2LBPA

Structure of the l-leucine-binding protein refined at 2.4 angstroms resolution and comparison with the leu(slash)ile(slash)val-binding protein structure
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
346
structure length
346
Chain Sequence
DDIKVAVVGAMSGPIAQWGIMEFNGAEQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATAPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-BINDING PROTEIN
publication title Structure of the L-leucine-binding protein refined at 2.4 A resolution and comparison with the Leu/Ile/Val-binding protein structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Periplasmic binding protein
total genus 109
structure length 346
sequence length 346
ec nomenclature
pdb deposition date 1989-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lbpA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lbpA01
4QYMA 1JFTA 3E3MA 3KKEA 4PEVA 1WETA 2HJ9A 3R0JA 3QEKA 1TM2A 3F6CA 4OBBA 1PNTA 4S05A 1OXKB 3MIZA 4ETIA 1SRRA 1MVOA 2FSPA 2PJUA 2MYUA 2PUCA 1MIHA 3EAFA 5IUJC 1DG9A 4S04A 3H1EA 3EODA 5CHYA 3F73A 5ABPA 2KYRA 1DJMA 1BA2A 1NXPA 1PEAA 1RXEA 1SXGA 1Z17A 3D02A 5TQ2B 2R25B 2JBAA 2R48A 1EHCA 5KC8A 1S8NA 3C97A 3I45A 2I6FA 2CHEA 4EVQA 1F4VA 1KGSA 3LFTA 3KYJB 4JAVC 4JP1A 5CNKA 5BQ3A 5I4CA 4E7PA 4EUKA 3OQMA 3HJFA 3T95A 1QPZA 1RPJA 1NTRA 1LBIA 1DC7A 2E4VA 2H0AA 1GLGA 3EQZA 4RK7A 3KG2A 3QLUC 2N9UA 1YS7A 4YR7A 3Q7SA 2JBAB 2O20A 3N0WA 3QELA 4DN6A 3FFWA 2PUEA 3FFTA 2VYCA 2R47A 5BR1A 3IP7A 5IULC 4DADA 3OO1A 1EWVA 3OM0A 3ROFA 4Z99A 4YCSA 1BDHA 4D6YA 1DCMA 4D6XA 5KQMA 2AYZA 4NV3A 3I5AA 3H5IA 5EWJA 3HO1A 3M9XA 3QLUA 5DGCA 7ABPA 4MQFA 1Y1LA 3KLNA 2RJOA 1SD5A 3KSMA 4EYOA 4QPJC 1IIBA 1M5UA 3HV2A 3RVJA 4WXEA 3SNKA 4RK5A 1U8TA 2IKSA 1NXTA 1EAYA 3QELB 1PNRA 3HS3A 3GT7A 4IF4A 4H60A 4MS4A 2GI4A 3OLYA 5DKFA 1AB5A 2JRLA 2A9QA 4MR9B 2JVKA 3Q41A 1NXWA 1QMPA 1JWLA 4XXHA 2FEWB 2IDMA 2E4YA 4RXMA 1Z2EA 3BRQA 2IOYA 1U2PA 4RKQA 3OLWA 4Y9TA 5TPZD 4PZ0A 3GWGA 1DCFA 2NZUG 3W9SA 8ABPA 4O1HA 3H5TA 5E3JA 3JVDA 1FSPA 4MS4B 3RVMA 1ZHHA 4OLBA 1USKA 2FMFA 3CG0A 3HVRA 2MYTA 4RK6A 5TPZA 1M2EA 5DTEA 2LBPA 1BVHA 2Q5CA 2FEKA 5HM6A 5GQSA 3ILYA 3CHYA 2IPNA 1USIA 3CU5A 3NHMA 3OMXA 4O1IA 4TMYA 3LMKA 1YK0A 5TPWA 4QICA 1JH9A 2JB9A 2PUGA 3LUKA 2L2QA 5TQ0B 4ZJPA 5DCLA 5JNUA 4RXTA 1CEYA 3NBMA 4P98A 2GX6A 4ZPJA 4RK4A 4XLTA 3CRNA 3I09A 4LRQA 3Q15C 3CZ5A 4G0ZA 1HEYA 5KQGA 4W5QA 3DLBA 4TN5A 3OM1A 3L6UA 2BGGA 1VPWA 3Q9SA 1JF8A 1JLKA 1FFWA 5TPWB 3KLOA 5B3JC 3RVPA 2QZJA 2JK1A 4LE2A 3SQNA 3G85A 4IILA 3RVSA 4N41A 4N0PA 4Z4GA 2ZWMA 1PEYA 2NT3A 2E4UA 2FLWA 3MMNA 3UKJA 4Z4FA 1W25A 3H5WA 4ML3A 1K68A 1YMVA 3KCNA 4G0QA 4GNRA 4PE5B 3MF4A 4RXUA 5B3JA 1L5ZA 3CZCA 3MQ4A 3F7NA 1JBEA 4HNSA 2P4UA 2QR3A 3LUGA 3K4HA 3O2SB 4ETMA 3CFYA 1KRWA 4NQRA 1KMIY 2RGYA 1D5WA 3HUTA 3L49A 4QYWA 2MSLA 4Z9BA 2IPMA 1AB6A 2FN8A 4EYKA 1ZY2A 2WY2D 4XAQA 5BRAA 5CNJA 4YGXB 1E6LA 4E7OA 3CTPA 4EGSA 5BRJA 1JFSA 3KYIB 3K9CA 5HKOA 3OQOA 4LX8A 4IMIB 1E6KA 4KREA 4Z4CA 4JOQA 1NY5A 2WWVD 4JB2A 1OXBB 2IPLA 4YV7A 1M5TA 2FVYA 4RK1A 5KI6A 1Z12A 4MPTA 1JDNA 2E4ZA 1DRJA 5KQPA 3HM9A 2NZVG 2TMYA 4EYQA 3S99A 4GPAA 3N8IA 4TLLB 2IPAB 4YS6A 4JB0A 4HNRA 3C3MA 2RDMA 1Z26A 3OLZA 1RNLA 4XARA 4F3TA 4HNQA 1YK1A 4MQEB 1C4WA 1ISSA 3LUHA 1T34A 4KV7A 2PUDA 4PYRA 4KRFA 3N0RA 4JA2A 1XHFA 3HSYA 2FW0A 4MR9A 2PUBA 3N6VA 2FMHA 3EULA 2YHAA 1F51E 5CNIA 3LUCA 2X7XA 3F6PA 3NNSA 4MR8A 4B09A 4LE1A 1EWKA 2QSJA 3SY8A 4Z4EA 3GYBA 3OMWA 4OTZA 1ZGGA 3VNAA 2HQBA 4F06A 1DBQA 1D2AA 2PKXA 2QW1A 4H3KB 1M2FA 3EQ2A 4RS3A 3D8UA 4W5RA 3HCWA 5CNMA 1ZGZA 2P9HA 1UDRA 4KK4A 4RU1A 1GUDA 1ISRA 4IGAA 3ROTA 3C6QA 1E6MA 4MR8B 1MAVA 4RY8A 4DQDA 3O2JA 1LJLA 3A10A 2JVJA 3GV0A 2GKGA 3Q7RA 4MS1B 4MYRA 4ZMSA 1ZAYA 3T6KA 2E4WA 4W5TA 3O74A 1PUXA 2FMKA 4YRZA 2PLNA 2PMCA 4FE7A 4RWEA 3RVKA 2FEPA 5TQ0A 3UUGA 4ZYLA 2MSKA 4ZMRA 1SXHA 2L18A 3B2NA 2FQWA 5FBKA 2VUIB 2FTKE 4OLAA 3HUUA 3CS3A 3TO5A 3IP9A 1QP4A 3DGFC 3GL9A 2DRIA 4RKRA 1APBA 2YHBA 1TLFA 1ZITA 2HQRA 3CKMA 3IPAA 1DCKA 2FMIA 4MAAA 3T38A 1J56A 2E4XA 1Z25A 4RK0A 3LTEA 4WUTA 1YS6A 4G0PA 3HZHA 4UHKA 1YTUA 1FFGA 1JX6A 1K66A 5KC9A 2WRZA 1EFAA 3C3WA 2FLKA 1URPA 3NNNA 1MB0A 1P8AA 4Z4IA 4RY0A 4EY3A 2VUHB 3MYYA 4KNYA 3CNBA 2W42A 3P9YA 2LPMA 1BDIA 2WJAA 2F8TA 1QNLA 3IDOA 5IUNC 3HDGA 3H1GA 1GCAA 3LKVA 2B1JA 3URMA 1A0OA 2M1ZA 3H5OA 4HYEA 3O21A 1JFVA 5IC5A 3RVOA 3RVQA 5GOTA 5HQJA 3O75A 4NICA 4G0MA 3KJXA 3EDCA 1ZH2A 2XDYA 1DRKA 3DBIA 3QLVC 4P1ZA 4KPYA 1GUBA 1U0SY 2NUBA 2WB4A 3TX6A 4NCBA 5FBHA 3HXMA 4MS3B 3A3KA 5D2CA 3QX9A 4MRMA 1P2FA 1P6UA 4MR7A 3QX8A 4WXMA 2HSGA 5IEJA 1LBHA 5JS1A 2A9OA 1JHZA 6CHYA 2F8SA 4Q6BA 5ED4A 2VK2A 4KQCA 2PE5A 4KFCA 1CYEA 3QLVA 1DBPA 2FQYA 3H5VA 1QQBA 3E61A 3OQNA 2R4QA 3JY6A 3QEMA 1Z16A 3CG4A 3M9WA 4MGEA 4YO7A 1QP0A 5C5CA 4XASA 2WMYA 3FDFA 3LUJA 3LUFA 4Z4HA 2H3HA 1R8JA 5FWXA 4MRMB 4FE4A 1JL3A 3O2QB 4MR7B 4Z9AA 3O1IC 3H6HA 2OQRA 2ID7A 4MQEA 1FQWA 1MB3A 3Q7TA 2GBPA 3KHTA 6ABPA 5C5EA 1SXIA 3HK2A 3C3KA 3EJWA 3JPYA 4OATA 2HPHA 4FB4A 1GCGA 2LP4Y 4IRXA 3GRCA 3LOPA 3H75A 2PAFA 3QEMB 4H3HB 3A0RB 2PUAA 3JVIA 5IEBA 1KRXA 1TMYA 2CHFA 3H6GA 3GBPA 1NXVA 4Z0NA 1QO0D 4KVFA 5JS2A 2MSWA 5FWXB 4G97A 3MA0A 5HSGA 3HDVA 4Q6WA 5TE9A 3TMYA 5TQJA 4KQ9A 5IX8A 1P6QA 4L4UA 4M88A 4N0QA 1FFSA 4MLCA 3SAJA 4LE0A 1LK0A 3LKBA 4G0OA 3TD9A 1VRVA 3CLKA 4LDAA 1QP7A 1BAPA 5KWSA 1YIOA 2IYNA 3NNDA 1NXOA 3N0XA 1QO0A 4N47A 3TB6A 1ZVVA 4MS1A 3H1FA 3FFXA 2HQOA 3QLTA 3RQIA 1BDJA 3GBVA 5KQLA 3LUAA 3IPCA 4WT7A 3JTEA 2A9PA 2V0NA 1Z13A 4O5AA 4L85A 2FKAA 4EVRA 5F64A 3KTOA 1XHEA 2MYNA 1CHNA 3OLVA 2NT4A 1YVUA 1A2OA 4F11A 4YWHA 2L17A 1Z2DA 1D1PA 3KS9A 4KZKA 1NXXA 2CD7A 1NXSA 1ABFA 2ZAYA 2WJWA 1DC8A 1EWTA 4W5OA 2L19A 4OG2A 3BILA 4W5NA 3OO0A 5T3YA 2CWDA 4MLDA 4JASB 3BBLA 2QVCA 3T8YA 4EVSA 1A04A 1ZN2A 2LIVA 2AYXA 3HEBA 4Q7EA 4YP9A 1RZRD 5EWJB 4RY9A 2MYPA 4XFKA 5IBQA 1LJUA 2B4AA 2QU7A 4MQFB 5EWLA 5JNTA 1DZ3A 3JPWA 1E2BA 1D4ZA 2FXIA 1Z15A 2PL1A 3LUDA 3M6MD 4ETNA 4PICA 3RH0A 3IP5A 3H5LA 3RVLA 5FWYA 4UHJA 1ZESA 2QXYA 3EGCA 1YMUA 2OENG 1B00A 5DLEA 3IP6A 1VKRA 2M98A 4TLMB 1Z18A 2QVGA 3A0UA 4YLEA 3SM9A 3I42A 3O1HB 1RZRA 1ZDMA 2FQXA 3FMVA 3OLXA 1QKKA 1H9CA 4MS3A 1I3CA 1TVMA 1U2QA 3ILHA 4G0XA 5EWLB 3RVRA 2QV0A 4LZLA 4KK3A 5JNRA 1L5YA 9ABPA 3FGZA 5FWYB 3G1WA 3N75A 2ID9A 2JCGA 5JNVA 1JDPA 3BRSA 4G0YA 1USGA 5EWMA 3VNBA 1W9HA 4F8JA 1DBWA 4KMRA 3QK7A 4CBVA 1JYEA 2JVIA 1D1QA 3DGEC 3MM4A 4WWHA 4RZSA 1ABEA 2J48A 1RXIA 5IUKC 3BREA 3JS5A 3N53A 5T7BA 4N76A 1ZH4A 5JNSA 3RVNA 5JNWA 4RV5A 3DZDA 4RSMA 5PNTA 3GA5A 4IMJB 4N03A 5EWMB 4F12A 4LDZA 3NHZA 4RDCA 3UK0A 1U04A 2GWRA 3O1JC 4EYGA 1VLZA 4WZZA 2PL9A 2LUOA 1DP4A 4NCAA 2A9RA 1NATA 1JYFA 3SG0A 2FN9A 1TJYA 2RJNA 4D74A 1QQAA 2PUFA 1C0EA 4G86A 5TQ2A 3DLHA 1PHRA 1XWWA
chains in the Genus database with same CATH superfamily
5LUBA 1PJRA 4D8WA 3EGWA 1ZM2A 4KPUA 1I2ZA 4L4ZA 5EE5B 3VHXB 4J16C 2W2OA 4OKIA 1YS1X 4V0OA 4J6FA 5KVSA 1PSZA 2FW1A 1N7IA 2QLMA 4N82A 3NUQA 2Q6TA 4F72A 2QMQA 4HY3A 2PWZA 2HRBA 5T64A 1P0CA 5DBIA 5KNBH 4RHCA 1TD9A 3M3HA 1E2JA 3G7NA 1J9ZA 1U11A 2BL4A 2FPGB 2QPOA 4W1SA 1PEAA 2ZYRA 4C08A 4Q7JB 4WA7A 3MBIA 3QPAA 4PSCA 2PO7A 3S68A 1Y3IA 1L6RA 4MEAA 3CC8A 1C0LA 4A82A 3NVMB 4X45A 1PW5A 3MB5A 4BP3A 3BCHA 4PANA 4EVQA 4ZYYA 4I08A 4KPUB 1X8JA 3B1XA 1SUSA 4JCOA 4XIJA 4TL8A 2WABA 3L6CA 3AGQA 1XOIA 2ATCA 4FOLA 4IJUA 5KSOA 1RYHA 2X0EA 1KEEA 3QTLA 4LGMA 5AXBA 2OCLA 1V7CA 3DOFA 3N2GA 3ZDZB 1GLGA 1HYQA 2VRWA 2ZZMA 2BGRA 5K03A 3Q7SA 1K7XB 2X8AA 1R0ZA 4ZT3A 3ECAA 5JJ5A 5LKAA 3HB9A 2O7VA 2VQDA 2XWSA 2RKWA 4C0LA 4CM3A 2YVUA 1CZUA 3OO1A 5SY6A 5C32A 4JKIA 4A0QA 2PMWB 4Z49A 3IMKA 2PZAA 3N1UA 3UFBA 2RFLA 3K9NA 2P9QA 3N2GB 3MT7A 3P2MA 3AV3A 1NVAA 3MCWA 4RK5A 2QZ4A 3EDYA 3KR0A 3KZNA 4Q9JA 2B1IA 3CLUC 2Y1DA 3R7AA 1ZW1A 4RFLA 2GXAA 4J76A 1UL1X 1ZMOA 3CLUD 1JE1A 4ZZ2A 1XZKA 4OJKA 3CN9A 4CF5A 1HNXB 4EUFA 3ECCA 5ESWA 4AY4A 1JWLA 2VHWA 5ALWA 2AJTA 1RJDA 2IZ7A 3QX7A 2OYCA 3A6FA 1U2PA 2HIMA 3ND5A 3RV4A 2XNKA 3SJAA 3EPJA 2DPGA 4K8RB 5KVQA 1E3EA 3A4MA 13PKA 4JZKA 5JATA 2R751 4P7FA 1KHHA 5E3JA 1H2XA 2G7MC 3GAFA 3L0SA 3MTJA 3RJTA 1W5BA 3V32A 3M6WA 1ISHA 4DWWA 4JNCA 1YVEI 1J0CA 1V3QE 3TRKA 1BFUA 2PG3A 5C1PA 1KIMA 5B5SA 1K8RA 3H2KA 1YJ8A 4RK6A 4ZK6A 1ZJWA 2E5LB 1OY1A 4EH1A 4ENRA 4QZVA 3AVXA 2ECPA 1YZTA 5C4MA 5LWHA 4Z4QA 2CHQA 3CHYA 3L8DA 3MRTA 4X62B 3DXZA 3JARA 5L4SA 3NHMA 2EZ4A 3GA0A 3BG5A 3FROA 2Z83A 3KYDA 2DLDA 2CWWA 2D2VA 1NV9A 3K0FA 3AF6A 1SOUA 4YASA 2Q29A 5FT9A 1S96A 4C07A 2P3QA 3GDWA 2R6JA 5JNUA 4EQZA 1NI3A 4Z6KA 1DAKA 1FDIA 1ODLA 1KY5A 2ZWIA 4UFNA 3UJ3X 4DLPA 3B1KA 4JLOA 1ECBA 4EB6A 4IDAA 5BURA 4ZTZB 1I2BA 1V45E 1SUPA 3JARB 2QUBA 3B13B 1VPWA 1PR4A 1G6Q1 4IINA 1Z0SA 3KALA 3HBFA 4MGKR 3VHRA 4QVIA 4G81A 5LXTF 5B1DA 1H2BA 1YR3A 2VBGA 1S8AA 1WXDA 3K0FB 4DA4A 1AH2A 2QXTA 1JQBA 3FCOA 4TN1A 4MVJG 3KE8A 1GR1A 1YCGA 2JLSA 1NVEA 3QUTA 3IT2A 3VTKA 4KXLA 1T0IA 1N6OA 1WOMA 3AKCA 4LRSB 2CUKA 5DB4A 3E9CA 3OPMA 1BVYF 3AIOA 5I9NA 4EB6B 5IVPA 4J0KA 3FMOB 1IMOA 2QMZA 3QVUA 1XK6A 3QVTA 4N54A 1MGPA 2GCGA 3C87A 3FRHA 1MC1A 4D82A 4DUZB 2DB3A 1TCAA 4CCSA 4BCBA 4HX9A 4NZPA 1EGHA 4JN6B 1J2EA 4ALKA 2YMLA 3F49S 1XPJA 3LXXA 4WMLA 3U0BA 4A8TA 3TE7A 2IPMA 1VMAA 2AW3A 5SYAA 1ZY2A 2V3VA 1A2QA 3M6VA 1PV1A 3MJEA 1Z5WA 2D3TA 5BRAA 2ZATA 2YHUA 3ODPA 3KSDO 4OHFA 2CHGA 4K0RA 4PV7A 4CL3A 4F96A 3SQXA 1VE5A 2CNOA 3BH7A 3NM5A 1QRDA 5ILQA 3O8DA 4XQGA 1SUAA 1IEWA 1ARZA 1FQOA 1V8FA 3IBCA 1F3LA 3UAGA 3NHAA 1PGQA 1SBQA 3K16A 1JTVA 4YROA 6LDHA 4PQFA 1N92A 5C46F 2E4ZA 1DE0A 1ZN8A 3I9KA 3HABA 4OXKA 2ZUVA 1KVSA 1NZJA 3GT4A 2OCYC 4FP9A 1XLUA 2ZCUA 1M54A 1ZRMA 3C5HA 2DLCX 5BVHA 4M0CA 1A4UA 1C7RA 5DT2A 3RABA 5TV2A 4JB0A 1HBJA 3NJ8A 5E7MA 5LBUA 3WO1A 1DARA 1Z26A 4HWSA 3IC5A 3F47A 2QVBA 3G9TA 2EL7A 3OVMA 4E4TA 1CRPA 3LNTA 4COOA 1L1QA 3OD1A 3UMYA 3IBGA 4ENWA 2HHLA 3DFIA 2PUBA 3CQ9A 2G36A 3U3ZA 2FUG1 5AI5A 4B87A 5CDFE 1WU7A 4PX2A 3AXSA 1USVA 3TOVA 1GT6A 2H85A 2F1JA 2NVOA 4OXQA 5A7FA 2NW6A 4F84A 1NY6A 8MHTA 1V1RB 1JU4A 3VNAA 2HQBA 3UPTA 3B5EA 2X1VA 1OIVA 3R74A 4UNSA 3K09C 4PQEA 1R18A 4RPKA 2QL5A 4G0WA 3R3YA 4L9SA 2IBSA 5EIHA 1X1QA 4Q3DA 3JQFC 1MNAA 4TRRA 5AOVA 2A9VA 3U4HA 3HVJA 1X9IA 1WBJB 1UKAA 2ZBRA 1KY2A 3AJDA 3ENWA 3NWJA 4M1EA 4Q3OA 3Q7PA 4OGKA 3T61A 2JA1A 4Y2RA 1SH7A 2W6CX 1VCIA 1E59A 2UUOA 3WKEA 1KEEB 4YV1A 2P9CA 3DCYA 2DP4E 1THGA 1VC2A 3F6SA 3FWKA 4ILEA 4MTCA 1OIWA 3OJOA 1E61A 3OKAA 2H5LA 3QH4A 1UBMS 3E9QA 1L4HA 2IE8A 2OY0A 1D1SA 3DMTA 4DM3A 3MBOA 2FEPA 5TQ0A 4R2XA 2YIVX 3PXGA 3SZ3A 1VJTA 4WJLA 4ZYLA 4HN2A 4BJHB 3HYSA 1ZJ5A 5FBKA 1W2WB 4YAUA 1GUAA 1TZJA 3CGGA 2BBSA 3NAMA 4XOUA 3ZD6A 4BTLA 3HTXA 4BO0A 2FSIA 2ZRGA 3P9SA 4ZEOA 4JHLA 3LECA 5FPHA 3SIRA 3FUCA 3FSEA 1OJ7A 1XD8A 2YHBA 1H0SA 1A71A 4FDLA 2R6FA 3DE7X 3AFGA 4ND2A 2DXIA 2V6BA 1E92A 3CWCA 3ZJ5A 1G38A 2E5FA 1S3GA 4ALNA 4U7JA 3QRWA 1T36A 2V0GA 1KJWA 3OZ7A 1YS6A 4LHWA 4B4UA 3GLHB 4XB6B 5GIOE 2GOYA 2ZDHA 1TEHA 2FPUA 3MJHA 1A8SA 1N2JA 2Y2VA 4IZHA 1FMFA 4C4XA 4RTSA 1ZRSA 3U0VA 4R6WA 5EL0A 2EKDA 4HH0A 1A7AA 1DJLA 3KO8A 3PYXA 4JK3A 3COSA 2CJWA 4IDDA 4O02B 3SYTA 4P4NA 2B6NA 3PUWA 1NJ8A 2FZVA 3ROMA 1VIYA 2R0QC 2HREA 3IQIX 3H1BA 4RHEA 3BD7A 4IUYA 4MEBA 2BJVA 2M1ZA 1IZYA 5KYVA 1T36B 3O21A 5A4IS 3CVYA 1QV9A 2O4CA 4TYQA 3R9KA 1P2TA 1IVSA 1PGPA 3PFNA 5KNLA 1JALA 1TK2A 4XWGA 4DLLA 1T9CA 1OFVA 4HH1A 4R9UC 3ZWXA 2TMDA 4EJ0A 3QE0A 1O95C 5IPFA 2HLPA 2C7BA 3TX6A 3UUWA 1O95D 3GUUA 1NQWA 1KFEB 4LJLA 3X2FA 3AHEA 2ODTX 2VTVA 1DIBA 4MR7A 1KGDA 3RAEC 4HSGA 4GYYA 1N77A 4PBSA 1D2RA 6CHYA 3RF7A 4UEJA 3QNWA 3CE6A 3E35A 4QGSA 1SBZA 5AMXA 4KTTE 2WG0A 4I2NA 2Q7OE 4RF2A 2HW8A 3KOZA 1TJ4A 3E1SA 1DX6A 3CONA 3I34X 3OU6A 4MVYA 3B3GA 5HCIA 1OVMA 3RU9A 4CEJA 4RF5A 4BV8A 1QP0A 1WCXA 2BONA 3GCZA 4U5QA 2IW1A 2P4SA 1OXTA 2W6JA 1DQYA 2YMPA 1DXQA 1U5AA 3DL0A 1QANA 3D0KA 2V6IA 4MR7B 4N7MA 1TAHA 3A1FA 1XU7A 3F3MA 3HB0A 3L1IA 4P36A 1AOXA 2ID7A 4MQEA 2OBBA 1E2GA 2HHCA 2B69A 5H9VA 1R50A 5C5EA 3CSDA 1FVXA 2XEDA 4WDQA 1B43A 3BS4A 4CEJB 1QGZA 4F5YA 1N57A 1JIQA 1KIAA 1TO2E 3WG9A 2D1TA 1P61B 4HQNA 3JVIA 4Q1VA 5JMOA 4CU5A 1BN6A 2X22A 1FX1A 4CIAA 3VZCA 1CJTC 1FL9A 1FLVA 1W76A 2VJQA 4KQ9A 3O3OB 4OVKA 4UTXA 5H0IA 1QQAA 3MXOA 3KX2A 2J6CA 2HPZA 4F9FA 3Q1LA 4HNAB 2UZ4A 4P6VF 3ASVA 1BAPA 4LDRA 3DYIA 2JW5A 4UEOA 1ELOA 3ILXA 3GJXC 4X6YA 3ML1A 4MRSA 2WHYA 3TB6A 1U8XX 4BLVA 2R97A 3C15C 1NUHA 1BHO1 1VL5A 2EBHX 2H0QA 1ZICA 1JSZA 3U9LA 4E2WA 4LCBA 1MQSA 5EJ4A 5EQFA 1YDHA 4DDHA 3IDZA 3RWBA 3JALB 1LPOA 2H8KA 4HDQB 2E6UX 1X7WA 2PS1A 2GM9A 2C03A 4IJMA 4DDMA 2CUNA 5F64A 1LNSA 2W22A 2H4FA 3L92A 4ALIA 4RLSA 5IJXA 4BO6A 4WZBA 1IDOA 1E6EA 5JE8A 3HI6A 5AVRA 1BCSA 3EVGA 4GLLA 4IHAA 1D6JA 3HN7A 3K0CC 2E82A 3N3BC 4H4EA 1U9IA 4ZVQA 5ICEA 2IDKA 2ASEA 4RELA 4HFNA 1KQNA 4FFBA 1SU8A 1OVGA 1R9GA 3G7SA 4US2R 4IEFB 1P75A 2HXGA 2Q2NA 1X7WB 2D0PB 3HUDA 5GY7A 5LZ9A 2RD2A 1EZZA 3SZGA 4FOOA 4Q3NA 4O63O 3WGTA 4Q3CA 2HSWA 3FNRA 4NOMA 4ARUA 1VE7A 3AFNA 4K9OA 4WZBB 5DNEA 1BCSB 3V80A 3ITKA 1W4AA 3WOVA 3F0TA 1NUQA 4BFZA 2J45A 2ADOA 4RHXA 3GIWA 3TYXA 4UHBA 2G1AA 2WSBA 3UIEA 1DRUA 4RY9A 4PHCA 2FWNA 4ZV4A 1DBRA 2QU7A 1DOHA 3OZIA 4FFBB 3L04A 1DEHA 2KLBA 4KQ2A 1DL5A 4HLDA 4C89A 4CXMA 3W8FA 1V1MA 3I1FA 2O1SA 4Z86A 4D7AA 1IG3A 3DDNA 4TTQA 1XQXA 1C7IA 5A5EA 3Q8MA 4GG1A 4P9NA 4WUVA 5E2IA 1ZIPA 4BNTA 1KJQA 2DT5A 5IW8A 1Y4UA 3HO6A 3KHKA 3OEYA 3R3UA 2ZYDA 1NM5A 3NO4A 5CFRA 3TFQA 3NHFA 1FBTA 4OQQA 1Y98A 1V1MB 4EA7A 3AR9A 1BNCA 1SZCA 1TIKA 2VZ0A 3GNTA 4J1QA 1XTSA 4GW3A 3VZSA 3UMSA 2GA8A 5D8DA 1OI7A 3UK7A 3ZS9A 2RGAA 1A97A 3Q88A 3CUVA 2I7VA 1ZA2A 2JVIA 3IR7A 2WAOA 1YZQA 4J90A 3WL5A 3JZIA 3R23A 1CZKA 3OETA 5AW0A 2X1LA 4F5DA 2X0KA 1SC4A 3TW6A 1UUFA 4ICIA 1CY7A 1FLAA 1GJRA 3HRKA 2Q9BA 3B1JA 1TCCA 4EFKA 4Z7OB 2G6BA 4U2BA 1D3AA 3AFMA 1KPGA 3LYLA 4RV5A 1RM5A 1TKAA 2COUA 2X41A 1BQ4A 2NZYA 3GA5A 4EI8A 2W11A 4BQNA 1PQUA 2A2ZA 4MCIA 1XZLA 3I9V1 2PYZA 2FRXA 3G0DA 3P96A 2I1WA 3IA7A 1E9EA 4NCAA 4Q05A 3PNQA 2LCQA 4U63A 5CVDA 3MTEA 3RUEA 2Z2ZA 4ZTBA 1TJYA 4H59A 2YWJA 3BWCA 3F4LA 2Z5FA 4D74A 3CRZA 4B3TB 4AI6A 1HO3A 2QZSA 4EGFA 2CYAA 4LV5B 4AS1A 4W1RA 1XVAA 2VXBA 3JQPA 1V3TA 1T2NA 2WDZA 4TT3A 2PH3A 1ID1A 3GLIA 1NUAA 2D8MA 3TOCA 1EI9A 4F04A 4ETIA 4E5UA 5FPSA 2IHVA 2B30A 3A05A 2XUQA 5CHYA 1FTSA 1P9LA 2X5NA 3FUUA 3CPJB 3ZX5A 4Q24A 3F73A 3FYHA 2Z2IA 1O96A 2V3WA 4EI2A 3SVLA 1YRAA 4P4TA 3CVUA 1F5SA 4JYZA 2BFMA 1KARA 4XUEA 1EQ2A 3SQDA 2NXJA 2H1OA 2JI8A 4RYLA 3DV9A 4BNUA 5K7SA 5G1PA 1E2DA 4F4FA 1ZN7A 1NJ2A 1NVVR 2KPOA 3ZE2B 1XEAA 2K4MA 1VJGA 3COWA 1LPAB 4LRWA 4QFDA 4F9TA 1KGSA 3DXXA 2QLBA 1HC7A 2NTEA 3L4BA 4XFJA 1B1AA 4EA8A 5KZMB 1AV6A 1RBYA 5JJLA 3VTZA 2AB0A 3W5AA 3HCNA 3NBQA 1UIMA 4QG7A 2ZIGA 3BB4A 4RAOA 3VFDA 4R05A 3WYBA 4EY8A 2DKOA 2PJRA 4BUCA 3CH5A 2I22A 3T3HA 2GT1A 2I7DA 3CLVA 2AL7A 2ZKLA 4R7TA 4CMGA 3ODGA 3G5MA 1XDBA 3C7KA 3HKCA 4D4JA 4MAMA 3EFOB 3FFWA 1GVHA 4N65A 2B7BA 1IHDA 2YCBA 4JBGA 1UPXA 4RADA 1UOOA 3RJ9A 1GTVA 2HO4A 2QYHA 2C29D 4EBBA 3M6UA 2G5CA 4ZQBA 1XP5A 4YCSA 4ALJA 1NC3A 4F9EA 1XB2A 5E9AA 2ERYA 2AJLI 2HSJA 4N3AA 5CX1A 5TY0A 1BG6A 4MPPA 3A1NA 3HO1A 3S2UA 4DZRA 1SD5A 5LP6B 1LVUA 3EWAA 1GQ2A 1ISIA 1EP3B 4BVLA 3GRRA 3HKCB 3ZWQA 2WW8A 3VVMA 4MV0A 4QTZA 1EFUA 1VLMA 4B3CA 3BFPA 1X9HA 3FTCA 2XV1A 2W8BB 1ZCAA 4H7EA 3Q41A 2G63A 1JR4A 1M8GA 3IP8A 1COWD 4NPCA 5JQWA 3AU8A 3BRQA 4GICA 5TPZD 1T24A 1NMQA 1DKOA 2BSQA 1W1WA 1W8IA 3IKLA 3CZQA 2EDAA 1JR3D 1E3WA 3OZXA 4KUGA 2ZIEA 3HUFA 4UEKA 3V33A 4DDWA 3QY0A 1XTKA 1TEXA 3SP1A 4A36A 1KXJA 1OWMA 3O95A 4JSRA 3D6JA 1CE8B 1P7VA 1G5IA 1Y9EA 3LV8A 2ZYVX 5FADA 3AP2A 4DNOA 1GQQA 1R9MA 2Q4EA 5E8RA 3L7OA 3FBTA 2BM0A 2X5XA 4D5EA 1MVLA 2ZUBA 4M9RA 1MHPA 1WX1A 4XIYA 4IKPA 1E3WB 1YK0A 2ZBVA 3G2OA 2JCSA 5DJ5A 5TPWA 1FUKA 4G1VA 3KDPA 3S44A 2OM2A 2GN2A 3PJEA 1BWPA 2JIOA 3V4OA 4BB5A 1GGNA 3WGGA 2B35A 3VPHA 1TMKA 1CEYA 3RREA 1NJ6A 1I10A 2DE0X 3VR1A 1T9ZA 4GOND 3C3AA 1N5RA 1S7GA 2F1OA 4W5QA 3Q8KA 3W2IA 2A86A 4TN5A 1NLYA 5FO1A 4POOA 2Y05A 1PBTA 3C6XA 4XZ3A 2IGBA 3IDAA 3M3DA 3HYRA 3OUUA 3CPEA 3TW0A 4P34A 4EGQA 4L8FA 3K8ZA 5TPWB 3VJMA 2XCLA 4YAGA 4DWJA 5T41A 2JIRA 4MUXA 2VXCA 4GOKA 4U2EA 5A03A 3VU8A 3OKCA 1U3TA 1S9HA 4RDIA 4RQUA 1EE9A 5A2GA 4Q1EA 2P2LA 2QG6A 2Q6KA 2QMHA 2HHAA 3GU3A 4ZCLA 2FPXA 2JGLA 3WIEA 1JA0A 2PPVA 1R3DA 3P94A 4KE6A 4Y7CA 1DHTA 3CZCA 1UJBA 2OKCA 3ACBA 5ICSA 3L05A 3U4MA 1MRSA 2LTAA 4PS1A 2VHUA 3B1ZA 5DI3A 2LKDA 3FTDA 5C80A 1T0BA 1ISFA 3PX3A 1C8LA 1DXHA 1MBZA 1FXWA 4WVLA 5LMUB 1N6HA 2VP2A 4TROA 1EUCB 3N2IA 4I4NA 4INPA 3NZEA 4EGSA 3OCJA 3KYIB 4D98A 5HKOA 2PRJA 2QKYA 4BKQA 1VKHA 1NY5A 3DCJA 1BXZA 1D2HA 1U8UA 2GCIA 3DTVA 4JQYA 3WLFA 1Z8NA 4LXGA 2R96A 2IT1A 3KSUA 6AT1A 1LSUA 2PMKA 5DI3B 3AP1A 4PGMA 1XQ1A 3ZDBA 1V4NA 3Q11A 4IUDS 4GBED 1EFHA 2EQAA 5J59A 3QMMA 4F3RA 2R6R1 3FDIA 3S40A 1FFAA 5LYJF 2BFBB 1YDFA 1MO5A 3N6XA 5SZIA 1L5GB 3KV3O 1P8JA 1XC7A 4B8WA 3QU2A 4QO7A 4U5XA 4R8KA 2JEYA 1GCUA 1I6KA 3G1TA 4YMVA 5AM3A 1J25A 7YASA 2GCOA 3FVQA 1T2FA 2PXAA 1N2EA 3JQ9C 3O8NA 3C3MA 4BO9A 4UVHA 3WQQA 1KYWA 1N5LA 4LZAA 4E2XA 5KBYA 4N0EA 4I66A 4M0UA 4YIKA 3SS9X 3WLHA 2W2PA 2QRZA 2YV3A 2GEBA 4PZZA 1T6ZA 4C4ZA 3ZGZA 2EATA 3KQYA 1ENOA 4PCLA 2DKFA 2WUFA 4KQIA 2PN1A 3V1LA 5JZSA 2XVXA 1QRTA 4V0SA 3NNSA 3OC0A 3CA8A 4M99A 1VXOA 1H2HA 5ERXA 3F8TA 2GCOB 3NUZA 3VYUB 1T35A 4COKA 5DNYB 3WK7A 1H94A 4R1OA 2C9OA 1T8TA 4IH4A 2YOFA 2O59A 3F4BA 1KAEA 3COYA 3I04A 4L5IA 4Y6QA 3LDHA 3IOCA 1HI9A 5FOUA 2IYFA 5B7PA 2YWRA 2ZI6A 1S3FA 3EQ2A 3MJRA 1UT6A 4D3ZA 1U2ZA 1U9YA 3K4PA 1U31A 1XCPA 4DT1B 3K9HA 5DT9A 3ZCSA 2H0RA 1T9GR 1WDMA 3AF3A 5DWQA 2IXTA 5A71A 3W1VA 3J81A 1O9GA 1IE3A 2I5PO 2VRCA 2XODA 3DT6A 2YJZA 3AJ8A 3GCDA 3MUFA 3NHWA 2JJ2A 3Q7RA 3S1AA 4MI3A 3HCDA 3WLLA 1YU6A 3QJ5A 3BWVA 1PYGA 4AJ4A 1HKHA 3HZRA 2PR2A 3C74A 4C4AA 3E5NA 3DJFA 1ZKMA 3WB1A 2CMKA 4P2BA 2Q07A 1P1FA 4HDNA 1NRIA 4G25A 4GSKA 3HR7A 4QOEA 1JP7A 2O2CA 3EYWA 3R6DA 2RGBA 5EYPA 5YASA 3V1TC 1EFVA 3CZ4A 4IX1A 4NFHA 3ZX4A 4C0JA 4R83A 1JYSA 2XGSA 1P9WA 5J4VA 2I6TA 4E4RA 3S1AB 3ZWOA 1RACA 1EK2A 1JQAA 1N7HA 1ZXBA 3RO7A 4CLDA 4BLUA 3BVPA 1Q44A 3KQUA 4IXDA 5LSAA 1GFZA 3OCVA 1OH8A 2JGDA 3L7LA 2ZBDA 5I9LA 4ZT6A 4C87A 1RHQA 2QMUA 4CF6A 1FFEA 3R9XA 2QM3A 4JD5A 3KUXA 1EFAA 3C3WA 3HVHA 3CLHA 1DHRA 3L4SO 4QOJA 1EFVB 1XQ9A 2XB6A 3TS1A 1DV2A 5BR7A 3P9ZA 1DTSA 1I4DD 4HYQA 4TVKA 1GGHA 1WUYA 5FUVA 3RAJA 1X15A 2WKSA 3NRCA 4EG7A 4LHYA 1CZLA 3PA8A 4MV4A 5KQSA 1A0OA 4TMXA 1Z6ZA 3PE4A 1E18A 3QV1A 5GOTA 4E4YA 3R9XB 4BU0A 4O0LA 2FG6C 1E5TA 2HWKA 4TRMA 4B73A 4PGFA 3H42B 5G0UA 2XDYA 3QLVC 1B2LA 3CY6A 1WUJS 4TL6A 2Y1EA 3AHGA 3FNGA 1XPOA 1CETA 4CODB 5A9SB 2FP4B 4UNPA 1T1RA 4X8LA 1YCDA 2YY5A 3L0IB 5FBHA 1ZJ4A 3WNCA 2ZT8A 4RPJA 5JAPA 2Z8YA 2FPKA 1JPUA 2D59A 5JS1A 1Z3CA 3AI7A 2PL3A 1VECA 3Q98A 3X1ZA 1ULZA 2R66A 3OZDA 3FTPA 3HDJA 1CYEA 3PDIA 4QL3A 4P08A 2J32A 3GGGA 3MGKA 3TOZA 1T15A 1HRDA 3W6PA 1Z0FA 4B6FA 2ZTMA 3JY6A 4KPFC 3U4QB 4LNAA 4CMBA 3OIGA 1WMAA 3I72A 3EEQA 1ORWA 5FNZA 1HG1A 2PYIA 4PBRA 5KTSA 1W4CA 4KB5A 4R1LA 1R8JA 1XA0A 1EDOA 1Q11A 3SDBA 1CRWG 3DT9A 2GVNA 3FUTA 3ZHUA 1J2UA 3M3PA 3VVLA 4D97A 2GJ9A 3D1LA 1FQWA 1JQ3A 3FYUC 2VJDA 4DLVA 1W59A 3CCCA 2JC3A 1DAFA 4PG7A 3P9IA 3PDIB 3PG5A 3C3KA 3S4YA 3HK2A 3ESBA 1WLYA 2JHPA 3VR6D 4FGLA 4AIRA 1HQKA 3FR7A 5K09A 1IXZA 3NT4A 2IY8A 5FJIA 1AUPA 2OC9A 3E4CA 3A11A 3EF0A 1FFXA 3MCUA 4DQVA 2CHFA 5JS2A 1NXVA 4QQ8A 5M2QA 4XX0B 4LN1A 3SMVA 2Z8ZA 1HDZA 3ZNPA 3LIIA 1G6OA 3JWPA 4UM7A 4B4DA 2P91A 1MP0A 1SHKA 1ETHA 1NJFA 3Q9LA 4LE0A 1LK0A 2BFDB 2NG1A 4I1PA 4R2IA 1QP7A 4L0CA 3S1SA 1CUZA 2IYNA 4IQGA 3BA1A 1QO0A 4BO1A 1L5RA 2VSQA 1D2GA 3HYTA 2WBLC 3RC9A 1ZD2P 3IV9A 2XRZA 3JAMA 4P35A 2WU3A 1KO5A 1QBKC 4I1VA 3PC8C 5B12A 1BX1A 2C2XA 5F78A 2XD9A 5K0FA 1Q22A 1PG2A 2GYWA 1LZLA 1C7ZA 1U90A 2HM7A 1G21A 2X6TA 4UQOA 2R84A 4X84A 5GOZA 3TQIA 4L85A 3FHCB 2FKNA 4RFSA 1KAOA 4YJ3F 2O7SA 4ECEA 2PKYX 4XM1A 3GFOA 1P1HA 1CIPA 1W93A 4C05A 4JP5A 1O57A 1OXVA 3P0HA 2JGAA 4K9PA 2YV2A 1AKVA 2NUPB 4QGHA 2OESA 3QWHA 2IOFK 5KTMA 2JLZA 4K6FA 2I2BA 3VPDA 4HWGA 4UUAA 2GN1A 4MUGA 1RP1A 3KS9A 4K28A 2UUCB 4KLZA 4RW0A 1R4NA 4YMTA 2C5LA 1K6MA 3DWGA 4FYXA 4GI3A 1G21B 1XV5A 3NHLA 4RFSB 3TQSA 2P6RA 1OIXA 1ACMA 3PVZA 3CLTC 5CAEA 1RWBA 5CYGA 1FP4A 1NFRA 1ECPA 1Q91A 1Z62A 2P3LA 3CLTD 4MVJA 2FEXA 4M1MA 4XIIA 4BFCA 4ZYUA 4Z99A 4YFYA 3FCEA 1X94A 4H31A 1XMIA 4W8OA 4YP9A 1TZMA 4HAYA 2WLSA 3PA6A 4R0VA 2C4HA 3HA7A 1GADO 2B4AA 4JLAA 4Q1DA 4RZ3A 2VDKB 1YRLA 2FXIA 3B52X 1PNVA 1CK4A 1IFXA 4KCGA 4V03A 1V35A 1I7NA 4RPLA 3A26A 2XAUA 4IV5A 3SEQA 5AVQA 1TKBA 5AK6A 1PG0A 1MO2A 3EK2A 2VH5R 1Z8HA 3LCVB 5CAEB 1B00A 4ZDJA 1FP4B 3IXQA 2XCSB 1J1UA 3FRIA 2QTFA 5TEWA 4W7IA 2VT3A 3H3JA 4QQNA 2DY0A 5H83A 1J2JA 1LUAA 3ACCA 2OFPA 4C88A 1YJAA 3FHOA 1AKTA 4JR0A 4YP5A 3PNYA 4E6EA 1EPUA 1CUIA 3IP3A 5B6PA 3AVOA 1E7QA 1P2UA 2XMDA 5CFOA 2KQUA 1P33A 4K5QA 1Z22A 4Q1CA 1KR2A 1Z45A 1GARA 3PK0A 4HQFA 4E08A 4EJSC 2GFIA 4C4PA 2BYTA 2V96A 2RKBA 1NULA 4KAXA 3NXSA 1JMVA 2CLOB 3MCZA 3ZWVA 2WWWA 3WV4A 5AXDA 4JVSB 1RLIA 2XCQA 5CFLA 2I80A 3ZJ4A 1G16A 4BZQA 2VNAA 2O5VA 1ABEA 2BIFA 1OW3B 3IESA 4RLQA 3U44A 2QAGB 4MP6A 5AKIA 2X9QA 4BYGA 4B3GA 4TS1A 1VRWA 1U3DA 2GDJA 4B6PA 5IYZA 1WP4A 4QM6A 5DP2A 5CFNA 5BYBA 3EF1A 1D0IA 3QX3A 2YMQA 1Z8DA 4RVUA 2LUOA 2PPLA 1ZS9A 3H2IA 3S2ZA 5ITSA 2CNDA 3LLUA 1DC3A 1NU6A 4P83A 4JB3A 5EFZA 4E32A 4YDRA 1L7OA 2Q6LA 4O2BF 1A8IA 3HDYA 3U44B 1T26A 2ABWA 1XJQA 1IH8A 3E5MA 3ZK8A 1N78A 1P7ZA 3KP1A 1VHLA 4Y9DA 3HXKA 4H7DA 5IYZB 3SWWA 3QEKA 4MW0A 2JJQA 3S7TA 3KM0A 3P5SA 4R1MA 1F9EA 2PJUA 5HMLA 4Y6RA 2SHKA 2ONCA 3VH4A 1W75A 3W3AH 4ER0A 3IAS6 4R0NA 5AKZA 4PF1A 4YACA 5ECYA 3TXYA 4AXXA 2ODPA 3S0JA 4CT4B 1WKCA 2GBLC 3STTA 4CM9A 5LZ5A 3NH6A 1NXPA 4E31A 1HEUA 1RXEA 2I4RA 3FPJA 5EY5B 2F3QA 3DP7A 2DLNA 2GRUA 5EKUA 4BO2A 3P5BA 4MUHA 4O4LA 1ITZA 4Z9YA 4OL0A 4B7UA 5AK3A 3NKFA 2P2ZA 4CIXA 4D79A 1ISGA 2BELA 4OFBA 3LH5A 3ORQA 1A9PA 4R2JA 3RSSA 1TAQA 2C9CA 3L8EA 2OG1A 2PBLA 3AG5A 1DBIA 2VUSA 3PJFA 1DKMA 7MDHA 2C4MA 2GA9A 4L5YA 4N01A 1RQ7A 2OZKA 1VHDA 5IMSA 2O2XA 5JZVA 3G0BA 5JBQA 4LBYA 4O4LB 4KMMA 1VG1A 4BJ6A 3BA6A 1SCQA 1DQRA 1ZD3A 2YINC 3LPNA 2RI1A 2H4ZA 1G7CA 3B9QA 4LSMA 4QDOA 4D6YA 3KT8A 5CBPA 2AYZA 2ID4A 3B82A 5T8KA 4PAMA 1E8DA 5DNCA 3M1AA 4PQRA 2XB4A 2HWWA 2OCGA 3E5HA 1GGEA 1BMFA 3PJGA 5FLYA 4ZGGA 3EBLA 3NMUF 3OT1A 4XCQA 1K06A 2OUIA 1VL0A 3CBQA 3KIPA 2QTVB 4BRWA 1TF2A 1YZUA 2AEJA 3TQQA 5F4ZA 1XRLA 1KYTA 2A9QA 2JVKA 4KEAA 4B46A 1WVMA 1YKFA 3NAZA 2G1JA 3LI2A 2IDMA 1AA6A 3R09A 4IUCS 4JBNA 4RPHA 1DXOA 4BYMA 4KBGA 2VDWB 2F62A 5HFAA 4F4CA 2BMJA 3UATA 4YAEA 4J29A 1NW3A 2XUOA 4F0JA 4QG3A 1TTTA 1L4EA 4MIOA 4WK6A 1I0LA 2ECOA 3OT1B 3AI2A 4D4KA 3M33A 5H59A 3IQGX 2MOKA 3LXMA 2FJ0A 1KH3A 2IYRA 4LQLA 4BKPA 2D7CA 3E2PA 2YNMA 4QJ4A 1A5ZA 2PFGA 4NL4H 5JSKA 1AO3A 1RLJA 3WHIA 1VMDA 2LBPA 2XNHA 4XI9A 1FUEA 4B7CA 3FKSD 4B40A 1ZQ1A 2W43A 4Y3UA 3ZJYA 3ZKWB 5GQSA 5KSYA 3N7AA 4RY2A 3T4PA 1QZ3A 2GSDA 2QM8A 5DDIP 5EZYA 4CV1A 2RK3A 2WJZB 1RRPA 4TMYA 3PHBE 3AH8A 1O4WA 4B0OA 1JFFB 3EQ9A 1O6GA 2P2CA 1Y9AA 3T5DA 4B7XA 4A23A 1HETA 4MEJA 3KVYA 3A6PC 2IHBA 3A9CA 4GH5A 3OEWA 3SR0A 1WWKA 1UQUA 2R86A 1J39A 1H9AA 2EFCB 3B89A 2CVPA 3FF1A 1TB4A 1KFCB 2Q4OA 1YL6A 4U2CA 4RD6A 3OM1A 2C7GA 3HYCA 3T15A 2FEMA 3LSTA 4D3XA 4EG6A 5EZYB 4RMIA 2HK8A 1O0SA 3RSZA 1YB5A 5B3JC 1K88A 1PWEA 4H4DA 1Y5LA 7AT1A 1SQ0A 1ZH0A 3D7KA 4IEEA 2ZB8A 3UA4A 3RS4A 3QNUA 1T4DA 2QJRA 3CNHA 3C8MA 5HOQA 2ZJAA 1EGVB 2V7UA 3DPSA 1PL0A 4W6ZA 3V4LA 3Q4GA 3J7TA 1SPXA 2HFKA 2J3QA 3NH9A 5IZCC 1E5QA 1R0RE 3IUEA 4KXYA 3SHFA 1FW8A 5E1DA 3B53X 3M5WA 3NHUA 4NCIA 3PNVA 4UU8A 1PKXA 3OTHA 2ACEA 2ZR0A 3EZ6A 1W52X 1ZMBA 3PKIA 5IDYA 4C4RA 5C31A 4L5BA 4FCWA 4FYKA 5K8JB 5EJGA 2JIZD 5DASA 2XJ9A 3H1TA 4Z7QB 3KQLA 1D5WA 3KJFA 5F51A 3ROGA 4BMSA 2FN8A 1BD3A 3BMCB 5CVJA 3IEKA 3Q12A 1IZZA 2BFWA 3SC2A 5IF3A 1WDWB 3FFAA 4II2A 4A6XA 2BGMA 2QSYA 3FOFC 4B3DA 1WMSA 2BM8A 3Q3VA 1ML4A 2GVDC 3C6MA 1AK2A 3NGLA 3OOJA 3IUBA 3OI7A 4LRTB 1BZYA 1QHIA 2JFXA 5DP1A 1C9YA 1MRZA 1FUUA 4JQOA 1XFAA 4V0NA 5DK6A 3MJTA 3UC5A 3O03A 2R85A 1PSWA 2OCAA 5TMBA 5BNIA 4P86A 1F6WA 1CZNA 1P45A 2XCOA 4RK1A 6ADHA 1JJ7A 5BXYA 1QH0A 3DAPA 1B0ZA 5DIZA 4G5YA 1GEEA 2ZS7A 2WM3A 1EX7A 2WYVA 3ETHA 2TMYA 4GU5A 3SC2B 1OI2A 4OHVA 4UVGA 4HMOA 1ZFNA 4GC9A 2BGLA 2G9NA 3L8GA 4W5JA 3QM1A 3HVKA 4XIFA 3ZD7A 1PE0A 3DEAA 3PEFA 2VTBA 1F3OA 1QYCA 1TA0A 3R7WA 4EEKA 5JWRA 1VCMA 1CHDA 3EMBA 3FD8A 1UAYA 3KV1A 3E15A 3TMKA 2A0UA 2RK6A 5ER6A 2Q21A 5F21A 5HX7A 1ISSA 4WNYA 4HS4A 5K05A 1NHWA 1SN7A 3ESYA 1CNEA 1IK6A 2FW0A 3EMDA 4FK8A 1OBHA 4MAFA 3DHVA 1SC9A 2C1EA 4BS9A 4E13A 1DWQA 3EX7C 2Q5IA 3PVSA 5HZHA 1ZPDA 2A5GA 2CNBA 4MWBA 1VXRA 3F6PA 2ZZNA 1JKFA 4B32A 1P72A 3RNLA 5LMCA 2AV6A 2VTBB 3I76A 4TKVA 1CJUC 2JBHA 2AK2A 5JAQA 3R7WB 1QOZA 2JIMA 2C07A 1JDUA 1UWCA 2A9KA 4W1PA 3C7CB 3UHOA 5IBRA 3ANXA 5DU2A 1Q0QA 3EIQA 1U4OA 1LLQA 2QW1A 1SQ5A 4N0DA 3DULA 4GPZA 1C0PA 1NUUA 4HAOA 2AVNA 2PIDA 4BLQA 3K5WA 5LOVA 4KYUA 5J4LA 1XBTA 1ADJA 3MT0A 2ZZKA 4LKOA 1IWBB 4RVHA 5ALXA 3PC2A 2FWIA 2JFZA 3H11A 3AM1A 1LDNA 3HP1A 4ZAVA 3PSAA 3GV0A 2XGJA 3QPCA 4MYRA 4TKVB 2C8JA 2J0UB 1O5IA 2OHXA 1ADBA 2O2DA 3WK8A 3O74A 3GJYA 5D51S 4HHEA 4DLNA 4DVJA 4MNTA 1O94C 4RWEA 2ZCVA 1FJ2A 1MVNA 1VGVA 4LMPA 4ENSA 2WILA 1O94D 2C2WA 5HXAA 3U31A 1NV8A 4OP2A 5BWMA 2O06A 3NYRA 5KOJA 5T4FA 4MKFA 5LOVB 3WLPA 5B2EA 3SFVA 3IIEA 5C34B 1KA9H 2ZUDA 2PZFA 2F4VB 1ONNA 1UKVY 3H11B 4QDJA 1N7JA 1KI1A 2J3EA 2RHDA 1YZLA 1YI0A 2XGOA 3N0VA 4PYOA 2HQRA 3EGEA 4AECA 4TM7A 2BRUA 1MTZA 5CR9A 1U1CA 5EXXA 1Z25A 5KNBD 2Z9DA 4I50B 4E5KA 4HXEB 2VBCA 2J7PA 5FV4A 2ZIAA 4YMGA 3KETA 1MG5A 3EOAI 2ZBGA 3FVRA 1E9SA 1LI7A 1Y8QB 3WIDA 1X0XA 1PR5A 3KT6A 5JFTA 1USWA 2ZBUA 1T4BA 3AY7A 4ZT7A 2WJAA 1NUTA 3AG6A 3IGFA 1PT9A 2C2YA 3O4VA 3GIDA 3WLJA 2H51A 5IC5A 5DM60 1XNHA 2OBNA 4GC5A 2PX4A 2ZREA 1VLVA 2C5GA 3CXUA 4LC0A 4RVFA 3ZW9A 1ZH6A 2AFIA 3ZV6A 3TL3A 1GRRA 3EDCA 4ZT5A 2B9EA 4IQFA 5CFQA 4RMGA 4EW3A 1X7ZA 2BBWA 2OHIA 3EAGA 1YR7A 3DLAA 3PKJA 2HT1A 1XKLA 3ZDXB 1EESA 2EBFX 4XRRA 1R0LA 2WJ6A 1PG5A 1BFKA 1U9JA 5MF6A 1P1KA 1XEWY 3TIVA 5I47A 3NORA 5EE1A 1E0AA 2AX3A 4Q6BA 4NZYA 3G0IA 2ZU0C 1W88A 1YI8A 2D3WA 1ZUWA 5AOCA 2AFIB 2FQYA 1ZH8A 1KP9A 2IYOA 4CM7A 1K6JA 1E2PA 3E61A 1PJ4A 3K1TA 3DDOA 2AW5A 2EKLA 3FAZA 1KTIA 4DV3B 4BGIA 5CDSA 1X7ZB 3MYRA 5AESA 3LL4A 3DDCA 4ZI2A 1EDEA 3HCRA 1PV2A 2Y93A 1K4YA 3NOQA 4B8YA 3L02A 1MDFA 3D59A 3OMLA 4DYVA 1IOLA 2OBLA 4JLKA 4P92A 1QF6A 1CIJA 1QFMA 3OZUA 5C0OE 4NATA 1DAOA 5DI9A 3WNQA 2HIGA 1LEHA 3CUWA 3N07A 4BNNA 3FA2A 1AZWA 2YJTD 1AUQA 1Q0SA 1W88B 2J4CA 2Q5EA 4EKDA 4RIIA 3CVWA 4IIJA 3MCTA 4OA5A 3F98A 2CXXA 3R0VA 3WLKX 1UC8A 3IB3A 2UKDA 4IRXA 4ZPXA 1BJKA 4HC4A 2I91A 5KO2A 3O93A 3M0EA 3BE4A 3H9QA 1WQ3A 1I33A 3FR8A 5IEBA 4D9HA 1C3VA 1JG1A 3OUZA 3LBNA 3RD5A 3WP0A 4D3FA 4E88A 3H6GA 1Z5PA 5JJCA 5K0CA 4AJJA 3GQVA 5GM1A 1VJDA 1EUZA 1E2LA 2B34A 2Q4DA 3TMYA 3Q10A 2V59A 4N5IX 3IAHA 4XX1A 4PW0A 5CVEA 1E3TA 3WK4A 1WVIA 2C77A 3SAJA 1GL7A 1JAIA 4IIJB 4NU5A 1FF9A 1VRVA 2GEKA 2WFZA 4PFKA 2XYVA 4CCWA 4D9CA 4DAEA 1AG9A 1N2GA 3HGMA 4WINA 2WB2A 1Y37A 2V7TA 4UPVA 2ZKIA 3R3XA 1T9GS 4AN4A 3NATA 4KFTA 1TFRA 4FZRA 3O83A 1NP7A 2E2WA 1R6DA 3DNPA 2XUZA 3EG5A 4AYXA 3G0CA 3PWSA 2I99A 2OCBA 1S6YA 3A36A 5CGZA 2CY0A 5IABA 1EDZA 2XDQA 4NJOA 2VXYA 3IPCA 3O92A 4BKUA 4KWHA 2V0NA 4QOHA 5D7NA 1ZD8A 2CLKB 2IX3A 1G19A 3CEAA 4ZHQA 5KTKA 3QWAA 2FG5A 2G06A 4MICA 4Z51A 2Y8EA 1SC3A 1ZCZA 2PH7A 1E9VA 4F8EA 4V0KA 3OLVA 4KIFA 3A4YA 2JI9A 1G18A 1L4MA 1M2JA 1NMZA 3ZH9B 2I2DA 1Z2DA 5DHUA 5KMGA 3EPHA 1SWVA 3P9PA 2ZBEA 4N7RA 4TLDA 4WCVA 2JKZA 1FOEB 2XDQB 2WF5A 1IEQA 1RAHA 2IJGX 3ZJTA 1DT5A 2HLNA 4C6TB 1SBCA 5CTAA 4W5NA 3OO0A 2PR7A 3GLSA 3IAFA 5BQFA 1SOMA 1CERA 2Z57A 2W2LA 3KQVA 4UUBA 3AU9A 2JCXA 5AW3A 2A0XA 4HDKA 1L5SA 1UQTA 1OV4A 1OWLA 1NU8A 1PT7A 3PE3A 4GDMA 2J6HA 3UMMA 4GE3A 4BLRA 2MYPA 3AONB 5KMGB 2GQ0A 4A92A 1NUPA 1QXSA 4RTOA 5MHTA 4BQOA 1PTJA 2BFPA 2OK8A 2F6RA 3BH6A 3NQ41 3V7FA 4D0GA 4DARA 1E1YA 4Z2AA 3G2HA 4HATA 5IN4A 1IZ7A 4B47A 1KDPA 4E70A 5JWOA 4GQIA 3NVDA 4XVQA 4OF4A 4LTDA 4DV5B 3FBGA 3DCNA 4CL0A 1TEZA 1II8A 3D5QA 1IN1A 2C82A 1ZDMA 4A8HA 4HDKB 4EQ6B 1I8TA 1QKKA 2OGSA 4I5GA 4M9XA 1KDYA 3BE6A 4ZN6A 4KQEA 1J21A 2GPAA 1QV7A 5GINE 4H7KA 2H07A 2PA3A 1PD1A 3UANA 4CLOA 3G17A 5A5FA 4K9MA 3RHTA 3LC2O 1EEXB 3T99A 3VH1A 1KL7A 3DHNA 4OBEA 3INRA 2G9ZA 3CX4A 1II8B 1PJCA 3DNFA 3QK7A 2JFBA 3DHEA 5HJ7A 2XNCA 3LX5A 3II6X 1MOSA 3WBJA 3A9RA 4BPRA 1T5BA 2HUNA 3BMQA 4G4JA 4YRFA 2HMSA 5AM5A 5AW7A 1KORA 4ESEA 4WASA 4JI0B 3AM4A 5HFNA 1GPAA 4UE6A 4CLOB 4C2UA 2ZSAA 4KWIA 3H86A 1R5OA 3BHMA 2I7TA 2Z6VA 4Y6GB 4DABA 1PEDA 3QXGA 3WYCA 1M2HA 4GPEA 2JJ1D 1WZNA 2VPZA 4CLRA 1VIMA 1I4LD 4M6WA 4QEKA 3ZZ1A 2AI3A 2GXUA 2Q9AA 2I33A 2J08A 4PLZA 4U3JA 4HSEA 1EJ6A 3LE8A 1JQJC 3P4XA 1F60A 2P4HX 3BMQB 4PG6A 5EI5A 1Z2AA 4RKEA 5H68A 1UCFA 1GSHA 3ZC3A 4ZODA 4I3HA 3I3OA 4IXTA 2VP3A 3QBEA 1SUCA 3EZGA 3G13A 1ULAA 3W5VA 4IH9A 1PVDA 2WJVA 1YS2X 3B8HA 4CLRB 3NM6B 3N8KA 3UFXA 4M6WB 2PLRA 5C8YA 1QDEA 3ZLJA 1TGVA 3MFYA 1YMQA 3I0MA 1AV7A 2WSIA 5LZ7A 2YQ5A 4AKHA 5KX5A 2BCJQ 4QTTB 2P3OA 1UZMA 2N0SA 2R8BA 3QBDA 4DV1B 3G82C 3MHPA 5ABPA 1XD9A 5CLQA 3NTOA 2ZRMA 1H3EA 3SZLA 4MRPA 2BMFA 3C97A 4QPCA 5TB5A 3W4JA 3DXFA 3WWZA 2UZ3A 5HBGA 4RE5A 2OHOA 4RLHA 3UFXB 1EBFA 1QQ6A 1Z2NX 2G8LA 4FYMA 4P4LA 3SLKA 4DJEC 3D5TA 5SY4A 4REQA 5F52A 5C8YB 3PPIA 4EF4A 1CB0A 2AG6A 4UEQA 4Q3LA 1EZ1A 4EUKA 3E9MA 2Q3MA 4F85A 5KX5B 2VHTA 3OLCX 4I55A 4JJGA 1W2GA 4O4JA 4QGBA 3DF7A 4IXWA 4FHCA 5ICGA 3OCZA 4LFBB 3NETA 2N9UA 2PL5A 3OJCA 1FTYA 2PGXA 2PRSA 2W90A 4NCHA 2FUEA 1ORDA 3ZGVA 1IM5A 3GZ4A 3OIVA 3A2NA 4GZ6A 5K0BA 4O5OA 3KZCA 2PQMA 3JWEA 5BR1A 4DADA 4F86A 4D26A 5MFPA 2R8PA 3BQMB 3ITEA 1BXKA 1AHPA 4REQB 5K3FA 4M8KA 3WICA 1AKMA 2ZM6B 3DOCA 3R3SA 4I55B 4O4JB 5IXJA 3V4VB 3RVJA 5C53B 1GU7A 1P73A 1U94A 2OV4A 4KITB 4PG8A 1ZGCA 3GT7A 3HS3A 3UN1A 3OZTA 1DIGA 3Q5EA 5D84A 5ED0A 3T9BA 4ZZ0A 3S6JA 2IEGA 4Q03A 4OHRA 4JDUA 3S2GA 2GMWA 1XLVA 3EA4A 4CTNA 5K3FB 1J23A 4BKMA 2FEWB 1EBBA 1NC1A 1MTOA 2E4YA 3DR3A 1XMSA 2IOQA 4GHWA 4S3MA 2IOYA 4RZQA 4C0HA 4YUYA 5F2NA 2Q5LA 5PGMA 1OXUA 2EJBA 3GQBA 4P3OA 2C5AA 3PYLA 2XA1A 3N0TA 5GZ3A 5JR3A 1MO3A 1Z5NA 3UV6A 2QP4A 1V7ZA 1R0WA 2C58A 5GWXA 1E7RA 3OE5A 1CVRA 3C0KA 3BHNA 3O94A 2Q7DA 1FYWA 4PWYA 5C2JB 3I62A 1ZNZA 2FMFA 2GTPA 3SS7X 5IG2A 1L4GA 3DWEX 4OKNA 4MARA 1EDBA 3STVA 5A62A 2NO7A 3MB8A 3U7EB 2OP0A 4I9UA 3GQBB 4D9GA 4XVCA 1NIJA 4KH0A 1EZ4A 2R7MA 4J3JA 5L9AA 3WX0A 3AUJB 1WMFA 4URZR 1PFYA 3EH2A 5CP8A 1KIFA 4UBMA 5ADVA 4UXJA 2IIBA 3VOSA 4OYHA 4ATNA 1OLXB 1QOQB 1EX6A 1HQDA 1F6DA 4RLFA 1FFDA 4K9RA 1U65A 2D7DA 3GLHE 3NTXA 4L8GA 3PCXA 4WJKB 2ZVJA 4FZ3A 1DX9A 4DLSA 3N28A 3EWSA 3ZWYA 4EGAA 2NWQA 1E60A 4XR4A 3U4AA 4FDMA 3NYWA 3UXYA 4R51A 5FBVB 5CITA 3DZJA 1MPXA 4OK5A 1JLKA 1QF9A 3C16C 4O2AA 3ZI0A 1Q92A 3IT0A 3G2JA 4Y2HA 4BV2A 2PGAA 4LSWA 5C4IA 3ZIAD 1YR6A 4JUIA 4N5DA 2J4FA 2OFXA 4Q1FA 4Q19A 5E9JA 2Y1CA 4DA7A 5L8VA 3AUSA 3WL6A 4MA5A 2OO5C 4MVJH 2DAPA 1JAHA 4BCCA 4BVEA 4Q21A 3SF0A 2I6XA 4JBYA 2DTXA 3FPBA 4G5XA 1BXGB 2FZ5A 4EKEA 1VJ0A 1SG9A 4GNRA 1G5HA 1FZQA 1SG6A 3P9KA 3SNHA 3HKDA 5B4VA 3IAM6 3MQ4A 2PZEA 4MQBA 4NZNA 5JD5A 4YMWA 1NBAA 1WF6A 4DR3B 2J3HA 2C4VA 3CFYA 5AVSA 2Q49A 3V4RA 3UM9A 1LDYA 4EBFA 2RONA 1GU0A 3ES9A 3GP8A 2VKTA 1SOWA 4M8NE 1RM4A 4FN5A 3TIIA 4CMIA 3O26A 1P4GA 2XYQA 5H9WA 2XB2A 2NPIA 3B2QA 1YR1A 4GVPA 1Z5UA 4O4IB 3HXQA 4DCUA 4JJIA 2X8BA 4Y2JA 5E1MA 2WF6A 4DJAA 2G40A 1FUYB 1Q2UA 1Z88A 3HKDB 4NG5A 4CFYA 1I6WA 3FPAA 4D4LA 1FSFA 1E6KA 5KYYA 2JGIA 4JOQA 1YL7A 4ED9A 4HEA6 4YP1A 4JUFA 3FHTA 1MAHA 4YV7A 1M5TA 2EHJA 3O8OA 4TKLA 4TMVA 1FDUA 3MRVA 4KUHA 4B2YA 2JDIA 2I2XB 2OO7A 2Y68A 1EWRA 5DWVA 3V1NA 2FPMA 2BGIA 1E99A 2JD1A 1UJ2A 3GPDG 1OV6A 4NBWA 3VJLA 4CMIB 2IHTA 5EJ9A 5HIKA 3VGPA 4H16A 3E22A 1ZZGA 2EV9A 2E5WA 1NVXQ 4O25A 5K6AC 2L42A 5IM4A 3F7MA 2JG3A 1NR7A 4QPPA 4I1SA 3FOCA 3EC2A 2IPAB 4TYYA 4RSRA 2P90A 4MYDA 2BPOA 2A4MA 2X3YA 4F38A 5KYYB 3GLFB 1ZXXA 1SA0B 2OBFA 4QD3A 5HF6A 1D6MA 1RMYA 5ELLA 3VYRB 2UYYA 1X70A 1JPJA 1YJXA 2XUGA 3R77A 4DEVA 3O8OB 3AM3A 3KELA 1C4WA 2JFYA 3NHKA 4QDKA 3JZAA 5HGJA 1KSGA 3EQ7A 2ZYHA 4EARA 1Z5VA 3P27A 2PMEA 3EIEA 3KOYA 3W5JA 1VB3A 1NOIA 1M7BA 2EAUA 2WAYA 1F51E 2YXLA 3E22B 3FGPA 3OJLA 3PIDA 4PFSA 4RZHA 5IT9A 3RT1A 5FYQA 1R3UA 4HXFB 1T3TA 2PLFA 3RS3A 4DRZA 2QSJA 4JIGA 1QCCA 1WZIA 1LV8A 2DT8A 2Q4RA 1MOPA 1Z5GA 3EXAA 1VI6A 5E4YA 3B12A 3LSYA 1SVLA 4F06A 4DAOA 5CB4A 5TIIA 3ETNA 4J3NA 1TRKA 1PFUA 4YHBA 1PZGA 1ZI8A 2JIPA 4QXMA 4RS3A 2NSDA 3ICWA 4XUDA 3O38A 4US0R 3X44A 1NASA 2HA2A 3FPLA 4ZAWA 1XDDA 2BEUA 1RC8A 3PNSA 1JEQA 5C5DA 1GRNA 1U7WA 3MINA 4HWPA 1QYVA 4L76A 4DQDA 2I78A 1Q50A 1IATA 5CPFA 4EK9A 4PVCA 3V8RA 4QGFA 2JI7A 5AHWA 2D74A 3EXG2 3MWYW 1Q3TA 2G5PA 5CB4B 4TZ0A 2XQJA 2DCMA 1SJ9A 1TA4A 1ORRA 4UMVA 3ABZA 1CW2B 3E48A 3SSMA 4CMHA 1ND5A 4E3WA 2YC2C 3H3FA 4X3CA 5DBFA 3B1FA 5SY9A 3HUUA 4WGGA 2WI8A 3ZWWA 3B5IA 4KXUA 2BEUB 3AL0C 2CUZA 2Z4SA 2WZDA 1ACJA 2ADFA 2C4NA 2PKQP 1MFPA 4YALA 4TLCA 2HU5A 2K2QB 4FVTA 3ZZNA 1UK8A 3HDQA 3L77A 4JLWA 1M6YA 1CS4C 1ODSA 1QX3A 4RK0A 5F3WB 5JZBA 5CYOA 4G65A 4II7A 3ZBTA 4LYGA 3GEGA 4JXXA 4FBLA 1YTUA 1IBSA 1KI9A 4REMA 3Q0EA 1QX4A 2D1YA 1ZEMA 4G5GA 5CW2A 2GZMA 3HCPA 1P8AA 3QFTA 5DPMA 2P2DA 2NU8A 4AZ3A 2O8VA 4Z4IA 2CXNA 1O97C 4A8JC 4KNYA 1O97D 4QO8A 4NHOA 4ZVKA 4BRSA 3QVKA 3U19A 5IUNC 2R1TB 1GNQA 2BBOA 4X63A 5ECGC 1AKEA 4JOSA 3NKLA 2NQ8A 4KOAA 1YQWA 2Q3HA 2BHLA 2AKYA 3R5SA 4PC3A 4PQGA 4DXHA 4IG4A 4N12A 4N6OA 1C8VB 1VG8A 3D8NA 4JUAA 4EA9A 5HUJA 1O8BA 3F8WA 1I7PA 4LDJA 3AKZA 1KHTA 4GFDA 2EW8A 1VJCA 1FRFS 3A6DA 2Z98A 4RHTA 4KPYA 4GM1A 2NU8B 2R2GA 5ES4B 5K99A 1S8OA 2GD2A 1G3MA 1TM4E 2QTBA 4XRGA 4Z53A 1ZR2A 2P6UA 4B35A 2WEKA 4P8RA 2WA2A 3M4XA 1GCIA 1AJEA 1H6DA 2XVMA 5TEVA 4B9AA 1PJAA 2FWBA 2W6IA 4M0KA 3KZ1E 4JB8A 4F4JA 1N9ZA 1DBPA 3KJZA 3JSAA 3WDLA 1CNMA 1A8HA 3OQNA 4JJKA 2O3RA 3LDUA 3J7AC 4HO1X 4RJTA 2D2EA 5LD2B 2JHCA 5K0SA 2W98A 1DEAA 1Z47A 2Q0QA 5T4EA 4K86A 4C0BA 4C2BA 2H8GA 5A02A 1Y6FA 4MGEA 1MD9A 4WK0B 4PLYA 1QCZA 3LQFA 1YZNA 2R6GA 3PQ8A 2MIIA 3BXFA 2BFNA 4BAGA 5ENVA 1UJNA 1BU5A 3A6EA 4YDQA 4I19A 2COEA 3OIFA 1DC4A 1UBEA 2O3TA 2PX2A 1MB3A 2C9BA 2HFJA 4UTPA 3U3RA 1E7SA 1W48A 2FCAA 4CVNA 5IT0A 3ZBQA 2G25A 4ND5A 1POWA 4MDYA 1SCJA 2EARA 1MA0A 1WZEA 2BKAA 3AV0B 4H3HB 1U7HA 4NZMA 1IHYA 2EZ9A 2BF7A 1XRMA 3GEBA 4DDVA 2HLDD 2IZ5A 4BO5A 5D6NA 1JJAA 1GV0A 1S8FA 2PFKA 4QXQA 5SYMA 5EFOA 4L02A 3L1VA 4Q6WA 4DTCA 4MKRA 3T7SA 2YXEA 4F3KA 1LPNA 5B7QA 1CEXA 1FFSA 1P2BA 1F4PA 1RP7A 2EU8A 1Y4ZA 2E0IA 2QMOA 4G0OA 1NF3A 4HKTA 1GZ5A 3CLKA 5CLIA 4B7ZA 2P2SA 3D7RA 1ZAKA 1X39A 2KE5A 2ZEJA 7ADHA 5F7XA 2UYCA 1XEWX 1Q7TA 1UJ6A 3KB1A 1EE1A 1GAEO 1UC5B 5EMHA 2ESRA 5A4MS 2ZSDA 3ABIA 1V16A 4WOBA 2B4RO 4QSMA 1AKNA 4NCJA 5CYFA 4JVOA 3FFXA 4AMUA 5K51A 1BDJA 3GBVA 3K96A 2VZLA 3LUAA 4WT7A 1AKWA 4JU8A 4GIBA 3TOSA 1E3JA 4B83A 1HTTA 3PFKA 1Q17A 2OAP1 4FGWA 4U00A 3NANA 2CLEB 3TLEA 1BD4A 2ORED 4JS0A 3IEMA 5B1YA 2A0YA 4RTNA 2CGEA 2GKOA 5D00A 5LL6P 1O9BA 2O2SA 4YWHA 3ZHBA 5JYDA 4KZKA 5LB4A 1C0IA 3KB6A 3QSGA 2CD7A 1DWPA 2YH2A 4LDPA 4MV8A 4TKZA 1JH8A 3LDAA 1NLMA 2VBFA 3FF4A 5DMXA 3N2YA 3O31A 4B85A 2BZ0A 3HP7A 1H1DA 4G5HA 1AN0A 3SFZA 4LPSA 2AE2A 4ZDKA 1OGYA 4JASB 1Z4MA 3T8YA 3HMQA 2OXIA 1TAGA 2GHRA 1XU4A 4B76A 1J00A 2ANBA 2XECA 2FZGA 3INGA 1P9NA 5IBQA 1FA9A 2QX7A 3IUNA 5HKKA 2PRZA 4ARIA 1QAMA 5BMVB 1N5OX 2PKQO 1PWZA 3HLTA 1B76A 1Z15A 1VYVA 1Y6ZA 3PFCA 3KOOA 4JVLA 4LC1A 4LTNA 3A2MA 3R75A 4F60A 3QWFA 3A1CA 3DKVA 2FOLA 3W5UA 3KTAA 2QW0X 5KTYA 2DKNA 2FMUA 1Z39A 4BVKA 2FW9A 2H3EA 3LVQE 1HZZC 2M6KA 3RVBA 4C43A 4IGEA 3A0UA 4P7GA 4XGKA 3AUKA 2PQ6A 2CBGA 5AP9A 4A0SA 4CR6A 4PN7A 5DRYA 4YLYA 4KO8A 5ECDA 1UBCA 3W3ZB 2NXNA 4EUSA 2CXHA 1WL8A 1SULA 2RAUA 2GKSA 2Z1MA 1IY1A 5FR1A 4GOXA 2ZE6A 16PKA 4IHJF 4LHXA 1FS5A 3DV2A 4PZCA 4WEQA 3RVRA 4J1TA 5HW0A 2H63A 3T7KA 3RYCA 1LVHA 3CRVA 1K2VN 5GGYA 4KDRA 3OE7A 3SF8A 3TR0A 5HZGA 3LPCA 3RT9A 1MZVA 3KTAB 4XDYA 2XDWA 4OQDA 1NG9A 4JR1A 1D8TA 2XNJA 5LP6F 3DFMA 4CFZA 3S29A 1QRAA 3S55A 4CUJA 2V4ZA 3A58B 4LBZA 2E87A 1S02A 1K3UB 2BMDA 2IP2A 2WZBA 3E8MA 4LRXA 1G7SA 2PGJA 1JLLB 4LGVA 5IUKC 2JPDA 5ALUA 2Z9CA 3AVUA 3N53A 2XKJE 3RYCB 1EM8A 3IAXA 4K03A 4F8YA 3U61B 3UG7A 5ISMA 2X19A 4YAJA 5G40A 3PQ4A 1VRCA 1T25A 2YJ6A 3RAPR 2ZSKA 4UW9A 4OQFA 1TU4A 3B5JA 4QGGA 1BTOA 5H3LA 3REQB 4EYGA 1VSTA 4CT0A 1N2CB 1RXVA 1RVV1 2A5YB 3N58A 3NCHA 4IR7A 1R2QA 5AUPB 5E95A 1I32A 1YOBA 3DHYA 3SG0A 2HK9A 4BZXA 4NP6A 2KB0A 2C2BA 5FRDA 1RWNA 4D9KA 5BNZA 3FWNA 5JSHA 2DUNA 2RBEA 5D3QA 3DLHA 1EM8B 4GMKA 4I14A 3TMAA 1CUCA 3E9NA 3ZDDA 1YQ9A 4D4IA 2H54A 4Y0NA 2Y1KA 2WF8A 3BT7A 4PEVA 2Y4NA 4QYTA 2X3UA 5ALOA 4UDOA 3ETDA 3CJQA 1DXYA 2BGNA 1Q7GA 4DSOA 3AIIA 5C7OO 3FGOA 1QHFA 3HWSA 4AO7A 1JU3A 1S2NA 1GNLA 2HJWA 2QN6A 2QS9A 2YOHA 3DVRX 3M6XA 4ZVNA 2E1PA 3WB0A 5FAKA 1DJMA 3GELA 4GSLA 3REGA 2WM9B 3NEAA 1U0HC 2OGZA 1ORVA 1IB0A 2BUAA 4H27A 5F76A 5DISB 1W87A 2QL6A 3G8BA 1S8NA 1VHWA 1WY7A 1RAIA 2P3SA 2XZDA 3IH5A 3H9BA 2GPSA 3QXHA 3VR0A 5CFPA 4WLVA 1O58A 2IIVA 5JLAA 4DHWA 2IITA 3AUYA 1SUWA 4EFLA 1L7EA 4GKJB 1UDBA 2M2IA 3BQNB 3X1DA 4NYJQ 2I8AA 5AR1A 3RK4A 1J8VA 2RGRA 1U0LA 3NFRA 1EINA 4MI9A 4P38A 2Y66A 3GJQA 4YJ2F 1DKRA 1WPRA 2QVXX 5JH7A 1YS7A 1IEXA 3ELBA 3GCGA 4E46A 4DM7A 1XZDA 3Q0TA 3QELA 4O4HA 4CLXA 4JCCA 4M36A 3VU3A 3QXJA 2QQGA 2G76A 1T5LA 3ER6A 4NK4A 3JATA 2W37A 2ZE7A 3DMRA 3F5DA 3IP7A 3NPAA 1EWVA 6Q21A 3ROFA 1LQUA 4IVQA 4R81A 9ATCA 1NDHA 2H92A 3QVSA 5FTLA 3ONNA 3IHTA 3I5AA 1YRQA 4MZDA 5EJEA 1N6RA 2I62A 3TFOA 2ZGVA 3GNSA 5GADl 3TWOA 3W2HA 1QIEA 4J4HA 4L8VA 1FRVA 3CEMA 3FIJA 3DE3X 3IODA 3PXDA 3AWIA 3UWMA 5DGDA 1E58A 5FTMA 2WQ6A 1Y3FE 4ZVLA 4P84A 3W4IA 4NOLA 5L6LB 3QELB 3FVVA 4XUGB 3JATB 5DLQC 3OLYA 2I67A 2IU4A 3NONA 4LA4A 3C3YA 4CM8A 4BE7B 5LP1A 4PLFA 3ORSA 4ESVA 1MV8A 4JC0A 5DLPA 3U4GA 4ARAA 2EYUA 4U7WA 4EIWA 4CEHA 2OORA 2PZMA 5P8WA 1M1UA 3GWGA 3A3YA 4J0CA 1ZNYA 3TW8A 1T9AA 4LYJA 4R8VA 3VVBA 1Q1EA 1NNUA 2J9RA 5I7FA 1C7FA 3BD9A 4KH1A 2FETA 2WR8A 2G71A 1FSPA 2DBVO 3EEBA 4DR7B 4IIFA 5LUAA 5J9FA 4R7GA 3SHQA 4AMZA 1Z8FA 4WNCA 3L2OB 3F67A 3I4LA 4X6UA 3ZDEA 3HVRA 2NP7A 4I9HA 4XVRA 3NU1A 4CM8B 2XOKA 4JEHA 4B3IA 3HHEA 1FMCA 2OPBA 4R2LA 4Z54A 1FZTA 2ZSJA 1M8KA 2Q2WA 4MIKA 5BPFA 1K9SA 3DE1X 1GPNA 2CKMA 1USIA 5AJYA 3CU5A 3TW8B 3T9EA 2K7FA 4TPKA 1VSBA 2EW2A 1JH9A 2UUBB 1U6JA 3PR3A 2PUGA 4BDTA 3JZMA 2RI0A 1Z0DA 3RIXA 1OC2A 1BCRA 1KP3A 1RRGA 1X1EA 2GAAA 2WPDA 5FBLB 1YFLA 1MOZA 1Y3CE 3PTAA 3A27A 1K7FB 4K9SA 3SX4A 4DLZA 2O2HA 3A06A 3V8MA 2AN5A 2D0DA 2X7HA 3ROEA 4G0ZA 2H65A 4AZWA 3KEMA 4UM8B 1IDN1 1NBWB 4M7WA 4PYNA 1ZG3A 5HILA 4QU8A 3GFTA 4ZMBA 2PWYA 1WPGA 3HGQA 2B25A 2G7ZA 3HWRA 4PC7A 3TSOA 2QR5A 4RZUA 3T1QA 3BUSA 3R0ZA 1LPPA 2G88A 1E20A 3WGHA 1DTWA 1VIAA 2ODBA 2I6SA 1BCRB 2A84A 2V9ZA 2BFAA 5D5QA 1ZMRA 3A6JA 1OZGA 3ANNA 4R2KA 1QFYA 4EECA 1LLCA 2JASA 2ZP1A 4A16A 2FLWA 3TAHA 3R5TA 1UP6A 4EHJA 3TNLA 3WLEA 3I5UA 2BCEA 1U0RA 4QEDA 4RM3A 4YJFA 5HRAA 3AZQA 4WCFA 1MNQA 3VKFA 3W2FA 3A4NA 2YVLA 1UWLA 2WJIA 2AA3A 1DTWB 3D3NA 3DEZA 1K5GA 1UM9A 1GEGA 3KHSA 5ALNA 3KOMA 5ITZB 3INTA 5KTPA 2AXNA 4JY7A 1NQAO 2I1LA 2HA0A 4URUR 4E7OA 4C29A 1QE5A 1OXMA 3RROA 4BTEA 3SZUA 5IHPA 3K9CA 4CQJA 3VUEA 5KPJA 1OX6A 4JHXA 4YJFB 4EG3A 4EG4A 4WCFB 4LXHA 4TQGA 1HK7A 1OXBB 2IUYA 4NIMA 4U9IS 4UBLA 3IUMA 1NBMA 2V8OA 3N39C 2W6NA 5FFNA 4OMCA 4ZCSA 2K87A 1DVRA 2V7WA 4ZAXA 2J1LA 4QDZA 5HA5A 4LFCB 5H5JA 5F23A 1IONA 2V7VA 3DC2A 4E5VA 3CX7A 4EYQA 2Y4OA 3AFHA 3IPRA 4FW9A 2GETA 1T10A 1R0XA 1EVKA 1OE0A 2X58A 2OQIA 3PR1A 1H22A 1NFQA 2R79A 4CF3A 5JEDA 1HDRA 4G9GA 2J30A 2B0CA 2PA0A 2FGKA 4FKBA 2AJBA 3MRXA 5IZ4A 4Q18A 1MXHA 3KYCA 2CD9A 3UHFA 3V00A 3EWNA 2DQKA 4M9CA 1DJOA 3AEQA 1KQFA 5JTUA 2JJYA 1ZKDA 3WLTA 3IELA 3OAAA 4L5JA 3N0RA 4JA2A 1T8PA 5FD8A 2A3NA 3V2GA 4D8VA 5BSVA 2RMKA 1CLEA 1Y5NA 4F1KA 1R66A 2OK7A 2AOVA 5IP5A 1GNPA 5LNK6 5CNIA 3RYIB 3WY9A 5I8ZA 3WVNA 4KGXA 2YIJA 3OX4A 1Y6RA 1H85A 4B81A 2G4CA 1G3IA 2ZAGA 4QNMA 3IKJA 2WVAA 2FWMX 3E7FA 5CLHA 2EIXA 1DQNA 2OXFA 3QVXA 1TVEA 3GUVA 3KT3A 2QRGA 1I0ZA 3AEQB 3GFQA 1LNZA 1QRRA 2WJPA 1X9GA 1LRJA 2HMAA 3DMTC 3EIXA 4OJNA 5FIUA 5FI0B 1UKYA 3K5IA 5A4FS 6PFKA 1QR6A 1ZGZA 3LCUA 3THWA 2P2NA 2F43B 3TEMA 1MJHA 1PYDA 1RYNA 2GGSA 3GJTA 5ESXA 5GTDA 3GGSA 1AURA 3EXG1 3O2JA 4R7ZA 1GUZA 1RXYA 1OF1A 1QGOA 3A10A 5B7NA 3G8YA 5DEOA 1JVNA 4R9VA 1V7PC 5BWLA 5GIPE 1G20A 3ED1A 3FB1A 3RRXA 4NF2A 3VTAA 4UARA 1KAMA 1UZNA 3Q8XB 3RGWS 2OQ2A 1BS9A 4NBTA 1QIIA 1SBHA 2OA0A 2WJJA 3THWB 2B82A 2RGWA 3IP9A 1MOQA 3R0IA 3I23A 2LDBA 7REQA 2BSXA 3O9MA 1J24A 5JAHA 4MA4A 2ZTUA 3IPAA 1MT3A 5G0TA 1Q19A 3MMZA 4JDPA 1LBSA 1J56A 1G20B 1A7UA 1JPVA 4HGQA 4PONA 1JU9A 3D5EA 3T3MB 2YBDA 3B20A 4B79A 4BC0A 4WUTA 3W6ZA 5LZ4A 1DI0A 3NI2A 3HZHA 2DYKA 4GKVA 1X1TA 4DSNA 3QA9A 5LR6A 3GLTA 4Z5XA 2QAJA 2XQFA 2Y1FA 4JBIA 2VHJA 1SHLA 2QPTA 4OREX 1JKIA 4DLWA 7REQB 1CKEA 1GLVA 1ESCA 2HMWA 3KKNA 3O8CA 4N48A 4PYIA 1IN4A 1OYYA 4L57A 5KVVA 3CO5A 3W7VA 2C7QA 3LY7A 1DLIA 3H05A 3H1GA 4QUGA 4LWZA 3U3MA 2ZFUA 3HB5X 1OREA 3CRQA 2DFPA 3O4FA 3QY9A 1DDIA 1VBFA 3P9QA 2XZPA 4I4TF 3VDXA 4Z1OA 5EA2A 2BGJA 1J5XA 1F20A 2D2XA 2MSCB 1SB9A 1DRKA 5K4HA 3JW8A 3L6DA 1GUBA 2NUBA 5M7EA 3EASA 2ZS8A 2A0FA 3L4EA 4QDTA 4NCBA 4BGVA 2EP5A 2G9RA 2C5FA 3A3KA 3QX9A 2RB5A 4RCVA 3NPMA 3EC7A 4I8XA 5BVGA 4L0MA 1CQXA 2R5NA 4X3OA 2R6HA 2W6JD 1UM8A 2C20A 2UVQA 1AXGA 1CUAA 2G9UA 4P3PA 2YHSA 4ZI7A 1FNSA 1NJSA 2J67A 2P9EA