;  4BE0 A;  2A6T A;  4Y33 A;  1K61 A;  4CCN A;  4DOZ A;  2L7K A;  3SDB A;  2HOA A;  1TP4 A;  5FFZ A;  1J7K A;  2P6S A;  1W5T A;  1YS6 A;  4MNU A;  3VDX A;  1WVR A;  4LGW A;  5JLW A;  4ZYH A;  1MDM A;  1OR7 A;  3ZMV A;  3PSI A;  1QZZ A;  4ZYA A;  1QZE A;  2E35 A;  1YG2 A;  2EA2 A;  3OR1 C;  1IGN A;  1O7L A;  3CCU I;  4IF4 A;  3BPV A;  4HF0 A;  1SFO J;  2JA8 J;  2DDA A;  1LQ1 A;  2MC3 A;  3ZRG A;  1K7A A;  1S7E A;  3E3V A;  2M1B A;  2ZJ2 A;  1XN7 A;  4G7H F;  4Y52 J;  2ZFW A;  1Z9C A;  1IG7 A;  4KYW A;  2VKE A;  1X4P A;  5K5Q A;  1S7O A;  1WJC A;  2IW5 A;  1ON2 A;  1SFE A;  3K1N A;  5J4V A;  4QWQ A;  3JRI A;  3P7N A;  4IRI A;  2DYR H;  2V9K A;  1LVA A;  4PFO A;  2VKV A;  1AA7 A;  2MA3 A;  2JT1 A;  1YJN I;  4W1U A;  2M4G A;  3A2K A;  2RGV A;  1HBX G;  2KPM A;  3DEW A;  1RC9 A;  3HJE A;  3ZMU A;  4S05 A;  1S6L A;  4EM0 B;  4BYY A;  1ZRD A;  4R1H A;  2HDD A;  5D5X B;  1ZAO A;  1R1U A;  1VQ9 I;  1T98 A;  4MQV A;  2VQC A;  1MBE A;  3G4S I;  1JGS A;  3CZ6 A;  2HDW A;  4B43 A;  4LOC A;  3IV5 A;  4J00 A;  4GFB A;  4WX9 A;  3JCU C;  2MC4 A;  1HC8 A;  1TT5 B;  1ZGW A;  4I02 A;  2M34 A;  1XSV A;  1SD5 A;  4Y3O A;  2XPV A;  2D5V A;  2V1X A;  4UUS B;  1SEU A;  1W7P D;  2H1K A;  5D4R A;  2EZH A;  2IVM A;  1EV7 A;  2V9P A;  3LFK A;  3CUO A;  4YEJ A;  1KQ8 A;  2IRF G;  5CPR B;  3GTG J;  4OIP F;  2DOD A;  1Z6T A;  1T6S A;  1QGP A;  3BG9 A;  2DDB A;  4L5I A;  2O61 A;  2HXO A;  3CTA A;  2L54 A;  2EV6 A;  3HL2 A;  2G7U A;  2H27 A;  4XRS G;  2FMY A;  2LC2 A;  1Y0U A;  3RKY A;  4AUX A;  3TOA A;  2M9H A;  1HKS A;  4RGX A;  2DA4 A;  2EZL A;  4DGW B;  2O7O A;  4YIF A;  3J81 K;  3M07 A;  4V2G A;  2JTV A;  2DJI A;  2ZJP F;  3M4O J;  4QLC U;  4GO1 A;  3EUA A;  1MBK A;  1TWC J;  5BPD A;  2PMH A;  1APL C;  1UHM A;  4LK0 F;  2DMP A;  3E5X A;  2QSG X;  3SXY A;  4OIO F;  3K69 A;  5JVG F;  3ELK A;  5FFX A;  2V4J C;  1O57 A;  1R5I D;  4EJW A;  1ZG5 A;  4G12 A;  1AWC A;  4ZTJ A;  2AO9 A;  2EFO A;  4ETS A;  1FJL A;  5M3F J;  1KU7 A;  4L0Y B;  4CCM A;  1P6R A;  4PJN A;  4A3K J;  1FP2 A;  2QQ9 A;  3PNY A;  4HF2 A;  3HSR A;  2MFZ A;  2M8G X;  3DKW A;  4H4K C;  3W6J B;  4AIH A;  5HLG A;  2NYX A;  5JR3 A;  3BR3 A;  1XGO A;  4UUS A;  1P7J A;  1GUU A;  1X3Z B;  4RB3 C;  2M5W A;  4GXO A;  2MG4 A;  5DCM A;  4BJ5 C;  4BJT A;  3ASO H;  5E1X A;  1MNE A;  3GFI A;  1QPM A;  4RGR A;  3L2U A;  3V42 A;  3W2V A;  2M8E A;  2OCE A;  3I59 A;  4PK4 A;  4WWC A;  3HOU J;  3VSK A;  2R93 J;  1A5J A;  2DT7 B;  1RNL A;  1WCM J;  1ZEL A;  5J8C A;  1ZRE A;  3ZPL A;  3RYP A;  3PNT A;  3Q0U A;  3J7A Y;  2X48 A;  3JRG A;  3GTJ J;  3CC2 I;  3GZ6 A;  2HPI A;  4I6Z A;  3OYL A;  1HCR A;  5CJ9 A;  2LKX A;  1TNS A;  1H88 C;  2EWN A;  1HXD A;  4M9S A;  2V26 A;  2ZSH B;  2XRO A;  3ASN H;  3DXJ F;  1R49 A;  1REP C;  2CW0 F;  4OAZ A;  4ENM A;  2XSJ C;  2J5O A;  4P5O A;  4R8H A;  9ANT A;  2XB5 A;  3DWL E;  3UR3 C;  4IX7 A;  1VQN I;  3K4M A;  4N9I A;  5JFR A;  5CVJ A;  5LRR A;  1O7F A;  4I7H A;  2EFQ A;  2DMQ A;  2Q0O A;  1VQL I;  3LSH A;  3BG7 A;  3U9G A;  1FYK A;  2R7T A;  4HNV A;  4Q47 A;  2EQR A;  1UG2 A;  3O8H A;  4LJZ F;  2CQX A;  2PBI A;  5HS8 A;  2ZME C;  1A04 A;  3DPU A;  1LNW A;  3CQZ J;  4LG3 A;  3SEQ A;  1WQ2 A;  2F5C A;  1HW1 A;  4D7N A;  3FHN A;  2I8D A;  3K4N A;  1UST A;  2QSF X;  3DCF A;  3H9Q A;  3T1B A;  1U5T B;  2M45 A;  1JT6 A;  3OYB A;  3I64 A;  3OL3 A;  2Z3Y A;  3HPH A;  2R0Q C;  1LFB A;  3LSK A;  3QP5 A;  3K4L A;  2E1C A;  3MAJ A;  2UXX A;  2P5K A;  3OV8 A;  3V7C A;  3V7R A;  4UVB A;  1TZL A;  1HF0 A;  2JJ7 A;  4M73 A;  1B8I A;  3KEQ A;  2IGN A;  1YJW I;  2NRA C;  3RDI A;  2QCO A;  5FGM A;  4IOA F;  2LY1 A;  3KEO A;  3OIQ A;  3F8M A;  1E0E A;  3K0L A;  1FZP B;  1XD7 A;  2CMP A;  3AFH A;  4M3F A;  3SFZ A;  4U7D A;  1JJ8 C;  5LGU A;  1R36 A;  5AON A;  1JHH A;  2ZXH A;  3S3O A;  3CJN A;  1YLF A;  3DF8 A;  4F55 A;  4PSX A;  1FY7 A;  3CO7 C;  1YHQ I;  2OC6 A;  2BBY A;  1HA8 A;  3AL0 C;  4GYI A;  2VI6 A;  1FT9 A;  4AIJ A;  1W0U A;  2WBM A;  1GT0 C;  2M4K A;  2FML A;  3KZY A;  1EJ9 A;  3BR1 A;  1IUY A;  2KDO A;  4C3J J;  1HST A;  2XRL A;  2X1E A;  2FOW A;  3PUB A;  5E3M A;  3KYL A;  5H6Q A;  2MD5 A;  1ETW A;  1UEL B;  3HUG A;  3GF2 A;  4YII A;  2OQR A;  1U5T A;  1QZY A;  2CQ7 A;  3NAR A;  5DYM A;  4P96 A;  5IYB J;  3G6E I;  4EGZ A;  4FTH A;  1PUF A;  1IJW C;  1IV6 A;  3IKT A;  1W5C C;  3BZC A;  2H6B A;  2MD0 A;  2VL8 A;  3QYE A;  1W5S A;  2L01 A;  3R60 A;  4DBQ A;  1TL8 A;  2NOG A;  1TWH J;  2DFI A;  1BL0 A;  5B1B H;  1I3Q J;  1VZ0 A;  5GAH J;  2AXL A;  5IOY A;  1I6X A;  2R7F A;  2FA5 A;  3E6D A;  3MMY B;  4CCO A;  3L9F A;  1BOB A;  3TGN A;  1HDD C;  4D9J A;  2LY2 A;  1VF9 A;  1P9Q C;  3JRA A;  1SD7 A;  2BXZ A;  4AD9 A;  2UWM A;  2QBY B;  3JRF A;  4AVZ A;  3X2Q H;  4PJ0 C;  1TWF J;  4ZH4 F;  3GTO J;  3F8F A;  2XVC A;  4LB6 B;  3ZXS A;  3BJA A;  2Y48 A;  4Y15 A;  2AS5 F;  3LST A;  4D7M A;  1LVK A;  3EPZ A;  1MMN A;  4UB8 C;  3W6V A;  5LGT A;  2VT2 A;  1WGX A;  1ZYR F;  2EA4 A;  4IHW A;  3Q3S A;  3MFK A;  1BOA A;  3H1C A;  2F4I A;  4IO9 F;  4JQF A;  2ZXW H;  2VIX A;  2KIM A;  2GOM A;  3WTY C;  1IAW A;  1TQM A;  1OCR H;  1YIO A;  2HYG D;  4X1E A;  1WJD A;  2A05 A;  4ZDL A;  3KP4 A;  4BHB A;  3Q0W A;  2LG4 A;  3K1P A;  3OYF A;  4FET A;  5HVQ C;  1VND A;  3CLQ A;  2X1D A;  4BS9 A;  1SVL A;  1PUE E;  3O2P E;  4HDU A;  5LGN A;  2KLO A;  1LDD A;  4NDL A;  2EV5 A;  3BZ6 A;  3H5A A;  3BRO A;  3QPS A;  1XGS A;  2BOL A;  1IRX A;  4ABZ A;  3HPG A;  3CCS I;  5GAG J;  5B1A H;  1WI9 A;  2DTR A;  5FB2 A;  3GTL J;  3BTL A;  2M0M A;  2BHY A;  2KRF A;  2A07 F;  1MJA A;  4AC0 A;  2X0L A;  3DLL F;  2E1M B;  2MSY A;  2OBP A;  1IRF A;  1OYI A;  3I54 A;  1U8R A;  3L09 A;  2YR2 A;  2EFN A;  3HHG A;  3BWG A;  1ZGA A;  5DEQ A;  3FXL A;  5IP7 J;  5FLX Z;  2D45 A;  2QQ8 A;  5IP9 J;  3BJO A;  5F08 A;  1FYL A;  1FBQ A;  1XCV A;  4I76 A;  2D1H A;  1MBG A;  4BKX A;  2XGD A;  3SFI A;  1DDN A;  2DAO A;  1Y6I A;  3FM5 A;  4IHS A;  3CDI A;  3MKW B;  1IDY A;  4D1Q A;  3ZQG A;  4KIG A;  2HDC A;  1YOV B;  2RDP A;  1X1D A;  1WJB A;  2VQH A;  3L2Q A;  2VN2 A;  1JTY A;  1LPQ A;  3B6C A;  1GDT A;  1XPX A;  2BY2 A;  2RQP A;  2HYF A;  3KYC B;  4N4N B;  3A1Y A;  1I1S A;  2ZXI A;  4L18 B;  3HOZ J;  2D1V A;  2VXD A;  4HQE A;  3JSP A;  1MH4 A;  4RB1 A;  3SQN A;  3P9K A;  2L7Z A;  1UHS A;  4Q5S F;  2FSW A;  1WJ5 A;  5ED4 A;  1OIS A;  2Z16 A;  1WKM A;  1IDZ A;  2X6Y A;  3H35 A;  2V1D A;  1D1A A;  5LHH A;  3ZQQ A;  4XRS A;  2A69 F;  2HPM A;  2VBZ A;  1IN4 A;  4ESB A;  4XN3 A;  2XKO A;  3ZGK A;  3K7A J;  2BW3 A;  5FLV A;  3BR6 A;  1W36 D;  1FSH A;  4KA4 A;  2IA1 A;  2W85 A;  2BZT A;  2CRG A;  4ZYG A;  2K9M A;  4XM3 A;  3DTI A;  2LOO A;  2CYY A;  5EEH A;  4UNO A;  4G94 A;  1D0Y A;  5K5O A;  1Z3Y A;  2HVR A;  3IRQ A;  3ZMT A;  2HVQ A;  2KZV A;  1EA3 A;  3F9K A;  2IEK A;  1X1A A;  3D5R C;  3NQO A;  1R1T A;  4G6T B;  3F8B A;  4D0P A;  1RET A;  1TWA J;  2XAJ A;  1JI8 A;  2IS6 A;  2M3A A;  2YX4 A;  3FMS A;  3A01 B;  5D6E A;  1R4M B;  1ORK A;  2E19 A;  1R6R A;  5CYV A;  2KKO A;  1W4M A;  4A3E J;  1ODD A;  3VEP A;  1IV8 A;  3GW2 A;  3FBN B;  3QPH A;  2LYC A;  1FSE A;  3GX4 X;  1JE8 A;  1B72 B;  2F2E A;  2M2E A;  3KLN A;  1SFK A;  2CW7 A;  5FLM J;  2DI3 A;  2GQQ A;  4OAY A;  1JKR C;  4UY8 I;  3IHU A;  1P2F A;  3KZI C;  4ZDO A;  5HNF A;  4FX4 A;  2VPL A;  2FXA A;  4UHT A;  1S7A A;  1JJ6 C;  4E7L A;  2A5W A;  2CO5 A;  1S29 A;  2QWW A;  1W0T A;  1UCR A;  5B3S H;  3K9T A;  2DU9 A;  4C3H J;  2RV8 A;  1LEA A;  5DD8 A;  4LLL A;  2OU2 A;  4NUB A;  1P92 A;  1JKO C;  2CU7 A;  3F8C A;  3KP5 A;  3S1Q J;  3PM1 A;  4RAY A;  2LR8 A;  4XOP A;  5HNH A;  2UXN A;  1MNM C;  3WTZ A;  4AID A;  3TKY A;  2EH3 A;  3LSJ A;  2IA2 A;  2FBK A;  2K7L A;  4YFK F;  1KA8 A;  3A01 A;  1XS9 A;  3E6C C;  4EJO A;  3WTW C;  3GME A;  1OCZ H;  1DUX C;  3WTS C;  1IZ1 A;  3QOE A;  2CUF A;  4XID A;  3WTT C;  3VOD A;  2R92 J;  4OIQ F;  1TQP A;  3L2R A;  3G73 A;  3WG7 H;  4XON A;  4HG2 A;  2KJB A;  3FHZ A;  3MD2 A;  4IKF A;  3VYT B;  1T2K A;  3DP7 A;  3CMM A;  2Z2S B;  4YG2 F;  4RB2 C;  3ERM A;  4G6D A;  3DU6 A;  2R5Y B;  1E3P A;  3FXM A;  1PP8 F;  5AIP A;  2IGK A;  5E79 C;  1XTA A;  4Y17 A;  3FWE A;  1T0F C;  5L3F A;  1Y1W J;  3M1E A;  4A0Z A;  2XDV A;  3LSR A;  4J19 A;  3BQY A;  3OIP A;  1Z05 A;  4GGG A;  4HEA 2;  3GZ5 A;  2OV7 A;  2OUM A;  3T0Y A;  5JHF A;  3B02 A;  3R0A A;  1K6O A;  3LMM A;  3M8J A;  3PUF A;  1FEX A;  3HIF A;  4KIB A;  4NQW A;  2VJ4 A;  3IC7 A;  2EK5 A;  2G9W A;  2KFD A;  4ANJ A;  3TO6 A;  4JX5 A;  2K27 A;  1MDM B;  2HTS A;  4XK4 A;  2BXY A;  2UV1 A;  3HHH A;  3RQ4 A;  1RR8 C;  3SZG A;  5LRS A;  2DW4 A;  3FF5 A;  4LFU A;  4AU7 A;  2HOS A;  3GUD A;  3LSM A;  3H3V K;  5F27 A;  3CP8 A;  5GPC A;  3C3W A;  3DTE A;  3LA7 A;  1WI3 A;  1IXC A;  4CCJ A;  3TW6 A;  5EG0 A;  4B44 A;  2COB A;  4Y4R A;  5E1Z B;  4HRI A;  3OS2 A;  2IP2 A;  1YQA A;  1ZN2 A;  2PG4 A;  2L9N A;  1W36 C;  1ZGJ A;  4PJL A;  4I98 B;  3A02 A;  4A3L J;  2CUE A;  3E0J B;  4KIF A;  2ID3 A;  2AXT C;  4K2E A;  2ISZ A;  1D0Z A;  1V5G A;  2GLO A;  3ZQH A;  2MBF A;  1EH7 A;  2R4G A;  2VOD A; 
#chains in the Genus database with same CATH homology
 2ELJ A;  4XKB A;  3W2W A;  4CCK A;  3PNV A;  4GRI A;  1MND A;  4BJ5 C;  4BJT A;  2E1M C;  1MNE A;  1QHG A;  3L2U A;  3IUO A;  3V42 A;  3W2V A;  5LFA A;  4PK4 A;  3LL7 A;  3VSK A;  4NNJ A;  1LDK B;  1UAA A;  3HOS A;  2DT7 B;  2IS2 A;  2W7N A;  2DCE A;  1ZEL A;  5LD2 C;  4BGD A;  3PNT A;  4HSR A;  3J7A Y;  2L9S A;  3BG6 A;  4DIQ A;  5KNL A;  2HPI A;  3OYD A;  2IGM A;  3D5L A;  4BQN A;  1WJA A;  3OYL A;  2X85 A;  3VYR B;  4XR6 A;  1DP3 A;  2V7F A;  3DPT A;  2CFO A;  2JVG A;  3HXL A;  2V26 A;  2ZSH B;  1V5E A;  2KHM A;  4NQW B;  2VKH A;  2XSJ C;  2WAF A;  4OAZ A;  3VYU B;  3K6G A;  4P5O A;  4NC7 A;  1D1C A;  5FRO A;  3UR3 C;  3DWL E;  4IX7 A;  3BLY A;  3K4M A;  4LIU A;  4CSW A;  1Y56 A;  2KMU A;  2PJR B;  2E60 A;  4DJA A;  1YX5 A;  4XOR A;  3LSH A;  3BG7 A;  2W4S A;  2R7T A;  3OYG A;  4ZJZ A;  3DPU A;  1MMA A;  4U7B A;  1X19 A;  4LG3 A;  2M7B A;  3SEQ A;  3CES A;  4BE2 A;  2DT6 A;  5KCM A;  4BEH A;  4XN0 A;  4B47 A;  4BU2 A;  3TBI A;  3OYJ A;  3FHN A;  2I8D A;  3K4N A;  2CV0 A;  3H9Q A;  4RMN A;  4KIS A;  4RM3 A;  2X6W A;  1Z3X A;  2Q2E B;  3OYB A;  3OL3 A;  3HPH A;  2DOA A;  5TGT A;  1QU3 A;  3LSK A;  2JVH A;  4XLE A;  3K4L A;  4XKW A;  3DLA A;  1TZL A;  2KP6 A;  2RNG A;  3K10 A;  2IGN A;  2LY1 A;  3GBG A;  1LKX A;  3OIQ A;  1E0E A;  2JUG A;  2LRD A;  1FMW A;  4J01 A;  3EUH C;  2CMP A;  3AFH A;  1K6Y A;  4RLF A;  4EAT A;  2W82 A;  2ZXH A;  3S3O A;  2PJR A;  2QKM B;  4F93 B;  4F55 A;  4PSX A;  2OC6 A;  2CUZ A;  3OS1 A;  1HA8 A;  3DKY A;  3AL0 C;  2PMZ A;  3S3M A;  2WBM A;  2M4K A;  3IAM 2;  2CUJ A;  3D5S C;  4RM2 A;  3MKY B;  2QKL B;  3H9G A;  2KDO A;  3AKZ A;  3S32 A;  4PJM A;  2CV2 A;  4E7J A;  2VB6 A;  2X1E A;  3PUB A;  4XLC A;  3U21 A;  2V1N A;  3KYL A;  2VJJ A;  4XLA A;  4ZDP A;  1UEL B;  2WAQ A;  2FUG 2;  1N77 A;  2CH0 A;  1NG7 A;  4XLH A;  3OR2 C;  3OYN A;  3HG9 A;  3G2B A;  2JSP A;  3M1C A;  4F52 A;  4YRV A;  4II3 A;  3N05 A;  3ZCO A;  2MD0 A;  2VL8 A;  3QYE A;  4DBQ A;  2DXI A;  2VKD A;  1VZ0 A;  2F5V A;  3H9J A;  3MKZ A;  1UG0 A;  3CF2 A;  3H5R A;  4E7S A;  3LSI A;  3MMY B;  4CCO A;  2XF5 A;  1BOB A;  4ITV A;  2V6E A;  4D9J A;  2LY2 A;  4U87 A;  1BR2 A;  3PL8 A;  1P9Q C;  4HPQ A;  3K70 D;  2UWM A;  4XMY A;  4PFP A;  4CZC A;  4KT6 A;  4AVZ A;  4R79 A;  3LFU A;  3ONQ A;  3K4K A;  4BEH B;  1SAU A;  5CQG A;  3IAS 2;  1Z7L A;  2NOJ B;  3ZXS A;  3K4C A;  1LVK A;  2KL4 A;  1MMN A;  2VQG A;  2XF6 A;  3EPZ A;  2X51 A;  2P0W A;  1NG6 A;  1WJE A;  2F4I A;  4BAC A;  3BCB A;  4JQF A;  3OWT A;  2VIX A;  2GOM A;  4XQF A;  4CUG A;  1YX3 A;  3DQV C;  4C9Y A;  3QOD A;  2R7V A;  1G59 A;  4F92 B;  1WJD A;  4ZDL A;  3H5N A;  2LG4 A;  3OYF A;  4FET A;  5HVQ C;  3CP2 A;  4IQJ A;  4B3X A;  2X1D A;  1OR7 C;  4BS9 A;  3DEE A;  2HZD A;  3OOU A;  3HC7 A;  2MAB A;  3RCO A;  2KLO A;  3OMY A;  2MYS A;  4XKV A;  3RSN A;  3BCA A;  3VWB A;  3H5A A;  4FAS D;  4KJZ A;  1PYV A;  2BOL A;  1IRX A;  3NWT A;  2W00 A;  3HPG A;  4XL9 A;  2K9L A;  3HUG B;  2M0M A;  2ZSI B;  3UNG C;  4MLO A;  2X6X A;  2K5C A;  3QYB A;  4II2 A;  4PSW A;  3OYC A;  3I3L A;  2E1M B;  3OYI A;  1QHH D;  2R7R A;  3RTR A;  3W2A A;  1WJF A;  2WAE A;  3S8P A;  4CH7 A;  4F3Q A;  1LFP A;  3QYF A;  1PJR A;  2BVL A;  2IGO A;  4PJJ A;  4F91 B;  2KRH A;  3BC8 A;  3SEZ A;  3TL4 X;  1BR1 A;  2E5N A;  2R7U A;  2XAU A;  3C2H A;  3TMO A;  2LH9 A;  2ZFU A;  3EUK L;  3OYA A;  1KON A;  3HOT A;  2R7X A;  2RQQ A;  1Y6I A;  3MKW B;  1Z21 A;  4HST A;  3H0D A;  1S9H A;  4XNF A;  4D1Q A;  2R7W A;  1X1D A;  2CS3 A;  1WJB A;  1DGW Y;  1GLN A;  2VQH A;  3L2Q A;  4ZC3 A;  2L5Q A;  2L2O A;  3KX2 A;  2WY7 Q;  2KRC A;  4N4N B;  3A1Y A;  3K4B A;  4HNU A;  2ZXI A;  2GOX B;  2VJ5 A;  2VXD A;  1DGR M;  5KHD A;  4BUP A;  1T95 A;  4E7I A;  2KQR A;  2HQA A;  1WJ5 A;  4NC8 A;  4ZTF A;  1TT0 A;  2VQL A;  2Z16 A;  3KEY A;  2X6Y A;  1WFX A;  3H35 A;  4HNT A;  1D1A A;  3ZQQ A;  4XKC A;  2HPM A;  2WAD A;  3DKX A;  4XN3 A;  5HOO A;  3ZGK A;  3L2W A;  2BW3 A;  3W3C A;  1G8X A;  1W36 D;  5CQE A;  1D1B A;  2LRE A;  3OYM A;  3A4C A;  3C2G A;  2K9M A;  4XM3 A;  4BQO A;  3DTI A;  2IXS A;  2LOO A;  3IP4 B;  2IS4 A;  2M7A A;  2F6C A;  4C2U A;  1D0Y A;  1Z3Y A;  2HVR A;  2CW8 A;  4BDY A;  3ZR8 X;  1X4O A;  3FKJ A;  1FMV A;  2HVQ A;  2X1C A;  2LBF B;  4XLF A;  2KZV A;  1EA3 A;  3F9K A;  4BJ6 C;  2BVM A;  2E5Z A;  3SYT A;  1X1A A;  1ERD A;  3D5R C;  3OS0 A;  4JOM A;  4G6T B;  4N4O B;  2RRE A;  2HU9 A;  4P1W A;  4IZZ A;  1N75 A;  4X0G A;  1MW7 A;  3FBI B;  2Q1Z B;  2M3A A;  4BQQ A;  3OYH A;  2IS6 A;  1JI8 A;  3K70 C;  1R6R A;  3RPU D;  2R7Q A;  3OY9 A;  4BE0 A;  2A6T A;  4Y33 A;  5FRM A;  4E7K A;  4CCN A;  5FRN A;  3FBN B;  4DOZ A;  2L7K A;  3SDB A;  2LYC A;  4E4H A;  3VDX A;  4XOT A;  2WY8 Q;  1SFK A;  2CW7 A;  3PSI A;  4ZYA A;  2Z1D A;  4OAY A;  3PFY A;  3S93 A;  3OR1 C;  3AL0 B;  2WB1 A;  4ZDO A;  4E6K G;  5HNF A;  2VPL A;  5CKT A;  4E7L A;  4CA0 A;  2A5W A;  3ZRG A;  3PSF A;  4BL0 B;  1X4P A;  4NUB A;  3HKZ A;  1WJC A;  4BDZ A;  4AYB A;  3I9V 2;  2LBF A;  4CCL A;  3CJR B;  2V9K A;  4XOP A;  4IQ4 A;  2AQE A;  5HNH A;  4PFO A;  2VJI A;  2WA0 A;  1U0J A;  1AA7 A;  3VSL A;  3FDY A;  3OYK A;  2M4G A;  4PUS A;  3A2K A;  2KPM A;  4QPQ A;  3VYS B;  3QOE A;  4YEL A;  2UUZ A;  3NWS A;  2BW3 B;  1BR4 A;  3L2R A;  2VQC A;  2JA2 A;  4XON A;  4HG2 A;  3CZ6 A;  4E7H A;  3MD2 A;  2HDW A;  4IKF A;  4B43 A;  3VYT B;  2K3P A;  3CMM A;  2O5R A;  4RLQ A;  4J00 A;  2Z2S B;  4LIT A;  4BE1 A;  3DU6 A;  4C30 A;  2IGK A;  2MC4 A;  1X1C A;  1MMG A;  2HNH A;  1T0F C;  4Y3O A;  2XDV A;  3OIP A;  3OYE A;  4HEA 2;  4QPO A;  2OV7 A;  2OUM A;  5JHF A;  2VAS A;  1YE9 A;  1D0X A;  2XF7 A;  4C2T A;  4YEJ A;  3LMM A;  3M8J A;  3OL4 A;  5CPR B;  1DQU A;  2VJ4 A;  2HVS A;  2CV1 A;  4ANJ A;  4LIV A;  4KIT B;  3HL2 A;  2LC2 A;  1MMD A;  2UV1 A;  2Y0S A;  3RQ4 A;  1N78 A;  3SZG A;  3DPL C;  4DGW B;  2VLA A;  2R7S A;  4AU7 A;  2DJI A;  3LSM A;  2VXZ A;  3PJR A;  3EUA A;  3K4J A;  3CP8 A;  2IS1 A;  2R7O A;  3DTE A;  3LSG A;  5HLT A;  4CCJ A;  4B44 A;  2AQF A;  1OLT A;  1X1B A;  3S3N A;  4Y4R A;  4DBR A;  4HRI A;  3OS2 A;  2XC7 A;  2V4J C;  4B48 A;  4ZTJ A;  2L9N A;  1J09 A;  2W1O A;  4E7Z A;  1W36 C;  4CCM A;  4PJL A;  3DU5 A;  3E1S A;  4BXF A;  4PJN A;  3CJQ B;  1V5F A;  3E0J B;  3DTK A;  3PNY A;  4OWR B;  1D0Z A;  1V5G A;  2MFZ A;  4H4K C;  2R4G A;  3L2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...