2LBFB

Solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 60S acidic ribosomal protein P1
publication title Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2011-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lbfB01
4BEHA 2W1OA 4BEHB 2LBFA 2LBFB 3A1YA
chains in the Genus database with same CATH superfamily
4IHSA 1JI8A 3GTLJ 4H0EA 4L9JA 1IRGA 3HSEA 3LSHA 5FFXA 2VPLA 1WJCA 1MNMC 2XAFA 2W24A 2X85A 2R7DA 5BOXA 4U87A 2H6CA 2Z16A 1RR8C 4BQAA 1KGSA 1KA8A 3BROA 3HOXJ 1J9IA 2L5QA 2DDAA 2BV6A 2VN2A 2O61A 1PUFA 3EUKL 2DMUA 5GTIC 1HF0A 1BW5A 3D5SC 2O9LA 4LOCA 2HGCA 3HDDA 3HBLA 2X1EA 3BZKA 4I09A 2R0QC 2QGUA 2OBPA 1USSA 5H6RA 1EKEA 1CF7A 1I5ZA 3E6CC 4A3KJ 3ECOA 2HI3A 5EGOB 3SZTA 3ML6A 2F5VA 1ETYA 1KU2A 3BR6A 1XCBA 3S3MA 2COMA 1KU9A 4CZCA 5HVQC 2LKSA 3J7YJ 1U9OA 3PO3J 4FE4A 5J8CA 3F8CA 1K61A 2QUFA 4IRIA 4ENKA 3JTGA 2XKPA 2PMZN 4IZZA 3K4MA 1O3RA 2L3DA 2YR2A 5HLIA 2X1DA 2QQAA 2CUJA 3K2AA 2R7VA 2DOFA 4Y33A 2QBYB 1FMWA 3OOUA 1EH7A 1FTTA 4A0XA 1PDNC 2VT3A 3RCOA 1P4WA 3NWTA 2E2IJ 1USTA 4EM1A 4J00A 2FMYA 4P5OA 1X1DA 4XLHA 3IH4A 4I99C 5D6FA 2LK2A 1OPCA 3L9FA 3OYGA 2H8RA 1A04A 4E7KA 5FB2A 4UVBA 5HDKA 3KYLA 2DFIA 4B47A 2MBFA 3L2QA 1WJDA 3GZ5A 2DMNA 3NARA 3E6MA 1WCMJ 2X0LA 2FQ4A 3S1RJ 2LLKA 2L54A 4JX5A 4M6XA 2HVRA 2M2EA 5ICFA 5HLTA 2HOEA 3D5RC 2Q0OA 2HOTA 2X4HA 2JA2A 3V7RA 3TL4X 1XCVA 1OMIA 2O7OA 1U5TA 4XSZF 2MH9A 5E18F 1ETWA 1Z91A 5EG0B 2W82A 1PYVA 3G2BA 5DDGA 1QZZA 5CQEA 2MGQA 1RESA 2BGCA 4MO7A 2E71A 5DUIA 4ZC3A 2L9SA 4XK4A 2WWYA 3OMYA 3U2RA 3G6EI 1JT0A 5F0CA 2E2JJ 4IQ4A 3SEQA 3FK6A 5FLVA 1ETXA 1ZG3A 1Y6IA 1DP3A 4A3MJ 1X58A 3KP6A 1P9QC 3Q0WA 3MEXA 4RLQA 3G73A 3ZGKA 5E79C 3L09A 2OZUA 3KP4A 2Y75A 3TDUC 2ZMEC 1SVMA 4UY8I 4RB2C 4UXNA 2YX4A 2KPMA 3J7ZI 2QBYA 4MQVA 1TWAJ 3PM1A 2HFHA 1WH5A 3H92A 2ADUA 2QCOA 2O8KA 2E34A 1BOAA 3SZPA 2L9NA 2ZMEA 4XRSA 1G3YA 4PUSA 3W6JB 3P9CA 1VQLI 2XV4S 2P6SA 4I7HA 2HYFA 3B73A 1P4AA 3RYRA 4BJ5C 3I56I 4HRIA 3J80Z 2ZJRF 4CCMA 1JTYA 3L2RA 3A0BC 1OCCH 5ICGA 4CCOA 3E3VA 1YI2I 1IN5A 2XRNA 2VBWA 3BG5A 1ZKGA 2IXSA 4GRIA 1KQ0A 1YO5C 5J1RA 3F21A 3NWSA 3CESA 2IGKA 4XONA 3S3NA 3RPQA 4I02A 2CU7A 1WSUA 2MLKA 2YS9A 2KLOA 2FUG2 5BPDA 1FOYA 3BG3A 3MN2A 2VIXA 4MTDA 3SQNA 4EGZA 4BKXA 1IRFA 2A6EF 2RGVA 2DYRH 3ZQFA 1MMGA 3QPSA 3VYUB 1MDMB 3K4BA 3M07A 3KX2A 3MZYA 2XC7A 1L0OC 1XMAA 4N4NB 5LGUA 1S72I 1A6QA 4F93B 1SC7A 2STTA 1SMTA 3E6BA 3QWLA 4EJWA 3IC7A 4L9TA 4D1QA 3BQYA 3S1MJ 3SDGA 3ABMH 1MBGA 5KK1A 2N8GA 1BBYA 4HLXA 2IGOA 2IA2A 4EATA 3A4CA 1P92A 1F43A 4U7BA 5KVRA 3WHBA 3DWLE 1T0FC 2E1OA 2PQ8A 2ZO4A 3ZMVA 5LHIA 4E7SA 1JUPA 4AWXB 2ISZA 3LFKA 1YOVB 1ON1A 1LKXA 2M3AA 4KNYA 4CO8A 3F3XA 2DA3A 2TDXA 4OIRF 3DTEA 2PX9A 2W00A 2XSDC 3QYFA 1A35A 4G9YA 5F27A 3OYFA 1O3SA 3H0DA 4EJUA 3GTOJ 2BZTA 3E1SA 2E60A 1GXQA 3QPHA 1OLTA 1XS9A 1GXPA 4K2EA 4HYEA 5K5OA 5HS7A 4A3DJ 3L2CA 3ZMSA 5DS9A 3HOYJ 2I10A 1WJEA 2COBA 4EVIA 2XB0X 3K1MA 2Y30A 2HXIA 1D5YA 1B8IA 5BQTA 1TLHB 1U0JA 4P96A 1WJFA 3JCUC 4I0BA 1U9NA 2R7FA 2Y0SA 1V4RA 1XGNA 2EV5A 5FKMA 5J40A 1NHAA 2DU9A 1ZR4A 2KP6A 1FY7A 5E8IA 3I4NJ 2F2EA 3H5AA 4XLNF 2G9WA 3DKXA 5ICEA 3WTZA 2KRFA 4YIFA 3IV5A 4QPOA 4MIMA 2VXZA 4HNTA 3AL0B 5HDGA 4EV0A 2VLAA 1IXCA 4BY1J 3QU3A 4XKCA 3K4NA 2PJRB 1Z05A 1W5CC 4XKVA 2L7KA 3LWFA 3OYDA 2X51A 1IJWC 2IAIA 1IN7A 2EZLA 3CUQB 3GZ6A 3WTWC 1LE8B 2H1LA 1WFXA 2BVMA 1LEBA 4XLAA 4HEA2 4BDYA 2IBDA 2IA0A 1IXRC 3ZMZA 4NC8A 1N75A 2EFNA 2Q1ZB 1HA8A 1Z0XA 2PEXA 4ZZDA 2CUEA 2VKEA 4JX6A 5E1ZB 3LQQA 5F1RA 1ULYA 2NVYJ 4OAYA 1F1ZA 2P81A 4LFUA 5F64A 4IX7A 3ABLH 3CMAI 4L5JA 1JKRC 3H35A 4M3EA 3GLLA 4XRSG 2XPVA 1D1BA 3BTCA 2BY2A 2WBMA 1E3HA 2LOOA 3WTYC 4ABZA 2YU9J 4XN0A 1S6LA 2FX0A 2WV1A 1TQMA 3PFYA 2HQRA 4AC0A 3F8FA 2Y2ZA 2KZVA 3OIOA 3DF8A 3V7CA 2R7OA 1ETKA 2VXDA 3LAPA 4CICA 3BT9A 2MD0A 1ZHFA 3R0AA 4G6DA 4IEJA 3AL0C 3K4CA 3GFLA 3CC7I 2KISA 2ZXHA 2O0YA 3FHNA 2J5PA 2G7HA 3TQNA 3ZQ7A 1X3ZB 4KT6A 2GXBA 2HPIA 4IL6C 4KMFA 4LG0A 3E5QA 3LSMA 2EZIA 4IHYA 3W6KB 2RNGA 2VKHA 3IAS2 3CUQC 1YW8A 3K69A 3I5UA 1H89C 2GA2A 1B72B 4HBLA 3N05A 1G59A 2UWMA 1ON2A 2Q2EB 3WTXC 1BI0A 2XIGA 4NHJA 2EH3A 2F6CA 1F9NA 1T98A 3OYJA 2DLLA 4CCNA 4W97A 2HOAA 4C3IJ 2WADA 5D8KB 6PAXA 2JVHA 3TOAA 4RB3C 5D6EA 2HR3A 4XORA 4PFPA 1Y39A 3AAFA 4KUMA 1UELB 3KP3A 5CPRB 1BL0A 3PUFA 4L0ZB 2Q8KA 3GTMJ 1YS6A 1MMSA 5GPCA 3ELKA 2EV6A 2NVUB 3O3KA 4Y15A 1SD7A 3VSKA 2PBIA 1TW2A 1AHDP 2WA0A 3BJ6A 2CV0A 2QWWA 3P7NA 4LIVA 4BY7J 3RKWA 2LKXA 3CD6I 4U0VA 3HSFA 3LFUA 3GMEA 2FRHA 3O8GA 3ASNH 2FNPA 2LBFA 3HTUA 4OOIA 4C2MJ 2VI6A 4BJTA 4IXAA 1K78B 3CZ6A 3DXJF 3TBIA 4KISA 1LUJB 4IPAA 1IGNA 2F5FA 3S32A 3C1DA 3HOWJ 3KYDB 1FOXA 2XASA 3DFGA 1K6YA 3P9KA 1VQPI 4ENMA 1XSDA 3S16J 1BIBA 1W36D 3WTVC 2QVOA 1X1AA 1SFOJ 5L3DA 4UV8A 1VTNC 4U0YA 4RBOA 3CCMI 2DOAA 1FP2A 4UNOA 2XDVA 4JX4A 3ZCOA 3HXLA 2BW3B 1YJWI 1R1TA 2IP2A 1FMVA 2LYCA 3REOA 2NS8A 1KU3A 1R1VA 3CC2I 2Q2EA 4UUTA 4MQ9F 2DK5A 2I5UA 2KIQA 3MCZA 4MHGA 4KYWA 2ESHA 4FX4A 3BZ6A 3R60A 4PSWA 5E3OA 1SVLA 3DEUA 2V6CA 1D0ZA 4S0HB 4ASNA 1YJNI 1U6GA 3PQJA 5FKLA 4M3DA 1X3UA 2M45A 2QYOA 3GF2A 1MJBA 5IY5H 1X1PA 1XSVA 2BXYA 1BA5A 2NAZA 4CHUA 2Z3YA 4CCJA 1W4MA 3K1PA 2CFOA 5BNGA 3TEDA 3WU0A 4DBRA 4HF2A 3QODA 4KIGA 1JE8A 3KE2A 5EYRA 2EILH 1RZ4A 5H6QA 4MEYF 4PFOA 4V2GA 3K4KA 3W6VA 2Z1DA 2K9QA 1UZCA 3BCBA 3VEPA 5HNFA 3AG4H 2KJCA 2DJIA 2HEOA 1FEXA 1Q1VA 1NTCA 2CW8A 3ZQCA 2HOSA 5E1XA 4ZTFA 5EDNA 3EUHC 3VDXA 4HQMA 1FLIA 3TW6A 5J1UA 2Z5UA 2H09A 2DAOA 2IEKA 3FM5A 1ZGJA 4LJZF 2GIZA 3HRSA 3EUHA 1RETA 1MIJA 1IAWA 1ZN2A 4PDKA 2GXGA 3RQIA 3A0HC 4AYBN 2LTPA 4BGDA 3S2DJ 3A01B 2JTVA 1JT6A 2KDOA 3F8MA 3IP4B 4UB8C 4S05A 4M6VA 1W36C 2R5ZA 3FBIB 2G7UA 2JSPA 4G12A 1Z6TA 3ZXSA 1K4SA 1OYYA 4RA2A 4FETA 1IUYA 5DCFA 2FQ3A 3OYEA 1ZG1A 3KPHA 5FGMA 1BI3A 3HPGA 1TQPA 2DODA 3DLAA 5M5WJ 1AKHB 2CYYA 2YPRA 4PGGA 2DMTA 1AA7A 2KQRA 5LHHA 1GDTA 4KIFA 3S1NJ 3CCYA 1ONVA 2WAQA 3V8JA 3GEZA 5CKTA 3RDIA 2AQFA 4II3A 4BYYA 3N97A 4AIJA 3FK7A 4H4KC 3CLQA 3ZQQA 3LAJA 2EINH 3OR1C 2BY3A 3ASOH 2DA6A 4D5FA 4NC7A 1MW7A 3BG6A 4W1UA 5DM7F 1FYLA 1SD6A 3JTHA 3M7GA 3J7AO 4NC6A 4A0ZA 1PUFB 3T1BA 4ETSA 2NRAC 2VL8A 5EEGA 3HJEA 3S93A 2QEXI 4GFBA 2HTJA 5DCMA 1BC7C 1VF9A 4RLFA 4AIDA 2BXZA 1DQUA 1CF7B 5B1AH 4WXCA 2V79A 2F5DA 4MGRA 1D1CA 1Y1VJ 3ZPLA 1VQNI 2VOPA 3IRRA 1IDYA 2GM4A 1R71A 3H0GJ 5BS6A 2LP0A 3BQZA 5FJ8J 2AQEA 4HX8A 2M34A 2CFXA 1KZHA 3COAC 1ZQ3P 3GO5A 1R49A 3VYTB 1U8BA 2NS7A 1FX7A 2DDBA 4AM3A 1IN6A 2ECBA 1X3WB 1R00A 2MH2A 3FMRA 1P6RA 4HW0A 2MFZA 4JQFA 4I0AA 4LLGF 1O7LA 3OS1A 2ME0A 3MZ8A 5JVGF 3IWFA 4JBAA 3PO2J 3CMMA 3GZNB 4OIOF 1V5EA 2D1VA 4OWRB 5FO5A 1PP8F 3BR0A 2QENA 2K9SA 4O3MA 2VBXA 2EA4A 3PNYA 5K7ZA 2MABA 1R5GA 3KZYA 4PJJA 2OZ6A 2KT0A 5FKKA 1VNDA 3X2QH 2VQCA 1GV2A 2VB6A 2MC4A 2HZTA 3J80K 2L7MP 2OUMA 1DGWY 1NH3A 1YJ9I 3M1CA 4ZYEA 2AO9A 1O7FA 3ABTA 3PNTA 5KAFC 1FZPB 1D0YA 4JP0A 4G7HF 2D1HA 1U5TB 3SJMA 2JA8J 3DQVC 1UG0A 4GCVA 2JZYA 1FT9A 4A5MA 4BDZA 3G1LA 3HKZN 3C7JA 1E2XA 2CQ7A 3C2GA 2DPUA 1MBFA 3DBLB 2A6HF 2V1XA 3IH3A 2KRCA 1TP4A 2A5WA 1MJAA 2OF7A 3E7LA 2MD5A 1T33A 2R5YA 5LGTA 1Z1DA 1XC5A 1QVUA 4LGWA 4QWQA 3SXYA 2IPQX 2DMQA 1LDJA 4PJMA 1ORKA 4Q48A 1S3JA 3D5LA 1QZYA 3CJNA 2EIJH 2V6EA 4B44A 1QU3A 2K7LA 3LL7A 4C30A 2QSGX 2PFBA 3WE2A 3C18A 1BIAA 3GWZA 3DBRB 4N9IA 2FBKA 2EQRA 2JPCA 4EJTA 4YFXF 2YX7A 4XMYA 5C4XJ 5GTHC 4ITVA 1WJ5A 4Y17A 2CJJA 3HUGA 1P4XA 4IRHA 3VODA 5L3CA 4ZYDA 2RN7A 4QSHA 2ZMEB 1ZELA 3V4GA 4I6ZA 3ZOBA 2BHYA 4A0YA 4HLYA 3RI4A 1FSEA 3OYKA 5DTDA 3SEZA 3MKWB 3MAJA 3CCRI 5E20A 1J59A 2MW8A 3HSRA 4A3FJ 1ERDA 1LB2A 2M0MA 3BPVA 1VQ7I 1U5TC 2MG4A 1BI1A 2JJ7A 2JPBA 4BE2A 2F5CA 2P5VA 1FYKA 3HB9A 2W57A 2KZGA 3BR1A 1LDKB 2CQNA 2ELHA 2LDUA 4E7HA 3LQRA 1Y8QB 4HV5A 4KITB 3QOPA 4Q4ZF 1HOMA 1YFHA 4PJ0C 2DO7A 4LK1F 3S2WA 3HOUJ 4BQOA 2DA1A 1OJLA 2A69F 3VWBA 4YRVA 3K4LA 4PGHA 2MSYA 4Y52J 5LHGA 2X9DA 4IJAA 3V7SA 2IJLA 1MBEA 2HS5A 2XGDA 1Y0NA 3BCAA 3RJPA 2DQLA 3WTSC 2FSWA 1Z6RA 1YQAA 4ENJA 4BEHA 1SFKA 3AG3H 3GLXA 4U7DA 5AONA 1QGPA 1HCRA 2EFOA 2TCTA 3TP0A 2DBBA 3N4MA 4BXXJ 1FIPA 1KYZA 2JA5J 2M30A 3OR2C 1MH3A 3VYSB 1R22A 3FKJA 2LVSA 5AIQA 3CCEI 2DFFA 1SVOA 2FBHA 3S1QJ 4M3BA 2E1NA 5TISC 5F08A 5K5QA 2JVGA 1WWXA 3CCQI 3W2AA 3OWTA 2CV1A 1HC8A 2XHKA 1E17A 1SFXA 3MKLA 1D5VA 4KMUX 2OPTA 1QNTA 5M3MJ 2DT6A 5EZGA 2JSCA 4XRMA 1MGTA 1WI3A 4B43A 2ZKZA 1W1WE 3KYCB 2DFEA 2LY2A 3VYRB 4XOPA 5ICCA 1Z3YA 1ZK8A 3A02A 2L01A 2VOOA 1S8NA 4BE1A 2ZB9A 3KP7A 5HODA 1PP7U 2VE8A 5K5RA 3JW4A 3HOVJ 3RQ4A 2VASA 1UCRA 4QPQA 4IOAF 3TKYA 1MBJA 3KIOA 3D1NI 1Z77A 3MZHA 1B8IB 1NK2P 2PI0A 5LRRA 5HS8A 2GQQA 1O4XA 5IYDJ 4IQJA 2CRGA 3CO7C 1UB9A 4G6QA 4P55A 3OV8A 5D4SA 3SFIA 2FU4A 3I9V2 2K9NA 4AU7A 3GFIA 3QAHA 4N0BA 5E17F 2QQ8A 1YHQI 1DDNA 2LR8A 5KAIC 1XPXA 3PSFA 1T95A 2V4JC 3BG7A 3F8NA 3DEWA 1W5SA 2L9VA 4A3IJ 1EF4A 2CUZA 5F0HA 3ZP5A 3M9AA 1CGPA 2BHZA 2ZSIB 2M4KA 2VPRA 4YFKF 3FZVA 4A69C 2EK5A 5IOZA 5DYMA 4UVCA 1K79A 1ETVA 1UFMA 5E3LA 4OAZA 1TT0A 2DPDA 2W25A 2VQGA 4B3XA 4CYCA 4OIPF 1OISA 3F22A 3C2HA 1UG2A 2X48A 1X2NA 4M9ZA 2R7WA 5JHFA 4R8HA 4E7IA 3H3ZA 1P7IA 2L4AA 4AIHA 2E5ZA 4PSXA 4P9UA 2MC3A 4IHVA 2QQ9A 4PZJA 5L3EA 4KIBA 3BTLA 4B8XA 2M87A 1VI0A 2HQAA 2F4OB 1PVEA 5FLXK 3FIWA 5J47A 3I4MJ 4EQQA 2CQQA 4DQ2A 3ZQIA 5IYCJ 1B9MA 2GXAA 2JUCA 4XICA 4AVPA 1NK3P 1U78A 1ETQA 3HPHA 2F4IA 2IW5A 3OYBA 4G7ZF 2KDZA 9ANTA 4RB1A 3OY9A 1TWGJ 1RR7A 4E70A 3Q5FA 2NS0A 1D1AA 4BAYA 3GUDA 2D5VA 2XAUA 2P4WA 2UXXA 4LG0B 3DBHB 4GYIA 4AVZA 4HAMA 4LG3A 2XRLA 3JRDA 3JRCA 2CO5A 3RTRA 1FC3A 2DTRA 3TGNA 1ZH5A 3J81Z 3OYMA 4QTRA 2R3SA 1TNTA 2E7WA 2WTEA 1B6AA 5LRSA 3S2HJ 1I39A 2VT2A 4L9VA 4NQWA 2FXAA 1YIOA 1SMYF 3PQKA 4AD9A 3HRUA 4IHWA 1BM9A 2HWVA 3LA2A 5DUKA 5B66C 3BR3A 4KJZA 3G3ZA 3WU2C 1G4DA 4GXOA 2XROA 3HOZJ 2OCEA 2DMPA 1K83J 2BE5F 1JJ6C 1F5TA 1HSJA 1WGXA 1QQIA 3L7WA 2ZXIA 2OU2A 1GV5A 1MNDA 2FOWA 4BUPA 2KKOA 1RC9A 1JKPC 2XF6A 3CP2A 3FXRA 4HSTA 2LBFB 5JLXA 3C2BA 3RSNA 4BBSJ 1EJ9A 5C4JJ 3HL2A 2XGXA 1FYMA 2Z9OA 2W4SA 1IF1A 3PIOF 3PIPF 1Y1WJ 1IRXA 4HDVA 1NG6A 3PL8A 2XAGA 1ZARA 2M1BA 2EFQA 2RNJA 5FFZA 4HQEA 3WE3A 2EA2A 3T8TA 4RB0A 3F9KA 1KQ8A 1IV6A 5FKNA 4BJ6C 3WU1B 1FIAA 1E3OC 2DA7A 4KDPA 3B6AA 2F4MB 2HVQA 1ZRDA 2ICWG 4BQNA 2PMZA 1GVDA 5E3NA 3CMYA 2ZXJA 3BY6A 1POGA 1R6RA 1X1CA 3JRAA 2O3FA 2AS5F 5EZHA 4XSXF 4A6DA 5LGNA 2UXNA 2ZXWH 3PFIA 1JKQC 2ZBKA 4A5NA 4BHCA 1Z7LA 5GPAA 1YLFA 3E97A 1V54H 3HC7A 2A6TA 4B1RA 3CMEI 1BI2A 3K2ZA 5JR3A 1T6SA 4BBRJ 1QBJA 3RKYA 2IS1A 4BHPA 3HOSA 3CF2A 3TO7A 3HGYA 2BEOA 2CW0F 3SZGA 3HIFA 5HOOA 1N77A 2CGPA 2GIVA 4C2TA 1SANA 3M4OJ 1A5JA 4CGZA 5FLMJ 3CCVI 5IT3A 1ITYA 2QKMB 1QHHD 2DFHA 3KEQA 3TW7A 2ZSHB 4ESBA 4JOMA 3FXQA 3IRQA 5FLXZ 2VQLA 4WX9A 1ZG5A 3VPRA 3T5XA 1P2FA 2K85A 4Y4RA 4G94A 3ZMUA 3RZDJ 5F04A 4CDGA 5HLHA 2CW7A 5KHDA 4FQGA 2IA1A 4D0PA 4IRGA 3QQAA 1QZEA 2HYGD 3EQLF 3GFMA 4M73A 2GWRA 2QLZA 3QP5A 3QOEA 4EJOA 2HQ5A 3PUBA 5IYBJ 3R4KA 1KU7A 3LNQA 3CJRB 4YELA 2K4JA 3JRGA 1OCZH 1TC3C 2VKVA 3U21A 1IUFA 4KN4X 2WAFA 4BS9A 3HYIA 1YYVA 3E5XA 1M1EB 5CVRA 1CQTA 3G1MA 4ZDOA 3A2KA 3HM5A 3T8RA 4I76A 1VQ6I 4KICA 2Y0MA 2DK8A 1W5TA 2O5RA 3OS2A 2CV2A 2DN0A 4BH9A 3CLOA 2YU3A 2P6TA 2IS2A 3VFZA 1WI9A 1I50J 3LSGA 5C3EJ 5TGTA 2R5ZB 1C0WA 1MSEC 1JJ8C 2DA4A 3IKVA 3S3OA 5CVUA 2XGCA 4WWCA 4Z6YA 2PMUA 3L00A 1REPC 4CXFA 2JRMA 3FMQA 3DCFA 5ED4A 2KIMA 2CS3A 2EZHA 2K27A 3CUOA 3I71A 2E5NA 4B09A 5J6XA 3OSGA 1MSFC 3V8KA 1RI7A 4S04A 4LLNA 1J0RA 4M9SA 2P0WA 5CYVA 1ENHA 3DPTA 1OR7A 5H2FC 2ETHA 1DP7P 3FXUA 5IP6A 1HW5A 2L7ZA 5IT9K 2LY1A 2K3PA 3H5RA 4DZPA 4BACA 1R7JA 2ZCWA 4PK4A 1ZLJA 1VQ8I 1G3WA 3H9QA 4ZYGA 5ILSA 3E5UA 1Z21A 2WY7Q 1S9HA 4HZFA 1R36A 1MKMA 2HZDA 4FISA 1UHSA 4M3FA 4HNVA 2LG4A 1UJ8A 3OYLA 3OYNA 1PUEE 3ZN1A 3LA7A 5BMZA 3ABUA 5DCMB 2Y31A 2GOXB 1QPIA 3L2WA 3BJAA 1HKQA 3EDPA 1QVTA 3RPUA 2VC0A 2OD5A 1OFCX 3I59A 4I2OA 5K7FA 1OKRA 1BC8C 3KETA 1QRYA 2FF4A 5IP7J 4XLFA 4LD5A 2DOEA 3BDDA 2K86A 1FNNA 3IAM2 4TV7A 2P7VB 1ZR2A 4UUVA 1FSHA 2LREA 1Y56A 5KCMA 5FD6A 3LSTA 3ISPA 2UV1A 1QHGA 3HRTA 1S7AA 1EA3A 3BOQA 3ZMTA 5D5WB 4UHTA 5LFAA 2M8GX 3IKTA 3ABKH 2QQBA 3GCMA 1JHFA 1H9GA 2KIFA 3J7AY 4HV6A 2HYJA 2DW4A 1SAUA 2H6BA 2H94A 4V2FA 2LF8A 4RAYA 4M74A 4YFNF 2WB1A 3QRFF 3VSLA 4ESJA 4RM3A 1ODDA 3FISA 2E2HJ 2FJ1A 2B9SA 4D7NA 1YW9A 1X4PA 4OMZA 3U1KA 4UUSA 1ZTRA 2R7QA 5M3FJ 1FOWA 4HOBA 3LOCA 1WJAA 3MQ0A 2XSJC 3CDIA 4ZTJA 1H8AC 2LH9A 3DKWA 1VQ4I 1FOKA 2GAUA 3BJOA 1XMXA 1TL8A 5E3MA 1IZ1A 3FXJA 1MMDA 2IS6A 2EBIA 2XUBA 3ZQGA 1XGSA 2W1OA 1FBUA 3F6OA 2K9MA 5F6FA 2R5YB 1A36A 2DA5A 3GFJA 3FX3A 2CWEA 1HKSA 2R7SA 2B63J 4ESFA 2V7FA 2WC2A 1JGSA 1W7PA 1T56A 5FKOA 1RNLA 5J8FA 3IL2A 2FA5A 2VQHA 2XPUA 4ON0A 3ZQHA 1XDSA 3LSKA 5HDNA 3IWZA 3HRMA 5JVTA 2VE9A 3M8EA 2Z2SB 3K7AJ 4Q5SF 1FBQA 1HW1A 1WH7A 2Y0SN 3HUGB 1AU7A 3SFZA 2R7UA 2CH0A 2PLYA 3WG9A 3WTTC 1B9NA 3GX4X 1I1GA 1R4MB 2HNHA 3F6VA 5ILVA 2IT0A 2ZJQF 4XM3A 1LPQA 2W7NA 5FROA 1TWCJ 5IT9Z 1ZGWA 1RRJA 1MMAA 2ID6A 2ZC2A 4FASD 4UV9A 2PMHA 3S14J 4M6YA 2OV7A 2A5YB 1JUMA 3RKXA 2K40A 4MTEA 2W84A 3KP5A 3FWEA 3Q9SA 5FRMA 1I6HJ 2R7TA 1Y0UA 2IGMA 5LEJA 4BE0A 4XL9A 2R7XA 3PJRA 1WKMA 3L1PA 1VFCA 1XG1A 4FCYA 3SDBA 2OQRA 1YW7A 1G2HA 3TO6A 3H3VK 4KT5C 1R1UA 1S5LC 2Y9ZA 1LNWA 1UAAA 1OYIA 2Y69H 4IKFA 1I1SA 4EM2A 2X6YA 1ZAOA 2RAEA 2P5LC 3OYCA 2XKOA 4LK0F 3QPTA 3UNGC 2QSHX 1JKOC 4BEHB 2P5KA 4E7ZA 4M9XA 2BOLA 2GOMA 2G0EA 1VQ5I 2ZFUA 5FRNA 1E3PA 3TO9A 2CQKA 5GAHJ 2DXIA 5B3SH 4N4OB 1YX5A 3Q0UA 4Z2YA 3HHGA 5EEHA 2E19A 2NXNB 3MVPA 1I27A 3KFWX 1BW6A 3CO6C 3GVAA 3IH2A 4FHTA 4P9FA 4X0GA 1YRNA 4ZYAA 2FD5A 1RUNA 1K6OA 1FBSA 1MD0A 1A31A 2JQ7A 3ERMA 3FM3A 3CJQB 3ZN0A 2F5EA 4PJNA 5IP9J 4IOCF 3SHFA 2XF5A 2JN6A 2L0KA 4EJVA 3MWMA 2K5CA 1RPWA 3CCLI 1VQKI 3DKYA 1YITI 3I54A 1R4NB 1V5FA 3F8BA 2EZKA 3KZIC 2JK3A 2M9HA 3I64A 4F7ZA 2WY8Q 3L2UA 5D5UB 1SFEA 1LVKA 3OYIA 4AIKA 1BJAA 4A6EA 3K70C 1VQ9I 1ZRCA 2CQXA 4L5IA 4U88A 1A6IA 2NVTJ 2R93J 5D8LB 3K1NA 3SYTA 3FBNB 2H1KA 3BZCA 4F91B 5LLQA 4A3BJ 4M71A 4ZZLA 1R58A 2Z33A 2RV8A 3A1YA 4CA0A 3DEEA 4HPQA 3OYAA 1S7OA 3GW2A 3PNVA 4HF0A 5M5YJ 3KLOA 1I3QJ 2OQGA 2OTJI 4LMYA 5K1YA 2E1CA 1V55H 2O8XA 3B02A 2W85A 4QIWN 1JUSA 5DV5A 1G3SA 1DUXC 1MH4A 3ECHA 5F1JA 4L5EA 4CUGA 2A3SA 1FWZA 4L9NA 1J7KA 4N9HA 3UKGA 2E35A 4RGRA 3CDLA 4B4CA 2PN6A 3MKYB 3ONQA 4BNCA 2E36A 2X6OA 3M8JA 1XTAA 1R9TJ 3W2VA 4E7LA 4A3CJ 1DU0A 3O6BB 1BOBA 2WV0A 4FE7A 3WODF 5L3BA 1SD4A 1BN5A 3OL3A 1KYWA 1MNEA 4G6TB 2H27A 3S17J 2NNNA 3K0LA 5EGOA 1TBXA 2P7CB 4F92B 4BXUA 3F0CA 3ZQLA 4JK1X 4C3HJ 4A2UA 1T08B 1GLNA 4HA8A 1DPUA 2I8DA 3I3LA 4CSWA 1XX5A 2ZNYA 1HSTA 3AG2H 3H5NA 5IPAA 1XN7A 3FKIJ 2DT5A 2XVCA 2D45A 1W0TA 4CYCB 3Q3SA 4IVNA 3J81K 2QKLB 1YX3A 5CJ9A 1BR2A 4I98B 2EFPA 2RREA 1RIOH 1SAXA 3WG7H 4E4HA 3AFHA 4XNFA 3LSRA 1V3FA 1J75A 4XN3A 3BTJA 1J2XA 1Z3XA 2JUGA 2HXOA 2XF7A 3D0SA 4GYGA 3OS0A 3GTQJ 3W2WA 4MNUA 4YIIA 3DTKA 3QU6A 3CTAA 4BQQA 1ZLKA 2K9LA 4EGYA 2LRDA 3HTSB 4YIRX 3F72A 4IF4A 2O6GE 2EIMH 5LBQA 2LY9A 3H1CA 3QPLA 4F52A 2V1DA 5D4RA 5E8GA 3RZOJ 1OYWA 2FNAA 3JR9A 1WHUA 4X6AJ 4HSRA 3G71I 1L3LA 3VB2A 4XKWA 4E6KG 4X1EA 3KCCA 1WZ2A 3FF5A 1S29A 3BC8A 1B4AA 3H36A 3CDHA 2FMLA 1OCTC 2HKOA 1O57A 4AYBA 5J4VA 1J09A 4D5CA 4KN7X 1SEUA 5L3GA 1P7JA 1B1BA 4IO9F 1EV7A 1YIJI 1UMQA 5EG0A 4YG2F 4GDFA 4II2A 2VJJA 2BY0A 2X6XA 1O3QA 3ERED 1FP1D 2HDWA 2EJRA 2GZWA 4J01A 2KMUA 3LSJA 1G6NA 1LDDA 1R23A 3P9IA 5JFRA 4OU0A 5F0FA 4BL0B 4WXDA 3KEYA 3BPXA 4DNCA 1RUOA 2NVXJ 1STZA 5DD8A 1TT5B 3OYHA 3CC4I 3C3WA 2WAEA 3M8FA 1GUUA 4L0YB 5B5EC 2JWTA 3DLLF 1IN4A 2A61A 4NQWB 2FBIA 2KJBA 3P5JA 2MLGA 1IV8A 3LSIA 3F23A 2GLOA 2M7BA 2OCCH 2RDPA 2AXTC 2F48A 1ZRFA 2OTLI 4CCLA 3QP6A 4DYRA 2CUFA 5LD2C 3RKQA 3HGGA 3KEOA 4ENNA 4C9YA 2EV0A 1HDPA 2X1CA 4MFDA 1IW7F 1KONA 2ELKA 3HEFA 2M8EA 1D3YA 2QZ8A 5EF6A 1TQIA 4A3LJ 4G7OF 1JTXA 1F36A 4OINF 2V9VA 3K9TA 1T0FA 1KQ9A 4Y3OA 1T2KA 4B3AA 1GVJA 4WK8F 3CCJI 4LB6B 1TNSA 4BU2A 3TMOA 4XR6A 3K10A 1UHWA 3ZMDA 4RAGA 1I3AA 2DT7B 3R0JA 3TP3A 2K02A 5JI6A 3GBGA 2QA4I 4RGXA 5J4YA 2DI3A 1RKWA 3L2VA 3JRIA 4NUBA 2WAQN 3RYPA 4OIQF 2LNBA 3T0YA 2LFBA 1TZLA 2LD5A 2ELJA 2WB1N 2K3FA 1X19A 4RMNA 5DD4A 1U8RA 1ETOA 5J1YA 2DTZA 1YS7A 3I4PA 4DIQA 4ZDPA 3FXMA 4AUXA 5TJJA 2OA4A 2VBYA 4XLPF 1H9TA 2STWA 5CQGA 2ID3A 3KLNA 3FDYA 1MDMA 1ZGAA 3E0JB 4DYQA 1IDZA 3KP2A 3HOTA 2FEZA 4L18B 2ZFWA 4IHTA 2ISYA 3BTIA 4A3GJ 3ROUA 2V26A 3NEUA 5FD5A 1HQCA 1LVAA 2E1MB 3WGHA 2VONA 3DV8A 3LSPA 2BVLA 1IC8A 2FOKA 1IO2A 3NRVA 3OIQA 4CZZA 1AWCA 3CF5F 2KL4A 1N25A 4RAFA 4BHBA 3U1DA 3H9JA 3JRHA 2NVQJ 3GTJJ 4V19K 4NBQA 5CVIA 5M5XJ 5TRDA 2V9KA 2NOGA 3I58A 2ZJPF 5ILUA 2QF7A 3FXLA 5D5XB 1UHMA 3QYEA 4G8XA 1Q1HA 4NNJA 4CYDA 3BR5A 3HKZA 2YUSA 2GBYA 3PSIA 3I0TA 2V1UA 2LMDA 1BR4A 4NDLA 2JRTA 2M0CA 2HDDA 3BG9A 3HHHA 2O03A 3JAMK 3V42A 3GXOA 2KFDA 4ANJA 4KA4A 4Y13A 4DGWB 1LFUP 4RGUA 1WRJA 1QO0D 2VJ4A 2X6WA 2NYXA 5A2QK 1F4KA 4DYCA 1SD5A 2HU9A 2IVMA 3Q9VA 4BXFA 3G4SI 2P8TA 2EPFA 3AKZA 2Z99A 2ECCA 1BR1A 4CH7A 1B59A 3FXKA 2E1MC 4HNUA 2DJNA 3DU6A 3DU5A 5HNHA 2K4BA 5DM6F 3GTGJ 2VC1A 4WF2A 2D2WA 3W3CA 1XDUA 3G1OA 2RQQA 3A03A 2BY1A 1Z9CA 2BBYA 2JT1A 2QSFX 3H3UA 4YEJA 3NAUA 2VJIA 1I6XA 2FE3A 3JSOA 5HLGA 2LSOA 5EEAA 1HW2A 4HF1A 1Z67A 3BR2A 4B48A 1R5HA 2PJRA 2NOJB 1WJBA 1U3EM 3ESWB 3S15J 2AHQA 4GGGA 1EH8A 2L9RA 3UR3C 4M72A 1PJRA 3RPUD 2VKDA 1XGOA 4CCKA 3CUQA 4OMYA 2RKHA 4U0WA 2OJED 1LE8A 1GHCA 1ZREA 2XGEA 1R5ID 2LKPA 2XPWA 3R6SA 3JREA 3CJTB 1E0EA 2XB5A 1ZYRF 2GA1A 1X1BA 4M3GA 5HS9A 1S7EA 5B1BH 3V8LA 4D7MA 2EB7A 2HTSA 1MBHA 4FT8A 1H88C 3BWGA 3DTIA 4F3QA 3S8PA 4DOZA 4A12A 1Z7UA 4QLCU 2R7RA 5J3LA 3IUOA 1TWFJ 3ZR8X 3EYYA 4ZJZA 4DW6A 1IG7A 3MFKA 2B0LA 1DGRM 1X4OA 2V1NA 3I59B 2L2OA 3WHCA 4F55A 3OSFA 1ACIA 4GO1A 4JYKA 3TOBA 3EUAA 1GT0C 4LB5A 4UVAA 1K4TA 4UB6C 1TTYA 1MJ9A 3WTUC 5GP9A 1QA6A 5LEKA 2HKXA 1B72A 2Y9YA 5JLWA 1MBKA 1XGMA 1OR7C 2DYSH 4R1HA 4DZJA 2XAHA 5AIPA 5BPIA 1Y8RB 3O8HA 3GTPJ 4PCQA 4MEXF 1G8XA 3WGIA 2RQPA 2Y48A 3HG9A 2IS4A 4LIUA 5EJCA 3DPLC 5KNLA 3HZJA 3DPUA 1O3TA 4EEFG 4NB5A 1W7PD 1FJLA 1XMKA 3JAMZ 1APLC 3JRFA 2UZKA 2HPMA 1FTZA 1TWHJ 1DU6A 4RAZA 1MZBA 4D9JA 4O5VA 4FTHA 4UUSB 5A2QZ 4RDUA 5ERIA 3GYHX 4HDUA 1T8IA 3MKZA 1JGGA 1WVRA 3DP7A 2XAQA 2DCEA 1H0MA 1FPQA 4O6JA 1K78A 5C44J 4RGSA 3M1EA 4XIDA 2UUZA 1HKTA 2C6YA 2BYVE 3BLYA 2W48A 2R4GA 2OC6A 4HX4A 4DBQA 4ZYHA 1EH6A 2RVCA 2LF7A 3LA3A 2R92J 2B7EA 5D5VB 2ME6A 4RS8A 2PJPA 1V5GA 3KZZA 3OL4A 3EETA 4C3JJ 2R7ZJ 2E7XA 3Q0VA 5IOYA 4R79A 3JSPA 4ZH4F 1OCPA 4LITA 3VOEA 3TDZC 5GAEJ 3ULQB 2EFWA 1W7PB 3EPZA 3RIRA 1TW3A 3EYIA 3CP8A 3B6CA 2A07F 5H20A 2BW3A 2AXLA 1D0XA 5CVVA 2QM3A 5GAGJ 4XLCA 3AG1H 1IXSB 3MD2A 1N78A 4I01A 4A3JJ 2CG4A 5L3FA 4HX7A 4A93J 3QYBA 2HQNA 1VZ0A 1T38A 2L02A 2OAZA 1IRZA 1OQYA 5DEQA 3FMSA 2JMWA 3GTKJ 1HBXG 1XSXA 1U2WA 4WCGA 3K6GA 5CLSA 3E6DA 1VQOI 2EIKH 4Y7NJ 1JHHA 4FX0A 2PG4A 2JA6J 3CCSI 1J5YA 1YG2A 3I55I 1IN8A 2L4MA 4WXHA 2M5WA 3U9GA 3I53A 4MLOA 2VUMJ 2EWNA 2A68F 2M4GA 3IHUA 3FXOA 1D8KA 4XQFA 4J19A 4IHXA 4RM2A 5JHUA 4C2UA 1VQMI 2TRTA 3R61A 2DQRA 2MYSA 2ZNZA 1LFPA 1WPKA 1K7AA 2M7AA 3LMMA 2V9PA 2IRFG 2CSOA 1LEAA 1LJ9A 1XD7A 3CQZJ 1W0UA 1LFBA 3BP8A 5K7HA 3MMYB 1G3TA 2KHMA 4XRFA 3WGGA 3M3YJ 1YTYA 1NG7A 3FHZA 4Q47A 4EM0B 4HG2A 4MFEA 4DJAA 1HXDA 5GADJ 2CMPA 2ACJA 4XKBA 3H9GA 3K70D 1JXSA 2XAJA 4E7JA 2JA7J 1YRNB 2ZJ2A 1T39A 2VJ5A 5CVJA 2IGNA 5E1WA 2J5OA 1BJZA 2A05A 2KRHA 2MA3A 4P1WA 3CCUI 1D8JA 3A01A 4PJLA 1WQ2A 1YE9A 1RKTA 2NNYA 2DA2A 1MMNA 1QPMA 2H8WA 2KIUA 4LLLA 2VODA 1SFUA 4XOTA 3OOPA 3O2PE 3K4JA 1OCRH 2LC2A 2YSRA 4ZDLA 4XBFA 1X2MA 3ZRGA 1DPRA 2HDCA 2RC4A 2HVSA 4XLEA 1LQ1A 1OCOH 2VBZA 4EMSA 2ESNA 3OIPA 3JRBA 2L7FP 1XB4A 4A3EJ 1AKHA 1AOYA 1HLVA 3NQOA 1HDDC 4KFCA
chains in the Genus database with same CATH topology
4PFOA 3HL2A 3K4KA 4F52A 2Z1DA 2W4SA 1JI8A 3BCBA 4HSRA 1IRXA 3LSHA 5HNFA 1NG6A 4XKWA 3PL8A 4E6KG 2DJIA 2VPLA 1WJCA 3BC8A 2X85A 3F9KA 2CW8A 4BJ6C 4AYBA 4U87A 1J09A 2Z16A 4ZTFA 3EUHC 3VDXA 2L5QA 2HVQA 4BQNA 3EUKL 2PMZA 3D5SC 4II2A 2VJJA 2X6XA 1R6RA 1X1CA 2HDWA 2X1EA 4J01A 2KMUA 4BL0B 3KEYA 2F5VA 1Z7LA 3HC7A 2A6TA 4BGDA 3OYHA 3S3MA 4CZCA 2WAEA 5HVQC 2KDOA 3IP4B 4NQWB 1W36C 4IZZA 2IS1A 3K4MA 3HOSA 3FBIB 3CF2A 5HOOA 3SZGA 2JSPA 1N77A 3LSIA 2X1DA 2M7BA 3ZXSA 2CUJA 2R7VA 4C2TA 4FETA 4Y33A 3OYEA 1FMWA 3OOUA 4CCLA 5LD2C 3RCOA 3NWTA 2X1CA 3HPGA 4C9YA 1KONA 2QKMB 3DLAA 1QHHD 4J00A 4P5OA 1X1DA 4XLHA 1AA7A 2ZSHB 2KQRA 4JOMA 3OYGA 4E7KA 2VQLA 3KYLA 2WAQA 5CKTA 4B47A 3L2QA 2AQFA 4II3A 1WJDA 4Y4RA 4Y3OA 2CW7A 4H4KC 5KHDA 3ZQQA 2HVRA 3OR1C 5HLTA 3D5RC 4BU2A 3TMOA 4XR6A 3K10A 4NC7A 3QOEA 1MW7A 2DT7B 2JA2A 3BG6A 3TL4X 3PUBA 3GBGA 3CJRB 4YELA 3L2VA 3U21A 4NUBA 2WAFA 4BS9A 1TZLA 2W82A 2VL8A 2ELJA 3S93A 1PYVA 3G2BA 1X19A 4RMNA 5CQEA 4RLFA 4ZDOA 3A2KA 4DIQA 1DQUA 4ZDPA 4ZC3A 2L9SA 2O5RA 3OMYA 3OS2A 2CV2A 1D1CA 4IQ4A 5CQGA 3SEQA 1DP3A 3FDYA 1Y6IA 1P9QC 3E0JB 2IS2A 3HOTA 4RLQA 2AQEA 3LSGA 5TGTA 3ZGKA 2V26A 3VYTB 2E1MB 3S3OA 2BVLA 2KPMA 3OIQA 2KL4A 3H9JA 2MFZA 4JQFA 3OS1A 2CS3A 2L9NA 2E5NA 4PUSA 2V9KA 3CMMA 1V5EA 2P0WA 4OWRB 3DPTA 3QYEA 4NNJA 4BJ5C 3HKZA 3PSIA 4HRIA 2LY1A 3PNYA 2K3PA 2MABA 1BR4A 3H5RA 4CCMA 4PJJA 3L2RA 4BACA 4PK4A 2VQCA 2VB6A 2MC4A 3V42A 3H9QA 4CCOA 2OUMA 4ANJA 1DGWY 4DGWB 1Z21A 3M1CA 3PNTA 2WY7Q 1S9HA 2IXSA 2VJ4A 1D0YA 2X6WA 4GRIA 2HZDA 2LG4A 3DQVC 1UG0A 3OYLA 3NWSA 2HU9A 2IGKA 3CESA 4XONA 3OYNA 4BXFA 3S3NA 4BDZA 2KLOA 2FUG2 3C2GA 3AKZA 2GOXB 2VIXA 1BR1A 2KRCA 4CH7A 3L2WA 2A5WA 2E1MC 1MMGA 4HNUA 3VYUB 3DU6A 3DU5A 3K4BA 5HNHA 3KX2A 2XC7A 4N4NB 4PJMA 3W3CA 2RQQA 3D5LA 4F93B 4D1QA 4YEJA 4XLFA 2V6EA 2VJIA 4B44A 3LL7A 4C30A 1QU3A 3IAM2 2LREA 1Y56A 5KCMA 2IGOA 4XMYA 4ITVA 4B48A 2UV1A 1QHGA 4EATA 1WJ5A 3A4CA 2PJRA 2NOJB 1WJBA 4U7BA 1EA3A 3DWLE 1T0FC 3UR3C 5LFAA 1ZELA 4E7SA 1PJRA 3RPUD 2VKDA 4CCKA 1LKXA 3J7AY 2M3AA 1SAUA 3OYKA 3SEZA 3MKWB 2WB1A 3DTEA 3VSLA 1ERDA 2W00A 2M0MA 4RM3A 3QYFA 3OYFA 3H0DA 4BE2A 3E1SA 1X4PA 2E60A 1E0EA 2R7QA 1X1BA 1LDKB 1OLTA 4E7HA 1WJAA 4KITB 2XSJC 3DTIA 4ZTJA 2LH9A 4F3QA 4BQOA 1WJEA 3S8PA 4DOZA 2R7RA 1MMDA 2IS6A 3VWBA 3IUOA 4YRVA 3K4LA 1U0JA 1WJFA 3ZR8X 2W1OA 4ZJZA 2K9MA 2Y0SA 3BCAA 1DGRM 1X4OA 2KP6A 2V1NA 1SFKA 4BEHA 2R7SA 2L2OA 4F55A 2V7FA 3H5AA 3DKXA 2VQHA 3EUAA 3OR2C 3LSKA 4QPOA 3VYSB 3FKJA 2VXZA 2Z2SB 4HNTA 3AL0B 2VLAA 4XKCA 1OR7C 3HUGB 3K4NA 2PJRB 2R7UA 2CH0A 4XKVA 2L7KA 2HNHA 3OYDA 2JVGA 2X51A 3W2AA 1G8XA 3OWTA 4XM3A 3HG9A 2CV1A 2IS4A 4LIUA 3DPLC 5KNLA 2W7NA 5FROA 2DT6A 1MMAA 3DPUA 4FASD 1WFXA 2BVMA 2OV7A 4XLAA 4HEA2 4BDYA 4B43A 2HPMA 4NC8A 1N75A 2Q1ZB 1HA8A 4D9JA 2LY2A 3VYRB 4XOPA 5FRMA 1Z3YA 4OAYA 2R7TA 2IGMA 4BE0A 4XL9A 4IX7A 4BE1A 2R7XA 3MKZA 3PJRA 3H35A 2DCEA 3SDBA 3RQ4A 2VASA 1D1BA 2UUZA 2WBMA 4QPQA 2LOOA 3BLYA 1UAAA 2R4GA 2OC6A 4XN0A 4DBQA 3PFYA 4IKFA 4IQJA 2X6YA 2KZVA 1V5GA 3OL4A 2R7OA 3OYCA 2VXDA 3I9V2 2MD0A 3UNGC 4R79A 4AU7A 4BEHB 4E7ZA 3AL0C 2BOLA 3K4CA 2GOMA 4LITA 2ZFUA 2ZXHA 5FRNA 3EPZA 2DXIA 3PSFA 3FHNA 1T95A 2V4JC 3CP8A 3BG7A 4N4OB 1YX5A 4KT6A 2CUZA 2BW3A 2HPIA 3LSMA 1D0XA 2RNGA 2VKHA 2ZSIB 3IAS2 4X0GA 2M4KA 4XLCA 3N05A 4ZYAA 1G59A 2UWMA 3MD2A 2Q2EB 1N78A 3CJQB 4PJNA 2XF5A 2F6CA 3QYBA 2K5CA 3OYJA 1VZ0A 4CCNA 4OAZA 1TT0A 3DKYA 2WADA 2VQGA 1V5FA 2JVHA 4B3XA 4XORA 3C2HA 4PFPA 1UELB 3K6GA 5CPRB 2R7WA 2WY8Q 3L2UA 5JHFA 1LVKA 4E7IA 3VSKA 3OYIA 3K70C 2WA0A 2CV0A 4LIVA 2E5ZA 4MLOA 3LFUA 4XQFA 2M4GA 3SYTA 3FBNB 4PSXA 2LBFA 4F91B 4RM2A 4BJTA 3A1YA 4CA0A 3DEEA 3CZ6A 4HPQA 3OYAA 4C2UA 3TBIA 4KISA 2HQAA 3PNVA 2MYSA 1LFPA 3S32A 2M7AA 3LMMA 1K6YA 4CUGA 3MMYB 1W36D 2KHMA 3MKYB 1X1AA 3ONQA 1NG7A 3M8JA 3HPHA 2F4IA 4HG2A 3OYBA 4DJAA 3W2VA 2DOAA 4E7LA 3OY9A 2CMPA 1BOBA 2XDVA 3ZCOA 3HXLA 1D1AA 2BW3B 2XAUA 4XKBA 3H9GA 3K70D 3OL3A 1FMVA 2LYCA 1MNEA 4G6TB 4AVZA 4E7JA 4LG3A 2VJ5A 4F92B 3RTRA 2IGNA 2KRHA 4P1WA 1GLNA 3OYMA 2I8DA 3I3LA 4CSWA 4PJLA 1YE9A 3H5NA 1MMNA 4PSWA 1D0ZA 2QKLB 1YX3A 1BR2A 4XOTA 2RREA 3K4JA 4E4HA 2LC2A 3AFHA 4XNFA 4XN3A 4ZDLA 3ZRGA 4KJZA 2HVSA 2JUGA 1Z3XA 2XF7A 4XLEA 3OS0A 3W2WA 4CCJA 3DTKA 4BQQA 2CFOA 3OIPA 4DBRA 2ZXIA 2K9LA 1MNDA 2LRDA 4BUPA 3QODA 2XF6A 3CP2A 4HSTA 2LBFB 3RSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEH A;  2W1O A;  4BEH B;  2LBF A;  2LBF B;  3A1Y A; 
#chains in the Genus database with same CATH topology
 4IHS A;  1JI8 A;  3GTL J;  4H0E A;  4L9J A;  1IRG A;  3HSE A;  3LSH A;  5FFX A;  2VPL A;  1WJC A;  1MNM C;  2XAF A;  2W24 A;  2X85 A;  2R7D A;  5BOX A;  4U87 A;  2H6C A;  2Z16 A;  1RR8 C;  4BQA A;  1KGS A;  1KA8 A;  3BRO A;  3HOX J;  1J9I A;  2L5Q A;  2DDA A;  2BV6 A;  2VN2 A;  2O61 A;  1PUF A;  3EUK L;  2DMU A;  5GTI C;  1HF0 A;  1BW5 A;  3D5S C;  2O9L A;  4LOC A;  2HGC A;  3HDD A;  3HBL A;  2X1E A;  3BZK A;  4I09 A;  2R0Q C;  2QGU A;  2OBP A;  1USS A;  5H6R A;  1EKE A;  1CF7 A;  1I5Z A;  3E6C C;  4A3K J;  3ECO A;  2HI3 A;  5EGO B;  3SZT A;  3ML6 A;  2F5V A;  1ETY A;  1KU2 A;  3BR6 A;  1XCB A;  3S3M A;  2COM A;  1KU9 A;  4CZC A;  5HVQ C;  2LKS A;  3J7Y J;  1U9O A;  3PO3 J;  4FE4 A;  5J8C A;  3F8C A;  1K61 A;  2QUF A;  4IRI A;  4ENK A;  3JTG A;  2XKP A;  2PMZ N;  4IZZ A;  3K4M A;  1O3R A;  2L3D A;  2YR2 A;  5HLI A;  2X1D A;  2QQA A;  2CUJ A;  3K2A A;  2R7V A;  2DOF A;  4Y33 A;  2QBY B;  1FMW A;  3OOU A;  1EH7 A;  1FTT A;  4A0X A;  1PDN C;  2VT3 A;  3RCO A;  1P4W A;  3NWT A;  2E2I J;  1UST A;  4EM1 A;  4J00 A;  2FMY A;  4P5O A;  1X1D A;  4XLH A;  3IH4 A;  4I99 C;  5D6F A;  2LK2 A;  1OPC A;  3L9F A;  3OYG A;  2H8R A;  1A04 A;  4E7K A;  5FB2 A;  4UVB A;  5HDK A;  3KYL A;  2DFI A;  4B47 A;  2MBF A;  3L2Q A;  1WJD A;  3GZ5 A;  2DMN A;  3NAR A;  3E6M A;  1WCM J;  2X0L A;  2FQ4 A;  3S1R J;  2LLK A;  2L54 A;  4JX5 A;  4M6X A;  2HVR A;  2M2E A;  5ICF A;  5HLT A;  2HOE A;  3D5R C;  2Q0O A;  2HOT A;  2X4H A;  2JA2 A;  3V7R A;  3TL4 X;  1XCV A;  1OMI A;  2O7O A;  1U5T A;  4XSZ F;  2MH9 A;  5E18 F;  1ETW A;  1Z91 A;  5EG0 B;  2W82 A;  1PYV A;  3G2B A;  5DDG A;  1QZZ A;  5CQE A;  2MGQ A;  1RES A;  2BGC A;  4MO7 A;  2E71 A;  5DUI A;  4ZC3 A;  2L9S A;  4XK4 A;  2WWY A;  3OMY A;  3U2R A;  3G6E I;  1JT0 A;  5F0C A;  2E2J J;  4IQ4 A;  3SEQ A;  3FK6 A;  5FLV A;  1ETX A;  1ZG3 A;  1Y6I A;  1DP3 A;  4A3M J;  1X58 A;  3KP6 A;  1P9Q C;  3Q0W A;  3MEX A;  4RLQ A;  3G73 A;  3ZGK A;  5E79 C;  3L09 A;  2OZU A;  3KP4 A;  2Y75 A;  3TDU C;  2ZME C;  1SVM A;  4UY8 I;  4RB2 C;  4UXN A;  2YX4 A;  2KPM A;  3J7Z I;  2QBY A;  4MQV A;  1TWA J;  3PM1 A;  2HFH A;  1WH5 A;  3H92 A;  2ADU A;  2QCO A;  2O8K A;  2E34 A;  1BOA A;  3SZP A;  2L9N A;  2ZME A;  4XRS A;  1G3Y A;  4PUS A;  3W6J B;  3P9C A;  1VQL I;  2XV4 S;  2P6S A;  4I7H A;  2HYF A;  3B73 A;  1P4A A;  3RYR A;  4BJ5 C;  3I56 I;  4HRI A;  3J80 Z;  2ZJR F;  4CCM A;  1JTY A;  3L2R A;  3A0B C;  1OCC H;  5ICG A;  4CCO A;  3E3V A;  1YI2 I;  1IN5 A;  2XRN A;  2VBW A;  3BG5 A;  1ZKG A;  2IXS A;  4GRI A;  1KQ0 A;  1YO5 C;  5J1R A;  3F21 A;  3NWS A;  3CES A;  2IGK A;  4XON A;  3S3N A;  3RPQ A;  4I02 A;  2CU7 A;  1WSU A;  2MLK A;  2YS9 A;  2KLO A;  2FUG 2;  5BPD A;  1FOY A;  3BG3 A;  3MN2 A;  2VIX A;  4MTD A;  3SQN A;  4EGZ A;  4BKX A;  1IRF A;  2A6E F;  2RGV A;  2DYR H;  3ZQF A;  1MMG A;  3QPS A;  3VYU B;  1MDM B;  3K4B A;  3M07 A;  3KX2 A;  3MZY A;  2XC7 A;  1L0O C;  1XMA A;  4N4N B;  5LGU A;  1S72 I;  1A6Q A;  4F93 B;  1SC7 A;  2STT A;  1SMT A;  3E6B A;  3QWL A;  4EJW A;  3IC7 A;  4L9T A;  4D1Q A;  3BQY A;  3S1M J;  3SDG A;  3ABM H;  1MBG A;  5KK1 A;  2N8G A;  1BBY A;  4HLX A;  2IGO A;  2IA2 A;  4EAT A;  3A4C A;  1P92 A;  1F43 A;  4U7B A;  5KVR A;  3WHB A;  3DWL E;  1T0F C;  2E1O A;  2PQ8 A;  2ZO4 A;  3ZMV A;  5LHI A;  4E7S A;  1JUP A;  4AWX B;  2ISZ A;  3LFK A;  1YOV B;  1ON1 A;  1LKX A;  2M3A A;  4KNY A;  4CO8 A;  3F3X A;  2DA3 A;  2TDX A;  4OIR F;  3DTE A;  2PX9 A;  2W00 A;  2XSD C;  3QYF A;  1A35 A;  4G9Y A;  5F27 A;  3OYF A;  1O3S A;  3H0D A;  4EJU A;  3GTO J;  2BZT A;  3E1S A;  2E60 A;  1GXQ A;  3QPH A;  1OLT A;  1XS9 A;  1GXP A;  4K2E A;  4HYE A;  5K5O A;  5HS7 A;  4A3D J;  3L2C A;  3ZMS A;  5DS9 A;  3HOY J;  2I10 A;  1WJE A;  2COB A;  4EVI A;  2XB0 X;  3K1M A;  2Y30 A;  2HXI A;  1D5Y A;  1B8I A;  5BQT A;  1TLH B;  1U0J A;  4P96 A;  1WJF A;  3JCU C;  4I0B A;  1U9N A;  2R7F A;  2Y0S A;  1V4R A;  1XGN A;  2EV5 A;  5FKM A;  5J40 A;  1NHA A;  2DU9 A;  1ZR4 A;  2KP6 A;  1FY7 A;  5E8I A;  3I4N J;  2F2E A;  3H5A A;  4XLN F;  2G9W A;  3DKX A;  5ICE A;  3WTZ A;  2KRF A;  4YIF A;  3IV5 A;  4QPO A;  4MIM A;  2VXZ A;  4HNT A;  3AL0 B;  5HDG A;  4EV0 A;  2VLA A;  1IXC A;  4BY1 J;  3QU3 A;  4XKC A;  3K4N A;  2PJR B;  1Z05 A;  1W5C C;  4XKV A;  2L7K A;  3LWF A;  3OYD A;  2X51 A;  1IJW C;  2IAI A;  1IN7 A;  2EZL A;  3CUQ B;  3GZ6 A;  3WTW C;  1LE8 B;  2H1L A;  1WFX A;  2BVM A;  1LEB A;  4XLA A;  4HEA 2;  4BDY A;  2IBD A;  2IA0 A;  1IXR C;  3ZMZ A;  4NC8 A;  1N75 A;  2EFN A;  2Q1Z B;  1HA8 A;  1Z0X A;  2PEX A;  4ZZD A;  2CUE A;  2VKE A;  4JX6 A;  5E1Z B;  3LQQ A;  5F1R A;  1ULY A;  2NVY J;  4OAY A;  1F1Z A;  2P81 A;  4LFU A;  5F64 A;  4IX7 A;  3ABL H;  3CMA I;  4L5J A;  1JKR C;  3H35 A;  4M3E A;  3GLL A;  4XRS G;  2XPV A;  1D1B A;  3BTC A;  2BY2 A;  2WBM A;  1E3H A;  2LOO A;  3WTY C;  4ABZ A;  2YU9 J;  4XN0 A;  1S6L A;  2FX0 A;  2WV1 A;  1TQM A;  3PFY A;  2HQR A;  4AC0 A;  3F8F A;  2Y2Z A;  2KZV A;  3OIO A;  3DF8 A;  3V7C A;  2R7O A;  1ETK A;  2VXD A;  3LAP A;  4CIC A;  3BT9 A;  2MD0 A;  1ZHF A;  3R0A A;  4G6D A;  4IEJ A;  3AL0 C;  3K4C A;  3GFL A;  3CC7 I;  2KIS A;  2ZXH A;  2O0Y A;  3FHN A;  2J5P A;  2G7H A;  3TQN A;  3ZQ7 A;  1X3Z B;  4KT6 A;  2GXB A;  2HPI A;  4IL6 C;  4KMF A;  4LG0 A;  3E5Q A;  3LSM A;  2EZI A;  4IHY A;  3W6K B;  2RNG A;  2VKH A;  3IAS 2;  3CUQ C;  1YW8 A;  3K69 A;  3I5U A;  1H89 C;  2GA2 A;  1B72 B;  4HBL A;  3N05 A;  1G59 A;  2UWM A;  1ON2 A;  2Q2E B;  3WTX C;  1BI0 A;  2XIG A;  4NHJ A;  2EH3 A;  2F6C A;  1F9N A;  1T98 A;  3OYJ A;  2DLL A;  4CCN A;  4W97 A;  2HOA A;  4C3I J;  2WAD A;  5D8K B;  6PAX A;  2JVH A;  3TOA A;  4RB3 C;  5D6E A;  2HR3 A;  4XOR A;  4PFP A;  1Y39 A;  3AAF A;  4KUM A;  1UEL B;  3KP3 A;  5CPR B;  1BL0 A;  3PUF A;  4L0Z B;  2Q8K A;  3GTM J;  1YS6 A;  1MMS A;  5GPC A;  3ELK A;  2EV6 A;  2NVU B;  3O3K A;  4Y15 A;  1SD7 A;  3VSK A;  2PBI A;  1TW2 A;  1AHD P;  2WA0 A;  3BJ6 A;  2CV0 A;  2QWW A;  3P7N A;  4LIV A;  4BY7 J;  3RKW A;  2LKX A;  3CD6 I;  4U0V A;  3HSF A;  3LFU A;  3GME A;  2FRH A;  3O8G A;  3ASN H;  2FNP A;  2LBF A;  3HTU A;  4OOI A;  4C2M J;  2VI6 A;  4BJT A;  4IXA A;  1K78 B;  3CZ6 A;  3DXJ F;  3TBI A;  4KIS A;  1LUJ B;  4IPA A;  1IGN A;  2F5F A;  3S32 A;  3C1D A;  3HOW J;  3KYD B;  1FOX A;  2XAS A;  3DFG A;  1K6Y A;  3P9K A;  1VQP I;  4ENM A;  1XSD A;  3S16 J;  1BIB A;  1W36 D;  3WTV C;  2QVO A;  1X1A A;  1SFO J;  5L3D A;  4UV8 A;  1VTN C;  4U0Y A;  4RBO A;  3CCM I;  2DOA A;  1FP2 A;  4UNO A;  2XDV A;  4JX4 A;  3ZCO A;  3HXL A;  2BW3 B;  1YJW I;  1R1T A;  2IP2 A;  1FMV A;  2LYC A;  3REO A;  2NS8 A;  1KU3 A;  1R1V A;  3CC2 I;  2Q2E A;  4UUT A;  4MQ9 F;  2DK5 A;  2I5U A;  2KIQ A;  3MCZ A;  4MHG A;  4KYW A;  2ESH A;  4FX4 A;  3BZ6 A;  3R60 A;  4PSW A;  5E3O A;  1SVL A;  3DEU A;  2V6C A;  1D0Z A;  4S0H B;  4ASN A;  1YJN I;  1U6G A;  3PQJ A;  5FKL A;  4M3D A;  1X3U A;  2M45 A;  2QYO A;  3GF2 A;  1MJB A;  5IY5 H;  1X1P A;  1XSV A;  2BXY A;  1BA5 A;  2NAZ A;  4CHU A;  2Z3Y A;  4CCJ A;  1W4M A;  3K1P A;  2CFO A;  5BNG A;  3TED A;  3WU0 A;  4DBR A;  4HF2 A;  3QOD A;  4KIG A;  1JE8 A;  3KE2 A;  5EYR A;  2EIL H;  1RZ4 A;  5H6Q A;  4MEY F;  4PFO A;  4V2G A;  3K4K A;  3W6V A;  2Z1D A;  2K9Q A;  1UZC A;  3BCB A;  3VEP A;  5HNF A;  3AG4 H;  2KJC A;  2DJI A;  2HEO A;  1FEX A;  1Q1V A;  1NTC A;  2CW8 A;  3ZQC A;  2HOS A;  5E1X A;  4ZTF A;  5EDN A;  3EUH C;  3VDX A;  4HQM A;  1FLI A;  3TW6 A;  5J1U A;  2Z5U A;  2H09 A;  2DAO A;  2IEK A;  3FM5 A;  1ZGJ A;  4LJZ F;  2GIZ A;  3HRS A;  3EUH A;  1RET A;  1MIJ A;  1IAW A;  1ZN2 A;  4PDK A;  2GXG A;  3RQI A;  3A0H C;  4AYB N;  2LTP A;  4BGD A;  3S2D J;  3A01 B;  2JTV A;  1JT6 A;  2KDO A;  3F8M A;  3IP4 B;  4UB8 C;  4S05 A;  4M6V A;  1W36 C;  2R5Z A;  3FBI B;  2G7U A;  2JSP A;  4G12 A;  1Z6T A;  3ZXS A;  1K4S A;  1OYY A;  4RA2 A;  4FET A;  1IUY A;  5DCF A;  2FQ3 A;  3OYE A;  1ZG1 A;  3KPH A;  5FGM A;  1BI3 A;  3HPG A;  1TQP A;  2DOD A;  3DLA A;  5M5W J;  1AKH B;  2CYY A;  2YPR A;  4PGG A;  2DMT A;  1AA7 A;  2KQR A;  5LHH A;  1GDT A;  4KIF A;  3S1N J;  3CCY A;  1ONV A;  2WAQ A;  3V8J A;  3GEZ A;  5CKT A;  3RDI A;  2AQF A;  4II3 A;  4BYY A;  3N97 A;  4AIJ A;  3FK7 A;  4H4K C;  3CLQ A;  3ZQQ A;  3LAJ A;  2EIN H;  3OR1 C;  2BY3 A;  3ASO H;  2DA6 A;  4D5F A;  4NC7 A;  1MW7 A;  3BG6 A;  4W1U A;  5DM7 F;  1FYL A;  1SD6 A;  3JTH A;  3M7G A;  3J7A O;  4NC6 A;  4A0Z A;  1PUF B;  3T1B A;  4ETS A;  2NRA C;  2VL8 A;  5EEG A;  3HJE A;  3S93 A;  2QEX I;  4GFB A;  2HTJ A;  5DCM A;  1BC7 C;  1VF9 A;  4RLF A;  4AID A;  2BXZ A;  1DQU A;  1CF7 B;  5B1A H;  4WXC A;  2V79 A;  2F5D A;  4MGR A;  1D1C A;  1Y1V J;  3ZPL A;  1VQN I;  2VOP A;  3IRR A;  1IDY A;  2GM4 A;  1R71 A;  3H0G J;  5BS6 A;  2LP0 A;  3BQZ A;  5FJ8 J;  2AQE A;  4HX8 A;  2M34 A;  2CFX A;  1KZH A;  3COA C;  1ZQ3 P;  3GO5 A;  1R49 A;  3VYT B;  1U8B A;  2NS7 A;  1FX7 A;  2DDB A;  4AM3 A;  1IN6 A;  2ECB A;  1X3W B;  1R00 A;  2MH2 A;  3FMR A;  1P6R A;  4HW0 A;  2MFZ A;  4JQF A;  4I0A A;  4LLG F;  1O7L A;  3OS1 A;  2ME0 A;  3MZ8 A;  5JVG F;  3IWF A;  4JBA A;  3PO2 J;  3CMM A;  3GZN B;  4OIO F;  1V5E A;  2D1V A;  4OWR B;  5FO5 A;  1PP8 F;  3BR0 A;  2QEN A;  2K9S A;  4O3M A;  2VBX A;  2EA4 A;  3PNY A;  5K7Z A;  2MAB A;  1R5G A;  3KZY A;  4PJJ A;  2OZ6 A;  2KT0 A;  5FKK A;  1VND A;  3X2Q H;  2VQC A;  1GV2 A;  2VB6 A;  2MC4 A;  2HZT A;  3J80 K;  2L7M P;  2OUM A;  1DGW Y;  1NH3 A;  1YJ9 I;  3M1C A;  4ZYE A;  2AO9 A;  1O7F A;  3ABT A;  3PNT A;  5KAF C;  1FZP B;  1D0Y A;  4JP0 A;  4G7H F;  2D1H A;  1U5T B;  3SJM A;  2JA8 J;  3DQV C;  1UG0 A;  4GCV A;  2JZY A;  1FT9 A;  4A5M A;  4BDZ A;  3G1L A;  3HKZ N;  3C7J A;  1E2X A;  2CQ7 A;  3C2G A;  2DPU A;  1MBF A;  3DBL B;  2A6H F;  2V1X A;  3IH3 A;  2KRC A;  1TP4 A;  2A5W A;  1MJA A;  2OF7 A;  3E7L A;  2MD5 A;  1T33 A;  2R5Y A;  5LGT A;  1Z1D A;  1XC5 A;  1QVU A;  4LGW A;  4QWQ A;  3SXY A;  2IPQ X;  2DMQ A;  1LDJ A;  4PJM A;  1ORK A;  4Q48 A;  1S3J A;  3D5L A;  1QZY A;  3CJN A;  2EIJ H;  2V6E A;  4B44 A;  1QU3 A;  2K7L A;  3LL7 A;  4C30 A;  2QSG X;  2PFB A;  3WE2 A;  3C18 A;  1BIA A;  3GWZ A;  3DBR B;  4N9I A;  2FBK A;  2EQR A;  2JPC A;  4EJT A;  4YFX F;  2YX7 A;  4XMY A;  5C4X J;  5GTH C;  4ITV A;  1WJ5 A;  4Y17 A;  2CJJ A;  3HUG A;  1P4X A;  4IRH A;  3VOD A;  5L3C A;  4ZYD A;  2RN7 A;  4QSH A;  2ZME B;  1ZEL A;  3V4G A;  4I6Z A;  3ZOB A;  2BHY A;  4A0Y A;  4HLY A;  3RI4 A;  1FSE A;  3OYK A;  5DTD A;  3SEZ A;  3MKW B;  3MAJ A;  3CCR I;  5E20 A;  1J59 A;  2MW8 A;  3HSR A;  4A3F J;  1ERD A;  1LB2 A;  2M0M A;  3BPV A;  1VQ7 I;  1U5T C;  2MG4 A;  1BI1 A;  2JJ7 A;  2JPB A;  4BE2 A;  2F5C A;  2P5V A;  1FYK A;  3HB9 A;  2W57 A;  2KZG A;  3BR1 A;  1LDK B;  2CQN A;  2ELH A;  2LDU A;  4E7H A;  3LQR A;  1Y8Q B;  4HV5 A;  4KIT B;  3QOP A;  4Q4Z F;  1HOM A;  1YFH A;  4PJ0 C;  2DO7 A;  4LK1 F;  3S2W A;  3HOU J;  4BQO A;  2DA1 A;  1OJL A;  2A69 F;  3VWB A;  4YRV A;  3K4L A;  4PGH A;  2MSY A;  4Y52 J;  5LHG A;  2X9D A;  4IJA A;  3V7S A;  2IJL A;  1MBE A;  2HS5 A;  2XGD A;  1Y0N A;  3BCA A;  3RJP A;  2DQL A;  3WTS C;  2FSW A;  1Z6R A;  1YQA A;  4ENJ A;  4BEH A;  1SFK A;  3AG3 H;  3GLX A;  4U7D A;  5AON A;  1QGP A;  1HCR A;  2EFO A;  2TCT A;  3TP0 A;  2DBB A;  3N4M A;  4BXX J;  1FIP A;  1KYZ A;  2JA5 J;  2M30 A;  3OR2 C;  1MH3 A;  3VYS B;  1R22 A;  3FKJ A;  2LVS A;  5AIQ A;  3CCE I;  2DFF A;  1SVO A;  2FBH A;  3S1Q J;  4M3B A;  2E1N A;  5TIS C;  5F08 A;  5K5Q A;  2JVG A;  1WWX A;  3CCQ I;  3W2A A;  3OWT A;  2CV1 A;  1HC8 A;  2XHK A;  1E17 A;  1SFX A;  3MKL A;  1D5V A;  4KMU X;  2OPT A;  1QNT A;  5M3M J;  2DT6 A;  5EZG A;  2JSC A;  4XRM A;  1MGT A;  1WI3 A;  4B43 A;  2ZKZ A;  1W1W E;  3KYC B;  2DFE A;  2LY2 A;  3VYR B;  4XOP A;  5ICC A;  1Z3Y A;  1ZK8 A;  3A02 A;  2L01 A;  2VOO A;  1S8N A;  4BE1 A;  2ZB9 A;  3KP7 A;  5HOD A;  1PP7 U;  2VE8 A;  5K5R A;  3JW4 A;  3HOV J;  3RQ4 A;  2VAS A;  1UCR A;  4QPQ A;  4IOA F;  3TKY A;  1MBJ A;  3KIO A;  3D1N I;  1Z77 A;  3MZH A;  1B8I B;  1NK2 P;  2PI0 A;  5LRR A;  5HS8 A;  2GQQ A;  1O4X A;  5IYD J;  4IQJ A;  2CRG A;  3CO7 C;  1UB9 A;  4G6Q A;  4P55 A;  3OV8 A;  5D4S A;  3SFI A;  2FU4 A;  3I9V 2;  2K9N A;  4AU7 A;  3GFI A;  3QAH A;  4N0B A;  5E17 F;  2QQ8 A;  1YHQ I;  1DDN A;  2LR8 A;  5KAI C;  1XPX A;  3PSF A;  1T95 A;  2V4J C;  3BG7 A;  3F8N A;  3DEW A;  1W5S A;  2L9V A;  4A3I J;  1EF4 A;  2CUZ A;  5F0H A;  3ZP5 A;  3M9A A;  1CGP A;  2BHZ A;  2ZSI B;  2M4K A;  2VPR A;  4YFK F;  3FZV A;  4A69 C;  2EK5 A;  5IOZ A;  5DYM A;  4UVC A;  1K79 A;  1ETV A;  1UFM A;  5E3L A;  4OAZ A;  1TT0 A;  2DPD A;  2W25 A;  2VQG A;  4B3X A;  4CYC A;  4OIP F;  1OIS A;  3F22 A;  3C2H A;  1UG2 A;  2X48 A;  1X2N A;  4M9Z A;  2R7W A;  5JHF A;  4R8H A;  4E7I A;  3H3Z A;  1P7I A;  2L4A A;  4AIH A;  2E5Z A;  4PSX A;  4P9U A;  2MC3 A;  4IHV A;  2QQ9 A;  4PZJ A;  5L3E A;  4KIB A;  3BTL A;  4B8X A;  2M87 A;  1VI0 A;  2HQA A;  2F4O B;  1PVE A;  5FLX K;  3FIW A;  5J47 A;  3I4M J;  4EQQ A;  2CQQ A;  4DQ2 A;  3ZQI A;  5IYC J;  1B9M A;  2GXA A;  2JUC A;  4XIC A;  4AVP A;  1NK3 P;  1U78 A;  1ETQ A;  3HPH A;  2F4I A;  2IW5 A;  3OYB A;  4G7Z F;  2KDZ A;  9ANT A;  4RB1 A;  3OY9 A;  1TWG J;  1RR7 A;  4E70 A;  3Q5F A;  2NS0 A;  1D1A A;  4BAY A;  3GUD A;  2D5V A;  2XAU A;  2P4W A;  2UXX A;  4LG0 B;  3DBH B;  4GYI A;  4AVZ A;  4HAM A;  4LG3 A;  2XRL A;  3JRD A;  3JRC A;  2CO5 A;  3RTR A;  1FC3 A;  2DTR A;  3TGN A;  1ZH5 A;  3J81 Z;  3OYM A;  4QTR A;  2R3S A;  1TNT A;  2E7W A;  2WTE A;  1B6A A;  5LRS A;  3S2H J;  1I39 A;  2VT2 A;  4L9V A;  4NQW A;  2FXA A;  1YIO A;  1SMY F;  3PQK A;  4AD9 A;  3HRU A;  4IHW A;  1BM9 A;  2HWV A;  3LA2 A;  5DUK A;  5B66 C;  3BR3 A;  4KJZ A;  3G3Z A;  3WU2 C;  1G4D A;  4GXO A;  2XRO A;  3HOZ J;  2OCE A;  2DMP A;  1K83 J;  2BE5 F;  1JJ6 C;  1F5T A;  1HSJ A;  1WGX A;  1QQI A;  3L7W A;  2ZXI A;  2OU2 A;  1GV5 A;  1MND A;  2FOW A;  4BUP A;  2KKO A;  1RC9 A;  1JKP C;  2XF6 A;  3CP2 A;  3FXR A;  4HST A;  2LBF B;  5JLX A;  3C2B A;  3RSN A;  4BBS J;  1EJ9 A;  5C4J J;  3HL2 A;  2XGX A;  1FYM A;  2Z9O A;  2W4S A;  1IF1 A;  3PIO F;  3PIP F;  1Y1W J;  1IRX A;  4HDV A;  1NG6 A;  3PL8 A;  2XAG A;  1ZAR A;  2M1B A;  2EFQ A;  2RNJ A;  5FFZ A;  4HQE A;  3WE3 A;  2EA2 A;  3T8T A;  4RB0 A;  3F9K A;  1KQ8 A;  1IV6 A;  5FKN A;  4BJ6 C;  3WU1 B;  1FIA A;  1E3O C;  2DA7 A;  4KDP A;  3B6A A;  2F4M B;  2HVQ A;  1ZRD A;  2ICW G;  4BQN A;  2PMZ A;  1GVD A;  5E3N A;  3CMY A;  2ZXJ A;  3BY6 A;  1POG A;  1R6R A;  1X1C A;  3JRA A;  2O3F A;  2AS5 F;  5EZH A;  4XSX F;  4A6D A;  5LGN A;  2UXN A;  2ZXW H;  3PFI A;  1JKQ C;  2ZBK A;  4A5N A;  4BHC A;  1Z7L A;  5GPA A;  1YLF A;  3E97 A;  1V54 H;  3HC7 A;  2A6T A;  4B1R A;  3CME I;  1BI2 A;  3K2Z A;  5JR3 A;  1T6S A;  4BBR J;  1QBJ A;  3RKY A;  2IS1 A;  4BHP A;  3HOS A;  3CF2 A;  3TO7 A;  3HGY A;  2BEO A;  2CW0 F;  3SZG A;  3HIF A;  5HOO A;  1N77 A;  2CGP A;  2GIV A;  4C2T A;  1SAN A;  3M4O J;  1A5J A;  4CGZ A;  5FLM J;  3CCV I;  5IT3 A;  1ITY A;  2QKM B;  1QHH D;  2DFH A;  3KEQ A;  3TW7 A;  2ZSH B;  4ESB A;  4JOM A;  3FXQ A;  3IRQ A;  5FLX Z;  2VQL A;  4WX9 A;  1ZG5 A;  3VPR A;  3T5X A;  1P2F A;  2K85 A;  4Y4R A;  4G94 A;  3ZMU A;  3RZD J;  5F04 A;  4CDG A;  5HLH A;  2CW7 A;  5KHD A;  4FQG A;  2IA1 A;  4D0P A;  4IRG A;  3QQA A;  1QZE A;  2HYG D;  3EQL F;  3GFM A;  4M73 A;  2GWR A;  2QLZ A;  3QP5 A;  3QOE A;  4EJO A;  2HQ5 A;  3PUB A;  5IYB J;  3R4K A;  1KU7 A;  3LNQ A;  3CJR B;  4YEL A;  2K4J A;  3JRG A;  1OCZ H;  1TC3 C;  2VKV A;  3U21 A;  1IUF A;  4KN4 X;  2WAF A;  4BS9 A;  3HYI A;  1YYV A;  3E5X A;  1M1E B;  5CVR A;  1CQT A;  3G1M A;  4ZDO A;  3A2K A;  3HM5 A;  3T8R A;  4I76 A;  1VQ6 I;  4KIC A;  2Y0M A;  2DK8 A;  1W5T A;  2O5R A;  3OS2 A;  2CV2 A;  2DN0 A;  4BH9 A;  3CLO A;  2YU3 A;  2P6T A;  2IS2 A;  3VFZ A;  1WI9 A;  1I50 J;  3LSG A;  5C3E J;  5TGT A;  2R5Z B;  1C0W A;  1MSE C;  1JJ8 C;  2DA4 A;  3IKV A;  3S3O A;  5CVU A;  2XGC A;  4WWC A;  4Z6Y A;  2PMU A;  3L00 A;  1REP C;  4CXF A;  2JRM A;  3FMQ A;  3DCF A;  5ED4 A;  2KIM A;  2CS3 A;  2EZH A;  2K27 A;  3CUO A;  3I71 A;  2E5N A;  4B09 A;  5J6X A;  3OSG A;  1MSF C;  3V8K A;  1RI7 A;  4S04 A;  4LLN A;  1J0R A;  4M9S A;  2P0W A;  5CYV A;  1ENH A;  3DPT A;  1OR7 A;  5H2F C;  2ETH A;  1DP7 P;  3FXU A;  5IP6 A;  1HW5 A;  2L7Z A;  5IT9 K;  2LY1 A;  2K3P A;  3H5R A;  4DZP A;  4BAC A;  1R7J A;  2ZCW A;  4PK4 A;  1ZLJ A;  1VQ8 I;  1G3W A;  3H9Q A;  4ZYG A;  5ILS A;  3E5U A;  1Z21 A;  2WY7 Q;  1S9H A;  4HZF A;  1R36 A;  1MKM A;  2HZD A;  4FIS A;  1UHS A;  4M3F A;  4HNV A;  2LG4 A;  1UJ8 A;  3OYL A;  3OYN A;  1PUE E;  3ZN1 A;  3LA7 A;  5BMZ A;  3ABU A;  5DCM B;  2Y31 A;  2GOX B;  1QPI A;  3L2W A;  3BJA A;  1HKQ A;  3EDP A;  1QVT A;  3RPU A;  2VC0 A;  2OD5 A;  1OFC X;  3I59 A;  4I2O A;  5K7F A;  1OKR A;  1BC8 C;  3KET A;  1QRY A;  2FF4 A;  5IP7 J;  4XLF A;  4LD5 A;  2DOE A;  3BDD A;  2K86 A;  1FNN A;  3IAM 2;  4TV7 A;  2P7V B;  1ZR2 A;  4UUV A;  1FSH A;  2LRE A;  1Y56 A;  5KCM A;  5FD6 A;  3LST A;  3ISP A;  2UV1 A;  1QHG A;  3HRT A;  1S7A A;  1EA3 A;  3BOQ A;  3ZMT A;  5D5W B;  4UHT A;  5LFA A;  2M8G X;  3IKT A;  3ABK H;  2QQB A;  3GCM A;  1JHF A;  1H9G A;  2KIF A;  3J7A Y;  4HV6 A;  2HYJ A;  2DW4 A;  1SAU A;  2H6B A;  2H94 A;  4V2F A;  2LF8 A;  4RAY A;  4M74 A;  4YFN F;  2WB1 A;  3QRF F;  3VSL A;  4ESJ A;  4RM3 A;  1ODD A;  3FIS A;  2E2H J;  2FJ1 A;  2B9S A;  4D7N A;  1YW9 A;  1X4P A;  4OMZ A;  3U1K A;  4UUS A;  1ZTR A;  2R7Q A;  5M3F J;  1FOW A;  4HOB A;  3LOC A;  1WJA A;  3MQ0 A;  2XSJ C;  3CDI A;  4ZTJ A;  1H8A C;  2LH9 A;  3DKW A;  1VQ4 I;  1FOK A;  2GAU A;  3BJO A;  1XMX A;  1TL8 A;  5E3M A;  1IZ1 A;  3FXJ A;  1MMD A;  2IS6 A;  2EBI A;  2XUB A;  3ZQG A;  1XGS A;  2W1O A;  1FBU A;  3F6O A;  2K9M A;  5F6F A;  2R5Y B;  1A36 A;  2DA5 A;  3GFJ A;  3FX3 A;  2CWE A;  1HKS A;  2R7S A;  2B63 J;  4ESF A;  2V7F A;  2WC2 A;  1JGS A;  1W7P A;  1T56 A;  5FKO A;  1RNL A;  5J8F A;  3IL2 A;  2FA5 A;  2VQH A;  2XPU A;  4ON0 A;  3ZQH A;  1XDS A;  3LSK A;  5HDN A;  3IWZ A;  3HRM A;  5JVT A;  2VE9 A;  3M8E A;  2Z2S B;  3K7A J;  4Q5S F;  1FBQ A;  1HW1 A;  1WH7 A;  2Y0S N;  3HUG B;  1AU7 A;  3SFZ A;  2R7U A;  2CH0 A;  2PLY A;  3WG9 A;  3WTT C;  1B9N A;  3GX4 X;  1I1G A;  1R4M B;  2HNH A;  3F6V A;  5ILV A;  2IT0 A;  2ZJQ F;  4XM3 A;  1LPQ A;  2W7N A;  5FRO A;  1TWC J;  5IT9 Z;  1ZGW A;  1RRJ A;  1MMA A;  2ID6 A;  2ZC2 A;  4FAS D;  4UV9 A;  2PMH A;  3S14 J;  4M6Y A;  2OV7 A;  2A5Y B;  1JUM A;  3RKX A;  2K40 A;  4MTE A;  2W84 A;  3KP5 A;  3FWE A;  3Q9S A;  5FRM A;  1I6H J;  2R7T A;  1Y0U A;  2IGM A;  5LEJ A;  4BE0 A;  4XL9 A;  2R7X A;  3PJR A;  1WKM A;  3L1P A;  1VFC A;  1XG1 A;  4FCY A;  3SDB A;  2OQR A;  1YW7 A;  1G2H A;  3TO6 A;  3H3V K;  4KT5 C;  1R1U A;  1S5L C;  2Y9Z A;  1LNW A;  1UAA A;  1OYI A;  2Y69 H;  4IKF A;  1I1S A;  4EM2 A;  2X6Y A;  1ZAO A;  2RAE A;  2P5L C;  3OYC A;  2XKO A;  4LK0 F;  3QPT A;  3UNG C;  2QSH X;  1JKO C;  4BEH B;  2P5K A;  4E7Z A;  4M9X A;  2BOL A;  2GOM A;  2G0E A;  1VQ5 I;  2ZFU A;  5FRN A;  1E3P A;  3TO9 A;  2CQK A;  5GAH J;  2DXI A;  5B3S H;  4N4O B;  1YX5 A;  3Q0U A;  4Z2Y A;  3HHG A;  5EEH A;  2E19 A;  2NXN B;  3MVP A;  1I27 A;  3KFW X;  1BW6 A;  3CO6 C;  3GVA A;  3IH2 A;  4FHT A;  4P9F A;  4X0G A;  1YRN A;  4ZYA A;  2FD5 A;  1RUN A;  1K6O A;  1FBS A;  1MD0 A;  1A31 A;  2JQ7 A;  3ERM A;  3FM3 A;  3CJQ B;  3ZN0 A;  2F5E A;  4PJN A;  5IP9 J;  4IOC F;  3SHF A;  2XF5 A;  2JN6 A;  2L0K A;  4EJV A;  3MWM A;  2K5C A;  1RPW A;  3CCL I;  1VQK I;  3DKY A;  1YIT I;  3I54 A;  1R4N B;  1V5F A;  3F8B A;  2EZK A;  3KZI C;  2JK3 A;  2M9H A;  3I64 A;  4F7Z A;  2WY8 Q;  3L2U A;  5D5U B;  1SFE A;  1LVK A;  3OYI A;  4AIK A;  1BJA A;  4A6E A;  3K70 C;  1VQ9 I;  1ZRC A;  2CQX A;  4L5I A;  4U88 A;  1A6I A;  2NVT J;  2R93 J;  5D8L B;  3K1N A;  3SYT A;  3FBN B;  2H1K A;  3BZC A;  4F91 B;  5LLQ A;  4A3B J;  4M71 A;  4ZZL A;  1R58 A;  2Z33 A;  2RV8 A;  3A1Y A;  4CA0 A;  3DEE A;  4HPQ A;  3OYA A;  1S7O A;  3GW2 A;  3PNV A;  4HF0 A;  5M5Y J;  3KLO A;  1I3Q J;  2OQG A;  2OTJ I;  4LMY A;  5K1Y A;  2E1C A;  1V55 H;  2O8X A;  3B02 A;  2W85 A;  4QIW N;  1JUS A;  5DV5 A;  1G3S A;  1DUX C;  1MH4 A;  3ECH A;  5F1J A;  4L5E A;  4CUG A;  2A3S A;  1FWZ A;  4L9N A;  1J7K A;  4N9H A;  3UKG A;  2E35 A;  4RGR A;  3CDL A;  4B4C A;  2PN6 A;  3MKY B;  3ONQ A;  4BNC A;  2E36 A;  2X6O A;  3M8J A;  1XTA A;  1R9T J;  3W2V A;  4E7L A;  4A3C J;  1DU0 A;  3O6B B;  1BOB A;  2WV0 A;  4FE7 A;  3WOD F;  5L3B A;  1SD4 A;  1BN5 A;  3OL3 A;  1KYW A;  1MNE A;  4G6T B;  2H27 A;  3S17 J;  2NNN A;  3K0L A;  5EGO A;  1TBX A;  2P7C B;  4F92 B;  4BXU A;  3F0C A;  3ZQL A;  4JK1 X;  4C3H J;  4A2U A;  1T08 B;  1GLN A;  4HA8 A;  1DPU A;  2I8D A;  3I3L A;  4CSW A;  1XX5 A;  2ZNY A;  1HST A;  3AG2 H;  3H5N A;  5IPA A;  1XN7 A;  3FKI J;  2DT5 A;  2XVC A;  2D45 A;  1W0T A;  4CYC B;  3Q3S A;  4IVN A;  3J81 K;  2QKL B;  1YX3 A;  5CJ9 A;  1BR2 A;  4I98 B;  2EFP A;  2RRE A;  1RIO H;  1SAX A;  3WG7 H;  4E4H A;  3AFH A;  4XNF A;  3LSR A;  1V3F A;  1J75 A;  4XN3 A;  3BTJ A;  1J2X A;  1Z3X A;  2JUG A;  2HXO A;  2XF7 A;  3D0S A;  4GYG A;  3OS0 A;  3GTQ J;  3W2W A;  4MNU A;  4YII A;  3DTK A;  3QU6 A;  3CTA A;  4BQQ A;  1ZLK A;  2K9L A;  4EGY A;  2LRD A;  3HTS B;  4YIR X;  3F72 A;  4IF4 A;  2O6G E;  2EIM H;  5LBQ A;  2LY9 A;  3H1C A;  3QPL A;  4F52 A;  2V1D A;  5D4R A;  5E8G A;  3RZO J;  1OYW A;  2FNA A;  3JR9 A;  1WHU A;  4X6A J;  4HSR A;  3G71 I;  1L3L A;  3VB2 A;  4XKW A;  4E6K G;  4X1E A;  3KCC A;  1WZ2 A;  3FF5 A;  1S29 A;  3BC8 A;  1B4A A;  3H36 A;  3CDH A;  2FML A;  1OCT C;  2HKO A;  1O57 A;  4AYB A;  5J4V A;  1J09 A;  4D5C A;  4KN7 X;  1SEU A;  5L3G A;  1P7J A;  1B1B A;  4IO9 F;  1EV7 A;  1YIJ I;  1UMQ A;  5EG0 A;  4YG2 F;  4GDF A;  4II2 A;  2VJJ A;  2BY0 A;  2X6X A;  1O3Q A;  3ERE D;  1FP1 D;  2HDW A;  2EJR A;  2GZW A;  4J01 A;  2KMU A;  3LSJ A;  1G6N A;  1LDD A;  1R23 A;  3P9I A;  5JFR A;  4OU0 A;  5F0F A;  4BL0 B;  4WXD A;  3KEY A;  3BPX A;  4DNC A;  1RUO A;  2NVX J;  1STZ A;  5DD8 A;  1TT5 B;  3OYH A;  3CC4 I;  3C3W A;  2WAE A;  3M8F A;  1GUU A;  4L0Y B;  5B5E C;  2JWT A;  3DLL F;  1IN4 A;  2A61 A;  4NQW B;  2FBI A;  2KJB A;  3P5J A;  2MLG A;  1IV8 A;  3LSI A;  3F23 A;  2GLO A;  2M7B A;  2OCC H;  2RDP A;  2AXT C;  2F48 A;  1ZRF A;  2OTL I;  4CCL A;  3QP6 A;  4DYR A;  2CUF A;  5LD2 C;  3RKQ A;  3HGG A;  3KEO A;  4ENN A;  4C9Y A;  2EV0 A;  1HDP A;  2X1C A;  4MFD A;  1IW7 F;  1KON A;  2ELK A;  3HEF A;  2M8E A;  1D3Y A;  2QZ8 A;  5EF6 A;  1TQI A;  4A3L J;  4G7O F;  1JTX A;  1F36 A;  4OIN F;  2V9V A;  3K9T A;  1T0F A;  1KQ9 A;  4Y3O A;  1T2K A;  4B3A A;  1GVJ A;  4WK8 F;  3CCJ I;  4LB6 B;  1TNS A;  4BU2 A;  3TMO A;  4XR6 A;  3K10 A;  1UHW A;  3ZMD A;  4RAG A;  1I3A A;  2DT7 B;  3R0J A;  3TP3 A;  2K02 A;  5JI6 A;  3GBG A;  2QA4 I;  4RGX A;  5J4Y A;  2DI3 A;  1RKW A;  3L2V A;  3JRI A;  4NUB A;  2WAQ N;  3RYP A;  4OIQ F;  2LNB A;  3T0Y A;  2LFB A;  1TZL A;  2LD5 A;  2ELJ A;  2WB1 N;  2K3F A;  1X19 A;  4RMN A;  5DD4 A;  1U8R A;  1ETO A;  5J1Y A;  2DTZ A;  1YS7 A;  3I4P A;  4DIQ A;  4ZDP A;  3FXM A;  4AUX A;  5TJJ A;  2OA4 A;  2VBY A;  4XLP F;  1H9T A;  2STW A;  5CQG A;  2ID3 A;  3KLN A;  3FDY A;  1MDM A;  1ZGA A;  3E0J B;  4DYQ A;  1IDZ A;  3KP2 A;  3HOT A;  2FEZ A;  4L18 B;  2ZFW A;  4IHT A;  2ISY A;  3BTI A;  4A3G J;  3ROU A;  2V26 A;  3NEU A;  5FD5 A;  1HQC A;  1LVA A;  2E1M B;  3WGH A;  2VON A;  3DV8 A;  3LSP A;  2BVL A;  1IC8 A;  2FOK A;  1IO2 A;  3NRV A;  3OIQ A;  4CZZ A;  1AWC A;  3CF5 F;  2KL4 A;  1N25 A;  4RAF A;  4BHB A;  3U1D A;  3H9J A;  3JRH A;  2NVQ J;  3GTJ J;  4V19 K;  4NBQ A;  5CVI A;  5M5X J;  5TRD A;  2V9K A;  2NOG A;  3I58 A;  2ZJP F;  5ILU A;  2QF7 A;  3FXL A;  5D5X B;  1UHM A;  3QYE A;  4G8X A;  1Q1H A;  4NNJ A;  4CYD A;  3BR5 A;  3HKZ A;  2YUS A;  2GBY A;  3PSI A;  3I0T A;  2V1U A;  2LMD A;  1BR4 A;  4NDL A;  2JRT A;  2M0C A;  2HDD A;  3BG9 A;  3HHH A;  2O03 A;  3JAM K;  3V42 A;  3GXO A;  2KFD A;  4ANJ A;  4KA4 A;  4Y13 A;  4DGW B;  1LFU P;  4RGU A;  1WRJ A;  1QO0 D;  2VJ4 A;  2X6W A;  2NYX A;  5A2Q K;  1F4K A;  4DYC A;  1SD5 A;  2HU9 A;  2IVM A;  3Q9V A;  4BXF A;  3G4S I;  2P8T A;  2EPF A;  3AKZ A;  2Z99 A;  2ECC A;  1BR1 A;  4CH7 A;  1B59 A;  3FXK A;  2E1M C;  4HNU A;  2DJN A;  3DU6 A;  3DU5 A;  5HNH A;  2K4B A;  5DM6 F;  3GTG J;  2VC1 A;  4WF2 A;  2D2W A;  3W3C A;  1XDU A;  3G1O A;  2RQQ A;  3A03 A;  2BY1 A;  1Z9C A;  2BBY A;  2JT1 A;  2QSF X;  3H3U A;  4YEJ A;  3NAU A;  2VJI A;  1I6X A;  2FE3 A;  3JSO A;  5HLG A;  2LSO A;  5EEA A;  1HW2 A;  4HF1 A;  1Z67 A;  3BR2 A;  4B48 A;  1R5H A;  2PJR A;  2NOJ B;  1WJB A;  1U3E M;  3ESW B;  3S15 J;  2AHQ A;  4GGG A;  1EH8 A;  2L9R A;  3UR3 C;  4M72 A;  1PJR A;  3RPU D;  2VKD A;  1XGO A;  4CCK A;  3CUQ A;  4OMY A;  2RKH A;  4U0W A;  2OJE D;  1LE8 A;  1GHC A;  1ZRE A;  2XGE A;  1R5I D;  2LKP A;  2XPW A;  3R6S A;  3JRE A;  3CJT B;  1E0E A;  2XB5 A;  1ZYR F;  2GA1 A;  1X1B A;  4M3G A;  5HS9 A;  1S7E A;  5B1B H;  3V8L A;  4D7M A;  2EB7 A;  2HTS A;  1MBH A;  4FT8 A;  1H88 C;  3BWG A;  3DTI A;  4F3Q A;  3S8P A;  4DOZ A;  4A12 A;  1Z7U A;  4QLC U;  2R7R A;  5J3L A;  3IUO A;  1TWF J;  3ZR8 X;  3EYY A;  4ZJZ A;  4DW6 A;  1IG7 A;  3MFK A;  2B0L A;  1DGR M;  1X4O A;  2V1N A;  3I59 B;  2L2O A;  3WHC A;  4F55 A;  3OSF A;  1ACI A;  4GO1 A;  4JYK A;  3TOB A;  3EUA A;  1GT0 C;  4LB5 A;  4UVA A;  1K4T A;  4UB6 C;  1TTY A;  1MJ9 A;  3WTU C;  5GP9 A;  1QA6 A;  5LEK A;  2HKX A;  1B72 A;  2Y9Y A;  5JLW A;  1MBK A;  1XGM A;  1OR7 C;  2DYS H;  4R1H A;  4DZJ A;  2XAH A;  5AIP A;  5BPI A;  1Y8R B;  3O8H A;  3GTP J;  4PCQ A;  4MEX F;  1G8X A;  3WGI A;  2RQP A;  2Y48 A;  3HG9 A;  2IS4 A;  4LIU A;  5EJC A;  3DPL C;  5KNL A;  3HZJ A;  3DPU A;  1O3T A;  4EEF G;  4NB5 A;  1W7P D;  1FJL A;  1XMK A;  3JAM Z;  1APL C;  3JRF A;  2UZK A;  2HPM A;  1FTZ A;  1TWH J;  1DU6 A;  4RAZ A;  1MZB A;  4D9J A;  4O5V A;  4FTH A;  4UUS B;  5A2Q Z;  4RDU A;  5ERI A;  3GYH X;  4HDU A;  1T8I A;  3MKZ A;  1JGG A;  1WVR A;  3DP7 A;  2XAQ A;  2DCE A;  1H0M A;  1FPQ A;  4O6J A;  1K78 A;  5C44 J;  4RGS A;  3M1E A;  4XID A;  2UUZ A;  1HKT A;  2C6Y A;  2BYV E;  3BLY A;  2W48 A;  2R4G A;  2OC6 A;  4HX4 A;  4DBQ A;  4ZYH A;  1EH6 A;  2RVC A;  2LF7 A;  3LA3 A;  2R92 J;  2B7E A;  5D5V B;  2ME6 A;  4RS8 A;  2PJP A;  1V5G A;  3KZZ A;  3OL4 A;  3EET A;  4C3J J;  2R7Z J;  2E7X A;  3Q0V A;  5IOY A;  4R79 A;  3JSP A;  4ZH4 F;  1OCP A;  4LIT A;  3VOE A;  3TDZ C;  5GAE J;  3ULQ B;  2EFW A;  1W7P B;  3EPZ A;  3RIR A;  1TW3 A;  3EYI A;  3CP8 A;  3B6C A;  2A07 F;  5H20 A;  2BW3 A;  2AXL A;  1D0X A;  5CVV A;  2QM3 A;  5GAG J;  4XLC A;  3AG1 H;  1IXS B;  3MD2 A;  1N78 A;  4I01 A;  4A3J J;  2CG4 A;  5L3F A;  4HX7 A;  4A93 J;  3QYB A;  2HQN A;  1VZ0 A;  1T38 A;  2L02 A;  2OAZ A;  1IRZ A;  1OQY A;  5DEQ A;  3FMS A;  2JMW A;  3GTK J;  1HBX G;  1XSX A;  1U2W A;  4WCG A;  3K6G A;  5CLS A;  3E6D A;  1VQO I;  2EIK H;  4Y7N J;  1JHH A;  4FX0 A;  2PG4 A;  2JA6 J;  3CCS I;  1J5Y A;  1YG2 A;  3I55 I;  1IN8 A;  2L4M A;  4WXH A;  2M5W A;  3U9G A;  3I53 A;  4MLO A;  2VUM J;  2EWN A;  2A68 F;  2M4G A;  3IHU A;  3FXO A;  1D8K A;  4XQF A;  4J19 A;  4IHX A;  4RM2 A;  5JHU A;  4C2U A;  1VQM I;  2TRT A;  3R61 A;  2DQR A;  2MYS A;  2ZNZ A;  1LFP A;  1WPK A;  1K7A A;  2M7A A;  3LMM A;  2V9P A;  2IRF G;  2CSO A;  1LEA A;  1LJ9 A;  1XD7 A;  3CQZ J;  1W0U A;  1LFB A;  3BP8 A;  5K7H A;  3MMY B;  1G3T A;  2KHM A;  4XRF A;  3WGG A;  3M3Y J;  1YTY A;  1NG7 A;  3FHZ A;  4Q47 A;  4EM0 B;  4HG2 A;  4MFE A;  4DJA A;  1HXD A;  5GAD J;  2CMP A;  2ACJ A;  4XKB A;  3H9G A;  3K70 D;  1JXS A;  2XAJ A;  4E7J A;  2JA7 J;  1YRN B;  2ZJ2 A;  1T39 A;  2VJ5 A;  5CVJ A;  2IGN A;  5E1W A;  2J5O A;  1BJZ A;  2A05 A;  2KRH A;  2MA3 A;  4P1W A;  3CCU I;  1D8J A;  3A01 A;  4PJL A;  1WQ2 A;  1YE9 A;  1RKT A;  2NNY A;  2DA2 A;  1MMN A;  1QPM A;  2H8W A;  2KIU A;  4LLL A;  2VOD A;  1SFU A;  4XOT A;  3OOP A;  3O2P E;  3K4J A;  1OCR H;  2LC2 A;  2YSR A;  4ZDL A;  4XBF A;  1X2M A;  3ZRG A;  1DPR A;  2HDC A;  2RC4 A;  2HVS A;  4XLE A;  1LQ1 A;  1OCO H;  2VBZ A;  4EMS A;  2ESN A;  3OIP A;  3JRB A;  2L7F P;  1XB4 A;  4A3E J;  1AKH A;  1AOY A;  1HLV A;  3NQO A;  1HDD C;  4KFC A; 
#chains in the Genus database with same CATH homology
 4PFO A;  3HL2 A;  3K4K A;  4F52 A;  2Z1D A;  2W4S A;  1JI8 A;  3BCB A;  4HSR A;  1IRX A;  3LSH A;  5HNF A;  1NG6 A;  4XKW A;  3PL8 A;  4E6K G;  2DJI A;  2VPL A;  1WJC A;  3BC8 A;  2X85 A;  3F9K A;  2CW8 A;  4BJ6 C;  4AYB A;  4U87 A;  1J09 A;  2Z16 A;  4ZTF A;  3EUH C;  3VDX A;  2L5Q A;  2HVQ A;  4BQN A;  3EUK L;  2PMZ A;  3D5S C;  4II2 A;  2VJJ A;  2X6X A;  1R6R A;  1X1C A;  2HDW A;  2X1E A;  4J01 A;  2KMU A;  4BL0 B;  3KEY A;  2F5V A;  1Z7L A;  3HC7 A;  2A6T A;  4BGD A;  3OYH A;  3S3M A;  4CZC A;  2WAE A;  5HVQ C;  2KDO A;  3IP4 B;  4NQW B;  1W36 C;  4IZZ A;  2IS1 A;  3K4M A;  3HOS A;  3FBI B;  3CF2 A;  5HOO A;  3SZG A;  2JSP A;  1N77 A;  3LSI A;  2X1D A;  2M7B A;  3ZXS A;  2CUJ A;  2R7V A;  4C2T A;  4FET A;  4Y33 A;  3OYE A;  1FMW A;  3OOU A;  4CCL A;  5LD2 C;  3RCO A;  3NWT A;  2X1C A;  3HPG A;  4C9Y A;  1KON A;  2QKM B;  3DLA A;  1QHH D;  4J00 A;  4P5O A;  1X1D A;  4XLH A;  1AA7 A;  2ZSH B;  2KQR A;  4JOM A;  3OYG A;  4E7K A;  2VQL A;  3KYL A;  2WAQ A;  5CKT A;  4B47 A;  3L2Q A;  2AQF A;  4II3 A;  1WJD A;  4Y4R A;  4Y3O A;  2CW7 A;  4H4K C;  5KHD A;  3ZQQ A;  2HVR A;  3OR1 C;  5HLT A;  3D5R C;  4BU2 A;  3TMO A;  4XR6 A;  3K10 A;  4NC7 A;  3QOE A;  1MW7 A;  2DT7 B;  2JA2 A;  3BG6 A;  3TL4 X;  3PUB A;  3GBG A;  3CJR B;  4YEL A;  3L2V A;  3U21 A;  4NUB A;  2WAF A;  4BS9 A;  1TZL A;  2W82 A;  2VL8 A;  2ELJ A;  3S93 A;  1PYV A;  3G2B A;  1X19 A;  4RMN A;  5CQE A;  4RLF A;  4ZDO A;  3A2K A;  4DIQ A;  1DQU A;  4ZDP A;  4ZC3 A;  2L9S A;  2O5R A;  3OMY A;  3OS2 A;  2CV2 A;  1D1C A;  4IQ4 A;  5CQG A;  3SEQ A;  1DP3 A;  3FDY A;  1Y6I A;  1P9Q C;  3E0J B;  2IS2 A;  3HOT A;  4RLQ A;  2AQE A;  3LSG A;  5TGT A;  3ZGK A;  2V26 A;  3VYT B;  2E1M B;  3S3O A;  2BVL A;  2KPM A;  3OIQ A;  2KL4 A;  3H9J A;  2MFZ A;  4JQF A;  3OS1 A;  2CS3 A;  2L9N A;  2E5N A;  4PUS A;  2V9K A;  3CMM A;  1V5E A;  2P0W A;  4OWR B;  3DPT A;  3QYE A;  4NNJ A;  4BJ5 C;  3HKZ A;  3PSI A;  4HRI A;  2LY1 A;  3PNY A;  2K3P A;  2MAB A;  1BR4 A;  3H5R A;  4CCM A;  4PJJ A;  3L2R A;  4BAC A;  4PK4 A;  2VQC A;  2VB6 A;  2MC4 A;  3V42 A;  3H9Q A;  4CCO A;  2OUM A;  4ANJ A;  1DGW Y;  4DGW B;  1Z21 A;  3M1C A;  3PNT A;  2WY7 Q;  1S9H A;  2IXS A;  2VJ4 A;  1D0Y A;  2X6W A;  4GRI A;  2HZD A;  2LG4 A;  3DQV C;  1UG0 A;  3OYL A;  3NWS A;  2HU9 A;  2IGK A;  3CES A;  4XON A;  3OYN A;  4BXF A;  3S3N A;  4BDZ A;  2KLO A;  2FUG 2;  3C2G A;  3AKZ A;  2GOX B;  2VIX A;  1BR1 A;  2KRC A;  4CH7 A;  3L2W A;  2A5W A;  2E1M C;  1MMG A;  4HNU A;  3VYU B;  3DU6 A;  3DU5 A;  3K4B A;  5HNH A;  3KX2 A;  2XC7 A;  4N4N B;  4PJM A;  3W3C A;  2RQQ A;  3D5L A;  4F93 B;  4D1Q A;  4YEJ A;  4XLF A;  2V6E A;  2VJI A;  4B44 A;  3LL7 A;  4C30 A;  1QU3 A;  3IAM 2;  2LRE A;  1Y56 A;  5KCM A;  2IGO A;  4XMY A;  4ITV A;  4B48 A;  2UV1 A;  1QHG A;  4EAT A;  1WJ5 A;  3A4C A;  2PJR A;  2NOJ B;  1WJB A;  4U7B A;  1EA3 A;  3DWL E;  1T0F C;  3UR3 C;  5LFA A;  1ZEL A;  4E7S A;  1PJR A;  3RPU D;  2VKD A;  4CCK A;  1LKX A;  3J7A Y;  2M3A A;  1SAU A;  3OYK A;  3SEZ A;  3MKW B;  2WB1 A;  3DTE A;  3VSL A;  1ERD A;  2W00 A;  2M0M A;  4RM3 A;  3QYF A;  3OYF A;  3H0D A;  4BE2 A;  3E1S A;  1X4P A;  2E60 A;  1E0E A;  2R7Q A;  1X1B A;  1LDK B;  1OLT A;  4E7H A;  1WJA A;  4KIT B;  2XSJ C;  3DTI A;  4ZTJ A;  2LH9 A;  4F3Q A;  4BQO A;  1WJE A;  3S8P A;  4DOZ A;  2R7R A;  1MMD A;  2IS6 A;  3VWB A;  3IUO A;  4YRV A;  3K4L A;  1U0J A;  1WJF A;  3ZR8 X;  2W1O A;  4ZJZ A;  2K9M A;  2Y0S A;  3BCA A;  1DGR M;  1X4O A;  2KP6 A;  2V1N A;  1SFK A;  4BEH A;  2R7S A;  2L2O A;  4F55 A;  2V7F A;  3H5A A;  3DKX A;  2VQH A;  3EUA A;  3OR2 C;  3LSK A;  4QPO A;  3VYS B;  3FKJ A;  2VXZ A;  2Z2S B;  4HNT A;  3AL0 B;  2VLA A;  4XKC A;  1OR7 C;  3HUG B;  3K4N A;  2PJR B;  2R7U A;  2CH0 A;  4XKV A;  2L7K A;  2HNH A;  3OYD A;  2JVG A;  2X51 A;  3W2A A;  1G8X A;  3OWT A;  4XM3 A;  3HG9 A;  2CV1 A;  2IS4 A;  4LIU A;  3DPL C;  5KNL A;  2W7N A;  5FRO A;  2DT6 A;  1MMA A;  3DPU A;  4FAS D;  1WFX A;  2BVM A;  2OV7 A;  4XLA A;  4HEA 2;  4BDY A;  4B43 A;  2HPM A;  4NC8 A;  1N75 A;  2Q1Z B;  1HA8 A;  4D9J A;  2LY2 A;  3VYR B;  4XOP A;  5FRM A;  1Z3Y A;  4OAY A;  2R7T A;  2IGM A;  4BE0 A;  4XL9 A;  4IX7 A;  4BE1 A;  2R7X A;  3MKZ A;  3PJR A;  3H35 A;  2DCE A;  3SDB A;  3RQ4 A;  2VAS A;  1D1B A;  2UUZ A;  2WBM A;  4QPQ A;  2LOO A;  3BLY A;  1UAA A;  2R4G A;  2OC6 A;  4XN0 A;  4DBQ A;  3PFY A;  4IKF A;  4IQJ A;  2X6Y A;  2KZV A;  1V5G A;  3OL4 A;  2R7O A;  3OYC A;  2VXD A;  3I9V 2;  2MD0 A;  3UNG C;  4R79 A;  4AU7 A;  4BEH B;  4E7Z A;  3AL0 C;  2BOL A;  3K4C A;  2GOM A;  4LIT A;  2ZFU A;  2ZXH A;  5FRN A;  3EPZ A;  2DXI A;  3PSF A;  3FHN A;  1T95 A;  2V4J C;  3CP8 A;  3BG7 A;  4N4O B;  1YX5 A;  4KT6 A;  2CUZ A;  2BW3 A;  2HPI A;  3LSM A;  1D0X A;  2RNG A;  2VKH A;  2ZSI B;  3IAS 2;  4X0G A;  2M4K A;  4XLC A;  3N05 A;  4ZYA A;  1G59 A;  2UWM A;  3MD2 A;  2Q2E B;  1N78 A;  3CJQ B;  4PJN A;  2XF5 A;  2F6C A;  3QYB A;  2K5C A;  3OYJ A;  1VZ0 A;  4CCN A;  4OAZ A;  1TT0 A;  3DKY A;  2WAD A;  2VQG A;  1V5F A;  2JVH A;  4B3X A;  4XOR A;  3C2H A;  4PFP A;  1UEL B;  3K6G A;  5CPR B;  2R7W A;  2WY8 Q;  3L2U A;  5JHF A;  1LVK A;  4E7I A;  3VSK A;  3OYI A;  3K70 C;  2WA0 A;  2CV0 A;  4LIV A;  2E5Z A;  4MLO A;  3LFU A;  4XQF A;  2M4G A;  3SYT A;  3FBN B;  4PSX A;  2LBF A;  4F91 B;  4RM2 A;  4BJT A;  3A1Y A;  4CA0 A;  3DEE A;  3CZ6 A;  4HPQ A;  3OYA A;  4C2U A;  3TBI A;  4KIS A;  2HQA A;  3PNV A;  2MYS A;  1LFP A;  3S32 A;  2M7A A;  3LMM A;  1K6Y A;  4CUG A;  3MMY B;  1W36 D;  2KHM A;  3MKY B;  1X1A A;  3ONQ A;  1NG7 A;  3M8J A;  3HPH A;  2F4I A;  4HG2 A;  3OYB A;  4DJA A;  3W2V A;  2DOA A;  4E7L A;  3OY9 A;  2CMP A;  1BOB A;  2XDV A;  3ZCO A;  3HXL A;  1D1A A;  2BW3 B;  2XAU A;  4XKB A;  3H9G A;  3K70 D;  3OL3 A;  1FMV A;  2LYC A;  1MNE A;  4G6T B;  4AVZ A;  4E7J A;  4LG3 A;  2VJ5 A;  4F92 B;  3RTR A;  2IGN A;  2KRH A;  4P1W A;  1GLN A;  3OYM A;  2I8D A;  3I3L A;  4CSW A;  4PJL A;  1YE9 A;  3H5N A;  1MMN A;  4PSW A;  1D0Z A;  2QKL B;  1YX3 A;  1BR2 A;  4XOT A;  2RRE A;  3K4J A;  4E4H A;  2LC2 A;  3AFH A;  4XNF A;  4XN3 A;  4ZDL A;  3ZRG A;  4KJZ A;  2HVS A;  2JUG A;  1Z3X A;  2XF7 A;  4XLE A;  3OS0 A;  3W2W A;  4CCJ A;  3DTK A;  4BQQ A;  2CFO A;  3OIP A;  4DBR A;  2ZXI A;  2K9L A;  1MND A;  2LRD A;  4BUP A;  3QOD A;  2XF6 A;  3CP2 A;  4HST A;  2LBF B;  3RSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...