2LBFB

Solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
molecule keywords 60S acidic ribosomal protein P1
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2011-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lbfB01
3A1YA 2LBFB 2LBFA 4BEHA 2W1OA 4BEHB
chains in the Genus database with same CATH superfamily
1D1AA 4YIRX 1JT6A 1Z3YA 1WQ2A 1K4SA 4IQJA 2VIXA 1I50J 5K5OA 1I1SA 1VTNC 5CJ9A 1DU6A 2E1MC 1RESA 1SMTA 3K70D 1PP7U 2BHYA 1G59A 4NBQA 5LLQA 2O9LA 4HLXA 3HTSB 1W1WE 2P6TA 3GYHX 4YFXF 5DCMA 2L3DA 1HBXG 4ZZDA 3GZNB 1U9OA 4MFEA 2IGNA 2BY0A 4I0BA 4A3JJ 1K6OA 2P7CB 3NARA 4ON0A 1WJFA 2LOOA 2XAGA 2WAEA 3C18A 3LSIA 5ERIA 3GLLA 3ERED 3JAMK 3W6JB 1WJEA 2LC2A 3J80K 1P6RA 3I64A 2YS9A 2HVSA 3J7AO 3S2WA 5GAHJ 5GADJ 4HBLA 1LPQA 1W0UA 4S0HB 4HEA2 3ZOBA 5KHDA 2ZCWA 2R7SA 1FYKA 1P2FA 5F0HA 3V7SA 1YTYA 5BPIA 1SFOJ 1HOMA 2DAOA 3KP5A 4RM2A 2E7WA 2E35A 3G2BA 3E6DA 1ETVA 5HDGA 2JT1A 3K4CA 4G7OF 4N9HA 4DYCA 2XF5A 2ZMEC 4CCJA 3N4MA 3RI4A 2I5UA 4WK8F 4EJUA 3S2DJ 2P5LC 2DDBA 3EUKL 5E17F 2GXBA 3ZMSA 2B7EA 2FBKA 4DGWB 2K9QA 3H92A 2VKDA 3BZKA 1FBUA 2LKXA 3MD2A 5HS7A 4IRHA 1LDKB 2IRFG 2D45A 1VQ4I 4V19K 4KT5C 3S16J 2FBHA 2DA3A 4F7ZA 3GZ6A 1UG0A 5J47A 3WHCA 3K69A 2JUCA 4MHGA 2XGDA 3F8MA 5F04A 1P92A 1XMAA 2XB0X 2XIGA 5KCMA 3BQZA 3DPUA 5GAGJ 2JMWA 5HDKA 5LRSA 2NVYJ 3WG7H 1RUNA 3BWGA 1FP2A 3CCMI 3FF5A 3HUGA 4LG3A 2FMLA 2ZXIA 3GZ5A 4I2OA 2EFOA 4OIPF 2R7RA 2LRDA 1YX5A 2L2OA 3EDPA 1WVRA 1QPIA 4C3IJ 4D5FA 2LDUA 4ZC3A 4PGHA 5HNHA 1MMDA 1BW6A 4EJTA 3KYLA 2DMNA 4IL6C 1MJ9A 1R36A 2RAEA 3CF2A 4A3LJ 1BR4A 5H2FC 3KLNA 4B8XA 2BXYA 2ZNZA 2E60A 5CVIA 2A3SA 4E7IA 5E3OA 4LIUA 4PJ0C 3RCOA 4GFBA 1SVOA 3OMYA 3ABUA 2X9DA 3SFZA 2NNNA 2MGQA 3PUBA 1QNTA 2WAFA 4NQWA 4ZDLA 3R0JA 1ETKA 4FCYA 3K2ZA 1FPQA 3PO3J 3S3NA 5AIQA 4HV5A 3HRMA 2DK5A 2O8XA 4G6QA 5D5XB 3BPXA 3F72A 4MTEA 2Y30A 3JSPA 3HYIA 1R1TA 2QEXI 2D5VA 2KDOA 2ECBA 4HX8A 3IKVA 2DMPA 1MDMB 4BQOA 1IXCA 2VUMJ 1H88C 4A3BJ 3R4KA 3CCLI 3L9FA 1E17A 1E3PA 9ANTA 3SXYA 1ZELA 2PFBA 2K3FA 1O57A 2DDAA 2IA1A 1ZARA 2O5RA 4C3HJ 1MD0A 4BE1A 2VODA 1F5TA 4CICA 2ZBKA 1M1EB 3P5JA 4LK0F 3ELKA 3V8JA 1WRJA 4N4NB 4A3CJ 5A2QZ 3CLOA 5FKLA 3U9GA 3CC4I 1Y8RB 2DLLA 4RAZA 1WWXA 2ZMEB 1I39A 2KJCA 2KMUA 3RQ4A 3BR6A 4LG0A 2IVMA 3PNYA 1T08B 3SZTA 1ERDA 1X58A 3IUOA 4ZTJA 5ILUA 1FZPB 2M3AA 1XSXA 5F27A 1MDMA 2Z1DA 3HPGA 3H5NA 4M9ZA 1SVMA 4CYCA 4BEHA 4LG0B 2MH2A 5HDNA 4WXDA 3CCJI 3BG5A 1R00A 3CD6I 5K7ZA 3WTVC 2P5VA 2QUFA 1ETYA 2WAQN 3EQLF 2JA6J 3PFIA 5E79C 5LEKA 2CQXA 4JK1X 5CYVA 4H0EA 2JSPA 2ZJRF 1IN5A 2ADUA 2D2WA 3IKTA 2E19A 1BL0A 3JREA 1OISA 1IO2A 4F92B 5EEAA 1WJBA 2DOEA 1IN8A 1LVKA 3S1RJ 3WGGA 4RAGA 5EZHA 1T39A 3X2QH 3W2AA 2LF7A 4UUSA 4XLEA 2EFPA 1H89C 5GPAA 3L2RA 1W7PD 3HTUA 3BTLA 3HGGA 1VFCA 2MC4A 3WTTC 4IO9F 3FDYA 2GZWA 4F3QA 3CDIA 1JXSA 3IHUA 4BDZA 1ON1A 3SEQA 3JRBA 3RTRA 3K4KA 1BR1A 1VQLI 1HKSA 1HA8A 1WKMA 3GTPJ 2RKHA 2Z16A 5EGOB 2COBA 2LY2A 2LK2A 2DODA 3VYUB 1FNNA 2EZLA 4Y3OA 3BG7A 2ICWG 3HSEA 4XKBA 4A5NA 2H27A 4LOCA 3SDGA 2XAUA 4QWQA 3VSKA 1D5YA 2RQQA 4IHVA 3MZ8A 3R60A 2PI0A 4RS8A 2M30A 3WTZA 3FBIB 3QOPA 2FQ3A 2PX9A 4JBAA 3FHZA 3CC2I 5B1AH 4WXCA 2K27A 2XHKA 4GYIA 3BZ6A 4DW6A 2Z9OA 5BMZA 3VSLA 3F8CA 4JOMA 4KN7X 1OKRA 2DFHA 4KN4X 4XR6A 1O3TA 1V55H 3DTIA 3VYSB 5F1RA 2QGUA 3K4JA 2DW4A 5M3FJ 5K5QA 4UY8I 1VQOI 2O03A 1RZ4A 1S7OA 3TDUC 1FP1D 2R3SA 1X3WB 1S7AA 1BN5A 3WGHA 1YRNB 4AIDA 4XSXF 3C7JA 2A68F 1UELB 1S72I 5BS6A 2RV8A 3BCAA 4YFKF 3S3OA 2Y48A 2DOFA 1SFKA 5B66C 4IJAA 1A35A 5GTHC 2WAQA 4L5JA 4V2FA 3DBLB 1S29A 1Q1VA 2LKPA 5JI6A 3S8PA 2L4MA 1YQAA 2KKOA 3E7LA 3OYKA 3C2HA 5DDGA 5J4VA 1H8AC 1SVLA 2O3FA 1T0FC 4FE4A 3D5SC 3DFGA 2X1CA 3MN2A 2YPRA 2UXXA 4Z6YA 1VQ8I 2EA2A 1TNSA 2GXGA 3IH4A 1TBXA 4RDUA 3GFMA 2KZVA 3TKYA 1D1BA 3F8BA 2NYXA 3S93A 2RN7A 3D1NI 4H4KC 4EM2A 1IN7A 4ZYHA 4G6TB 1TZLA 1R4MB 3LQRA 2VASA 2GXAA 1O3QA 2GA1A 2PEXA 2JTVA 4AWXB 1UJ8A 3CMEI 1RRJA 1YYVA 1CF7A 4RMNA 3G1LA 1GV5A 2F5CA 4Q47A 3OYEA 1W36C 3I4PA 3TL4X 4RBOA 2R5ZA 3KX2A 3KETA 3CJRB 2GBYA 1TLHB 3LA2A 3QPTA 1MZBA 3A2KA 1JHHA 5DYMA 5EJCA 2ME6A 2EK5A 2OPTA 1MSEC 1H9TA 3UNGC 2VXDA 3P7NA 4IVNA 4I01A 3CMMA 1KU3A 3BLYA 2Y2ZA 4CCKA 4IZZA 3QYEA 4XLPF 3KYDB 2DI3A 1B4AA 3RKQA 4BXUA 1XGSA 3OS1A 4BAYA 4Q48A 3C2BA 2Q1ZB 2K9MA 2FOKA 3VYTB 2PJRA 2OUMA 4YELA 5LHGA 2JRMA 2CUFA 4G6DA 1QGPA 4TV7A 3NRVA 2UXNA 3FXMA 4W1UA 4EJOA 1OLTA 2CSOA 2GOXB 4ABZA 4KUMA 2M4KA 3KIOA 2JQ7A 4RB2C 1Z1DA 5B5EC 4UNOA 1E0EA 2E2JJ 2HEOA 2ELKA 3FKIJ 4ZDPA 2VKVA 3BR3A 2CU7A 3KZZA 1XMXA 5LHHA 1S8NA 3K1NA 1QO0D 3FHNA 1AOYA 1LEBA 1R4NB 3H35A 4C30A 3OL3A 2K40A 5E8IA 5F0CA 1IF1A 3HHHA 1QBJA 1TC3C 3KP6A 2R4GA 1XDSA 1X3UA 2X48A 5AONA 5J3LA 4BHCA 5IY5H 2FEZA 1D0YA 2HQ5A 4K2EA 3MKZA 3G71I 4A5MA 3PUFA 1MMGA 3K9TA 2Y75A 2KRCA 4YIFA 5CPRB 2FNPA 3ML6A 2DFFA 2XAJA 1UCRA 4DZJA 5FLVA 1T6SA 1KA8A 1TWHJ 1ZK8A 4RAFA 3CCSI 2KIUA 2V1XA 1ZGJA 5D4RA 3SYTA 2EBIA 2HS5A 5EG0A 2STTA 3PQKA 3GCMA 4RLFA 5TJJA 4YIIA 4KMUX 4P5OA 4LD5A 4XLNF 3DCFA 1KYWA 2RNJA 1OCTC 4BACA 4PJLA 2Y9YA 3M3YJ 4C2TA 2DT6A 3FWEA 4M6VA 3TBIA 1SFUA 1U5TC 2Z5UA 3B73A 4BXFA 2CV2A 3GFJA 2MA3A 3F23A 3MAJA 3OIQA 2ZXJA 2V1NA 2OCEA 1DP3A 1T98A 2ZO4A 2LBFB 4ZYGA 4D7NA 1QRYA 2X6YA 2XKOA 4ZYDA 1KGSA 4DOZA 2ISZA 2PN6A 4A93J 4M9XA 4OINF 2VC1A 4E7ZA 4Q4ZF 3TOAA 1J7KA 3WG9A 4NC6A 2EFWA 1NK2P 2R7WA 4U0WA 1R49A 1MBHA 1OCCH 4ESBA 2M0CA 3G1OA 3M9AA 3M07A 4ESJA 4AVPA 1MBFA 2VXZA 2F5FA 2GWRA 4FHTA 4D9JA 3ZCOA 4I76A 5JHUA 1KZHA 2R5YB 2BVLA 1U78A 4MEXF 1B8IB 4HG2A 4FX4A 2VC0A 2X0LA 4MO7A 5M5YJ 2W25A 5DV5A 3JTGA 2LYCA 1V4RA 1T8IA 1R1UA 3GLXA 2ESHA 2LTPA 3WE3A 3OYFA 2YU9J 4NC7A 3QPSA 2A69F 1PUEE 4M71A 1ETOA 3V8LA 3E1SA 1H0MA 5F1JA 1OFCX 3ABMH 3VFZA 3HXLA 3I59B 3A03A 3Q0UA 3JRAA 4AIHA 1RIOH 1MGTA 1JKPC 2VPLA 3O8GA 2HFHA 1MJBA 2ZKZA 2XSDC 4RGXA 1FOYA 2L9RA 1EJ9A 2L01A 3T5XA 1HC8A 1ZN2A 4MFDA 3KE2A 2ID3A 2IEKA 5D8LB 3EUHA 1IG7A 1DPUA 2HVRA 2DN0A 3BTJA 3HSRA 4L5EA 2KPMA 1WZ2A 1GV2A 4OU0A 2ZJQF 5IT9Z 2UUZA 2VBWA 3MWMA 5DTDA 3O8HA 2XGXA 2A6HF 3Q0VA 5HVQC 1VQKI 5DCFA 4YEJA 2MSYA 1CF7B 2WV1A 1ZRFA 2ZC2A 2G9WA 4FT8A 4IF4A 2K02A 3F6OA 1YRNA 1AKHA 3CDHA 3E5QA 3DEUA 2EFQA 3HJEA 2X51A 2ZB9A 3HBLA 3N97A 1FBSA 1UMQA 4DQ2A 3BDDA 2QSFX 3F0CA 3JR9A 1JGGA 1TQIA 1DGWY 2H8WA 4RGRA 1G6NA 3ERMA 1SFXA 5BPDA 3KEOA 2CMPA 5FD5A 1Q1HA 2KRHA 2NOJB 2PG4A 4DJAA 3L7WA 3W6VA 3W2WA 1FYMA 4M3DA 1XGOA 3BJ6A 3FIWA 4HX7A 1MH4A 1AA7A 3I0TA 1IC8A 3BR0A 3R61A 1QZZA 2HXOA 1B8IA 1X1DA 5CKTA 5K1YA 2WB1A 3WU1B 3Q0WA 2L7FP 1ZGWA 4S04A 2DQLA 3DU5A 3CO7C 1I1GA 1XDUA 2E71A 4KIGA 1LFUP 2ZXHA 2CG4A 3DBHB 2JK3A 2H1KA 3HHGA 2AXLA 2ESNA 4HA8A 5H6RA 3FXQA 2KISA 1OPCA 3TO9A 2R7DA 4BL0B 1DQUA 1QPMA 4L5IA 3HOZJ 2L9NA 3S1NJ 2BHZA 5CVUA 2MLGA 4M3FA 4CH7A 1FT9A 3BJOA 3GEZA 2R7VA 1UFMA 1IRZA 5K7HA 1V3FA 2BGCA 2DA7A 4HF1A 5BNGA 5JVTA 2R7TA 2XUBA 4EJVA 1BA5A 3F9KA 1PUFA 4XRFA 1SAXA 3L2CA 2UZKA 1LE8A 1K6YA 1NHAA 1X2NA 5LGUA 1U5TA 3LSHA 3F8FA 4XICA 1ONVA 1R6RA 2VLAA 4L0ZB 3H5AA 1N25A 2NVUB 5E3NA 3GUDA 1IRFA 2A05A 1IXRC 2MABA 2HOAA 1BOAA 2V9KA 2Y0SN 4BJ5C 1FIAA 1W5TA 1OMIA 5IOZA 3CCEI 3LA3A 5D6FA 4NNJA 1NTCA 5IP9J 2KRFA 1MBJA 2ECCA 4DIQA 2BYVE 3J7ZI 2HPMA 2H09A 2DMQA 1SD4A 2M8GX 2VONA 1UAAA 3GTGJ 1J59A 3GVAA 2XKPA 4KNYA 3U1DA 1I3AA 3HOVJ 3KP3A 2DA1A 4U0VA 1W7PA 2CQNA 2DMUA 4MLOA 5D5VB 4KIFA 5FKOA 5IP6A 3MZYA 4IHXA 1WFXA 1TW2A 3K4MA 1X3ZB 4U88A 1VQ6I 3GTMJ 1QQIA 3OR1C 2JVHA 4UXNA 2QBYA 1HDDC 3HGYA 2FXAA 3OIPA 1FTZA 2KHMA 1JI8A 2E1NA 3IV5A 4AYBN 1SEUA 4D5CA 2DA2A 3TP3A 2HDWA 2XVCA 1BI3A 2WY8Q 4R1HA 3MVPA 5LHIA 1XCBA 2HNHA 1REPC 3OS2A 5KAIC 1MBEA 4JX5A 2XPUA 2GIZA 3FMRA 2HDCA 3RKXA 4Y7NJ 2FSWA 1TNTA 2HYGD 4AC0A 2XV4S 1YG2A 4XL9A 3T8RA 2DYRH 1YW7A 1X1PA 4P1WA 2F48A 3V4GA 4EV0A 1MKMA 3I4NJ 5IYBJ 3LSRA 3BTCA 4ZYAA 4AIJA 2UWMA 1SAUA 1ZH5A 2LY9A 1MNEA 5F08A 2HYFA 3KZYA 2VBYA 4A3FJ 2W82A 2IP2A 3M8FA 5ICGA 3PJRA 2AQEA 3BROA 3COAC 3WU0A 2GAUA 2HQNA 3C1DA 3BC8A 4V2GA 4A2UA 4XN0A 1YS6A 4B3XA 2R7UA 5EYRA 3H1CA 4HNVA 2CFXA 2CGPA 2LLKA 2YR2A 3E0JB 3SQNA 2Q2EB 4L9JA 2DOAA 1P4XA 2D1VA 2OU2A 3C3WA 4IOCF 5D5WB 5DEQA 3RJPA 4PJNA 4FASD 4QPQA 3S17J 4XBFA 2CO5A 2E2HJ 3QQAA 3ZMZA 2QSGX 5H6QA 1W4MA 3S1MJ 3MFKA 2Y0MA 4F52A 4ANJA 3ZQLA 2XB5A 2OV7A 4A69C 4L18B 4UHTA 3WTSC 1GXPA 4JX6A 5JR3A 1HW5A 3A02A 3V7RA 2M2EA 1SANA 2VT2A 3MKWB 4UUVA 2VQGA 3AG2H 3HSFA 1RC9A 4EM0B 2X4HA 1ZGAA 1RUOA 3GTOJ 2Z3YA 3S14J 1JKQC 1NK3P 3RDIA 2EIMH 1S7EA 2L9SA 5M3MJ 3GMEA 2RNGA 2L7ZA 5FLXK 2M7AA 1SD5A 5LGTA 1A04A 1OCZH 3KYCB 1ACIA 2BW3A 1VQ9I 3QP6A 5DD4A 1D0ZA 3QOEA 2W1OA 3S2HJ 1MNMC 4OMYA 2CUEA 5EF6A 4GGGA 2Q8KA 3LFUA 4PSXA 1XS9A 3F3XA 3K4BA 1Z77A 4S05A 2BY1A 2CW8A 1K78B 5DD8A 2ELJA 3LSPA 4I6ZA 1XTAA 2KIQA 3KP4A 5J40A 2V7FA 2LD5A 4ENNA 2F2EA 2NAZA 1A31A 4F93B 1G4DA 3M4OJ 5L3DA 2STWA 5FJ8J 1QVUA 3VOEA 5CQGA 1A6IA 5FKKA 3GF2A 2FU4A 5M5XJ 2WBMA 3AKZA 1USSA 5LBQA 1P7JA 2V4JC 2RDPA 3I55I 2EQRA 3ZGKA 3ZN0A 4DYQA 3K0LA 4PFOA 1D0XA 1W5CC 3DP7A 2R7FA 4PJJA 4I02A 2ZJPF 1Z0XA 3HEFA 3PO2J 1ITYA 2FRHA 2CRGA 3Q5FA 3HUGB 5J4YA 1AWCA 2DA5A 4EM1A 3CUQB 2L7KA 2O6GE 4E7HA 3CP8A 2DA4A 4NHJA 3JRCA 4KYWA 3EYYA 4RB3C 1ZKGA 5EDNA 2IGKA 2GM4A 1T33A 5C3EJ 4A3DJ 1I27A 1TQMA 2VE8A 1F4KA 2CQ7A 3LQQA 4L9VA 3RZDJ 3OYIA 1PDNC 3CUQA 2MW8A 4ITVA 3IC7A 3ZP5A 2XRNA 2K9LA 2BZTA 2DCEA 2FD5A 3HKZN 1FIPA 5KVRA 1A5JA 5GPCA 2L4AA 4BXXJ 2EZHA 4CHUA 3HOTA 1FOWA 1BC8C 1TL8A 2FE3A 1BJZA 2XGEA 1LQ1A 2O7OA 2CWEA 1GVDA 3Q3SA 5ILVA 4HSTA 3ZMUA 4X6AJ 3ZPLA 3FXRA 3MKLA 3I59A 3W2VA 1U5TB 1GHCA 2ME0A 1O7LA 4Z2YA 3BR1A 2F5DA 2BBYA 2EV0A 1TTYA 2FMYA 3DPLC 3BR5A 3SZPA 3I71A 3E5XA 1R23A 1G3TA 2G7UA 1JE8A 3ZQIA 1JJ8C 1FSHA 4OIQF 1IN6A 3BPVA 4GYGA 4XLCA 1YFHA 1JT0A 2HYJA 2HI3A 2W7NA 1QU3A 2E34A 2KJBA 2X6XA 2P81A 1VI0A 1ZG3A 2NVXJ 3OOPA 2OC6A 2ZSHB 3ABLH 3LSTA 3WTXC 1K78A 5FGMA 3VEPA 5L3BA 4O6JA 3I54A 1BIAA 2RQPA 4L9NA 3E5UA 1QZYA 1IN4A 2Y69H 1GXQA 4CCLA 3H0DA 2N8GA 4EGZA 5D5UB 2ACJA 2K9NA 4KDPA 2ZJ2A 4UVCA 2V1UA 1TWFJ 1XG1A 1FWZA 2H8RA 2V6CA 2Y0SA 2BV6A 2VBZA 1LUJB 1BM9A 3WTWC 3OY9A 1K61A 3G1MA 2GIVA 3LSKA 3I9V2 1IZ1A 3AAFA 1JUSA 2BE5F 1ULYA 1S3JA 2UV1A 1BBYA 1B6AA 3BJAA 1OJLA 1SMYF 4JQFA 4CZZA 4CSWA 2W84A 3FISA 2VOPA 2LP0A 5ICFA 4BHBA 3ZQQA 5ICCA 2K85A 3E6BA 2QM3A 2MFZA 1WJ5A 1LB2A 1LEAA 1Z21A 2P5KA 2NVTJ 2PQ8A 5IOYA 3CDLA 3W3CA 2HOSA 3PNTA 2L54A 3KCCA 4M72A 2M0MA 4BBRJ 2QZ8A 1IRXA 1ENHA 1WGXA 3M8JA 5L3FA 3ZMVA 3DKXA 2H6CA 3IRQA 2A5YB 1R22A 4XM3A 3RIRA 2MYSA 3QWLA 3OS0A 1T38A 2HKXA 4EEFG 1F43A 1OQYA 2EFNA 4WXHA 2JZYA 2R5ZB 1HSTA 2R7XA 4BBSJ 1DGRM 2QCOA 1V5FA 1S5LC 3TOBA 3I4MJ 3VODA 1W5SA 4AYBA 3GTLJ 3NAUA 3FK6A 4AD9A 5JVGF 2B0LA 4PDKA 4B3AA 2J5PA 1L0OC 1LKXA 4MIMA 1SD7A 3DKWA 1MMAA 1KU2A 1YE9A 2DTRA 4WCGA 3PSFA 2M45A 2Z2SB 1P4WA 2JVGA 3M8EA 5CVJA 1S6LA 3S1QJ 2XSJC 4EVIA 3JW4A 4RM3A 4QSHA 5GAEJ 5HODA 3S15J 3KP2A 1K7AA 4LB6B 3A01A 2DT5A 3VPRA 5IYCJ 2BOLA 3PSIA 2P6SA 5E18F 1QZEA 2LY1A 4UUSB 3O3KA 4HYEA 3DKYA 4HLYA 5E3LA 2P8TA 3N05A 3CUQC 3J81Z 2M87A 2P7VB 2R92J 1GUUA 4A6DA 2DJIA 2QWWA 1JGSA 2J5OA 1EH6A 2VQCA 3TW6A 1X1BA 1F1ZA 5E20A 4RB1A 3MZHA 2JA7J 3LAPA 1V54H 1OYWA 5K7FA 3T1BA 4LLLA 2KL4A 2HR3A 1MMNA 1N75A 2L0KA 1G3WA 4B44A 1TWAJ 1Z67A 2V9VA 1XD7A 1JTXA 2VPRA 3FBNB 1V5GA 2VJ4A 1D3YA 3QP5A 1Y0NA 3IH2A 4FETA 5DS9A 3DV8A 2F6CA 2QENA 4HOBA 2LSOA 1YX3A 1EH8A 1FOXA 3QODA 3K4NA 4I7HA 2OTJI 1N77A 2XASA 1P9QC 1HCRA 2IS4A 4XRSG 3CJQB 1NG6A 5E3MA 1TWGJ 3BCBA 1B72B 3DBRB 1R7JA 3G6EI 4KFCA 5E1XA 3OYDA 5H20A 4IX7A 2HU9A 2Z33A 1DU0A 2DO7A 2E36A 3AL0B 3KEYA 3WGIA 1MSFC 1FBQA 1WH7A 1G3YA 4ZZLA 2PJRB 1FLIA 3HC7A 3CMAI 3QAHA 3E3VA 4OAYA 1FY7A 1XSDA 3CCYA 4LK1F 2DA6A 3QU6A 3BG3A 3V8KA 2CW0F 3ECHA 4R79A 2JWTA 1B9MA 1IGNA 2CFOA 5F0FA 4UUTA 2FNAA 3H5RA 2EZKA 4PFPA 5FO5A 4DZPA 4G8XA 5DUIA 3WODF 2JA5J 3GXOA 3K1MA 4JYKA 2CV0A 2K86A 1F9NA 2W24A 3UKGA 3ZQFA 1OR7C 4OWRB 3GO5A 1X2MA 1ZYRF 1XGMA 1HF0A 2QKMB 5FFXA 3RYPA 1ZLJA 3ABTA 2WWYA 3OYBA 2ISYA 2W00A 1XX5A 3PIOF 5F6FA 1VQMI 2QKLB 2QF7A 4HRIA 4JX4A 3BP8A 4BGDA 2LFBA 2QYOA 3ZMDA 1Z91A 3GFIA 4OOIA 3OYHA 4ZH4F 5CQEA 2M5WA 3R0AA 4EQQA 5BQTA 3BR2A 5JLWA 3SJMA 1I6HJ 4YG2F 4Y4RA 3T8TA 3GTJJ 1B1BA 2H6BA 3CP2A 3BTIA 1R5ID 2CW7A 2K3PA 3SHFA 1GVJA 5JFRA 1NH3A 1TW3A 2IPQX 2WB1N 5FRMA 1KQ8A 1I6XA 1TQPA 1YOVB 2M4GA 2V26A 4XN3A 1BJAA 1APLC 1A36A 1ZREA 3BOQA 1XGNA 5BOXA 1CGPA 5IP7J 1ZLKA 1VQ7I 1Z9CA 2E7XA 1IUFA 3W6KB 4RGSA 4IHSA 3EUAA 1K83J 3JRGA 2H1LA 1LDJA 2PMUA 1IXSB 2M8EA 4XLHA 5J6XA 3OYLA 3M1CA 2FF4A 4E7KA 4YRVA 2TRTA 3L2QA 2EJRA 3CZ6A 4BEHB 2XRLA 2MLKA 3EUHC 3H3VK 4HQMA 3IWZA 5C4JJ 5JLXA 3EETA 3K70C 1MJAA 2VJIA 3JSOA 1AU7A 3CJTB 3NWTA 4GXOA 4I99C 5LD2C 3DEEA 1QVTA 3DPTA 3ZR8X 3QPLA 5J1RA 3CO6C 1J0RA 3RZOJ 3VYRB 3TGNA 3WTUC 3H9JA 3OYMA 2IW5A 3H3ZA 5KAFC 3KZIC 3RYRA 2DFIA 3BQYA 2XAQA 5DUKA 4HZFA 2OQRA 2EIKH 2IA0A 3ESWB 2WC2A 4NQWB 4E7SA 5KNLA 1HKTA 2NVQJ 3NWSA 2KT0A 3HOUJ 1T0FA 2EIJH 1MBGA 4I09A 4BNCA 4B43A 4IKFA 1Z6TA 2QLZA 3R6SA 2HDDA 1EH7A 1G8XA 3FZVA 5LRRA 4C3JJ 2CV1A 1IW7F 4I98B 4O3MA 1D8KA 2XAHA 2KIFA 1YJWI 2XROA 4P96A 4XKCA 4XONA 3S32A 1BIBA 4LIVA 5LGNA 4OIOF 2VJJA 2IAIA 2FJ1A 4UV8A 4A3MJ 2K9SA 2V1DA 1Y56A 4WX9A 4A3GJ 2IJLA 4ZDOA 4D1QA 4IOAF 1D1CA 2R7OA 2Z99A 3EPZA 4KICA 1ODDA 2BW3B 1J5YA 1R9TJ 1ZQ3P 1N78A 4BE2A 1JTYA 3DU6A 4HDVA 3H9QA 4G7ZF 4PSWA 1HKQA 1WJDA 2VI6A 3LOCA 2P0WA 3G4SI 4Y17A 3DEWA 3K6GA 4AUXA 4LFUA 2XPVA 4LGWA 3IRRA 2HKOA 2QVOA 3HOSA 1R58A 1FYLA 5J8CA 3A01B 3TO6A 2JRTA 5AIPA 1E3HA 3HZJA 1ZRCA 4BUPA 3VDXA 4U7DA 3BY6A 3AL0C 2KFDA 3NQOA 3QPHA 4ZYEA 2VKEA 5IYDJ 2HWVA 2WA0A 1VNDA 4L9TA 1POGA 3E97A 4ETSA 2IBDA 2LH9A 2CJJA 3ZRGA 5IPAA 2A5WA 2EWNA 3K4LA 2GA2A 1WI3A 4A3KJ 1BI1A 4PCQA 3TO7A 1VQNI 1J2XA 2DK8A 4DNCA 1HLVA 4M3GA 1XC5A 1FJLA 3P9KA 2RC4A 3HRSA 1R71A 2PLYA 3BG6A 5B1BH 3KLOA 2HTSA 3REOA 4EJWA 1FOKA 4XMYA 3SDBA 1SD6A 4IHWA 3AG3H 1YLFA 2PJPA 2FBIA 2VQLA 1TP4A 5FFZA 1X4PA 4HAMA 1KYZA 2CQQA 2DJNA 4A6EA 1ZG1A 4AM3A 2MC3A 4IHYA 2YU3A 3H9GA 1UZCA 3F8NA 3LA7A 1W0TA 4HF2A 1S9HA 2QQ8A 2QSHX 3CCQI 1XN7A 4QTRA 1JUPA 3OWTA 2ZNYA 2L5QA 2DQRA 1IDZA 2EPFA 5EGOA 3CTAA 2R93J 2OCCH 4XIDA 2X1DA 1U2WA 3D5LA 1WCMJ 4C9YA 5HNFA 4ENMA 3ZXSA 5HOOA 3FM5A 3QRFF 4DBQA 1YHQI 3FXLA 4U87A 4P9UA 2HOTA 1U3EM 1IJWC 1LDDA 1RKWA 4F55A 4CDGA 5LFAA 2EZIA 1YW8A 2XAFA 2EB7A 5EG0B 3FXJA 4BH9A 4G7HF 3ZQGA 3QYBA 2OBPA 4HNUA 2HVQA 5DCMB 4G12A 2JUGA 2NS0A 2GQQA 4J19A 2YSRA 3J7YJ 3NEUA 3ISPA 1Y1WJ 3GX4X 3F21A 4CCMA 1WH5A 3WHBA 5D8KB 1QHGA 4II3A 4KIBA 2DXIA 3ZN1A 4B47A 1FC3A 1G3SA 2XPWA 2MBFA 3KPHA 5IT3A 2M1BA 5TISC 2I8DA 6PAXA 3M7GA 3JAMZ 1E2XA 3B6AA 2V6EA 1AHDP 4ZTFA 1DUXC 5M5WJ 3H36A 3BG9A 1HW2A 4BKXA 1Y0UA 2Q2EA 1C0WA 3BT9A 5ICEA 2LVSA 2QQAA 2NXNB 4ASNA 1UHMA 3JTHA 4HV6A 3K1PA 5E8GA 5FROA 3ECOA 3F22A 4BE0A 3TEDA 1T2KA 3SZGA 4OIRF 4D0PA 4Y33A 4FISA 3JRFA 1YITI 3OOUA 1HW1A 2R7QA 3DTEA 3OSGA 4N9IA 3LNQA 3FXKA 4QLCU 3ZQ7A 4CUGA 2FUG2 3LSJA 2W57A 1YIOA 2BY2A 1ZR2A 1RNLA 3A1YA 1R5GA 1V5EA 1VF9A 2AXTC 2D1HA 5EEHA 5JHFA 4LITA 2EV5A 4XLFA 3GTQJ 2VKHA 2HQAA 5HS8A 1L3LA 4KISA 2ZFWA 4A3EJ 1OYIA 2F4OB 3F6VA 3O6BB 1QHHD 1KONA 2VQHA 2TDXA 1Y8QB 5B3SH 1O3SA 4G94A 1B9NA 4AIKA 3ASNH 1P7IA 2PMZA 4BDYA 2I10A 3FM3A 1PUFB 1D8JA 3HRUA 1PP8F 2QBYB 4UB8C 4DBRA 2V9PA 1Z7LA 2ZMEA 2JA8J 2NNYA 4LLNA 3AFHA 3HM5A 4BU2A 3GFLA 3V7CA 3TP0A 4YFNF 1GT0C 2BXZA 4NUBA 2KP6A 5F64A 3RKYA 3LWFA 3IAS2 1KQ0A 1R1VA 3OV8A 5L3GA 2O61A 4CYCB 2F5EA 3JRIA 3L2WA 1ZG5A 4MQVA 2K5CA 5IT9K 2CH0A 4E4HA 4BS9A 3P9IA 1NG7A 2VB6A 2JPCA 2E1MB 5CLSA 2L02A 4XORA 3RSNA 1J9IA 3MMYB 1LVAA 2PMZN 3TDZC 2OF7A 3HOWJ 3DWLE 2LG4A 4EGYA 3CESA 2LR8A 4PZJA 4LLGF 3RKWA 4KA4A 4RGUA 1TWCJ 3A0HC 1YO5C 2EILH 4CO8A 3ULQB 1I3QJ 4GO1A 4HPQA 1RI7A 1R5HA 1O4XA 2X85A 3TQNA 1YS7A 4E70A 4WWCA 2Y31A 3B02A 5HLTA 1HQCA 3OYJA 1UB9A 3ASOH 3JRDA 2LKSA 2GOMA 3GWZA 5ED4A 2IS2A 2MD0A 3DXJF 3VB2A 2BY3A 3LL7A 5J1YA 1U0JA 4MTDA 2K4BA 1YJ9I 5FRNA 3FXUA 1JKOC 4B1RA 3J7AY 1IRGA 3LFKA 1MH3A 3G73A 3HRTA 2P4WA 3O2PE 3WTYC 1QA6A 2W4SA 2G7HA 1MIJA 1BI0A 1MW7A 3TW7A 2PBIA 3CUOA 3RPQA 2M7BA 4MQ9F 2O0YA 2DPDA 4NDLA 4XSZF 4A12A 2KLOA 2LMDA 3ZQHA 4BHPA 4Q5SF 4GCVA 2W48A 2OTLI 2B63J 3HKZA 3IAM2 1U8BA 2EINH 2AO9A 4B48A 4CZCA 3FMSA 1USTA 3CCVI 1BR2A 2LREA 1OYYA 3D0SA 4XLAA 2HZDA 1B72A 4HNTA 1IDYA 4BQNA 4CGZA 2FX0A 2BEOA 1G2HA 2TCTA 4BY1J 1A6QA 3RQIA 5LEJA 2HGCA 1LFBA 1DPRA 4XRSA 1BI2A 4IRGA 1IAWA 2CUZA 4HX4A 4C2MJ 4W97A 5L3CA 1X19A 4R8HA 1ZR4A 1CQTA 1FX7A 2DU9A 3Q9SA 2CYYA 3S3MA 4XKWA 1MBKA 1TT0A 3ABKH 3ZMTA 1X1CA 4KJZA 4BYYA 3ROUA 2YX7A 1F36A 3OSFA 3HOYJ 3CQZJ 1RKTA 2NS8A 2FOWA 3CLQA 1RPWA 1KU9A 3PQJA 3OYCA 2OZ6A 4M6YA 1JJ6C 1LJ9A 2X6WA 1DP7P 2HQRA 5E1WA 1FEXA 4ZJZA 2XC7A 1HDPA 4LMYA 4CXFA 2Y9ZA 5CVVA 3U1KA 4XK4A 1U8RA 1WJAA 2FA5A 3I3LA 4XOPA 3AG4H 2XGCA 2OQGA 4A0YA 1BW5A 4NB5A 2E2IJ 1EKEA 5FLXZ 1PJRA 5EEGA 3PM1A 1VZ0A 3QYFA 1Z05A 5HLGA 5KK1A 4PK4A 2G0EA 3Q9VA 5GP9A 2ELHA 4Y52J 2O8KA 1UHWA 3WU2C 4XKVA 1EF4A 2YX4A 4O5VA 4A0XA 5FKNA 1FTTA 3EYIA 1OCOH 2VT3A 4M73A 2F5VA 3FXOA 3HG9A 2F4IA 1OR7A 3K2AA 1Z3XA 4BJTA 2XF7A 2H94A 2JPBA 5CVRA 2E1CA 2XF6A 4IEJA 1HSJA 4A0ZA 4IXAA 1AKHB 4FQGA 4U7BA 3SFIA 1LFPA 4EMSA 3HDDA 2WADA 4HQEA 3DLAA 1UG2A 3L09A 5ILSA 1LNWA 3FMQA 5GTIC 2IS6A 2YUSA 2NOGA 4II2A 2KZGA 4Y13A 2KDZA 1OCPA 3U21A 3IWFA 3TMOA 5C44J 4RA2A 5TRDA 3GTKJ 1U9NA 2MD5A 3I5UA 4OMZA 4CYDA 1Z7UA 1T95A 3IH3A 4G9YA 2ETHA 4OAZA 4CCNA 2AHQA 1XSVA 1Y6IA 2ID6A 2COMA 4QIWN 2FQ4A 4Y15A 2LBFA 4GRIA 2NRAC 4KITB 2BVMA 3ONQA 4B09A 5C4XJ 3P9CA 1GLNA 3PL8A 1FMVA 2L9VA 1WPKA 3CC7I 1JUMA 5DM6F 1W7PB 3MQ0A 3CCRI 2V79A 3K7AJ 4MEYF 3CCUI 4LB5A 2QQBA 3L1PA 2HXIA 2VOOA 3RPUD 4PGGA 1P4AA 4HSRA 1IV6A 1MMSA 4ENKA 4J00A 1FMWA 1ZTRA 4AVZA 1FSEA 2OA4A 3HL2A 4BQAA 4BQQA 2HZTA 3DLLF 4N0BA 5FD6A 3G3ZA 3UR3C 1J75A 2B9SA 2A61A 2AS5F 4IQ4A 4KMFA 3V42A 2W85A 2QA4I 4BY7J 4FTHA 4J01A 2F4MB 2JN6A 2CS3A 2VE9A 2M9HA 3VWBA 2R7ZJ 4D7MA 2DPUA 2X6OA 1H9GA 2ZXWH 3U2RA 3LAJA 2KIMA 1Y39A 3ZQCA 1XCVA 3A0BC 1BOBA 3DTKA 3M1EA 4UVAA 1ZRDA 2A6TA 2AQFA 3JCUC 1EA3A 3RPUA 1U6GA 4IPAA 5K5RA 1BC7C 2JJ7A 1XPXA 3OIOA 2A6EF 4XOTA 3JRHA 1VQPI 2A07F 1ORKA 4PUSA 4HDUA 3K10A 4RAYA 4LJZF 3DQVC 1B59A 2E1OA 3BZCA 5J8FA 1E3OC 3FK7A 1STZA 2CUJA 4M3BA 1RETA 3J80Z 3DF8A 2WV0A 2K4JA 2LF8A 2RVCA 4AU7A 3E6CC 3SEZA 4C2UA 5DM7F 4E6KG 3CJNA 2IXSA 3GW2A 3FX3A 3PIPF 4P9FA 2M34A 4XRMA 4DYRA 3B6CA 3E6MA 3D5RC 4HW0A 1ETWA 2ZSIB 5FB2A 2E5ZA 2OD5A 1ETXA 4FX0A 2MG4A 4UVBA 1OCRH 1WJCA 5HLHA 1RR8C 4F91B 2DTZA 3OL4A 3MEXA 2DMTA 2PMHA 2OAZA 3IP4B 3QU3A 4I0AA 1SC7A 2DBBA 1J09A 2HOEA 1PYVA 4M3EA 3KFWX 4FE7A 1XMKA 3OYAA 3L2VA 1UHSA 1I5ZA 5L3EA 3C2GA 3LSGA 4UB6C 1YJNI 1RR7A 4WF2A 1PVEA 3WE2A 5J1UA 1JKRC 5HLIA 1VQ5I 1XB4A 2QQ9A 1ON2A 1K4TA 2CQKA 5TGTA 3CF5F 4L0YB 4EATA 4NC8A 1ZAOA 2VN2A 3FKJA 4KT6A 2HPIA 2RREA 1Y1VJ 2WY7Q 1EV7A 2VBXA 3MCZA 4RB0A 5FKMA 3PNVA 1YI2I 1KQ9A 3HOXJ 1O7FA 3MKYB 3OR2C 2XDVA 2WTEA 2R0QC 3LMMA 1WHUA 2VL8A 2VJ5A 4XQFA 4IRIA 2DYSH 2GLOA 3HPHA 2MH9A 1X4OA 2KQRA 2NS7A 4M6XA 1K79A 3OYGA 3H0GJ 4B4CA 1O3RA 4HF0A 4A3IJ 3KP7A 4M9SA 3I58A 5HS9A 1KU7A 5D6EA 3CMYA 3I56I 1D5VA 4JP0A 3J81K 2RGVA 4X1EA 3A4CA 2L7MP 4XNFA 3IL2A 4PJMA 3I53A 5EZGA 4CCOA 5E1ZB 2EV6A 1ZHFA 2JSCA 4E7LA 2OJED 2OZUA 2C6YA 3KEQA 4IHTA 1MNDA 2IA2A 4MNUA 2IGOA 4ESFA 1GDTA 1JHFA 2IS1A 3L2UA 4UV9A 2JA2A 1IV8A 4P55A 2E5NA 4M74A 4ENJA 2K7LA 2X1EA 2IGMA 2R5YA 1IUYA 2DT7B 2EH3A 3HIFA 3HB9A 3L00A 4RLQA 3GBGA 2ZFUA 1X1AA 3LSMA 3H3UA 4QPOA 2HTJA 3OYNA 4X0GA 2IT0A 4BJ6C 4GDFA 3AG1H 1W36D 1Z6RA 3T0YA 5D4SA 2LNBA 1SFEA 1YIJI 1YW9A 1WSUA 4CA0A 4N4OB 1DDNA 1T56A 3PFYA 1ETQA 5FLMJ 5A2QK 2Q0OA 1LE8B 1TT5B 2DFEA 4E7JA 1HXDA 4MGRA 2EA4A 1WI9A 4U0YA
chains in the Genus database with same CATH topology
2HQAA 2LBFB 1D1AA 2X6YA 4KISA 1Z3YA 4IQJA 2VIXA 2UV1A 4DOZA 1QHHD 4JQFA 1KONA 2E1MC 2VQHA 3K70D 4CSWA 4E7ZA 1G59A 2PMZA 4BDYA 3ZQQA 2R7WA 2MFZA 1WJ5A 1Z21A 3W3CA 3PNTA 2VXZA 4DBRA 4D9JA 2M0MA 1Z7LA 3ZCOA 1IRXA 3AFHA 2IGNA 3M8JA 4BU2A 2BVLA 1WJFA 2LOOA 3DKXA 2WAEA 3LSIA 4HG2A 4XM3A 2MYSA 1WJEA 2KP6A 2LC2A 4NUBA 3OS0A 3IAS2 2LYCA 2HVSA 3L2WA 3OYFA 4NC7A 2K5CA 2R7XA 4HEA2 2CH0A 5KHDA 4E4HA 1DGRM 3E1SA 4BS9A 2R7SA 1V5FA 1NG7A 2VB6A 4AYBA 2E1MB 3HXLA 4XORA 3RSNA 3MMYB 1LKXA 1MMAA 4RM2A 1YE9A 2VPLA 3DWLE 3G2BA 3PSFA 2Z2SB 2LG4A 2JVGA 3CESA 3K4CA 2XSJC 4RM3A 2XF5A 4CCJA 4HPQA 2HVRA 2X85A 2KPMA 3EUKL 2UUZA 4DGWB 5HLTA 2BOLA 3OYJA 3PSIA 5HVQC 2VKDA 4YEJA 2LY1A 2GOMA 2IS2A 2MD0A 3LL7A 3DKYA 3MD2A 1U0JA 3N05A 5FRNA 3J7AY 1LDKB 2W4SA 2X51A 2DJIA 1UG0A 1MW7A 2M7BA 2VQCA 1X1BA 1DGWY 5KCMA 2KLOA 3DPUA 2KL4A 2CMPA 1MMNA 1N75A 2KRHA 2NOJB 4LG3A 4B44A 4DJAA 2ZXIA 3HKZA 3IAM2 3W2WA 3FBNB 2R7RA 1V5GA 2LRDA 1YX5A 2L2OA 2VJ4A 4B48A 4CZCA 1AA7A 4ZC3A 4FETA 5HNHA 1MMDA 3KYLA 2F6CA 1X1DA 5CKTA 1YX3A 1BR2A 2LREA 2WB1A 3CF2A 1BR4A 3QODA 3DU5A 3K4NA 2E60A 4XLAA 2HZDA 4E7IA 4HNTA 1N77A 4BQNA 4LIUA 3RCOA 1P9QC 2ZXHA 2IS4A 3CJQB 3OMYA 1NG6A 3BCBA 3PUBA 4BL0B 2WAFA 4ZDLA 1DQUA 3OYDA 2L9NA 2HU9A 4IX7A 3S3NA 3AL0B 3KEYA 4CH7A 2R7VA 2PJRB 2CUZA 3HC7A 4OAYA 2R7TA 1X19A 3F9KA 2KDOA 4R79A 1K6YA 2CFOA 4BQOA 3S3MA 4XKWA 3H5RA 1TT0A 3LSHA 1X1CA 4KJZA 4PFPA 1ZELA 1R6RA 2VLAA 3H5AA 2CV0A 3OYCA 2MABA 2O5RA 2V9KA 4BJ5C 2X6WA 4BE1A 1OR7C 4OWRB 4ZJZA 2XC7A 2QKMB 4N4NB 4NNJA 3OYBA 1WJAA 3I3LA 2W00A 4XOPA 3RQ4A 2KMUA 2QKLB 4DIQA 2HPMA 4HRIA 3PNYA 1PJRA 1ERDA 4BGDA 1VZ0A 3IUOA 3QYFA 4ZTJA 1UAAA 2M3AA 2Z1DA 3OYHA 4PK4A 5CQEA 3HPGA 3H5NA 4XKVA 4Y4RA 4BEHA 3CP2A 2CW7A 2K3PA 4MLOA 2F5VA 5FRMA 3HG9A 1WFXA 2F4IA 2JSPA 3K4MA 2M4GA 2V26A 4XN3A 3OR1C 1Z3XA 2JVHA 4F92B 1WJBA 4BJTA 2XF7A 1LVKA 2XF6A 3OIPA 2KHMA 1JI8A 4U7BA 3EUAA 1LFPA 3W2AA 2WADA 2HDWA 2WY8Q 3DLAA 2IS6A 4XLHA 3OYLA 4XLEA 3M1CA 4II2A 3L2RA 2HNHA 4E7KA 4YRVA 3L2QA 3U21A 4BEHB 3CZ6A 2MC4A 3TMOA 3OS2A 3EUHC 3FDYA 4F3QA 4BDZA 3K70C 2VJIA 1T95A 3SEQA 3RTRA 3K4KA 4OAZA 1BR1A 3NWTA 4CCNA 1Y6IA 1HA8A 4XL9A 5LD2C 2Z16A 4P1WA 3DEEA 3DPTA 3ZR8X 2LBFA 2LY2A 4GRIA 3VYUB 4KITB 4Y3OA 2BVMA 3BG7A 3VYRB 4XKBA 3ONQA 4ZYAA 3OYMA 3H9JA 2UWMA 1SAUA 1GLNA 3PL8A 1FMVA 2XAUA 3VSKA 1MNEA 2RQQA 3FBIB 2W82A 4NQWB 4E7SA 5KNLA 3NWSA 3RPUD 4HSRA 3PJRA 4B43A 4J00A 1FMWA 2AQEA 4IKFA 4AVZA 1G8XA 3BC8A 3HL2A 4BQQA 4XN0A 3VSLA 2CV1A 4B3XA 2R7UA 3UR3C 4JOMA 4XKCA 4XONA 3S32A 3E0JB 4IQ4A 4LIVA 2Q2EB 4XR6A 2DOAA 3V42A 3DTIA 3VYSB 2VJJA 3K4JA 4FASD 4PJNA 4QPQA 4J01A 2CS3A 3VWBA 1Y56A 1UELB 4ZDOA 4D1QA 1D1CA 4F52A 2R7OA 4ANJA 3EPZA 1BOBA 3BCAA 3DTKA 2OV7A 3S3OA 2BW3B 1N78A 1SFKA 4BE2A 2A6TA 2AQFA 3DU6A 1EA3A 3H9QA 2WAQA 4PSWA 1WJDA 3MKWB 2P0WA 2VQGA 3S8PA 4XOTA 3OYKA 3C2HA 3K6GA 1T0FC 4PUSA 3D5SC 2X1CA 3HOSA 3K10A 2L9SA 3DQVC 2RNGA 2M7AA 4BUPA 3VDXA 2CUJA 2KZVA 2BW3A 3AL0C 1D1BA 1D0ZA 4AU7A 3QOEA 3S93A 2WA0A 2W1OA 3SEZA 4C2UA 4E6KG 4H4KC 2LH9A 2IXSA 4G6TB 1TZLA 3LFUA 4PSXA 3ZRGA 3K4BA 2A5WA 2VASA 3K4LA 3D5RC 2ZSIB 2E5ZA 2CW8A 2ELJA 1WJCA 2V7FA 4F91B 4RMNA 4F93B 3OYEA 1W36C 3BG6A 3TL4X 3OL4A 5CQGA 3KX2A 3CJRB 3IP4B 4XMYA 3SDBA 3A2KA 1J09A 1PYVA 2WBMA 3AKZA 3OYAA 3L2VA 2VQLA 1X4PA 2V4JC 3C2GA 3LSGA 3UNGC 2VXDA 3ZGKA 3H9GA 4PFOA 1D0XA 4PJJA 3CMMA 3BLYA 1S9HA 4CCKA 4IZZA 3QYEA 3OWTA 5TGTA 3HUGB 2L5QA 4EATA 4NC8A 3FKJA 3OS1A 4KT6A 2L7KA 2HPIA 2RREA 2Q1ZB 2K9MA 3CP8A 4E7HA 2X1DA 2WY7Q 3VYTB 3PNVA 3D5LA 2IGKA 4C9YA 2OUMA 5HNFA 2PJRA 3MKYB 3ZXSA 3OR2C 2XDVA 5HOOA 3LMMA 4YELA 2VL8A 2VJ5A 4DBQA 4XQFA 3OYIA 3HPHA 4U87A 1OLTA 4ITVA 1X4OA 2GOXB 2KQRA 4F55A 2M4KA 1E0EA 2K9LA 3OYGA 2DCEA 5LFAA 4ZDPA 3QYBA 4HNUA 2HVQA 3HOTA 2JUGA 3FHNA 4C30A 3H35A 3OL3A 4HSTA 4CCMA 1QHGA 4II3A 2DXIA 3W2VA 4B47A 3A4CA 4XNFA 2R4GA 4PJMA 4CCOA 3MKZA 1D0YA 4E7LA 2I8DA 1MMGA 3DPLC 2KRCA 5CPRB 2V6EA 4ZTFA 1MNDA 2IGOA 2IS1A 3L2UA 2JA2A 2E5NA 4XLCA 2X1EA 2IGMA 1QU3A 2W7NA 2DT7B 3SYTA 2X6XA 4RLQA 3GBGA 4RLFA 2OC6A 2ZFUA 2ZSHB 5FROA 1X1AA 4BE0A 3LSMA 4P5OA 3SZGA 4QPOA 4BACA 3OYNA 4PJLA 4X0GA 4Y33A 4CCLA 3H0DA 4BJ6C 1W36D 4C2TA 3OOUA 2DT6A 2R7QA 3DTEA 3TBIA 2FUG2 4CUGA 4BXFA 2CV2A 4CA0A 4N4OB 2Y0SA 3PFYA 3A1YA 1V5EA 5JHFA 3OY9A 3OIQA 4E7JA 4LITA 2V1NA 4XLFA 3LSKA 3I9V2 1DP3A 2VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1Y A;  2LBF B;  2LBF A;  4BEH A;  2W1O A;  4BEH B; 
#chains in the Genus database with same CATH topology
 1D1A A;  4YIR X;  1JT6 A;  1Z3Y A;  1WQ2 A;  1K4S A;  4IQJ A;  2VIX A;  1I50 J;  5K5O A;  1I1S A;  1VTN C;  5CJ9 A;  1DU6 A;  2E1M C;  1RES A;  1SMT A;  3K70 D;  1PP7 U;  2BHY A;  1G59 A;  4NBQ A;  5LLQ A;  2O9L A;  4HLX A;  3HTS B;  1W1W E;  2P6T A;  3GYH X;  4YFX F;  5DCM A;  2L3D A;  1HBX G;  4ZZD A;  3GZN B;  1U9O A;  4MFE A;  2IGN A;  2BY0 A;  4I0B A;  4A3J J;  1K6O A;  2P7C B;  3NAR A;  4ON0 A;  1WJF A;  2LOO A;  2XAG A;  2WAE A;  3C18 A;  3LSI A;  5ERI A;  3GLL A;  3ERE D;  3JAM K;  3W6J B;  1WJE A;  2LC2 A;  3J80 K;  1P6R A;  3I64 A;  2YS9 A;  2HVS A;  3J7A O;  3S2W A;  5GAH J;  5GAD J;  4HBL A;  1LPQ A;  1W0U A;  4S0H B;  4HEA 2;  3ZOB A;  5KHD A;  2ZCW A;  2R7S A;  1FYK A;  1P2F A;  5F0H A;  3V7S A;  1YTY A;  5BPI A;  1SFO J;  1HOM A;  2DAO A;  3KP5 A;  4RM2 A;  2E7W A;  2E35 A;  3G2B A;  3E6D A;  1ETV A;  5HDG A;  2JT1 A;  3K4C A;  4G7O F;  4N9H A;  4DYC A;  2XF5 A;  2ZME C;  4CCJ A;  3N4M A;  3RI4 A;  2I5U A;  4WK8 F;  4EJU A;  3S2D J;  2P5L C;  2DDB A;  3EUK L;  5E17 F;  2GXB A;  3ZMS A;  2B7E A;  2FBK A;  4DGW B;  2K9Q A;  3H92 A;  2VKD A;  3BZK A;  1FBU A;  2LKX A;  3MD2 A;  5HS7 A;  4IRH A;  1LDK B;  2IRF G;  2D45 A;  1VQ4 I;  4V19 K;  4KT5 C;  3S16 J;  2FBH A;  2DA3 A;  4F7Z A;  3GZ6 A;  1UG0 A;  5J47 A;  3WHC A;  3K69 A;  2JUC A;  4MHG A;  2XGD A;  3F8M A;  5F04 A;  1P92 A;  1XMA A;  2XB0 X;  2XIG A;  5KCM A;  3BQZ A;  3DPU A;  5GAG J;  2JMW A;  5HDK A;  5LRS A;  2NVY J;  3WG7 H;  1RUN A;  3BWG A;  1FP2 A;  3CCM I;  3FF5 A;  3HUG A;  4LG3 A;  2FML A;  2ZXI A;  3GZ5 A;  4I2O A;  2EFO A;  4OIP F;  2R7R A;  2LRD A;  1YX5 A;  2L2O A;  3EDP A;  1WVR A;  1QPI A;  4C3I J;  4D5F A;  2LDU A;  4ZC3 A;  4PGH A;  5HNH A;  1MMD A;  1BW6 A;  4EJT A;  3KYL A;  2DMN A;  4IL6 C;  1MJ9 A;  1R36 A;  2RAE A;  3CF2 A;  4A3L J;  1BR4 A;  5H2F C;  3KLN A;  4B8X A;  2BXY A;  2ZNZ A;  2E60 A;  5CVI A;  2A3S A;  4E7I A;  5E3O A;  4LIU A;  4PJ0 C;  3RCO A;  4GFB A;  1SVO A;  3OMY A;  3ABU A;  2X9D A;  3SFZ A;  2NNN A;  2MGQ A;  3PUB A;  1QNT A;  2WAF A;  4NQW A;  4ZDL A;  3R0J A;  1ETK A;  4FCY A;  3K2Z A;  1FPQ A;  3PO3 J;  3S3N A;  5AIQ A;  4HV5 A;  3HRM A;  2DK5 A;  2O8X A;  4G6Q A;  5D5X B;  3BPX A;  3F72 A;  4MTE A;  2Y30 A;  3JSP A;  3HYI A;  1R1T A;  2QEX I;  2D5V A;  2KDO A;  2ECB A;  4HX8 A;  3IKV A;  2DMP A;  1MDM B;  4BQO A;  1IXC A;  2VUM J;  1H88 C;  4A3B J;  3R4K A;  3CCL I;  3L9F A;  1E17 A;  1E3P A;  9ANT A;  3SXY A;  1ZEL A;  2PFB A;  2K3F A;  1O57 A;  2DDA A;  2IA1 A;  1ZAR A;  2O5R A;  4C3H J;  1MD0 A;  4BE1 A;  2VOD A;  1F5T A;  4CIC A;  2ZBK A;  1M1E B;  3P5J A;  4LK0 F;  3ELK A;  3V8J A;  1WRJ A;  4N4N B;  4A3C J;  5A2Q Z;  3CLO A;  5FKL A;  3U9G A;  3CC4 I;  1Y8R B;  2DLL A;  4RAZ A;  1WWX A;  2ZME B;  1I39 A;  2KJC A;  2KMU A;  3RQ4 A;  3BR6 A;  4LG0 A;  2IVM A;  3PNY A;  1T08 B;  3SZT A;  1ERD A;  1X58 A;  3IUO A;  4ZTJ A;  5ILU A;  1FZP B;  2M3A A;  1XSX A;  5F27 A;  1MDM A;  2Z1D A;  3HPG A;  3H5N A;  4M9Z A;  1SVM A;  4CYC A;  4BEH A;  4LG0 B;  2MH2 A;  5HDN A;  4WXD A;  3CCJ I;  3BG5 A;  1R00 A;  3CD6 I;  5K7Z A;  3WTV C;  2P5V A;  2QUF A;  1ETY A;  2WAQ N;  3EQL F;  2JA6 J;  3PFI A;  5E79 C;  5LEK A;  2CQX A;  4JK1 X;  5CYV A;  4H0E A;  2JSP A;  2ZJR F;  1IN5 A;  2ADU A;  2D2W A;  3IKT A;  2E19 A;  1BL0 A;  3JRE A;  1OIS A;  1IO2 A;  4F92 B;  5EEA A;  1WJB A;  2DOE A;  1IN8 A;  1LVK A;  3S1R J;  3WGG A;  4RAG A;  5EZH A;  1T39 A;  3X2Q H;  3W2A A;  2LF7 A;  4UUS A;  4XLE A;  2EFP A;  1H89 C;  5GPA A;  3L2R A;  1W7P D;  3HTU A;  3BTL A;  3HGG A;  1VFC A;  2MC4 A;  3WTT C;  4IO9 F;  3FDY A;  2GZW A;  4F3Q A;  3CDI A;  1JXS A;  3IHU A;  4BDZ A;  1ON1 A;  3SEQ A;  3JRB A;  3RTR A;  3K4K A;  1BR1 A;  1VQL I;  1HKS A;  1HA8 A;  1WKM A;  3GTP J;  2RKH A;  2Z16 A;  5EGO B;  2COB A;  2LY2 A;  2LK2 A;  2DOD A;  3VYU B;  1FNN A;  2EZL A;  4Y3O A;  3BG7 A;  2ICW G;  3HSE A;  4XKB A;  4A5N A;  2H27 A;  4LOC A;  3SDG A;  2XAU A;  4QWQ A;  3VSK A;  1D5Y A;  2RQQ A;  4IHV A;  3MZ8 A;  3R60 A;  2PI0 A;  4RS8 A;  2M30 A;  3WTZ A;  3FBI B;  3QOP A;  2FQ3 A;  2PX9 A;  4JBA A;  3FHZ A;  3CC2 I;  5B1A H;  4WXC A;  2K27 A;  2XHK A;  4GYI A;  3BZ6 A;  4DW6 A;  2Z9O A;  5BMZ A;  3VSL A;  3F8C A;  4JOM A;  4KN7 X;  1OKR A;  2DFH A;  4KN4 X;  4XR6 A;  1O3T A;  1V55 H;  3DTI A;  3VYS B;  5F1R A;  2QGU A;  3K4J A;  2DW4 A;  5M3F J;  5K5Q A;  4UY8 I;  1VQO I;  2O03 A;  1RZ4 A;  1S7O A;  3TDU C;  1FP1 D;  2R3S A;  1X3W B;  1S7A A;  1BN5 A;  3WGH A;  1YRN B;  4AID A;  4XSX F;  3C7J A;  2A68 F;  1UEL B;  1S72 I;  5BS6 A;  2RV8 A;  3BCA A;  4YFK F;  3S3O A;  2Y48 A;  2DOF A;  1SFK A;  5B66 C;  4IJA A;  1A35 A;  5GTH C;  2WAQ A;  4L5J A;  4V2F A;  3DBL B;  1S29 A;  1Q1V A;  2LKP A;  5JI6 A;  3S8P A;  2L4M A;  1YQA A;  2KKO A;  3E7L A;  3OYK A;  3C2H A;  5DDG A;  5J4V A;  1H8A C;  1SVL A;  2O3F A;  1T0F C;  4FE4 A;  3D5S C;  3DFG A;  2X1C A;  3MN2 A;  2YPR A;  2UXX A;  4Z6Y A;  1VQ8 I;  2EA2 A;  1TNS A;  2GXG A;  3IH4 A;  1TBX A;  4RDU A;  3GFM A;  2KZV A;  3TKY A;  1D1B A;  3F8B A;  2NYX A;  3S93 A;  2RN7 A;  3D1N I;  4H4K C;  4EM2 A;  1IN7 A;  4ZYH A;  4G6T B;  1TZL A;  1R4M B;  3LQR A;  2VAS A;  2GXA A;  1O3Q A;  2GA1 A;  2PEX A;  2JTV A;  4AWX B;  1UJ8 A;  3CME I;  1RRJ A;  1YYV A;  1CF7 A;  4RMN A;  3G1L A;  1GV5 A;  2F5C A;  4Q47 A;  3OYE A;  1W36 C;  3I4P A;  3TL4 X;  4RBO A;  2R5Z A;  3KX2 A;  3KET A;  3CJR B;  2GBY A;  1TLH B;  3LA2 A;  3QPT A;  1MZB A;  3A2K A;  1JHH A;  5DYM A;  5EJC A;  2ME6 A;  2EK5 A;  2OPT A;  1MSE C;  1H9T A;  3UNG C;  2VXD A;  3P7N A;  4IVN A;  4I01 A;  3CMM A;  1KU3 A;  3BLY A;  2Y2Z A;  4CCK A;  4IZZ A;  3QYE A;  4XLP F;  3KYD B;  2DI3 A;  1B4A A;  3RKQ A;  4BXU A;  1XGS A;  3OS1 A;  4BAY A;  4Q48 A;  3C2B A;  2Q1Z B;  2K9M A;  2FOK A;  3VYT B;  2PJR A;  2OUM A;  4YEL A;  5LHG A;  2JRM A;  2CUF A;  4G6D A;  1QGP A;  4TV7 A;  3NRV A;  2UXN A;  3FXM A;  4W1U A;  4EJO A;  1OLT A;  2CSO A;  2GOX B;  4ABZ A;  4KUM A;  2M4K A;  3KIO A;  2JQ7 A;  4RB2 C;  1Z1D A;  5B5E C;  4UNO A;  1E0E A;  2E2J J;  2HEO A;  2ELK A;  3FKI J;  4ZDP A;  2VKV A;  3BR3 A;  2CU7 A;  3KZZ A;  1XMX A;  5LHH A;  1S8N A;  3K1N A;  1QO0 D;  3FHN A;  1AOY A;  1LEB A;  1R4N B;  3H35 A;  4C30 A;  3OL3 A;  2K40 A;  5E8I A;  5F0C A;  1IF1 A;  3HHH A;  1QBJ A;  1TC3 C;  3KP6 A;  2R4G A;  1XDS A;  1X3U A;  2X48 A;  5AON A;  5J3L A;  4BHC A;  5IY5 H;  2FEZ A;  1D0Y A;  2HQ5 A;  4K2E A;  3MKZ A;  3G71 I;  4A5M A;  3PUF A;  1MMG A;  3K9T A;  2Y75 A;  2KRC A;  4YIF A;  5CPR B;  2FNP A;  3ML6 A;  2DFF A;  2XAJ A;  1UCR A;  4DZJ A;  5FLV A;  1T6S A;  1KA8 A;  1TWH J;  1ZK8 A;  4RAF A;  3CCS I;  2KIU A;  2V1X A;  1ZGJ A;  5D4R A;  3SYT A;  2EBI A;  2HS5 A;  5EG0 A;  2STT A;  3PQK A;  3GCM A;  4RLF A;  5TJJ A;  4YII A;  4KMU X;  4P5O A;  4LD5 A;  4XLN F;  3DCF A;  1KYW A;  2RNJ A;  1OCT C;  4BAC A;  4PJL A;  2Y9Y A;  3M3Y J;  4C2T A;  2DT6 A;  3FWE A;  4M6V A;  3TBI A;  1SFU A;  1U5T C;  2Z5U A;  3B73 A;  4BXF A;  2CV2 A;  3GFJ A;  2MA3 A;  3F23 A;  3MAJ A;  3OIQ A;  2ZXJ A;  2V1N A;  2OCE A;  1DP3 A;  1T98 A;  2ZO4 A;  2LBF B;  4ZYG A;  4D7N A;  1QRY A;  2X6Y A;  2XKO A;  4ZYD A;  1KGS A;  4DOZ A;  2ISZ A;  2PN6 A;  4A93 J;  4M9X A;  4OIN F;  2VC1 A;  4E7Z A;  4Q4Z F;  3TOA A;  1J7K A;  3WG9 A;  4NC6 A;  2EFW A;  1NK2 P;  2R7W A;  4U0W A;  1R49 A;  1MBH A;  1OCC H;  4ESB A;  2M0C A;  3G1O A;  3M9A A;  3M07 A;  4ESJ A;  4AVP A;  1MBF A;  2VXZ A;  2F5F A;  2GWR A;  4FHT A;  4D9J A;  3ZCO A;  4I76 A;  5JHU A;  1KZH A;  2R5Y B;  2BVL A;  1U78 A;  4MEX F;  1B8I B;  4HG2 A;  4FX4 A;  2VC0 A;  2X0L A;  4MO7 A;  5M5Y J;  2W25 A;  5DV5 A;  3JTG A;  2LYC A;  1V4R A;  1T8I A;  1R1U A;  3GLX A;  2ESH A;  2LTP A;  3WE3 A;  3OYF A;  2YU9 J;  4NC7 A;  3QPS A;  2A69 F;  1PUE E;  4M71 A;  1ETO A;  3V8L A;  3E1S A;  1H0M A;  5F1J A;  1OFC X;  3ABM H;  3VFZ A;  3HXL A;  3I59 B;  3A03 A;  3Q0U A;  3JRA A;  4AIH A;  1RIO H;  1MGT A;  1JKP C;  2VPL A;  3O8G A;  2HFH A;  1MJB A;  2ZKZ A;  2XSD C;  4RGX A;  1FOY A;  2L9R A;  1EJ9 A;  2L01 A;  3T5X A;  1HC8 A;  1ZN2 A;  4MFD A;  3KE2 A;  2ID3 A;  2IEK A;  5D8L B;  3EUH A;  1IG7 A;  1DPU A;  2HVR A;  2DN0 A;  3BTJ A;  3HSR A;  4L5E A;  2KPM A;  1WZ2 A;  1GV2 A;  4OU0 A;  2ZJQ F;  5IT9 Z;  2UUZ A;  2VBW A;  3MWM A;  5DTD A;  3O8H A;  2XGX A;  2A6H F;  3Q0V A;  5HVQ C;  1VQK I;  5DCF A;  4YEJ A;  2MSY A;  1CF7 B;  2WV1 A;  1ZRF A;  2ZC2 A;  2G9W A;  4FT8 A;  4IF4 A;  2K02 A;  3F6O A;  1YRN A;  1AKH A;  3CDH A;  3E5Q A;  3DEU A;  2EFQ A;  3HJE A;  2X51 A;  2ZB9 A;  3HBL A;  3N97 A;  1FBS A;  1UMQ A;  4DQ2 A;  3BDD A;  2QSF X;  3F0C A;  3JR9 A;  1JGG A;  1TQI A;  1DGW Y;  2H8W A;  4RGR A;  1G6N A;  3ERM A;  1SFX A;  5BPD A;  3KEO A;  2CMP A;  5FD5 A;  1Q1H A;  2KRH A;  2NOJ B;  2PG4 A;  4DJA A;  3L7W A;  3W6V A;  3W2W A;  1FYM A;  4M3D A;  1XGO A;  3BJ6 A;  3FIW A;  4HX7 A;  1MH4 A;  1AA7 A;  3I0T A;  1IC8 A;  3BR0 A;  3R61 A;  1QZZ A;  2HXO A;  1B8I A;  1X1D A;  5CKT A;  5K1Y A;  2WB1 A;  3WU1 B;  3Q0W A;  2L7F P;  1ZGW A;  4S04 A;  2DQL A;  3DU5 A;  3CO7 C;  1I1G A;  1XDU A;  2E71 A;  4KIG A;  1LFU P;  2ZXH A;  2CG4 A;  3DBH B;  2JK3 A;  2H1K A;  3HHG A;  2AXL A;  2ESN A;  4HA8 A;  5H6R A;  3FXQ A;  2KIS A;  1OPC A;  3TO9 A;  2R7D A;  4BL0 B;  1DQU A;  1QPM A;  4L5I A;  3HOZ J;  2L9N A;  3S1N J;  2BHZ A;  5CVU A;  2MLG A;  4M3F A;  4CH7 A;  1FT9 A;  3BJO A;  3GEZ A;  2R7V A;  1UFM A;  1IRZ A;  5K7H A;  1V3F A;  2BGC A;  2DA7 A;  4HF1 A;  5BNG A;  5JVT A;  2R7T A;  2XUB A;  4EJV A;  1BA5 A;  3F9K A;  1PUF A;  4XRF A;  1SAX A;  3L2C A;  2UZK A;  1LE8 A;  1K6Y A;  1NHA A;  1X2N A;  5LGU A;  1U5T A;  3LSH A;  3F8F A;  4XIC A;  1ONV A;  1R6R A;  2VLA A;  4L0Z B;  3H5A A;  1N25 A;  2NVU B;  5E3N A;  3GUD A;  1IRF A;  2A05 A;  1IXR C;  2MAB A;  2HOA A;  1BOA A;  2V9K A;  2Y0S N;  4BJ5 C;  1FIA A;  1W5T A;  1OMI A;  5IOZ A;  3CCE I;  3LA3 A;  5D6F A;  4NNJ A;  1NTC A;  5IP9 J;  2KRF A;  1MBJ A;  2ECC A;  4DIQ A;  2BYV E;  3J7Z I;  2HPM A;  2H09 A;  2DMQ A;  1SD4 A;  2M8G X;  2VON A;  1UAA A;  3GTG J;  1J59 A;  3GVA A;  2XKP A;  4KNY A;  3U1D A;  1I3A A;  3HOV J;  3KP3 A;  2DA1 A;  4U0V A;  1W7P A;  2CQN A;  2DMU A;  4MLO A;  5D5V B;  4KIF A;  5FKO A;  5IP6 A;  3MZY A;  4IHX A;  1WFX A;  1TW2 A;  3K4M A;  1X3Z B;  4U88 A;  1VQ6 I;  3GTM J;  1QQI A;  3OR1 C;  2JVH A;  4UXN A;  2QBY A;  1HDD C;  3HGY A;  2FXA A;  3OIP A;  1FTZ A;  2KHM A;  1JI8 A;  2E1N A;  3IV5 A;  4AYB N;  1SEU A;  4D5C A;  2DA2 A;  3TP3 A;  2HDW A;  2XVC A;  1BI3 A;  2WY8 Q;  4R1H A;  3MVP A;  5LHI A;  1XCB A;  2HNH A;  1REP C;  3OS2 A;  5KAI C;  1MBE A;  4JX5 A;  2XPU A;  2GIZ A;  3FMR A;  2HDC A;  3RKX A;  4Y7N J;  2FSW A;  1TNT A;  2HYG D;  4AC0 A;  2XV4 S;  1YG2 A;  4XL9 A;  3T8R A;  2DYR H;  1YW7 A;  1X1P A;  4P1W A;  2F48 A;  3V4G A;  4EV0 A;  1MKM A;  3I4N J;  5IYB J;  3LSR A;  3BTC A;  4ZYA A;  4AIJ A;  2UWM A;  1SAU A;  1ZH5 A;  2LY9 A;  1MNE A;  5F08 A;  2HYF A;  3KZY A;  2VBY A;  4A3F J;  2W82 A;  2IP2 A;  3M8F A;  5ICG A;  3PJR A;  2AQE A;  3BRO A;  3COA C;  3WU0 A;  2GAU A;  2HQN A;  3C1D A;  3BC8 A;  4V2G A;  4A2U A;  4XN0 A;  1YS6 A;  4B3X A;  2R7U A;  5EYR A;  3H1C A;  4HNV A;  2CFX A;  2CGP A;  2LLK A;  2YR2 A;  3E0J B;  3SQN A;  2Q2E B;  4L9J A;  2DOA A;  1P4X A;  2D1V A;  2OU2 A;  3C3W A;  4IOC F;  5D5W B;  5DEQ A;  3RJP A;  4PJN A;  4FAS D;  4QPQ A;  3S17 J;  4XBF A;  2CO5 A;  2E2H J;  3QQA A;  3ZMZ A;  2QSG X;  5H6Q A;  1W4M A;  3S1M J;  3MFK A;  2Y0M A;  4F52 A;  4ANJ A;  3ZQL A;  2XB5 A;  2OV7 A;  4A69 C;  4L18 B;  4UHT A;  3WTS C;  1GXP A;  4JX6 A;  5JR3 A;  1HW5 A;  3A02 A;  3V7R A;  2M2E A;  1SAN A;  2VT2 A;  3MKW B;  4UUV A;  2VQG A;  3AG2 H;  3HSF A;  1RC9 A;  4EM0 B;  2X4H A;  1ZGA A;  1RUO A;  3GTO J;  2Z3Y A;  3S14 J;  1JKQ C;  1NK3 P;  3RDI A;  2EIM H;  1S7E A;  2L9S A;  5M3M J;  3GME A;  2RNG A;  2L7Z A;  5FLX K;  2M7A A;  1SD5 A;  5LGT A;  1A04 A;  1OCZ H;  3KYC B;  1ACI A;  2BW3 A;  1VQ9 I;  3QP6 A;  5DD4 A;  1D0Z A;  3QOE A;  2W1O A;  3S2H J;  1MNM C;  4OMY A;  2CUE A;  5EF6 A;  4GGG A;  2Q8K A;  3LFU A;  4PSX A;  1XS9 A;  3F3X A;  3K4B A;  1Z77 A;  4S05 A;  2BY1 A;  2CW8 A;  1K78 B;  5DD8 A;  2ELJ A;  3LSP A;  4I6Z A;  1XTA A;  2KIQ A;  3KP4 A;  5J40 A;  2V7F A;  2LD5 A;  4ENN A;  2F2E A;  2NAZ A;  1A31 A;  4F93 B;  1G4D A;  3M4O J;  5L3D A;  2STW A;  5FJ8 J;  1QVU A;  3VOE A;  5CQG A;  1A6I A;  5FKK A;  3GF2 A;  2FU4 A;  5M5X J;  2WBM A;  3AKZ A;  1USS A;  5LBQ A;  1P7J A;  2V4J C;  2RDP A;  3I55 I;  2EQR A;  3ZGK A;  3ZN0 A;  4DYQ A;  3K0L A;  4PFO A;  1D0X A;  1W5C C;  3DP7 A;  2R7F A;  4PJJ A;  4I02 A;  2ZJP F;  1Z0X A;  3HEF A;  3PO2 J;  1ITY A;  2FRH A;  2CRG A;  3Q5F A;  3HUG B;  5J4Y A;  1AWC A;  2DA5 A;  4EM1 A;  3CUQ B;  2L7K A;  2O6G E;  4E7H A;  3CP8 A;  2DA4 A;  4NHJ A;  3JRC A;  4KYW A;  3EYY A;  4RB3 C;  1ZKG A;  5EDN A;  2IGK A;  2GM4 A;  1T33 A;  5C3E J;  4A3D J;  1I27 A;  1TQM A;  2VE8 A;  1F4K A;  2CQ7 A;  3LQQ A;  4L9V A;  3RZD J;  3OYI A;  1PDN C;  3CUQ A;  2MW8 A;  4ITV A;  3IC7 A;  3ZP5 A;  2XRN A;  2K9L A;  2BZT A;  2DCE A;  2FD5 A;  3HKZ N;  1FIP A;  5KVR A;  1A5J A;  5GPC A;  2L4A A;  4BXX J;  2EZH A;  4CHU A;  3HOT A;  1FOW A;  1BC8 C;  1TL8 A;  2FE3 A;  1BJZ A;  2XGE A;  1LQ1 A;  2O7O A;  2CWE A;  1GVD A;  3Q3S A;  5ILV A;  4HST A;  3ZMU A;  4X6A J;  3ZPL A;  3FXR A;  3MKL A;  3I59 A;  3W2V A;  1U5T B;  1GHC A;  2ME0 A;  1O7L A;  4Z2Y A;  3BR1 A;  2F5D A;  2BBY A;  2EV0 A;  1TTY A;  2FMY A;  3DPL C;  3BR5 A;  3SZP A;  3I71 A;  3E5X A;  1R23 A;  1G3T A;  2G7U A;  1JE8 A;  3ZQI A;  1JJ8 C;  1FSH A;  4OIQ F;  1IN6 A;  3BPV A;  4GYG A;  4XLC A;  1YFH A;  1JT0 A;  2HYJ A;  2HI3 A;  2W7N A;  1QU3 A;  2E34 A;  2KJB A;  2X6X A;  2P81 A;  1VI0 A;  1ZG3 A;  2NVX J;  3OOP A;  2OC6 A;  2ZSH B;  3ABL H;  3LST A;  3WTX C;  1K78 A;  5FGM A;  3VEP A;  5L3B A;  4O6J A;  3I54 A;  1BIA A;  2RQP A;  4L9N A;  3E5U A;  1QZY A;  1IN4 A;  2Y69 H;  1GXQ A;  4CCL A;  3H0D A;  2N8G A;  4EGZ A;  5D5U B;  2ACJ A;  2K9N A;  4KDP A;  2ZJ2 A;  4UVC A;  2V1U A;  1TWF J;  1XG1 A;  1FWZ A;  2H8R A;  2V6C A;  2Y0S A;  2BV6 A;  2VBZ A;  1LUJ B;  1BM9 A;  3WTW C;  3OY9 A;  1K61 A;  3G1M A;  2GIV A;  3LSK A;  3I9V 2;  1IZ1 A;  3AAF A;  1JUS A;  2BE5 F;  1ULY A;  1S3J A;  2UV1 A;  1BBY A;  1B6A A;  3BJA A;  1OJL A;  1SMY F;  4JQF A;  4CZZ A;  4CSW A;  2W84 A;  3FIS A;  2VOP A;  2LP0 A;  5ICF A;  4BHB A;  3ZQQ A;  5ICC A;  2K85 A;  3E6B A;  2QM3 A;  2MFZ A;  1WJ5 A;  1LB2 A;  1LEA A;  1Z21 A;  2P5K A;  2NVT J;  2PQ8 A;  5IOY A;  3CDL A;  3W3C A;  2HOS A;  3PNT A;  2L54 A;  3KCC A;  4M72 A;  2M0M A;  4BBR J;  2QZ8 A;  1IRX A;  1ENH A;  1WGX A;  3M8J A;  5L3F A;  3ZMV A;  3DKX A;  2H6C A;  3IRQ A;  2A5Y B;  1R22 A;  4XM3 A;  3RIR A;  2MYS A;  3QWL A;  3OS0 A;  1T38 A;  2HKX A;  4EEF G;  1F43 A;  1OQY A;  2EFN A;  4WXH A;  2JZY A;  2R5Z B;  1HST A;  2R7X A;  4BBS J;  1DGR M;  2QCO A;  1V5F A;  1S5L C;  3TOB A;  3I4M J;  3VOD A;  1W5S A;  4AYB A;  3GTL J;  3NAU A;  3FK6 A;  4AD9 A;  5JVG F;  2B0L A;  4PDK A;  4B3A A;  2J5P A;  1L0O C;  1LKX A;  4MIM A;  1SD7 A;  3DKW A;  1MMA A;  1KU2 A;  1YE9 A;  2DTR A;  4WCG A;  3PSF A;  2M45 A;  2Z2S B;  1P4W A;  2JVG A;  3M8E A;  5CVJ A;  1S6L A;  3S1Q J;  2XSJ C;  4EVI A;  3JW4 A;  4RM3 A;  4QSH A;  5GAE J;  5HOD A;  3S15 J;  3KP2 A;  1K7A A;  4LB6 B;  3A01 A;  2DT5 A;  3VPR A;  5IYC J;  2BOL A;  3PSI A;  2P6S A;  5E18 F;  1QZE A;  2LY1 A;  4UUS B;  3O3K A;  4HYE A;  3DKY A;  4HLY A;  5E3L A;  2P8T A;  3N05 A;  3CUQ C;  3J81 Z;  2M87 A;  2P7V B;  2R92 J;  1GUU A;  4A6D A;  2DJI A;  2QWW A;  1JGS A;  2J5O A;  1EH6 A;  2VQC A;  3TW6 A;  1X1B A;  1F1Z A;  5E20 A;  4RB1 A;  3MZH A;  2JA7 J;  3LAP A;  1V54 H;  1OYW A;  5K7F A;  3T1B A;  4LLL A;  2KL4 A;  2HR3 A;  1MMN A;  1N75 A;  2L0K A;  1G3W A;  4B44 A;  1TWA J;  1Z67 A;  2V9V A;  1XD7 A;  1JTX A;  2VPR A;  3FBN B;  1V5G A;  2VJ4 A;  1D3Y A;  3QP5 A;  1Y0N A;  3IH2 A;  4FET A;  5DS9 A;  3DV8 A;  2F6C A;  2QEN A;  4HOB A;  2LSO A;  1YX3 A;  1EH8 A;  1FOX A;  3QOD A;  3K4N A;  4I7H A;  2OTJ I;  1N77 A;  2XAS A;  1P9Q C;  1HCR A;  2IS4 A;  4XRS G;  3CJQ B;  1NG6 A;  5E3M A;  1TWG J;  3BCB A;  1B72 B;  3DBR B;  1R7J A;  3G6E I;  4KFC A;  5E1X A;  3OYD A;  5H20 A;  4IX7 A;  2HU9 A;  2Z33 A;  1DU0 A;  2DO7 A;  2E36 A;  3AL0 B;  3KEY A;  3WGI A;  1MSF C;  1FBQ A;  1WH7 A;  1G3Y A;  4ZZL A;  2PJR B;  1FLI A;  3HC7 A;  3CMA I;  3QAH A;  3E3V A;  4OAY A;  1FY7 A;  1XSD A;  3CCY A;  4LK1 F;  2DA6 A;  3QU6 A;  3BG3 A;  3V8K A;  2CW0 F;  3ECH A;  4R79 A;  2JWT A;  1B9M A;  1IGN A;  2CFO A;  5F0F A;  4UUT A;  2FNA A;  3H5R A;  2EZK A;  4PFP A;  5FO5 A;  4DZP A;  4G8X A;  5DUI A;  3WOD F;  2JA5 J;  3GXO A;  3K1M A;  4JYK A;  2CV0 A;  2K86 A;  1F9N A;  2W24 A;  3UKG A;  3ZQF A;  1OR7 C;  4OWR B;  3GO5 A;  1X2M A;  1ZYR F;  1XGM A;  1HF0 A;  2QKM B;  5FFX A;  3RYP A;  1ZLJ A;  3ABT A;  2WWY A;  3OYB A;  2ISY A;  2W00 A;  1XX5 A;  3PIO F;  5F6F A;  1VQM I;  2QKL B;  2QF7 A;  4HRI A;  4JX4 A;  3BP8 A;  4BGD A;  2LFB A;  2QYO A;  3ZMD A;  1Z91 A;  3GFI A;  4OOI A;  3OYH A;  4ZH4 F;  5CQE A;  2M5W A;  3R0A A;  4EQQ A;  5BQT A;  3BR2 A;  5JLW A;  3SJM A;  1I6H J;  4YG2 F;  4Y4R A;  3T8T A;  3GTJ J;  1B1B A;  2H6B A;  3CP2 A;  3BTI A;  1R5I D;  2CW7 A;  2K3P A;  3SHF A;  1GVJ A;  5JFR A;  1NH3 A;  1TW3 A;  2IPQ X;  2WB1 N;  5FRM A;  1KQ8 A;  1I6X A;  1TQP A;  1YOV B;  2M4G A;  2V26 A;  4XN3 A;  1BJA A;  1APL C;  1A36 A;  1ZRE A;  3BOQ A;  1XGN A;  5BOX A;  1CGP A;  5IP7 J;  1ZLK A;  1VQ7 I;  1Z9C A;  2E7X A;  1IUF A;  3W6K B;  4RGS A;  4IHS A;  3EUA A;  1K83 J;  3JRG A;  2H1L A;  1LDJ A;  2PMU A;  1IXS B;  2M8E A;  4XLH A;  5J6X A;  3OYL A;  3M1C A;  2FF4 A;  4E7K A;  4YRV A;  2TRT A;  3L2Q A;  2EJR A;  3CZ6 A;  4BEH B;  2XRL A;  2MLK A;  3EUH C;  3H3V K;  4HQM A;  3IWZ A;  5C4J J;  5JLX A;  3EET A;  3K70 C;  1MJA A;  2VJI A;  3JSO A;  1AU7 A;  3CJT B;  3NWT A;  4GXO A;  4I99 C;  5LD2 C;  3DEE A;  1QVT A;  3DPT A;  3ZR8 X;  3QPL A;  5J1R A;  3CO6 C;  1J0R A;  3RZO J;  3VYR B;  3TGN A;  3WTU C;  3H9J A;  3OYM A;  2IW5 A;  3H3Z A;  5KAF C;  3KZI C;  3RYR A;  2DFI A;  3BQY A;  2XAQ A;  5DUK A;  4HZF A;  2OQR A;  2EIK H;  2IA0 A;  3ESW B;  2WC2 A;  4NQW B;  4E7S A;  5KNL A;  1HKT A;  2NVQ J;  3NWS A;  2KT0 A;  3HOU J;  1T0F A;  2EIJ H;  1MBG A;  4I09 A;  4BNC A;  4B43 A;  4IKF A;  1Z6T A;  2QLZ A;  3R6S A;  2HDD A;  1EH7 A;  1G8X A;  3FZV A;  5LRR A;  4C3J J;  2CV1 A;  1IW7 F;  4I98 B;  4O3M A;  1D8K A;  2XAH A;  2KIF A;  1YJW I;  2XRO A;  4P96 A;  4XKC A;  4XON A;  3S32 A;  1BIB A;  4LIV A;  5LGN A;  4OIO F;  2VJJ A;  2IAI A;  2FJ1 A;  4UV8 A;  4A3M J;  2K9S A;  2V1D A;  1Y56 A;  4WX9 A;  4A3G J;  2IJL A;  4ZDO A;  4D1Q A;  4IOA F;  1D1C A;  2R7O A;  2Z99 A;  3EPZ A;  4KIC A;  1ODD A;  2BW3 B;  1J5Y A;  1R9T J;  1ZQ3 P;  1N78 A;  4BE2 A;  1JTY A;  3DU6 A;  4HDV A;  3H9Q A;  4G7Z F;  4PSW A;  1HKQ A;  1WJD A;  2VI6 A;  3LOC A;  2P0W A;  3G4S I;  4Y17 A;  3DEW A;  3K6G A;  4AUX A;  4LFU A;  2XPV A;  4LGW A;  3IRR A;  2HKO A;  2QVO A;  3HOS A;  1R58 A;  1FYL A;  5J8C A;  3A01 B;  3TO6 A;  2JRT A;  5AIP A;  1E3H A;  3HZJ A;  1ZRC A;  4BUP A;  3VDX A;  4U7D A;  3BY6 A;  3AL0 C;  2KFD A;  3NQO A;  3QPH A;  4ZYE A;  2VKE A;  5IYD J;  2HWV A;  2WA0 A;  1VND A;  4L9T A;  1POG A;  3E97 A;  4ETS A;  2IBD A;  2LH9 A;  2CJJ A;  3ZRG A;  5IPA A;  2A5W A;  2EWN A;  3K4L A;  2GA2 A;  1WI3 A;  4A3K J;  1BI1 A;  4PCQ A;  3TO7 A;  1VQN I;  1J2X A;  2DK8 A;  4DNC A;  1HLV A;  4M3G A;  1XC5 A;  1FJL A;  3P9K A;  2RC4 A;  3HRS A;  1R71 A;  2PLY A;  3BG6 A;  5B1B H;  3KLO A;  2HTS A;  3REO A;  4EJW A;  1FOK A;  4XMY A;  3SDB A;  1SD6 A;  4IHW A;  3AG3 H;  1YLF A;  2PJP A;  2FBI A;  2VQL A;  1TP4 A;  5FFZ A;  1X4P A;  4HAM A;  1KYZ A;  2CQQ A;  2DJN A;  4A6E A;  1ZG1 A;  4AM3 A;  2MC3 A;  4IHY A;  2YU3 A;  3H9G A;  1UZC A;  3F8N A;  3LA7 A;  1W0T A;  4HF2 A;  1S9H A;  2QQ8 A;  2QSH X;  3CCQ I;  1XN7 A;  4QTR A;  1JUP A;  3OWT A;  2ZNY A;  2L5Q A;  2DQR A;  1IDZ A;  2EPF A;  5EGO A;  3CTA A;  2R93 J;  2OCC H;  4XID A;  2X1D A;  1U2W A;  3D5L A;  1WCM J;  4C9Y A;  5HNF A;  4ENM A;  3ZXS A;  5HOO A;  3FM5 A;  3QRF F;  4DBQ A;  1YHQ I;  3FXL A;  4U87 A;  4P9U A;  2HOT A;  1U3E M;  1IJW C;  1LDD A;  1RKW A;  4F55 A;  4CDG A;  5LFA A;  2EZI A;  1YW8 A;  2XAF A;  2EB7 A;  5EG0 B;  3FXJ A;  4BH9 A;  4G7H F;  3ZQG A;  3QYB A;  2OBP A;  4HNU A;  2HVQ A;  5DCM B;  4G12 A;  2JUG A;  2NS0 A;  2GQQ A;  4J19 A;  2YSR A;  3J7Y J;  3NEU A;  3ISP A;  1Y1W J;  3GX4 X;  3F21 A;  4CCM A;  1WH5 A;  3WHB A;  5D8K B;  1QHG A;  4II3 A;  4KIB A;  2DXI A;  3ZN1 A;  4B47 A;  1FC3 A;  1G3S A;  2XPW A;  2MBF A;  3KPH A;  5IT3 A;  2M1B A;  5TIS C;  2I8D A;  6PAX A;  3M7G A;  3JAM Z;  1E2X A;  3B6A A;  2V6E A;  1AHD P;  4ZTF A;  1DUX C;  5M5W J;  3H36 A;  3BG9 A;  1HW2 A;  4BKX A;  1Y0U A;  2Q2E A;  1C0W A;  3BT9 A;  5ICE A;  2LVS A;  2QQA A;  2NXN B;  4ASN A;  1UHM A;  3JTH A;  4HV6 A;  3K1P A;  5E8G A;  5FRO A;  3ECO A;  3F22 A;  4BE0 A;  3TED A;  1T2K A;  3SZG A;  4OIR F;  4D0P A;  4Y33 A;  4FIS A;  3JRF A;  1YIT I;  3OOU A;  1HW1 A;  2R7Q A;  3DTE A;  3OSG A;  4N9I A;  3LNQ A;  3FXK A;  4QLC U;  3ZQ7 A;  4CUG A;  2FUG 2;  3LSJ A;  2W57 A;  1YIO A;  2BY2 A;  1ZR2 A;  1RNL A;  3A1Y A;  1R5G A;  1V5E A;  1VF9 A;  2AXT C;  2D1H A;  5EEH A;  5JHF A;  4LIT A;  2EV5 A;  4XLF A;  3GTQ J;  2VKH A;  2HQA A;  5HS8 A;  1L3L A;  4KIS A;  2ZFW A;  4A3E J;  1OYI A;  2F4O B;  3F6V A;  3O6B B;  1QHH D;  1KON A;  2VQH A;  2TDX A;  1Y8Q B;  5B3S H;  1O3S A;  4G94 A;  1B9N A;  4AIK A;  3ASN H;  1P7I A;  2PMZ A;  4BDY A;  2I10 A;  3FM3 A;  1PUF B;  1D8J A;  3HRU A;  1PP8 F;  2QBY B;  4UB8 C;  4DBR A;  2V9P A;  1Z7L A;  2ZME A;  2JA8 J;  2NNY A;  4LLN A;  3AFH A;  3HM5 A;  4BU2 A;  3GFL A;  3V7C A;  3TP0 A;  4YFN F;  1GT0 C;  2BXZ A;  4NUB A;  2KP6 A;  5F64 A;  3RKY A;  3LWF A;  3IAS 2;  1KQ0 A;  1R1V A;  3OV8 A;  5L3G A;  2O61 A;  4CYC B;  2F5E A;  3JRI A;  3L2W A;  1ZG5 A;  4MQV A;  2K5C A;  5IT9 K;  2CH0 A;  4E4H A;  4BS9 A;  3P9I A;  1NG7 A;  2VB6 A;  2JPC A;  2E1M B;  5CLS A;  2L02 A;  4XOR A;  3RSN A;  1J9I A;  3MMY B;  1LVA A;  2PMZ N;  3TDZ C;  2OF7 A;  3HOW J;  3DWL E;  2LG4 A;  4EGY A;  3CES A;  2LR8 A;  4PZJ A;  4LLG F;  3RKW A;  4KA4 A;  4RGU A;  1TWC J;  3A0H C;  1YO5 C;  2EIL H;  4CO8 A;  3ULQ B;  1I3Q J;  4GO1 A;  4HPQ A;  1RI7 A;  1R5H A;  1O4X A;  2X85 A;  3TQN A;  1YS7 A;  4E70 A;  4WWC A;  2Y31 A;  3B02 A;  5HLT A;  1HQC A;  3OYJ A;  1UB9 A;  3ASO H;  3JRD A;  2LKS A;  2GOM A;  3GWZ A;  5ED4 A;  2IS2 A;  2MD0 A;  3DXJ F;  3VB2 A;  2BY3 A;  3LL7 A;  5J1Y A;  1U0J A;  4MTD A;  2K4B A;  1YJ9 I;  5FRN A;  3FXU A;  1JKO C;  4B1R A;  3J7A Y;  1IRG A;  3LFK A;  1MH3 A;  3G73 A;  3HRT A;  2P4W A;  3O2P E;  3WTY C;  1QA6 A;  2W4S A;  2G7H A;  1MIJ A;  1BI0 A;  1MW7 A;  3TW7 A;  2PBI A;  3CUO A;  3RPQ A;  2M7B A;  4MQ9 F;  2O0Y A;  2DPD A;  4NDL A;  4XSZ F;  4A12 A;  2KLO A;  2LMD A;  3ZQH A;  4BHP A;  4Q5S F;  4GCV A;  2W48 A;  2OTL I;  2B63 J;  3HKZ A;  3IAM 2;  1U8B A;  2EIN H;  2AO9 A;  4B48 A;  4CZC A;  3FMS A;  1UST A;  3CCV I;  1BR2 A;  2LRE A;  1OYY A;  3D0S A;  4XLA A;  2HZD A;  1B72 A;  4HNT A;  1IDY A;  4BQN A;  4CGZ A;  2FX0 A;  2BEO A;  1G2H A;  2TCT A;  4BY1 J;  1A6Q A;  3RQI A;  5LEJ A;  2HGC A;  1LFB A;  1DPR A;  4XRS A;  1BI2 A;  4IRG A;  1IAW A;  2CUZ A;  4HX4 A;  4C2M J;  4W97 A;  5L3C A;  1X19 A;  4R8H A;  1ZR4 A;  1CQT A;  1FX7 A;  2DU9 A;  3Q9S A;  2CYY A;  3S3M A;  4XKW A;  1MBK A;  1TT0 A;  3ABK H;  3ZMT A;  1X1C A;  4KJZ A;  4BYY A;  3ROU A;  2YX7 A;  1F36 A;  3OSF A;  3HOY J;  3CQZ J;  1RKT A;  2NS8 A;  2FOW A;  3CLQ A;  1RPW A;  1KU9 A;  3PQJ A;  3OYC A;  2OZ6 A;  4M6Y A;  1JJ6 C;  1LJ9 A;  2X6W A;  1DP7 P;  2HQR A;  5E1W A;  1FEX A;  4ZJZ A;  2XC7 A;  1HDP A;  4LMY A;  4CXF A;  2Y9Z A;  5CVV A;  3U1K A;  4XK4 A;  1U8R A;  1WJA A;  2FA5 A;  3I3L A;  4XOP A;  3AG4 H;  2XGC A;  2OQG A;  4A0Y A;  1BW5 A;  4NB5 A;  2E2I J;  1EKE A;  5FLX Z;  1PJR A;  5EEG A;  3PM1 A;  1VZ0 A;  3QYF A;  1Z05 A;  5HLG A;  5KK1 A;  4PK4 A;  2G0E A;  3Q9V A;  5GP9 A;  2ELH A;  4Y52 J;  2O8K A;  1UHW A;  3WU2 C;  4XKV A;  1EF4 A;  2YX4 A;  4O5V A;  4A0X A;  5FKN A;  1FTT A;  3EYI A;  1OCO H;  2VT3 A;  4M73 A;  2F5V A;  3FXO A;  3HG9 A;  2F4I A;  1OR7 A;  3K2A A;  1Z3X A;  4BJT A;  2XF7 A;  2H94 A;  2JPB A;  5CVR A;  2E1C A;  2XF6 A;  4IEJ A;  1HSJ A;  4A0Z A;  4IXA A;  1AKH B;  4FQG A;  4U7B A;  3SFI A;  1LFP A;  4EMS A;  3HDD A;  2WAD A;  4HQE A;  3DLA A;  1UG2 A;  3L09 A;  5ILS A;  1LNW A;  3FMQ A;  5GTI C;  2IS6 A;  2YUS A;  2NOG A;  4II2 A;  2KZG A;  4Y13 A;  2KDZ A;  1OCP A;  3U21 A;  3IWF A;  3TMO A;  5C44 J;  4RA2 A;  5TRD A;  3GTK J;  1U9N A;  2MD5 A;  3I5U A;  4OMZ A;  4CYD A;  1Z7U A;  1T95 A;  3IH3 A;  4G9Y A;  2ETH A;  4OAZ A;  4CCN A;  2AHQ A;  1XSV A;  1Y6I A;  2ID6 A;  2COM A;  4QIW N;  2FQ4 A;  4Y15 A;  2LBF A;  4GRI A;  2NRA C;  4KIT B;  2BVM A;  3ONQ A;  4B09 A;  5C4X J;  3P9C A;  1GLN A;  3PL8 A;  1FMV A;  2L9V A;  1WPK A;  3CC7 I;  1JUM A;  5DM6 F;  1W7P B;  3MQ0 A;  3CCR I;  2V79 A;  3K7A J;  4MEY F;  3CCU I;  4LB5 A;  2QQB A;  3L1P A;  2HXI A;  2VOO A;  3RPU D;  4PGG A;  1P4A A;  4HSR A;  1IV6 A;  1MMS A;  4ENK A;  4J00 A;  1FMW A;  1ZTR A;  4AVZ A;  1FSE A;  2OA4 A;  3HL2 A;  4BQA A;  4BQQ A;  2HZT A;  3DLL F;  4N0B A;  5FD6 A;  3G3Z A;  3UR3 C;  1J75 A;  2B9S A;  2A61 A;  2AS5 F;  4IQ4 A;  4KMF A;  3V42 A;  2W85 A;  2QA4 I;  4BY7 J;  4FTH A;  4J01 A;  2F4M B;  2JN6 A;  2CS3 A;  2VE9 A;  2M9H A;  3VWB A;  2R7Z J;  4D7M A;  2DPU A;  2X6O A;  1H9G A;  2ZXW H;  3U2R A;  3LAJ A;  2KIM A;  1Y39 A;  3ZQC A;  1XCV A;  3A0B C;  1BOB A;  3DTK A;  3M1E A;  4UVA A;  1ZRD A;  2A6T A;  2AQF A;  3JCU C;  1EA3 A;  3RPU A;  1U6G A;  4IPA A;  5K5R A;  1BC7 C;  2JJ7 A;  1XPX A;  3OIO A;  2A6E F;  4XOT A;  3JRH A;  1VQP I;  2A07 F;  1ORK A;  4PUS A;  4HDU A;  3K10 A;  4RAY A;  4LJZ F;  3DQV C;  1B59 A;  2E1O A;  3BZC A;  5J8F A;  1E3O C;  3FK7 A;  1STZ A;  2CUJ A;  4M3B A;  1RET A;  3J80 Z;  3DF8 A;  2WV0 A;  2K4J A;  2LF8 A;  2RVC A;  4AU7 A;  3E6C C;  3SEZ A;  4C2U A;  5DM7 F;  4E6K G;  3CJN A;  2IXS A;  3GW2 A;  3FX3 A;  3PIP F;  4P9F A;  2M34 A;  4XRM A;  4DYR A;  3B6C A;  3E6M A;  3D5R C;  4HW0 A;  1ETW A;  2ZSI B;  5FB2 A;  2E5Z A;  2OD5 A;  1ETX A;  4FX0 A;  2MG4 A;  4UVB A;  1OCR H;  1WJC A;  5HLH A;  1RR8 C;  4F91 B;  2DTZ A;  3OL4 A;  3MEX A;  2DMT A;  2PMH A;  2OAZ A;  3IP4 B;  3QU3 A;  4I0A A;  1SC7 A;  2DBB A;  1J09 A;  2HOE A;  1PYV A;  4M3E A;  3KFW X;  4FE7 A;  1XMK A;  3OYA A;  3L2V A;  1UHS A;  1I5Z A;  5L3E A;  3C2G A;  3LSG A;  4UB6 C;  1YJN I;  1RR7 A;  4WF2 A;  1PVE A;  3WE2 A;  5J1U A;  1JKR C;  5HLI A;  1VQ5 I;  1XB4 A;  2QQ9 A;  1ON2 A;  1K4T A;  2CQK A;  5TGT A;  3CF5 F;  4L0Y B;  4EAT A;  4NC8 A;  1ZAO A;  2VN2 A;  3FKJ A;  4KT6 A;  2HPI A;  2RRE A;  1Y1V J;  2WY7 Q;  1EV7 A;  2VBX A;  3MCZ A;  4RB0 A;  5FKM A;  3PNV A;  1YI2 I;  1KQ9 A;  3HOX J;  1O7F A;  3MKY B;  3OR2 C;  2XDV A;  2WTE A;  2R0Q C;  3LMM A;  1WHU A;  2VL8 A;  2VJ5 A;  4XQF A;  4IRI A;  2DYS H;  2GLO A;  3HPH A;  2MH9 A;  1X4O A;  2KQR A;  2NS7 A;  4M6X A;  1K79 A;  3OYG A;  3H0G J;  4B4C A;  1O3R A;  4HF0 A;  4A3I J;  3KP7 A;  4M9S A;  3I58 A;  5HS9 A;  1KU7 A;  5D6E A;  3CMY A;  3I56 I;  1D5V A;  4JP0 A;  3J81 K;  2RGV A;  4X1E A;  3A4C A;  2L7M P;  4XNF A;  3IL2 A;  4PJM A;  3I53 A;  5EZG A;  4CCO A;  5E1Z B;  2EV6 A;  1ZHF A;  2JSC A;  4E7L A;  2OJE D;  2OZU A;  2C6Y A;  3KEQ A;  4IHT A;  1MND A;  2IA2 A;  4MNU A;  2IGO A;  4ESF A;  1GDT A;  1JHF A;  2IS1 A;  3L2U A;  4UV9 A;  2JA2 A;  1IV8 A;  4P55 A;  2E5N A;  4M74 A;  4ENJ A;  2K7L A;  2X1E A;  2IGM A;  2R5Y A;  1IUY A;  2DT7 B;  2EH3 A;  3HIF A;  3HB9 A;  3L00 A;  4RLQ A;  3GBG A;  2ZFU A;  1X1A A;  3LSM A;  3H3U A;  4QPO A;  2HTJ A;  3OYN A;  4X0G A;  2IT0 A;  4BJ6 C;  4GDF A;  3AG1 H;  1W36 D;  1Z6R A;  3T0Y A;  5D4S A;  2LNB A;  1SFE A;  1YIJ I;  1YW9 A;  1WSU A;  4CA0 A;  4N4O B;  1DDN A;  1T56 A;  3PFY A;  1ETQ A;  5FLM J;  5A2Q K;  2Q0O A;  1LE8 B;  1TT5 B;  2DFE A;  4E7J A;  1HXD A;  4MGR A;  2EA4 A;  1WI9 A;  4U0Y A; 
#chains in the Genus database with same CATH homology
 2HQA A;  2LBF B;  1D1A A;  2X6Y A;  4KIS A;  1Z3Y A;  4IQJ A;  2VIX A;  2UV1 A;  4DOZ A;  1QHH D;  4JQF A;  1KON A;  2E1M C;  2VQH A;  3K70 D;  4CSW A;  4E7Z A;  1G59 A;  2PMZ A;  4BDY A;  3ZQQ A;  2R7W A;  2MFZ A;  1WJ5 A;  1Z21 A;  3W3C A;  3PNT A;  2VXZ A;  4DBR A;  4D9J A;  2M0M A;  1Z7L A;  3ZCO A;  1IRX A;  3AFH A;  2IGN A;  3M8J A;  4BU2 A;  2BVL A;  1WJF A;  2LOO A;  3DKX A;  2WAE A;  3LSI A;  4HG2 A;  4XM3 A;  2MYS A;  1WJE A;  2KP6 A;  2LC2 A;  4NUB A;  3OS0 A;  3IAS 2;  2LYC A;  2HVS A;  3L2W A;  3OYF A;  4NC7 A;  2K5C A;  2R7X A;  4HEA 2;  2CH0 A;  5KHD A;  4E4H A;  1DGR M;  3E1S A;  4BS9 A;  2R7S A;  1V5F A;  1NG7 A;  2VB6 A;  4AYB A;  2E1M B;  3HXL A;  4XOR A;  3RSN A;  3MMY B;  1LKX A;  1MMA A;  4RM2 A;  1YE9 A;  2VPL A;  3DWL E;  3G2B A;  3PSF A;  2Z2S B;  2LG4 A;  2JVG A;  3CES A;  3K4C A;  2XSJ C;  4RM3 A;  2XF5 A;  4CCJ A;  4HPQ A;  2HVR A;  2X85 A;  2KPM A;  3EUK L;  2UUZ A;  4DGW B;  5HLT A;  2BOL A;  3OYJ A;  3PSI A;  5HVQ C;  2VKD A;  4YEJ A;  2LY1 A;  2GOM A;  2IS2 A;  2MD0 A;  3LL7 A;  3DKY A;  3MD2 A;  1U0J A;  3N05 A;  5FRN A;  3J7A Y;  1LDK B;  2W4S A;  2X51 A;  2DJI A;  1UG0 A;  1MW7 A;  2M7B A;  2VQC A;  1X1B A;  1DGW Y;  5KCM A;  2KLO A;  3DPU A;  2KL4 A;  2CMP A;  1MMN A;  1N75 A;  2KRH A;  2NOJ B;  4LG3 A;  4B44 A;  4DJA A;  2ZXI A;  3HKZ A;  3IAM 2;  3W2W A;  3FBN B;  2R7R A;  1V5G A;  2LRD A;  1YX5 A;  2L2O A;  2VJ4 A;  4B48 A;  4CZC A;  1AA7 A;  4ZC3 A;  4FET A;  5HNH A;  1MMD A;  3KYL A;  2F6C A;  1X1D A;  5CKT A;  1YX3 A;  1BR2 A;  2LRE A;  2WB1 A;  3CF2 A;  1BR4 A;  3QOD A;  3DU5 A;  3K4N A;  2E60 A;  4XLA A;  2HZD A;  4E7I A;  4HNT A;  1N77 A;  4BQN A;  4LIU A;  3RCO A;  1P9Q C;  2ZXH A;  2IS4 A;  3CJQ B;  3OMY A;  1NG6 A;  3BCB A;  3PUB A;  4BL0 B;  2WAF A;  4ZDL A;  1DQU A;  3OYD A;  2L9N A;  2HU9 A;  4IX7 A;  3S3N A;  3AL0 B;  3KEY A;  4CH7 A;  2R7V A;  2PJR B;  2CUZ A;  3HC7 A;  4OAY A;  2R7T A;  1X19 A;  3F9K A;  2KDO A;  4R79 A;  1K6Y A;  2CFO A;  4BQO A;  3S3M A;  4XKW A;  3H5R A;  1TT0 A;  3LSH A;  1X1C A;  4KJZ A;  4PFP A;  1ZEL A;  1R6R A;  2VLA A;  3H5A A;  2CV0 A;  3OYC A;  2MAB A;  2O5R A;  2V9K A;  4BJ5 C;  2X6W A;  4BE1 A;  1OR7 C;  4OWR B;  4ZJZ A;  2XC7 A;  2QKM B;  4N4N B;  4NNJ A;  3OYB A;  1WJA A;  3I3L A;  2W00 A;  4XOP A;  3RQ4 A;  2KMU A;  2QKL B;  4DIQ A;  2HPM A;  4HRI A;  3PNY A;  1PJR A;  1ERD A;  4BGD A;  1VZ0 A;  3IUO A;  3QYF A;  4ZTJ A;  1UAA A;  2M3A A;  2Z1D A;  3OYH A;  4PK4 A;  5CQE A;  3HPG A;  3H5N A;  4XKV A;  4Y4R A;  4BEH A;  3CP2 A;  2CW7 A;  2K3P A;  4MLO A;  2F5V A;  5FRM A;  3HG9 A;  1WFX A;  2F4I A;  2JSP A;  3K4M A;  2M4G A;  2V26 A;  4XN3 A;  3OR1 C;  1Z3X A;  2JVH A;  4F92 B;  1WJB A;  4BJT A;  2XF7 A;  1LVK A;  2XF6 A;  3OIP A;  2KHM A;  1JI8 A;  4U7B A;  3EUA A;  1LFP A;  3W2A A;  2WAD A;  2HDW A;  2WY8 Q;  3DLA A;  2IS6 A;  4XLH A;  3OYL A;  4XLE A;  3M1C A;  4II2 A;  3L2R A;  2HNH A;  4E7K A;  4YRV A;  3L2Q A;  3U21 A;  4BEH B;  3CZ6 A;  2MC4 A;  3TMO A;  3OS2 A;  3EUH C;  3FDY A;  4F3Q A;  4BDZ A;  3K70 C;  2VJI A;  1T95 A;  3SEQ A;  3RTR A;  3K4K A;  4OAZ A;  1BR1 A;  3NWT A;  4CCN A;  1Y6I A;  1HA8 A;  4XL9 A;  5LD2 C;  2Z16 A;  4P1W A;  3DEE A;  3DPT A;  3ZR8 X;  2LBF A;  2LY2 A;  4GRI A;  3VYU B;  4KIT B;  4Y3O A;  2BVM A;  3BG7 A;  3VYR B;  4XKB A;  3ONQ A;  4ZYA A;  3OYM A;  3H9J A;  2UWM A;  1SAU A;  1GLN A;  3PL8 A;  1FMV A;  2XAU A;  3VSK A;  1MNE A;  2RQQ A;  3FBI B;  2W82 A;  4NQW B;  4E7S A;  5KNL A;  3NWS A;  3RPU D;  4HSR A;  3PJR A;  4B43 A;  4J00 A;  1FMW A;  2AQE A;  4IKF A;  4AVZ A;  1G8X A;  3BC8 A;  3HL2 A;  4BQQ A;  4XN0 A;  3VSL A;  2CV1 A;  4B3X A;  2R7U A;  3UR3 C;  4JOM A;  4XKC A;  4XON A;  3S32 A;  3E0J B;  4IQ4 A;  4LIV A;  2Q2E B;  4XR6 A;  2DOA A;  3V42 A;  3DTI A;  3VYS B;  2VJJ A;  3K4J A;  4FAS D;  4PJN A;  4QPQ A;  4J01 A;  2CS3 A;  3VWB A;  1Y56 A;  1UEL B;  4ZDO A;  4D1Q A;  1D1C A;  4F52 A;  2R7O A;  4ANJ A;  3EPZ A;  1BOB A;  3BCA A;  3DTK A;  2OV7 A;  3S3O A;  2BW3 B;  1N78 A;  1SFK A;  4BE2 A;  2A6T A;  2AQF A;  3DU6 A;  1EA3 A;  3H9Q A;  2WAQ A;  4PSW A;  1WJD A;  3MKW B;  2P0W A;  2VQG A;  3S8P A;  4XOT A;  3OYK A;  3C2H A;  3K6G A;  1T0F C;  4PUS A;  3D5S C;  2X1C A;  3HOS A;  3K10 A;  2L9S A;  3DQV C;  2RNG A;  2M7A A;  4BUP A;  3VDX A;  2CUJ A;  2KZV A;  2BW3 A;  3AL0 C;  1D1B A;  1D0Z A;  4AU7 A;  3QOE A;  3S93 A;  2WA0 A;  2W1O A;  3SEZ A;  4C2U A;  4E6K G;  4H4K C;  2LH9 A;  2IXS A;  4G6T B;  1TZL A;  3LFU A;  4PSX A;  3ZRG A;  3K4B A;  2A5W A;  2VAS A;  3K4L A;  3D5R C;  2ZSI B;  2E5Z A;  2CW8 A;  2ELJ A;  1WJC A;  2V7F A;  4F91 B;  4RMN A;  4F93 B;  3OYE A;  1W36 C;  3BG6 A;  3TL4 X;  3OL4 A;  5CQG A;  3KX2 A;  3CJR B;  3IP4 B;  4XMY A;  3SDB A;  3A2K A;  1J09 A;  1PYV A;  2WBM A;  3AKZ A;  3OYA A;  3L2V A;  2VQL A;  1X4P A;  2V4J C;  3C2G A;  3LSG A;  3UNG C;  2VXD A;  3ZGK A;  3H9G A;  4PFO A;  1D0X A;  4PJJ A;  3CMM A;  3BLY A;  1S9H A;  4CCK A;  4IZZ A;  3QYE A;  3OWT A;  5TGT A;  3HUG B;  2L5Q A;  4EAT A;  4NC8 A;  3FKJ A;  3OS1 A;  4KT6 A;  2L7K A;  2HPI A;  2RRE A;  2Q1Z B;  2K9M A;  3CP8 A;  4E7H A;  2X1D A;  2WY7 Q;  3VYT B;  3PNV A;  3D5L A;  2IGK A;  4C9Y A;  2OUM A;  5HNF A;  2PJR A;  3MKY B;  3ZXS A;  3OR2 C;  2XDV A;  5HOO A;  3LMM A;  4YEL A;  2VL8 A;  2VJ5 A;  4DBQ A;  4XQF A;  3OYI A;  3HPH A;  4U87 A;  1OLT A;  4ITV A;  1X4O A;  2GOX B;  2KQR A;  4F55 A;  2M4K A;  1E0E A;  2K9L A;  3OYG A;  2DCE A;  5LFA A;  4ZDP A;  3QYB A;  4HNU A;  2HVQ A;  3HOT A;  2JUG A;  3FHN A;  4C30 A;  3H35 A;  3OL3 A;  4HST A;  4CCM A;  1QHG A;  4II3 A;  2DXI A;  3W2V A;  4B47 A;  3A4C A;  4XNF A;  2R4G A;  4PJM A;  4CCO A;  3MKZ A;  1D0Y A;  4E7L A;  2I8D A;  1MMG A;  3DPL C;  2KRC A;  5CPR B;  2V6E A;  4ZTF A;  1MND A;  2IGO A;  2IS1 A;  3L2U A;  2JA2 A;  2E5N A;  4XLC A;  2X1E A;  2IGM A;  1QU3 A;  2W7N A;  2DT7 B;  3SYT A;  2X6X A;  4RLQ A;  3GBG A;  4RLF A;  2OC6 A;  2ZFU A;  2ZSH B;  5FRO A;  1X1A A;  4BE0 A;  3LSM A;  4P5O A;  3SZG A;  4QPO A;  4BAC A;  3OYN A;  4PJL A;  4X0G A;  4Y33 A;  4CCL A;  3H0D A;  4BJ6 C;  1W36 D;  4C2T A;  3OOU A;  2DT6 A;  2R7Q A;  3DTE A;  3TBI A;  2FUG 2;  4CUG A;  4BXF A;  2CV2 A;  4CA0 A;  4N4O B;  2Y0S A;  3PFY A;  3A1Y A;  1V5E A;  5JHF A;  3OY9 A;  3OIQ A;  4E7J A;  4LIT A;  2V1N A;  4XLF A;  3LSK A;  3I9V 2;  1DP3 A;  2VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...