2LBPA

Structure of the l-leucine-binding protein refined at 2.4 angstroms resolution and comparison with the leu(slash)ile(slash)val-binding protein structure
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
346
structure length
346
Chain Sequence
DDIKVAVVGAMSGPIAQWGIMEFNGAEQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATAPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-BINDING PROTEIN
publication title Structure of the L-leucine-binding protein refined at 2.4 A resolution and comparison with the Leu/Ile/Val-binding protein structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Periplasmic binding protein
total genus 109
structure length 346
sequence length 346
ec nomenclature
pdb deposition date 1989-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lbpA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lbpA01
1TM2A 4L85A 4IMIB 2HSGA 2YHBA 1ZAYA 1MAVA 3H5LA 2MSLA 1DCKA 4RY8A 3SQNA 5KQLA 5JNVA 1NXWA 1ABFA 4RK0A 3HCWA 3C97A 5CNKA 4N76A 4YCSA 2JBAA 2QVGA 4RY0A 3KJXA 4W5RA 1MB0A 4S04A 3CRNA 1EWTA 4MS1B 4F11A 3GBVA 3HZHA 3RQIA 5KC8A 5FWYA 5IC5A 1JWLA 1EWKA 4JA2A 3CS3A 4RK5A 4Z9BA 3VNBA 3RVRA 1DZ3A 4RXMA 4MR9A 3IP9A 2XDYA 1ZY2A 3L6UA 4EYGA 4TN5A 3M9WA 4RV5A 4NV3A 1E2BA 1P2FA 2NT3A 3DGFC 3T38A 2X7XA 1D5WA 3F6PA 3LMKA 4O1IA 3JVDA 4MRMB 3HXMA 1JYFA 2FSPA 1LK0A 5HKOA 3O2JA 1ZH2A 1A0OA 4MR8A 4Z4EA 3EDCA 1ZGGA 2LUOA 2QV0A 4G0MA 5GQSA 4B09A 3H6HA 4KVFA 1DRKA 4XASA 2JB9A 4HNSA 4MAAA 1RZRD 3GA5A 3OM1A 4Z4HA 5CNIA 1QNLA 4W5NA 3CU5A 3LUDA 2GKGA 2WJAA 1I3CA 4EUKA 3A10A 3KYJB 4PYRA 1Z25A 2FMIA 4ML3A 3RVSA 1DC7A 2NZVG 3LUJA 5DTEA 2F8SA 1L5YA 1DP4A 2HQRA 3OLWA 5E3JA 3OM0A 3FFXA 2IPNA 3H75A 1NXSA 3F7NA 4JP1A 1YMUA 2E4XA 3H5OA 2E4VA 4D74A 4W5QA 1YS7A 1DBPA 4NCBA 2HJ9A 2PE5A 3OQMA 6CHYA 3ROFA 4Z4GA 1L5ZA 3CZ5A 1GCGA 1DBWA 3ILYA 4RK7A 3OLYA 4NICA 4RXUA 5B3JC 3HK2A 3H5WA 1QKKA 3IPAA 1KMIY 1LBHA 3EQ2A 2MYPA 3D02A 3LKBA 2PKXA 3H5TA 2GX6A 1E6LA 3KKEA 2A9RA 4LE0A 3GYBA 2E4ZA 1FFWA 2FLWA 3H1EA 1IIBA 5IBQA 1M5TA 2IDMA 3UUGA 4G0OA 2L18A 1YTUA 1KRXA 2FN9A 3TMYA 3OLVA 7ABPA 3KYIB 4EYKA 1D4ZA 1A04A 2GBPA 1J56A 3NHMA 3DZDA 1SD5A 3BRSA 1QP7A 4Y9TA 2FKAA 4KNYA 4JB0A 3QLUC 4G86A 1JDPA 4HNRA 4ETNA 3BREA 1E6KA 4KREA 4H3KB 4DADA 1YK1A 1ZN2A 4KPYA 2MYUA 4MGEA 3O75A 5CHYA 2JVJA 3E61A 3G85A 2RGYA 4JASB 1M2FA 2H3HA 2P9HA 3BBLA 3MMNA 4RU1A 3TB6A 4CBVA 3KTOA 1JH9A 1F51E 1USGA 4PE5B 3HJFA 1DC8A 3CTPA 1BA2A 4MQFA 1USIA 4NQRA 3I42A 3QELA 3UK0A 3LUGA 5FBKA 3IDOA 4TLLB 4YGXB 3QEMA 1ZHHA 2E4YA 1JLKA 3CKMA 1R8JA 5F64A 2CHEA 1PHRA 4PZ0A 1Z26A 5EWLB 3S99A 1T34A 4RZSA 4OTZA 1ZH4A 4RWEA 4IRXA 3IP7A 4RS3A 4YS6A 1PEAA 4E7PA 3ROTA 1FFSA 3DLHA 2PL1A 3BILA 1M2EA 2PUCA 1Z12A 4P98A 4JOQA 3KSMA 5C5CA 2MSKA 3LUKA 4WXMA 5TPZA 1QPZA 4NCAA 1EWVA 1DCMA 2N9UA 3EGCA 1W9HA 2WRZA 3HS3A 3DBIA 4TMYA 1C0EA 1TJYA 1FFGA 1GUDA 1Z17A 2PUBA 1U0SY 1YMVA 3I09A 5TQ0B 3OO1A 3H1FA 3E3MA 2MYTA 2IOYA 5TQ2A 3RVQA 2LIVA 2HPHA 2MYNA 1BDIA 2CD7A 3RVJA 4E7OA 1FQWA 3N0WA 1KRWA 2VK2A 3HDGA 2FQXA 1ISRA 1U8TA 3EQZA 2MSWA 1QO0A 3FGZA 2ZWMA 4MS4B 4MQEA 1SRRA 3CNBA 4EVSA 3CG4A 4KRFA 2QXYA 4DN6A 1JX6A 3MIZA 3TX6A 1ISSA 3MM4A 4YLEA 5JNUA 4M88A 2L19A 4RK1A 5DKFA 1TVMA 5TE9A 4KQ9A 4D6XA 4Z4FA 2PMCA 3O2SB 3Q41A 5KQMA 3H5IA 2WJWA 3HSYA 3HUTA 4OATA 1JL3A 1NXOA 4MR7B 5PNTA 3LTEA 2A9PA 4RK6A 5EWMA 5DCLA 3LOPA 2PL9A 3KLOA 5JS2A 4YWHA 1B00A 4LE1A 3KCNA 1GLGA 4Z4CA 3SNKA 3HDVA 4YO7A 4XLTA 3OO0A 4KK3A 4W5OA 3M9XA 2I6FA 2LP4Y 2L17A 1U2QA 2E4UA 4O5AA 4F06A 3F6CA 1LJLA 1JFSA 2IPLA 4RDCA 2JK1A 4EYQA 3KLNA 3HV2A 4Z4IA 2WB4A 5FWXA 1JHZA 2QSJA 3EULA 4QICA 1A2OA 5EWJB 2R25B 1JFVA 1Y1LA 5BQ3A 4KFCA 3SY8A 5BRAA 4EYOA 2IYNA 1NXPA 2A9OA 3N0XA 3NBMA 2OENG 2B1JA 1EHCA 3M6MD 2QU7A 5KC9A 2FQYA 2FMFA 4Q6BA 1RNLA 2ID9A 3D8UA 3NHZA 1SXGA 2AYXA 5I4CA 3NNNA 2PUEA 1RPJA 2KYRA 2CWDA 4YRZA 1BDJA 3Q15C 3I45A 4YV7A 1XWWA 5B3JA 3KHTA 1OXKB 3EODA 3O1JC 3QEKA 4GPAA 1CHNA 5TPWB 4KZKA 5ED4A 4H60A 2IKSA 4PEVA 3RVLA 1CYEA 3GRCA 4LDAA 2TMYA 1BVHA 3TO5A 3A3KA 1MB3A 3JVIA 4MS1A 1SXIA 1ZVVA 4FE7A 5HM6A 5HSGA 4XARA 1W25A 4QYMA 1ZDMA 2FTKE 2PUDA 5TQJA 2JBAB 2NUBA 1QO0D 1XHFA 2CHFA 1DG9A 3N8IA 1GUBA 2R48A 2VUHB 3F73A 3QLUA 5ABPA 1FSPA 4WT7A 4KV7A 3O2QB 2NT4A 4Q6WA 3HVRA 4OLAA 3Q7TA 3B2NA 4G0XA 3SM9A 2A9QA 5FWYB 3FFTA 1LJUA 3HEBA 1ZGZA 3N0RA 5CNJA 5DLEA 1YIOA 5JS1A 3N53A 4ZMRA 1MVOA 1Z18A 1DCFA 1JDNA 2FEPA 3C6QA 4MR9B 1D1QA 1AB6A 4KQCA 2PLNA 2WWVD 2FMKA 1BDHA 2ZAYA 1NTRA 1H9CA 1Z2EA 1XHEA 3GBPA 5T3YA 4N47A 1YS6A 2IPAB 4XXHA 4N41A 3KS9A 3O21A 4WWHA 1F4VA 3MYYA 4F12A 3MQ4A 3O74A 5C5EA 1RZRA 3EAFA 2BGGA 1VRVA 4MR8B 3LKVA 5IUNC 3DLBA 5KQGA 3CG0A 2FVYA 2HQBA 2RDMA 3QLVA 3IP6A 3O1HB 4RXTA 2JCGA 3N6VA 2QW1A 1P6UA 3JY6A 4EVQA 4N0PA 2PAFA 4G0PA 2LPMA 4LE2A 4RKRA 2IPMA 1NXTA 3GL9A 2RJNA 5IEJA 3LUHA 2P4UA 1JFTA 2V0NA 4IGAA 1Z13A 1D2AA 3T8YA 2PUGA 4GNRA 2NZUG 3LUAA 4Q7EA 1NXXA 5CNMA 1URPA 1APBA 4KK4A 3DGEC 3JPYA 3UKJA 4EY3A 3RVOA 3I5AA 3JS5A 4YR7A 4PICA 3HO1A 1DJMA 2YHAA 1DRJA 2H0AA 4Z0NA 5KQPA 5IX8A 3TD9A 1ABEA 3RVKA 8ABPA 3KG2A 4UHJA 1NXVA 3LUCA 1JBEA 3A0RB 4JB2A 3IP5A 4WUTA 4H3HB 1VLZA 3K9CA 4Z99A 1MIHA 2M98A 1YK0A 4WZZA 1S8NA 5IUJC 2PUFA 5IULC 1ZESA 4ETIA 1USKA 1QMPA 2FW0A 2J48A 3NNDA 1EFAA 6ABPA 1QP4A 4HNQA 3Q9SA 1YVUA 3L49A 4N0QA 2M1ZA 3C3WA 5HQJA 3A0UA 1UDRA 4QPJC 3FMVA 1WETA 4QYWA 1PUXA 5EWLA 3RH0A 3LFTA 4WXEA 2PUAA 3QX8A 5D2CA 4UHKA 4IF4A 2FMHA 3RVNA 1Z16A 3QLTA 4O1HA 3HM9A 4JAVC 4L4UA 4MS3A 2F8TA 4MQFB 3H5VA 3OMWA 4Z9AA 2QR3A 3H6GA 3QELB 4RSMA 2OQRA 3MF4A 3H1GA 2FEWB 3FFWA 3SG0A 4XAQA 3QEMB 3O1IC 4G0YA 1P8AA 4ZJPA 1EAYA 5JNTA 1RXEA 3FDFA 3CZCA 3QX9A 1ZITA 5TPZD 9ABPA 1Z15A 5KI6A 3GT7A 3W9SA 4D6YA 5TQ0A 4ETMA 4FB4A 1CEYA 3IPCA 1K66A 1D1PA 1NY5A 2E4WA 3T6KA 4MLDA 2QVCA 3SAJA 5KWSA 1TLFA 1OXBB 1BAPA 4EGSA 1SXHA 4N03A 3N75A 2JRLA 4MS4A 2R47A 4TLMB 3T95A 1PNRA 3QK7A 5DGCA 3CHYA 2RJOA 4ZMSA 4MYRA 1TMYA 2JVKA 1PEYA 3GWGA 2L2QA 2Q5CA 4DQDA 3RVPA 1KGSA 5TQ2B 4MLCA 4RK4A 3MA0A 3BRQA 3R0JA 1E6MA 1Z2DA 4ZYLA 3LUFA 2LBPA 2JVIA 1VKRA 2R4QA 4MR7A 4G97A 1GCAA 3P9YA 3JTEA 2VUIB 3OLZA 4MQEB 4XFKA 3OQOA 3ILHA 4MRMA 3Q7RA 4LRQA 2HQOA 4RY9A 1JF8A 3OMXA 4KMRA 1QP0A 4OLBA 4OG2A 3JPWA 2ID7A 1RXIA 1AB5A 5BRJA 5BR1A 1QQAA 4S05A 3Q7SA 3CLKA 2PJUA 2QZJA 3K4HA 1U2PA 5EWMB 5JNSA 1JYEA 4G0QA 4LZLA 5EWJA 1VPWA 1HEYA 2B4AA 2DRIA 2GWRA 1DBQA 4P1ZA 5IEBA 2AYZA 3NNSA 3OQNA 1K68A 2FLKA 3VNAA 5IUKC 1C4WA 2FN8A 2FQWA 2FEKA 3C3MA 5FBHA 3C3KA 3HUUA 4W5TA 5T7BA 3GV0A 1QQBA 4FE4A 5FWXB 1P6QA 3EJWA 3OLXA 2VYCA 1LBIA 4LDZA 4EVRA 5GOTA 4YP9A 4LX8A 4ZPJA 4G0ZA 4IILA 5JNRA 2WMYA 3QLVC 4IMJB 4MS3B 5JNWA 2O20A 4RKQA 3RVMA 4MPTA 5TPWA 4HYEA 1M5UA 4OBBA 3CFYA 4F3TA 2GI4A 1PNTA 3G1WA 2WY2D 4F8JA 2FXIA 1U04A 1NATA 2W42A 3URMA
chains in the Genus database with same CATH superfamily
2GO1A 1GO2A 3BH6A 3CKYA 3N58A 4DNPA 1QTRA 3KOMA 3GG9A 4OHZA 4BO9A 3BCRA 3WOHA 5CLIA 3J7AC 5JNVA 4OP2A 2QTVA 2O2SA 1SO8A 3MAAC 4D2IA 4WCVA 4YCSA 3P2JA 3Q4GA 1E7RA 4MYCA 5JC8A 5BN5B 1NF3A 3FCUB 3WL7A 1KARA 1L7QA 1AG9A 1TT5B 3KYBA 4UEQA 4KWTA 5LDHA 3H42B 2ZT7A 2FW7A 2QN3A 5M5BA 3FTEA 1E2JA 4RTOA 2Q6LA 4LXYA 3EXIA 1XEXB 5HRAA 3ABQB 3RIGA 1OYOA 1BH6A 3RQIA 5B64A 4Q4DA 4Z9BA 1EE9A 2CDCA 2V9CA 1EDEA 3I92A 1S3GA 3H1TA 4D9GA 7MDHA 2OZPA 4E5DA 2XDYA 4PLVA 1FSFA 5JUWA 1JU9A 2XRZA 1TCCA 2LE0A 4WQMA 4ER0A 2QLBA 2YRWA 5BOSB 2Q07A 1VP9A 3EXFB 2P78A 1P2BA 3S68A 1J2TA 3JXEA 5K05A 3DDUA 1FU4A 4I1UA 4NFSA 2UXBB 4DIEA 2GCEA 3A4MA 3JASB 3FJYA 3QW4B 1XZGA 1ZH2A 3X1XA 2JGEA 3SYKA 1PDOA 2EDCA 1QZXA 3DXXA 4N9WA 3VPSA 3WTBA 5A5EA 3CH5A 4CKXA 1VCOA 3M0EA 1HE1C 2PSJA 3P9KA 2OBMA 2AJBA 1UBEA 2DE0X 4G25A 3AR6A 3O8BA 4INJA 1YZLA 1RRKA 1Y8CA 4QYSA 3SXPA 1PP4A 2QL7A 4Z3DA 3PA8A 4QQRA 1RC1A 1M73E 5KTOA 3FGPA 2O4UX 3KBBA 4CV0A 3NASA 1H66A 4ML3A 3SOZA 3T94A 4AMBA 1DC7A 1IG0A 5JS7A 2OO3A 3GT0A 5IAJA 3T7JA 4BMPB 1DP4A 1REQB 1TUGA 3IKVA 3CRZA 1D2HA 3FFXA 4HTAA 8OHMA 5L7WA 3Q5DA 4TGLA 4DIFA 5HRUA 1Z0KA 3IUQA 1UEIA 5D84A 3ZUGA 2RBEA 3BZBA 2BTQA 2VF8A 1T5HX 3OQIA 1JTVA 3TRDA 1W4RA 3GEHA 2OBLA 4QAJA 1QUFA 2XITA 3KKOA 2WICA 1NQAO 1GGNA 1GR0A 4GO1A 3H11B 4QUEA 3MW8A 5IF3A 2IXTA 2V7EA 5TC4A 3E8SA 5K0SA 3JZIA 4OHKA 4QU9A 2BBTA 1PIWA 2VP3A 2IHZA 2Y67A 1OZFA 1CF2O 2IQIA 2V5VA 2CUKA 3I3OA 5LD2B 1R74A 4ZT5A 1F06A 3U6BA 3K5HA 4KTTE 3C7TA 4Q24A 2R8YA 3N8NA 2E4ZA 3AUXA 1T8UA 4TV8A 1WM1A 5B2EA 5ICMA 5JXGA 1BWSA 2EZUA 3Q11A 2ZBPA 4EPYA 4YRFA 4Q0MA 3ECCA 1NOIA 4B6OA 1SCNE 2ZJ0A 4URZR 3ZDYB 4B2IA 1XU4A 1Y82A 5D86A 2XVAA 2XT9A 3ZE8A 1EVIA 1XUOA 1LS1A 2ZJ8A 1DIBA 2CNBA 4NFYA 5I9TA 1ZIDA 1RRFA 4LOAA 2PDAA 2AJTA 1CVIA 1LVHA 1U0GA 2R1VB 4TTQA 1U3UA 1NT2A 3BXXA 3I9KA 2C9YA 3N2LA 3TN7A 2VZ8A 4K3VA 1SU4A 2MYUA 3BA1A 3LXMA 1BGVA 2YQZA 3D6UA 4NBVA 4GAEA 2H3HA 3WWPA 1ML4A 1I5OA 3IVRA 1SVNA 2GERA 3FHOA 2EZTA 1XN1A 4PE5B 5IF9A 1PEDA 3AM1A 1M7HA 1Q1AA 2HLDD 3CXRA 4G56A 4MQFA 4YJKA 3MMSA 1RCTE 2A57A 2FG5A 3M4XA 3L46A 3NIWA 3I8XA 1TPYA 4A0SA 5FTLA 3QU4A 5KNCA 3UAZA 1O96B 3GLHA 4XD7D 3AHEA 4CETA 4ER7A 3L05A 2ZJ7A 4L5CA 1ZAKA 2PO5A 3M6UA 4UW9A 5KTRA 4AUMA 4OBWA 2NTEA 3O47A 3AILA 4P80A 1PFQA 4TS3A 3MWFA 2P40A 4DLKA 4E7PA 3ROTA 2V7WA 1DIHA 1OR8A 1V95A 2BFPA 3P0FA 3B78A 4HMPA 5KYYB 1GEGA 1OJ7A 3ZNQA 2DH5A 2YZNA 5BQPA 2NO7A 2OV3A 3QGMA 4JKOA 1N1MA 4JK3A 3KELA 4UM9B 1NC3A 3BHMA 5COQA 4QRDA 1VYVA 2ZPUA 2PNJA 4NYJQ 5JU6A 3EJ6A 2BKAA 3SHQA 5JJBA 1FTGA 3LLUA 3TLGA 3T7TA 4DM7A 2C54A 4QFCA 4N9QA 3OPVA 4RD0A 5FXMA 4OB7A 3ZE2B 2FPGB 2HPHA 4I4IA 1BDIA 1NP6A 2FUG1 4E7OA 3KQWA 2XMDA 1NM5C 3HWX1 4RW0A 1KHTA 1PR0A 3U0BA 3VDXA 1RXVA 1RZUA 5E6RA 1UDXA 1NASA 1TW3A 2ZWMA 1F5NA 5I7VA 1L5WA 4KYUA 4YIKA 3P8ZA 5AUNB 4BFZA 2UUPA 3DPSA 3L7YA 4IFBA 3DXYA 1XZHA 2VOJA 3A1DA 1ZW6A 3GH3A 2ORVA 2QRVB 3KAKA 1OU4A 3PXCX 3JYNA 3DAHA 1PL0A 5H9VA 3DNFA 4DDKA 1QORA 3QOFA 3PITA 4O6VA 4PBTA 4YJFA 3E5RA 5ARDA 1USUA 1LNQA 2CLHB 3TLKA 1U0LA 1UFQA 2H2AA 1Q0TA 1ZL2A 2AD1A 1VHDA 5EWMA 1WMSA 2NAFA 4JBNA 1WQ3A 1DQRA 4YWHA 5CVTA 1EKXA 2IK8A 4MKFA 3CNQS 3I4CA 1NLYA 1R64A 4XM0A 2H8KA 2OFXA 3R0VA 3AEUA 4QWWA 2RHRA 3AOEA 4R3UC 3R0XA 1ZMXA 1DQYA 1Q12A 1TUBA 3TBFA 1UOOA 4WXPA 3VZCA 4CYMA 3L8CA 4Y2PA 3S4YA 3IVMA 3WIOA 5KTTA 1IUOA 3BFXA 1RIIA 3HV2A 3QYPA 1M1UA 3STHA 4CV2A 1T5SA 4JNCA 1YR8A 2HEGA 5A71A 3OTWA 1EK2A 3G9TA 3PS9A 1ZCZA 2OHGA 4Q1EA 4Q01A 5JPDA 4ERXA 1I51A 3Q10A 1IN1A 4B3DA 4TMVA 4NJEA 3GMDA 3MD0A 4IQ4A 3BERA 1T5LA 2AZMA 2J41A 5JAOA 1SBTA 1DARA 2GO7A 1K4MA 4GI7A 5GGYA 1A1VA 2NYRA 3EWNA 1RLIA 1RNLA 5B30A 2IHUA 3AR9A 3UK6A 1DBRA 1BHO1 3PQ5A 3FWZA 5KJ1A 2Z43A 1KVSA 5DW3A 4IIJB 4OKIA 4MW0A 1BDJA 2ZWOA 1IB0A 1N0HA 3L1VA 3ESXA 4JY7A 2IUSA 4JVOA 1XDUA 4PYIA 1JECA 3A9VA 1H4VB 1EJBA 3HBLA 4R2HA 5A7HA 2Q7DA 3GA0A 2SCUB 3IUYA 3JQGB 2X0RA 5C1BA 5IWCA 3OFKA 3OFNA 3V1UA 3ZWYA 2OZLB 3HB7A 1I9GA 3ORQA 3E1KA 4KJZA 1QJ4A 4CPDA 4HQFA 1A9ZA 3JVIA 1SXIA 4N12A 3V7UA 5CXSA 3PNVA 4JX8A 4RD3A 2CKMA 5E1BA 5C4IA 3BWBA 4FJ0A 3TQHA 1Q21A 3ZWQA 2E49A 3BIOA 3NKLA 2VDMB 1QGZA 3DOEA 2R7LA 1EM6A 5HF6A 5KSZA 1SB9A 3I1FA 4R1LA 3KV1A 1M6HA 1M6VA 2ERCA 1FJ2A 2BHSA 1SOWA 3FPBA 3E0XA 4FYMA 1LF5A 1XFDA 2BGWA 3JZMA 4MW1A 1Z8DA 3O0DA 1MR3F 1T3HA 2CVFA 3KB2A 3DM5A 3JYLA 3B2NA 4MRRA 1O94D 1PZMA 1QK4A 3HXQA 4YTEA 1GPH1 2ZAIA 1GGJA 1PT8A 1M1ZA 1G21E 3PC7A 4R81A 2B2XA 4LHEA 2BZ0A 4F9EA 1J70A 3GJRA 2FEPA 2J67A 1D03A 1EUCA 3O95A 1A9PA 3TDMA 4EHIA 3U3RA 4GS5A 1J07A 2PJDA 4K8OA 4OGGA 3RADC 4E03A 3E7PA 4XEUA 5A05A 4R83A 2DECA 2BMDA 3NRCA 3PUVA 1P9WA 3CWQA 1Z63A 5E3IA 4GMXA 4ZT7A 1GGFA 3O21A 1X1BA 3VUFA 2JLZA 3BH7A 3S70A 2KJQA 5JAHA 4G0VA 1LW6E 5MN4A 2I7DA 3W5AA 5C81A 1VRVA 5M3BA 3CZRA 2E82A 2GJAA 5M34A 1ZM9A 4D9BA 5B1EA 2REBA 2PQ6A 4DTIA 4EZIA 4BWFB 1TKAA 3O1HB 4MCHA 4NULA 4GNKA 4WJKB 1P6UA 3W3AH 4LF4B 4K9OA 3AFNA 4JR0A 1IAVA 1N78A 3ZBQA 4HF7A 2CXOA 4CMGA 4C2UA 4XIGS 3H04A 4I5DA 4J91A 1IDOA 2QK4A 3EFOB 1F8UA 1YFJA 1QK5A 1HLDA 2WJ4A 5A5GA 1CLUA 3KZXA 5IS2A 1OKKA 2HGSA 3GMTA 2PEYA 3AR4A 1GAEO 2ZAOA 1BD4A 1AY0A 2G36A 5D1HA 2RH8A 2Q27A 2UZ0A 3KR1A 3L1IA 1Z0ZA 3NHJA 3WTCA 2H9IA 4X44A 1APBA 2W43A 1EE2A 4IL5A 3EPRA 2GWHA 3KEGA 1GFZA 4R8MA 4KQ6A 5TGZA 1B8PA 4EY3A 4U9IS 2IOQA 3GP3A 2WAMA 2WPDD 4ZT3A 3JS5A 4IHQA 1A96A 4V1CI 4LF7B 4OYRA 2ECPA 2FPSA 2WWIA 2CHQA 4EOGA 5DYTA 1DRJA 2XRFA 5ALVA 5EJ8A 1SUDA 3LCMA 4FD3A 2ZM5A 4AS1A 2D1FA 1SUFA 3RS5A 1RYNA 3JATA 1W36B 1MGOA 2C99A 3ESCA 3IMGA 1SHLA 4G67A 1ZO8A 2WIKA 3CISA 4FFPA 5LB4A 1AX9A 3K9CA 3SHTA 5ITSA 1N4DA 1OPXA 2NU7B 3L40A 2WTEA 4GPTA 4Z99A 5IUJC 2B7CA 2QPLA 4LY6A 1F20A 5MGBA 1F0KA 1T4MA 2H2DA 3PXDA 1CUEA 5DHSA 4E08A 1YQGA 1P4RA 2FPLA 1WXDA 4FOTA 1FMCA 1YS9A 4MIKA 4TQAA 1TCVA 1E3DA 5FLKA 3AQIA 1WSWA 2R6ZA 5U4XA 5LWHA 3FMVA 4OREX 4LVOA 1F0NA 3KUDA 1CUVA 3NAQA 1GM5A 4QYWA 1DC6A 3N6RA 1PUXA 1XTJA 2ESRA 4O2BB 2HTEA 2FRVA 3FKQA 4KZPA 2R5WA 4PWYA 1HSOA 3RVNA 1DKOA 4C3ZA 1YQDA 3P9XA 1VLLA 3NG1A 1AHHA 4JAVC 4FN4A 1YR9A 4B6GA 5REQA 1FFEA 5BW5A 4CR8A 1VG1A 4GP7A 4V0KA 2JJQA 1PK9A 3L3BA 2WABA 3D7SA 3DR5A 2IYUA 3A3PA 3ASYA 2NUAA 5HDBB 3DLCA 5LQJA 1GZDA 2WW8A 2GPTA 4LI3X 1Z8NA 1WB5A 4KQEA 4BWVA 4NC9A 1L7XA 3DCIA 3BRWD 3BKXA 5FP0A 4PS1A 4ZYZA 1RYEA 1XZFA 2YCLA 1PJTA 3EAQA 3GT7A 4K28A 3D8TA 4L3WA 5ER9A 4D6YA 4ETMA 5BMVB 5BV8A 3VR4A 3ZDEA 1SOVA 2E1RA 4R05A 5LP6B 3SC2A 1A72A 1NVVQ 4NCIA 4OHBA 1HBJA 3GLGE 2G5CA 4KIUA 2IVZA 5ICSA 3K2IA 1GGEA 1RYHA 4Z7QB 3T95A 4PIPA 2O2JA 3MS2A 4CKBB 4DIBA 3DAGA 3UAOA 2C04A 2ZSBA 1UK7A 4Q1FA 3NEYA 1E7YA 2W2MA 5F77A 3RYTC 4BO7A 4D41A 5K3FB 3PGJA 5IJXA 3RFTA 4R5MA 1W44A 2C7PA 4KV9A 3DONA 1UDBA 4M89A 4W8HA 4WKPA 3KOOA 1P1RA 3OCXA 1GIAA 3I05A 1Q19A 1Z29A 4B35A 4UMEA 2CNKA 3OHMA 4EFKA 5B7GA 1KFEB 1H3FA 3DOUA 4PPNA 3GEMA 3OLZA 4S2UA 4NYIQ 1ENOA 4OM8A 4E21A 4GLOA 1BEEA 3KNZA 1JI0A 2BRUA 4PX5A 3BB4A 1MCZA 1THTA 3KTFA 3BTOA 3T5PA 1TEZA 3QE3A 3BCUA 3DB2A 5BSWA 4IWXA 1ZR2A 2CNLA 1RXIA 2W98A 3B1VA 3VOBA 3NC0C 1IQ0A 4CRWB 3K4HA 3S2IA 2GYVA 4AJLA 3D0QA 2ZE7A 4A2QA 5JZMA 1HEYA 3HVHA 1NRXA 1VLVA 1AN0A 2QRJA 1AT1A 1SNYA 2AR7A 2PXCA 4PFQA 2X9LA 1K3TA 1OGYA 2FLKA 3AIIA 3EZYA 1N9GA 3VNAA 3WGIA 1RR6A 3JX9A 3GA7A 3N05A 4AJOA 4JWKA 1Z2AA 3K9HA 1OJLA 5B3AA 1LFAA 3ZS8A 1FXWF 5AKLA 5F3RA 2C3YA 3ASUA 3ABRB 1RLUA 4YAIA 2JS7A 2O5CA 4OQXA 4W82A 1EESA 3EJWA 4FR2A 5F98A 1FLNA 1QIFA 4MULA 2C82A 3KTDA 2B7LA 2GZ2A 3FBGA 3ANNA 1UZLA 4B8ZA 2CLOB 2PVCA 2O8BA 1F14A 3FGOA 1SVOA 5EUBA 3NGMA 5JW6A 4H9GA 5DLDA 2IL1A 4IMJB 3WYEA 3CE9A 1TVKB 3EIQA 2B8WA 1CYDA 2IGBA 1NATA 2QJTA 5D3MB 1KU6A 2Q3MA 3NVAA 4RORA 4G89A 3AR2A 1V3UA 3MJTA 1PGPA 2AMLA 4ARVA 1A82A 2WFAA 1G0OA 1BEZA 4X94A 1MTZA 4LJLA 1FYVA 1MC1A 1ZP6A 3B8EA 3BXOA 4Q7JB 4YJGB 3R7DA 4ZVPA 1ESMA 2LDXA 3GAMA 3G0BA 4GH5A 5A4DA 4ACBA 4K2HA 3H1PA 5LOVA 3BJZA 1GDDA 1ODFA 1V48A 4A6PA 1VPVA 5DHTA 1EWTA 4MS1B 4PYLA 1X7DA 2GCPA 4OJKA 1JR3E 3RC7A 5F2NA 3UVEA 3MJEA 4FGJA 5FWYA 4Q3DA 2BJHA 5DB4A 4CXMA 3VNBA 3RYHA 1IXSB 5FAXA 1BROA 5HKLA 2YZ2A 3CF6R 1E7QA 2QZZA 2V74B 4UUPA 1JIVA 2WUVA 2HLDA 1WVMA 1P2FA 5KREA 1V3QE 3L0DA 1JG3A 3JQEA 2Y71A 1BS1A 3IJPA 3MG9A 4Q15A 4R5HA 2GBGA 1CRQA 4I55B 1WKBA 1AZLA 3BTVA 3VPHA 4D4JA 1JWAB 4DEVA 2OYSA 5CLHA 3CPSA 1RPNA 1U3CA 2OVFA 2D5AA 4BQOA 5IDWA 1PWYE 4IEIA 3VYWA 2JFGA 3Q9UA 1BS9A 3D3NA 4EB6A 1U2SA 2HWWA 1VE7A 1R0XA 2YVLA 3NBXX 3ELBA 3LQ4A 4K81B 2G76A 2P9JA 4RLHA 2GK4A 5H70A 1ZGBA 2DR0A 4FMCB 5AVSA 2PV0A 5JOQA 2WV7A 2ONZA 3Q40A 5JAUA 1WS6A 2H4FA 3T1VA 3LHSA 3ANXA 4TKVA 2FZ4A 3H5OA 3TQSA 1GILA 5IC4A 1YS7A 1DXHA 1RP7A 4NARA 4BUJA 5JFGA 2PE5A 1XX6A 3OQMA 1RKXA 4EUSA 1OHHD 5IKOA 1V9LA 5CCDA 2XNDA 3R1IA 4IIDA 1PTJC 1UUFA 3BJMA 2ZJ4A 5KCZA 3L18A 1WMDA 2AA3A 3TINA 1LBHA 4AMUA 2UXCB 4WLEA 2YV1A 4MUJA 2FCAA 1A3CA 1A5BB 2PKXA 3HBAA 4BPRA 3U19A 1BHJA 3FPCA 1AH2A 5EHGA 5J4YA 2W2NA 4Q4JB 5K3CA 3I6BA 1QF7A 4BFWA 2J4DA 5BQXA 1Q16A 1WLYA 4F86A 2XF8A 1X1TA 3A31A 3NW9A 5TMPA 3TMYA 3OLVA 4N7MA 1V45E 1ZC4A 2O0JA 1JR3D 4NKRA 5IM5A 3DCYA 4KE6A 3GAZA 3MEQA 1C3OA 3HVUA 1UZUA 4JBHA 4J7CA 4H4EA 2QTRA 4JB0A 3DBLB 3CRW1 5AKKA 3RSFA 2P2ZA 1PRYA 3G2HA 4G86A 3O91A 4YCDA 2OYRA 4DUPA 4HNRA 4EMBA 1K27A 3G23A 3NT5A 3O90A 1AKRA 1JKIA 2DSNA 2COUA 2BRUC 1HKHA 1WHTA 3ZQ4A 2WE7A 1NKSA 4HS9A 3LLSA 1DX6A 3Q3IA 4RGQA 3BD9A 1LXCA 2O8CB 2NU6A 2GPWA 4IUBS 3UF0A 5FUQA 3U3MA 3PFGA 3PUIA 2HPZA 3WIBA 4AAYA 2BM8A 4HRAA 4U4AA 3QTLA 1BXKA 3HL0A 5GINE 3QE0A 1WXHA 4G24A 4BJ1A 1CWUA 5F64A 1GCUA 1J7JA 1XRMA 2YIMA 3FCCA 3TIXB 4IIJA 5EWLB 5JI3E 2AKAB 3QHPA 2YWHA 4P7BA 3PV0A 2CV0A 3KLPX 1KAOA 5B4TA 4X97A 2VI5A 3MWLA 3HPQA 3U56A 2DHEA 2EKLA 5E8RA 4OMUA 2D00A 3AB3A 4LHWA 2EEPA 4EYEA 1VGVA 2EJBA 1K9VF 4JVNA 4XVQA 2G83A 3VX4A 5JDIC 4MSUA 3FYUB 3KOYA 5FOSA 2FZ5A 2QRHA 4ZGWA 1AA6A 4JN6B 3TZHA 2IXFA 2O23A 4TMYA 5EIOA 2IV2X 3KU1A 5AO9A 4J43A 4AO7A 2B4KA 1QWOA 4QYXA 1T29A 4TN1A 4IS2A 2XYVA 1Y6JA 1CDDA 1YR3A 2A1TS 4U02A 121PA 1NN3A 5I48A 5LD2C 4G4JA 4MVYA 3WIDA 1QG6A 4YACA 2X8BA 1DTSA 2GJ8A 1XTSA 3UT5A 1B8NA 3LX4A 5E2AA 1IJKA 4KRGA 4MS4B 1SEVA 3C45A 4RVGA 3UFXA 1HORA 3K09C 2CJWB 3CNBA 3QLJA 3Q72A 4AL4A 4E2XA 1YQQA 2ZU0C 3MIZA 3RTDA 3IV6A 3VV2A 4DR1B 3CKLA 3DF9A 4FYVA 1EE1A 4OP1A 4QNRA 4M88A 4YLEA 4ZZ0A 3GUUA 4DIUA 1M2GA 3DD1A 4R9UC 1OASA 1PVDA 4NG4A 3EGWA 2H7YA 2Q1TA 5DNDA 4OATA 1JHXA 3MN1A 3JQ9A 3IDAA 3TRKA 3UY4A 1ATZA 1US8A 1ZN9A 3ZWVA 4Y6QA 2FW9A 1CZKA 1ONNA 2BAGA 5DCLA 4DC9A 2PL9A 2H1IA 4CMBA 1KP9A 3U7JA 5JCOC 4LE1A 3QPWA 4P82A 4Y3UA 1IHPA 1M8PA 3BSFA 4DZRA 1KP2A 3IQEA 3ZX4A 2A3RA 2P5YA 2QYHA 4X8LA 4XGQA 1PJBA 1EDOA 2KQUA 5CVVA 5LZ8A 3WGVA 3IVGA 1R4MB 3A6JA 3GZNB 3N76A 4MPPA 1M2VB 2ZRAA 1Z34A 4O5AA 4P84A 5ALTA 1M6WA 4AMGA 4DXHA 3DZGA 3Q8XB 3HCDA 3EZLA 4BAGA 1DV2A 3WGUA 1OU0A 4RVCA 2P4SA 3GG2A 1ODSA 1R16A 4Z4IA 1L5MA 4K9QA 3UCFA 1YQWA 3DMGA 3GYGA 5BNFA 2F43A 1MDFA 3GMSA 5TMDA 5L6LB 3P2OA 1B0ZA 3EFOA 1XA3A 2QRZA 2EG5A 3KKKA 3GT4A 2BKVA 1QFYA 4EB8A 2YXNA 3JRNA 3EQ6A 4L4RA 4BN0A 1NMXA 5C3MA 3SSAA 1E2NA 3DO8A 1EHCA 2QU7A 1Z0UA 4C3UA 4EIWA 3NPMA 2ATVA 1EJ6A 2QAIA 4HEA1 5ULLA 4TLDA 4KE9A 1Z7BA 1H94A 2MU1A 3DWFA 5CFNA 5EHZA 2W37A 5TVKA 3PI6A 3HR4A 5E9JA 4KN6A 2KYRA 3PD1A 4QPNA 4B0OA 3GW8A 5JDCC 3T3MB 3B9BA 2BGIA 2WFZA 1VIAA 4IX9A 2PMBA 4ENRA 1LX7A 5K4HA 3IKJA 5G0VA 2WPDA 2HMSA 3ZZMA 4AMYA 3K9QO 3OKFA 1CXZA 3B7PA 4PO1A 2K4MA 2X2PA 2IKSA 5EMNA 4DPMA 4EHKA 2WU4A 1Q74A 2G80A 3NM6B 1ITZA 1J23A 2P6UA 2HWKA 1Z5GA 3I9FA 3RPEA 5DI9A 4DPKA 2DH6A 4B5KA 3ZKWA 5I7HA 3VSAA 3UBTA 3WYNA 1DBIA 3PHJA 5HUQA 3S2SA 4JL6A 5A2GA 2I6QA 2SHKA 3ELUA 3PJGA 3ZNNA 1BHSA 2CL0X 2BI8A 1L5FA 3AEYA 2EJUA 3B70A 3SOPA 3SXUB 3VV3A 1UKBA 1VSTA 4F4HA 2F00A 2OP1A 4DQUA 1PR2A 3CTMA 3G6KA 2YYYA 3EHDA 5JYCA 3RUFA 2O5VA 3ESRA 1G21A 5E1DA 3WGQA 3WFJA 4CM8B 2RE8A 2HYIC 1PYGA 3MCUA 4IDNA 5HPYB 2C2GA 3FF4A 3RDPA 5G0UA 1FLAA 5HUJA 3V34A 4Y1EA 1YSCA 4O2BA 3AUTA 1IHDA 1YR1A 5CNJA 1UPTA 5A3SA 2ODEA 3SZGA 1JDSA 3WK8A 2QP3A 1Z18A 2PYIA 2UYYA 1LRKA 3O82A 4FXOA 4AJPA 1D1QA 5GJWC 3FPLA 3RJTA 4BEBA 2A7XA 3RFCA 1G5FA 1C0LA 1K89A 2O7RA 2Z6QA 3S44A 1KAGA 2VP0A 1G9XA 1PZFA 1X38A 3ND9A 1C81A 4Q1AA 4BZZA 3TG8A 3GCDA 5JH7F 1C1DB 1F38A 2YVAA 1DFIA 1ZM2A 1QSGA 4NJMB 1YRAA 4BMDA 3CN7A 5K2OA 1U2ZA 1V6AA 2FF5A 6ADHA 4H1HA 3CG0A 3IR7A 3RANA 2NP7A 4FWTA 4I1SA 1BJTA 2Q2QA 4CNBA 2RD2A 3RRXA 1Y3BE 5FEUA 1IIRA 5MHTA 4YB8A 3EE6A 1H65A 1JR4A 1VFPA 2NOAA 3I52A 3L82B 4OAQA 4R2XA 3W3ZB 3ZOKA 2ZZMA 5BYBA 4QL3A 3OJOA 1QH1B 1U8AA 4NSNA 1EI9A 2A4KA 4YP5A 5DYNA 1XJ5A 1J5PA 1FP4A 5TEVA 1U0NA 1VFNA 1E1LA 1MAHA 2J5XA 3HMKA 2NZUG 3OX4A 5HYVA 2XNJA 2Y2UA 3LUAA 4EB0A 1JMVA 1Q1GA 3LBIA 3DLAA 4OFZA 4G0UA 2Q8NA 1NF8A 2UUCB 3QUAA 3M6IA 3V3KA 4KK4A 4MMXB 3TE7A 3IQFA 3H16A 1AKVA 5L4LA 3AG6A 3CPEA 4MYTA 4QLBA 1XU7A 4GQIA 3WK7A 5U4QA 5DO9A 1Y1RA 5DJ5A 2NVBA 4EO9A 2XRYA 2YHAA 1N6NA 3LVBA 2XB9A 2H0AA 1JG2A 4GYKA 4HN4B 1HQYE 1C0KA 4HB4A 2H17A 1Y1TA 1QHSA 4ZV7A 1KAEA 1JBQA 2Z3WA 1T1RA 3W06A 3LSYA 3D8NA 3E5HA 1X19A 5DNWA 2QMQA 2XLCA 3CZ4A 3D3WA 4ZDIA 2HCRA 2N1BA 4R4JA 1STOA 2JANA 1Q0ZA 2P5UA 3GJXC 4TV8F 5C37A 2PUFA 5T67A 1O6CA 1P0IA 2FETA 1L5QA 1UQRA 2JGRA 5IK2A 4YT8A 3RYIA 3HUFA 1ZXBA 4JI6B 1U6KA 1O94C 1XRLA 4BO2A 2C9MA 2VJNA 3P0HA 5KWIA 5CCBA 4D5GA 1EVYA 1D8TA 2CF6A 3K72B 2F48A 4LKOA 4TS4A 3OOEA 1AJEA 2W6ID 3JQ9C 4HWGA 2AL7A 2ZUVA 4OB6A 1WUYA 3OU6A 1YVDA 1GPJA 1ZUIA 4JI2B 2IYYA 5JQGB 3LA8A 1G17A 2WBLC 3C7AA 4UHKA 4YASA 1N5IA 4KHZA 3GJ5A 4YT5A 1Y5LA 3AJ9A 3UWPA 2PWAA 1AMUA 5AUOB 1FNDA 3X43A 5LMUB 3PL1A 3DR3A 3H4MA 3V4VB 1ESEA 4KMMA 2OXCA 4N7JA 4ZIRB 5EINA 3GUYA 1RTKA 1V5EA 3DFFA 3M4YA 2FMXA 3KKZA 3RTGA 4ZAVA 3I1YA 1AK2A 4MV0A 2WQ6A 1PLJA 1D7AA 3A2LA 3PHHA 3TGWA 4B47A 4D7AA 1C7JA 1XCPA 3M1AA 4GHWA 3GLGA 2C59A 1KU0A 3M4NA 2R1TA 2XECA 2ZJ2A 4KBFA 5TQ0A 2VDNB 3H4VA 3UJ9A 4EG3A 1JQBA 1T9HA 3OEED 5D7NA 4KODA 4PQGA 4EW2A 1Q7EA 2IV7A 2XUFA 3SAJA 3WNZA 2ECKA 2P0EA 3N2KB 2GDJA 1NRWA 3ZCPA 4DWVA 1BWQA 5M04A 4AJ2A 5JZSA 3HN2A 3DW3X 4O4IB 4Z86A 2WTAA 1KVUA 4MIEA 5EPUA 3RG2A 1BQ3A 1PNRA 5FL7D 2J0VA 2M32A 1JEYB 1QHXA 4L8VA 1KVTA 1GV0A 1XEWY 2PSHA 2AK3A 1GJRA 3BF7A 3IAM6 2A0WA 3IQIX 1Y8QB 4GIBA 4K6GA 4LWZA 4DA6A 1Q57A 4HGNA 3GD5A 5I7OA 5B2FA 4UTOA 2I87A 1A95A 1CRZA 3DTVD 3OJXA 4RK4A 1KXJA 4EG5A 1BEUB 1W36C 3RK0A 1E6MA 5L4NA 2P1ZA 4EPTA 3N2EA 4JC8A 3ZEAA 2NZYA 4ERNA 1SBNE 5CDSA 3MTQA 1O4WA 3DTVB 4MEJA 2GKSA 3HA5A 1T2VA 1UKAA 1PFKA 1VLMA 3CF0A 2H31A 3QXCA 3ZHUA 4YH1A 3QPUA 1Q0PA 1BIFA 4J8PA 1YRQA 1Z28A 3V8EA 2AKEA 1EHYA 3O9VA 1ZCJA 1QYWA 1CE8B 2DUNA 1M0TA 2HHJA 2YVUA 4YJ3B 1ID1A 4AF7A 2GPAA 1T6BY 3BCHA 1EFCA 2PZAA 1NU6A 5EKXA 3UWDA 2QENA 1CULC 4L95C 4M8LA 3G8YA 1W94A 2O1XA 4D81A 3QJ5A 3ED1A 4Y1GA 1K5GA 1KYWA 1EK6A 2X0FA 2A58A 1UXJA 4I66A 2IS4A 2CDRA 3SGLA 5KYXB 4KFUA 4RTQA 4ZVOA 3O8RA 1NV8A 2VSNA 3EA0A 5HZMA 3WYDA 4INAA 2YY7A 1DG3A 4GQAA 5DTRA 2GD1O 4I6GA 3OQNA 1QONA 2R7NA 2W6JA 3DFUA 3OPQA 5E4JA 1KI3A 5I3ZA 4JYCA 3W9YA 4Q4HB 1H8ED 5J59A 4ZAGA 2BMJA 3I0MA 3WK9A 2FEKA 5AJUA 1OX4B 2CFRA 1QQ7A 5C18A 1FYXA 3C3MA 5CLQA 2HPAA 3HABA 4C03A 4P4UA 5BV0A 3FOEC 5IVHA 2J5KA 3ZEIA 1RWQA 1F8YA 5E0OA 2FPMA 1HYHA 5FWXB 1HDZA 4CF6A 1MORA 4ZYTA 1X2EA 3PUWA 3PBKA 2DWPA 2V7XA 2ZYDA 3F8TA 4OYYA 1CFZA 2YIJA 2Z98A 2PFGA 4XM2A 2F1KA 3H17A 1QLWA 4LX8A 2QSYA 5LP6C 4CIDA 4ZJYA 1VECA 2WMYA 3DUFA 3GPCA 3ODGA 2BLNA 1RWKA 5EUCA 1W49A 3BHNA 1PYDA 2GZDA 2D1YA 2LXNA 2IZ5A 2FA9A 1M5UA 4TKMA 2JLRA 3DBRA 4A6DA 4Q4JA 3PJEA 1K6EA 3R7LA 2YV5A 1EFRD 3WGGA 3WGMA 1TU3A 1UAAA 2FB9A 5EJFA 2ZAMA 1FNMA 4L85A 3PIRA 4B4VA 3OZBA 3MBIA 4LIPD 4PO8A 2NSJA 3X1MA 1JDZA 1U4NA 2Z0MA 3CNLA 1NXWA 2DBQA 4N48A 5GPBA 1A2BA 2FSSA 3PB3A 4C05A 5CDYA 4UVHA 4PFSA 5GTDA 2PD3A 3WDMA 2OCDA 4ZHQA 4N76A 1V3VA 3N8GA 3SR4A 3DBLA 2UUBB 3LK6A 3PPVA 1F48A 1JR3A 3ABZA 4RDIA 4DUGD 2WP0A 2JGKA 1H4QA 4YV0A 3LU1A 1ZJZA 2AFVA 4W1RA 3U39A 3DBVO 2AZTA 4IVNA 4RE6A 2F8MA 5T3UA 2IP2A 3QKWA 2PYDA 3CB2A 2ZI5A 3WBFA 3ZIUA 4EG7A 4ZCLA 2HSEA 2PT7A 1CERA 3ORRA 1FVFA 2OGUA 3S2FA 5EP4A 3CF2A 1E9VA 1GGHA 1IHOA 3L79A 3VVBA 3CS3A 1H8HD 4LYEA 1FRNA 3HEMA 2E48A 4GPBA 4HQOA 3RSOA 4RHUA 3WRYC 2HJWA 4E46A 5LR6A 1V71A 4RCVA 4UAJA 4S1OA 1W5BA 1KK2A 3HU1A 4FCCA 4PN7A 4COKA 3DGFC 1KJ9A 1VB5A 3L4SO 2NM0A 1OPRA 3P26A 4EJ6A 5B7PA 4CL0A 1H1LB 1VIVA 3P2KA 5LUAA 3OKPA 1W4AA 1T6XA 5FFMA 1GQ2A 1HDYA 1JYFA 1XELA 2BHNA 2WC1A 5ITWA 1MZVA 5CA1A 1B1AA 5I4IA 3DEHA 1ZK1A 1P17A 1JYSA 2ACWA 4CLEA 2LUOA 3HU5A 3P97A 5COBA 3TFOA 221PA 2OAP1 3ZVNA 4PHCA 4D4MA 4F38A 3IGFA 1E5QA 4WJZA 3OM1A 3QW2A 3G02A 2O3QA 4LPKA 1MNQA 1P0QA 2YN4A 3CU5A 3LUDA 1PQUA 4W8GA 5B1DA 3K3PA 1I3CA 1ADYA 3E9NA 2BMWA 2BSQA 1NF9A 4L8LA 1RHMA 1YZYA 1E4VA 3ISTA 2GZRA 3LUJA 5DTEA 3O8NA 3I2FA 3I2IA 4PV7A 1W4BA 2H9AA 2I2CA 3UQZA 1FQOA 3CLTC 3CEPB 3H75A 3QIVA 1GKUB 3ESZA 5CX1B 3TMKA 3F4LA 1L4MA 2AUNA 4URXR 1YIDA 3CEMA 4C1BA 1GNQA 2QMHA 3ICVA 3UJ7A 2OTCA 1FEZA 4DG5A 5IYZF 4Z4GA 2XKAA 4JITA 2D8MA 4YP7A 2EAUA 2B0CA 4RK7A 1Y8RA 3T3PB 3TSWA 3WI7A 4F3YA 4HBGA 1I33A 4P33A 3ANYB 1XNGA 5FWDA 3Q2KA 5PGMA 2I6GA 1H93A 1HRDA 4MCAA 1XMOB 4FGKA 3SJAA 1H69A 1S0UA 1I32A 3FPJA 2VWHA 1IYZA 3H4IA 1JKFA 2GX6A 4G5HA 3HY4A 4CMKA 1GG8A 4LE0A 4LQLA 3KALA 4RKEA 2PR7A 4RL6A 1ZOLA 2ZSUA 2QN9A 4KN9S 4QAQA 4G0OA 2ZUFA 4JYMA 3AVXA 1W47A 1TYEB 1M8KA 5HK9A 2R68A 2VHJA 5AIAA 1L7MA 3T54A 4QT4A 1D4ZA 4NAUA 1ZNQO 4WBSA 2GBPA 3LPMA 1A9YA 1YZTA 3A37A 3K31A 3GZNA 3HYSA 3OOYA 4UTZA 4EAAA 4EA7A 3OY2A 5FTKA 3CGWA 1QGUB 1T3ZA 4S1TA 3V7WA 3ZZTA 3NBKA 1XU9A 1QU2A 4MI3A 3WGYA 1RTTA 4WGGA 4K6FA 4BMZA 3D0KA 5JBQA 3K73O 3KJIA 4MGEA 3IX7A 3I28A 2PGNA 1S2MA 3FSGA 4CM7A 4R0MA 4RF4A 1EFVA 2B9EA 3TNDA 4G6ZA 2WMNB 1NRJB 4O4LB 4WL0A 1JH9A 4JJAA 1WETA 4QGFA 5LDGA 2BR3A 1DC8A 2OOKA 3EIUA 3RT9A 2X76A 3MQ2A 2IEGA 1E6CA 1SG0A 3DZKA 3L92A 3O8LA 1L7BA 4LOIA 4NQRA 3VPDA 4DSNA 1SXPA 2QT0A 4QHYA 1SBIA 4GX1A 3PLRA 3LQ1A 3TLZA 1AUVA 4HAZA 4U0KA 1HT0A 3I01A 3RRBA 4UULA 1VKNA 3VZBA 5LWQA 3L2OB 1E8DA 4R9SA 3ZQJA 1P0PA 5EOVA 1XMQB 1WLSA 1NI3A 1EVJA 4CHGA 1G98A 1M2EA 5E4YA 4F1KA 4LGCA 4EI7A 1NBOA 4FYXA 2PUCA 1G60A 2OHHA 4W5JA 3WMRA 2ZUTA 5AUPB 2QT1A 4NP6A 3FOBA 4YJDA 3G6WA 4B17A 1G9TA 1AGNA 3GGGA 1K0FA 5LIRA 1ADJA 1Z17A 4CNQA 4HDOB 1FDVA 3Q5GA 3P32A 3WO1A 3A6PC 1SA0A 5ESDA 3E3MA 2Z3ZA 1Z5VA 4LUCA 2XUGA 4QYIA 1SURA 2BEVA 2QMZA 5JE8A 2VQ3A 3S1AB 2F1HA 4HDKB 3VYVA 5C32A 1FQWA 3SU8A 3ORFA 3RC9A 2GVDC 1D2NA 3DDCA 3UMSA 3WK6A 1R8YA 1UWCA 4U3JB 4WN9B 1QK3A 4C4TA 1L7VC 3I23A 4Y67A 5LPNA 4KRFA 1C7FA 1LPPA 2FR8A 4ZCRA 4YFYA 1V3TA 3BZUA 1T35A 1PF7E 4NX2A 4CR7A 2Q6VA 3UPTA 5JZOA 1YS1X 4ENWA 2VKQA 4J49A 2PZ8A 1T36A 5TX7A 3H5IA 3VI4B 2YQ4A 3IAS1 5IVDA 2XMCA 3VDNB 4NU6A 3GP5A 5EQFA 2FDRA 3V1YA 3A1VA 4MYSA 4EO4A 3FSEA 2DQKA 1PQWA 2NXJA 3KQMA 4GU5A 4EY4A 4F9GA 5JAPA 1EIWA 1DB3A 3KCNA 4M4SA 2XUKA 3QENA 1AV7A 4PG8A 4FHFA 4LHSA 3ZK9A 3HCRA 1WUIS 4KK3A 5JFOA 4W5OA 4U2KA 1W4LA 2H18A 3NS7A 2OFPA 3ZDDA 3P5SA 1K7YA 1X0VA 2VSFA 4YYEA 1ZZEA 2C9DA 2Q6KA 3ZWKA 2JK1A 4OGKA 4AN4A 4UXIA 4BBPA 3UXHA 4IFEA 4WBNB 1KH2A 1Y6RA 1VG8A 1DXQA 1P2VA 2G17A 2Q4OA 4JHLA 3T4XA 5IKMA 3KQPA 4UBIA 2CT8A 1Y1LA 1ODTC 1XPJA 3DC7A 2IVFA 3RS4A 2N1MA 1HFJA 1DWQA 3ANLA 3TTTA 1AGXA 3VC3A 2Y1XA 3IAAA 1HDGO 3VR3A 2Y9PB 1JILA 2A9OA 2PSSA 1JA9A 3NI2A 4YV1A 1TTTA 3MINB 3QPDA 5K3DA 3UJHA 4HKTA 2O3UA 3FYUC 3S5JA 2A8YA 4TWAA 2PIDA 4OSEA 1N5LA 3CF4G 3NKFA 3UMJA 4ZDKA 1VXRA 4E5MA 4KP7A 2IYLD 3KT6A 3EZ2A 1XZEA 2X0JA 1SCJA 5HZGA 2QPOA 1OD6A 1C41A 3QM1A 2GA9A 2YOFA 4HDAA 4BYMA 4O2AB 4V0SA 3INTA 4BLRA 3MCTA 1RADA 3P4XA 3W8EA 1L4UA 2R5FA 1FTWA 3IDQA 3MJCA 3NAZA 1QVAA 1Q0LA 1UPXA 5DYIA 5A4IS 3V1LA 3OE7A 3OP4A 1AGRA 2B20A 3QE4A 5DGHA 3VHXB 2QBYB 1PR6A 3JAKB 1PJQA 5GADl 2O2HA 5H8WA 3ICWA 1JPUA 3ZXIA 2PGOA 2GFIA 2PSFA 4D8XA 4EF6A 3DQPA 4CIAA 5IVPA 2R0QC 4B2LA 1T13A 5FO0A 2I4NA 5DM1A 1DAMA 3LGAA 2BBSA 2WHPB 4ZQCB 4Q05A 3DKRA 1WW3A 1JDBB 4ZXFA 1KE2A 4DSUA 4NDZA 5A0VA 3ZTYA 4E3ZA 3BMNB 1SOMA 4O02B 3K05A 2CHFA 4B87A 4ZCPA 1GTSA 1VL5A 2EWWA 3V80A 1KZ4A 2MSNA 2YICA 3WP0A 4P4SB 5LOVF 3MAJA 3VA7A 5CFZA 3D3JA 4KV7A 2JGNA 4HDRB 2IXGA 2O48X 1OT3A 2BMFA 1VL1A 2I29A 3DEJA 2A5DA 4ZI2A 3MT9A 3FZQA 4FZJA 3PC3A 4RMNA 1NC1A 1NMEA 1U8XX 2FZKA 1VBFA 4MO9A 5EERA 4EHBA 1GPNA 3DV0B 2QUKA 1YB2A 1ORDA 2ZZNA 1RXUA 1K7FB 4I4NA 4O4HA 4CKEB 1VXOA 3ESAA 3T9EA 1VA5A 4N18A 2VNIA 4N47A 2EIXA 1NJ6A 2PH1A 1JIIA 1EQAA 3DYIA 3GF4A 5KVAA 5LZ4A 1ELOA 1JHRA 2JHAA 2LVBA 2R8PA 3H5AA 1XRRA 3MYYA 4Y9DA 5G3YA 1TVCA 4F12A 1CUFA 4IQGA 5C5EA 4CGZA 3TTUA 4NVRA 1GQRA 2PY6A 1PGQA 2IHYA 4J0QA 3BEOA 3MWDB 3HEAA 4GE3A 2HQBA 4JJKA 3SZMA 1P4GA 3O3MB 3N2KA 5DNVA 1RS0A 1N4AA 1IY9A 2V7PA 3G49A 4IJMA 1KZHA 1FBTA 2JAUA 1VLHA 2BM0A 1NBAA 3ZHXA 1M33A 1AKQA 2LPMA 2ZTHA 3W05A 1BG6A 2QG6A 3A6DA 3D54D 3LT0A 4KLCA 3PCTA 2WMDA 4TXNA 1KI7A 3QVOA 1KMQA 2A9JA 2QMYA 2XEDA 2IH2A 9MHTA 2HMTA 1D2AA 1S9DA 3F1KA 4YRTA 5FL7A 1HI9A 2XKKA 3B1ZA 1DUSA 1QAMA 1Z9BA 2Y92A 5DISB 3UENA 4DL9A 5K01A 5K9ZA 5TNXA 1Z6XA 5LZ9A 5DM4A 4X84A 1OZHA 3KVRA 2A5FA 3D4NA 2BE7A 4AECA 2QLMA 2H59A 5C8YB 1A88A 1UXKA 1WABA 3ORYA 2O2DA 3DKIA 1YDMA 1ZVJA 1G0NA 2IEBA 4MUEA 4UTNA 5I9MA 4W7SA 3KWMA 2DLNA 1NBHA 1YZKA 1KYXA 2B4RO 5FJJA 1UCFA 2QX8A 5GOZA 1EBFA 2Z9BA 3RVKA 3WL5A 3FVVA 1WU8A 3SQOA 1KYQA 3H3JA 4HO1X 1F6WA 1VPTA 1DAOA 2HSWA 4HADA 4X20B 1LDGA 5BNTA 3IXMA 3QKTA 1F60A 2XODA 3BE4A 4LRWA 2IHTA 1CUHA 3R8XA 1EFAA 4IRMA 1QTIA 2POQX 5I47A 4Q4HA 2CXHA 5KOJB 2ZRMA 1AU9A 2QMOA 2P35A 2XQKA 4UU7A 5J2UB 2H1CA 2WFLB 1JFLA 2GYUA 3DS8A 1T8RA 4N0QA 2YJ3A 1YU6A 1RRMA 3A0UA 2A5JA 1I1QB 1ODCA 1W0JA 4QPZA 3RYCB 2VQEB 1HDRA 1NIJA 1XV5A 2ATCA 1IOLA 1UFOA 5JSHA 5P21A 1FQJA 2HIHA 1DJLA 1JA0A 3DE3X 5LMCA 2XQIA 2ZBGA 2P8SA 5J2TA 3AM3A 3OTHA 4O1HA 1Q6ZA 1KS2A 1XYVA 1U7DA 1W96A 1Y1SA 3U4MA 3RU2A 2I66A 3CT6A 5C7OO 5CTAA 5KDLA 3T5TA 4N65A 4XRRA 2EP8A 2VYND 3J7TA 1N6KA 1FYEA 3E9RA 3V8MA 3T1QA 4GXQA 1QH0A 2F2TA 2Z5FA 1F6BA 3RVBA 3O5AA 5KX5B 4JT9A 4X95A 3LG2A 1BXRB 2IBTA 1XVTA 3ASZA 4RPLA 1EFRA 2V96A 4PCUA 1E6WA 3EVCA 4IIJF 3H87A 2VDUE 4QOSA 5IXSA 1Z15A 4Z7JA 1P1HA 1W5EA 2F1JA 1FU7A 3QWBA 4NU0A 5EHXA 3DDSA 3RNOA 5BV1A 2YRXA 1AZWA 3SF8B 5IDQA 4CIVA 4UUQA 4C0WA 2CXNA 4KQWA 4UBNA 1S3SA 2P91A 1P2DA 2DBZA 2P30A 3OCWA 5AQEA 1ZX1A 1WBBA 3H2YA 2JRLA 2DTDA 5DVZA 5DGCA 3JALA 1RXSA 3GVIA 4F7DA 1YJCA 2FXVA 3TLAA 4EL5A 1D6MA 2JVKA 3AGPA 1QH8A 3KOZA 4J0KA 3IKLA 4UHEA 5CFRA 1IG3A 2XUJA 2ZWPA 3AJRA 3IJEB 3ZCRA 5EPEA 1Z06A 3ZJUA 2EIHA 2OBBA 4FPXA 5F1PA 4RTPA 2DP4E 1QIDA 4ZTUB 3T9CA 4ZMBA 1H8HA 1KY3A 1E58A 1TZ2A 1U3DA 4XFKA 4CMJA 4BFCA 3CMCO 4E1AA 2WYOA 5KYGA 3E70C 3PR2B 2AZ4A 3EGDA 5E9WA 3I6MA 3PYMA 2PQ0A 3QVKA 4RFLA 5AKHA 1CQWA 2X9QA 3FYTA 3PXBA 5F5NA 5INTA 2QTBA 1NFFA 3BBPA 1G7SA 4LY3A 4LXXA 3GCZA 2RBKA 3NLLA 2B99A 1SUWA 4GYWA 4O2RA 5AJTA 5ADVA 2XX3A 1Y7TA 3QVJA 2G5PA 4PYQA 1V1RB 2WE8A 1KEVA 1MENA 4V0NA 2Y66A 2QTLA 5DASA 1PW5A 2VJPA 3HLTA 3NX4A 2V1UA 2RCNA 1BCRB 1U1GA 4RM2A 4CLHA 4HUQB 3UN1A 5C52B 1K68A 4N82A 1JDVA 1Z5OA 1O95A 2ZBDA 2MJLA 1C3XA 3SEAA 1YR2A 2GFHA 1XVLA 1NUHA 3AHIA 3K4QA 4UMVA 1IVNA 5IT5A 3R5HA 2GF2A 1MJ5A 5T7BA 4U7WA 3I62A 2HR1A 4JT2A 3EPLA 1FFDA 3FGNA 4ZVSA 1LDNA 1KI6B 1KVRA 2BOVA 3U9SA 2J4CA 3IQDB 1U2GC 1RKQA 1C7RA 4D44A 3IB3A 2NTVA 1YBHA 3RJZA 1AURA 3MRVA 4C5AA 4RJKA 2JW5A 4ZOQI 5LLTA 4E94A 4FU0A 4ASUD 5AJYA 3U61B 1PNTA 5AIBA 2PTHA 3SC6A 1PJ8A 6YASA 4P4TA 1WNFA 2QQ0A 2Z09A 4M98A 2PKEA 4MUIA 4RL4A 2C2KA 3C3AA 2E5FA 3I4FA 1GSHA 2GQ0A 4FYWA 4IJ6A 2GSWA 4G8JA 1ZU5A 4QX6A 1A5TA 2ZETA 1GGVA 2QRKA 2QPTA 3D2AA 2ONKA 2X8LA 3K70D 3L5OA 1YXMA 4R0VA 2JFQA 2CDAA 1LSOA 3T7DA 4GWKA 3BTUA 3B48A 2QUIA 1DJNA 1HO3A 4HDCA 5FPQA 5J5CA 3T1TA 4W5RA 5JSQA 3K70B 4WIAA 1S02A 4B3TB 5EE1A 3EXAA 5DM2A 4F11A 2JARA 1EG7A 2GDZA 3MFYA 3QVWA 4IHKA 3VKHA 3GZTB 4I3GA 4O4LA 3VPAA 2IE8A 3NATA 4DDVA 4DR6B 1CQIA 1KHHA 3DB1A 3MXTA 5G1OA 2H1LA 3M1YA 4KUHA 3L6UA 1VPDA 1HMPA 4TN5A 1LGYA 2LKCA 3QUSA 5KO2A 3W5BA 2KBFA 1KQ3A 2GCNA 3ZE9A 3E7FA 1S2OA 1XZQA 4EK9A 4PX3A 3T38A 3P20A 4PSUA 3EGXA 5CIQA 2V7UA 4KN8A 4D98A 1MC5A 2BYTA 4MZXA 5EMLA 1CQPA 4O2BF 1RAAA 5AK6A 4Z9FA 3DBOB 4BVHA 1FXSA 2FSPA 2O7NA 4NPAA 3O4GA 5FKJA 1OXTA 4IQ0A 4QVKA 3H6HA 4PPFA 1KGDA 2WU0A 1XOIA 3B3AA 1BW9A 4PLYA 3K0FB 3OC6A 2HU2A 3OHSX 3R4CA 2GEVA 5ALGA 1M0EA 1QF6A 1U8CB 2HDWA 1RBMA 3NYQA 1SG9A 2XTMA 3I5YA 4JYZA 5F78A 2X41A 3KD2A 3LQKA 4BQSA 3IKMB 1NVEA 3UH0A 1HURA 1U0JA 4Z2YA 3O8QB 3SJZA 4B71A 2BD0A 5FR2A 2LKDA 5HILA 4NLLA 5KMGB 5LP6F 3CRRA 2VNAA 1UBUS 2M6KA 3ZCTA 1ZCBA 1JAXA 1D6NA 3BM5A 3F6BX 1OAKA 1RYMA 4B3GA 1GT91 4WCDA 1XYGA 4E2FA 2HMAA 2YWCA 3A32A 4YRPA 5I7AA 3LH5A 1UJ4A 4NNOA 2JJ2A 3QF4A 4NICA 4NATA 3L4JA 3K35A 3RSGA 2FWRA 4CF4A 3PP8A 4WK0B 1QKKA 2HOQA 3V00A 3IPAA 4B4OA 2HHLA 3EN0A 3QG1A 2ARKA 2X4DA 1SQSA 1ZPDA 1JT9A 2LZ0A 1G5RA 1AKEA 1QDLB 3CN9A 3JSAA 1CLEA 3KKEA 4P08A 2SKEA 4U5QA 3G7UA 1T4CB 2ZOSA 1QYVA 2W11A 3QI2A 4E11A 5CM2Z 2VJYA 4PLCA 5IH7A 4UDNA 5DYGA 4ZVUA 3HWRA 1G63A 1NULA 1Q1EA 2JKZA 3NHMA 4P6VF 1HF3A 2J45A 4TVOA 4MKZA 3U7GA 3R41A 3QLUC 3PWSA 1INLA 1XI2A 2I3AA 1PFUA 4EKIA 3BK2A 4CCSA 1XWFA 3E7WA 3PQ6A 4M1KA 5C8XA 5A4AA 4MKXA 4KBYA 1JEQB 4JI3B 3OZAA 3FNHA 4XGRA 2P9HA 3MMNA 5DN9A 3PGVA 3RAFC 2QROA 5D6NA 3P96A 4KAXA 3STUA 3FH0A 4B46A 4U9UA 4KXWA 4PG6A 1D2CA 5T4FA 1M9NA 1NHWA 5AVKA 4BN4A 4E70A 4DTCA 4ER6A 3QWHA 1KI9A 4DLXA 3M6VA 2HA7A 2GSDA 3RRZA 2AFHE 2HHAA 1BMFA 4GYJA 2O5RA 3UG7A 3UAXA 2BMAA 1T34A 1PJ2A 1LDMA 2F1OA 3BWXA 3EGIA 3DOCA 1BD3A 1OZGA 3W34A 1N2EA 3L7MA 3NDJA 3QJGA 4M38A 1NWCA 1EWQA 4KH1A 3HYTA 1Q3TA 4EUEA 1Z12A 4D8VA 3O83A 1G8YA 3PENA 1WCWA 4WX2B 4F45A 1ZLXA 5KYNA 1E9BA 5E7JA 2UVPB 4JL8A 1QC5A 3TVTA 1T2CA 2IP1A 3ND6A 1WWKA 4U7JA 3A1FA 3VNSA 1EEHA 2WHPA 3OAAA 3LBNA 5NULA 3W6PA 5AVOA 3LJKA 2DPXA 2PXHA 4FWIB 4RHXA 5JY6A 3H1FA 3JQDA 1W0KD 4OY3A 3GIWA 2GBIA 1SKYE 2MYNA 2VAXA 1NVAA 3RLIA 3LC7O 1LBQA 2CD7A 5DN6D 1Y3DE 4XLLA 5IAAA 2OAGA 3FNQA 1TYCA 1HQDA 1YCGA 1BJRE 4FE3A 4H77A 2FU5C 1XTQA 3U3XA 5HZHA 3AF0A 3C3BA 4NRDA 2JFYA 1DHRA 2C07A 4Q4AB 3FYCA 4PGAA 4YC7A 3WWDA 4Q9IA 4CI0B 3C8ZA 3KCQA 3L7CA 1LTQA 1ISSA 4BE4A 3DAOA 5CD9A 2I9KA 1NSTA 2JPDA 4WESA 4OHCA 1O2DA 2CXTA 2FSFA 5GONB 4HRVA 2W00A 1YL5A 1QQTA 4I50B 4JMPA 4TTJA 5THXA 3OZXA 1WEHA 1LI5A 1S3FA 2F59A 1M7GA 4PYMA 5PNTA 4EJ0A 1XKLA 5L45A 3LA6A 2A9PA 1ZICA 3BMOA 2ONJA 3O8OA 4CFSA 1AUOA 3CUKA 5AXCA 3ND8A 3D6MA 5EJIA 2O0LA 2I6XA 1MQAA 4YAFA 5EMMA 4IDQA 1M8JA 3H2HA 3MJHA 2Y93A 3RRMA 4UFPA 4Q00A 3KQKA 4I55F 1VOTA 1FDTA 3RK1A 2C57A 3WFIA 1DEKA 3A70A 1YKGA 3H18A 3SZ3A 3DFIA 4PG4A 4XB1A 1EP2B 4B7UA 4ZCIA 4NYJR 1DFGA 4QDOA 1S2DA 3CVXA 2QF7A 1ZOPA 2PCJA 5FDFA 2VPIA 4UVIA 2WB4A 1E7SA 4X3PA 5CA0B 1WQ1R 1P4SA 1YS4A 4MI1A 2V4UA 5B4VA 1VQ1A 2ZIXB 1Z0FA 3K9GA 3NBFA 2OV1A 1LNSA 3FNRA 5FYQA 4FMCF 1UBFA 3TTXA 1F8FA 1MEOA 2EBFX 2AFHB 4AW9A 5KTNA 3P27A 3Q0EA 2E5WA 4WFJA 5JD4A 2G5TA 5EQDA 3ZDRA 4AZ3A 1U2TA 4NU8X 2WJ3A 3ROKA 3RABA 5HE9A 1XFAA 4PCLA 4R16A 2HRBA 5DGXA 3GVHA 2BKUA 4BO3A 2WWTA 2F67A 4OD0A 5MF6A 3GUHA 4EL0A 1OZAA 2EHJA 3D2BA 4MDFA 3A4TA 3C3JA 3OLCX 1I2BA 3THWB 4MQUA 1J2JA 4PZEA 4Q3NA 4GI5A 4RZXA 5EKSA 4EUNA 1LDEA 1QKIA 2QTAA 2GZSA 1UMBB 1V39A 4MB0A 4J1SA 3RGGA 4XQEA 1FA9A 4PZDA 5TPWB 2I7CA 3G9XA 2QM8A 4YJ2A 4PGHA 2WZDA 3RV3A 3LVRE 3PCXA 4FYPA 1KEEB 4U0JA 3TCKA 3FETA 3A3KA 3OCZA 4IF6A 3KPVA 3DYBA 1GNPA 5JCJA 1IZYA 2HJHA 5FYDA 1NAHA 4E0BA 1SKYB 3MD9A 4D3FA 4NMHA 1RBYA 3KJNA 1ORIA 1XNQB 2RAPA 5F33A 2R97A 4B9AA 2O3TA 2QG4A 2RAFA 2H2FA 3TTSA 2PMWB 3NOQA 2OESA 1EJ2A 3CBQA 1BVRA 3QKRB 5L3QA 2PUDA 1SULA 4QBHA 1E9CA 2G9RA 2B35A 1N7HA 1CC1S 3IT0A 4BBJA 4QXQA 1YVEI 3CH4B 2ZYIA 1HLPA 3HZOA 3N5KA 3Q7TA 5J1SB 1OXSC 4FP9A 4X93A 1WHSA 2AYYA 1J0EA 1TIPA 2PVSA 3JAWA 3K30A 4G1VA 4XDHA 3C6KA 1JB1A 3TCNA 2HIAA 3WBJA 3Q8MA 3DV2A 4ZMRA 3HZRA 1IQUA 4LFBB 3R5XA 4UPDA 3KQQA 5BN4B 3UAVA 4ZZIA 3OOJA 3I6YA 4F04A 2FMKA 4MTCA 4F3NA 5EAIA 4CG1A 5T3YA 1BXRA 2OBNA 1E2EA 3BIJA 3KVYA 3M3HA 2I4LA 4FQ8A 5F1KA 4B33A 2X40A 3SLRA 4LV5B 2IEIA 3WWEA 5IMBA 3FOFC 4JLNA 2GRAA 3Q1LA 3FIJA 3QVLA 2I3BA 1J09A 2DBRA 4FEGA 4H6VA 4LG1A 3LL7A 3LY5A 3DKKA 4Y8VA 2AOTA 2YY5A 5B7QA 5CA1F 3EY9A 3MERA 4XJSA 4YRGA 3KTAA 3W5UA 2AC2A 4QXPA 2ZSIA 4TL6A 2ZI9A 4BNKA 3WA7A 1JU4A 3C87A 5BWOA 2ZIZA 3CVWA 4QDTA 2G07A 4BL5A 5ERYA 1ST2A 3LT2A 5C7YA 4YJHA 5IEJA 1UM9B 5HVNA 4EP1A 2V0NA 3OF3A 4KN5A 4LF5B 1X39A 2HF7A 2JHFA 4IDPA 3E6AA 5T8KA 1EVZA 2ZI3A 1E1MA 2OWEA 1XO1A 1QV9A 3IDFA 3IJRA 4U2EA 1YJBA 5CBPA 1J5EB 3W1EA 4YRMA 3COSA 1V4NA 3T0IA 4YMSA 4CCYB 3AETA 5DCWA 2HSJA 2RHJA 2VWPA 2IYRA 4M0CA 2WJZB 3HDYA 3SYRA 3EC7A 3M6WA 3NHBA 3UKJA 5CB0A 1JDBC 5F9MA 2GTHA 3PD7A 1KE1A 2VBGA 3RAGA 3OT1B 3WNBA 3WQRA 2DJIA 2VPZA 3FVQA 3H8VA 4H18A 4AICA 2QVBA 4G5QA 4ND3A 4MRSA 1KDYA 5ALOA 5JV5A 1E2QA 4DEXA 2VL7A 4WNYA 1QRSA 4H35A 1ABEA 4X7BA 4YDRA 2E7ZA 5C35A 1YUBA 3OE1A 2J1LA 1IZ0A 1TKCA 5TY0A 3DTTA 3MCWA 5F3WB 1HUQA 3PXAA 1QV7A 4QUGA 4HWPA 3A4LA 1OIWA 4OA5A 4F6RB 5IULC 5J5VA 4RTLA 1GD1O 4XIFA 1LI7A 4D9KA 2H4JA 1N2GA 1XR3A 2Q5LA 2WWHA 3TW8A 4ETWA 3EF0A 2JFZA 3E9MA 3TJMA 2MWMA 4X54A 1A7JA 1VKJA 1KBQA 3V2GA 1UDRA 3UNXA 1H2EA 5LZ2A 2AOUA 1E0SA 1G20B 2X42A 3IAHA 3M2PA 3ETJA 4KXMA 3MWJA 5CUQA 3TDKA 3WB9A 3WHLA 3GJYA 2VAVA 3JARB 3W5HA 2JEYA 3EEBA 3FCYA 1KC3A 4JLOA 5FI1B 3NHFA 3NVDA 4QDUA 5G53C 3ZU3A 3KYCB 1BN7A 3TEJA 3ZWAA 1U8FO 2XWJI 1RABA 1TA0A 1DINA 1VHWA 1OB2A 4X7MA 4WNAA 5FNVA 3H5VA 2OO5C 1A4IA 1JIXA 4PYOA 3W2EA 3ZXUB 3H1GA 3P0IA 3FFWA 1QHEA 3AW8A 4G41A 2WSMA 2ZRKA 4HXGA 3QEMB 4MVJE 1PJCA 2GNOA 2R6GA 3CURA 4MJ7A 4QFMA 4RVUA 3U40A 2YXDA 4V39A 3K9WA 4R2MA 2VH1A 1GTRA 1DL5A 3IULA 4DRYA 3WLKX 2PU5A 3ZNPA 2IEDA 3KJQA 4AO8A 1OA0A 1KJIA 3I01M 1R6AA 3DC2A 1LVGA 3PC8A 1MPTA 1D2RA 4FOPA 1DHTA 4JI5B 1J2RA 3TQTA 1E1QD 4K26A 3U62A 2WOJA 3EC1A 4ROTA 5DDIP 8AT1A 1FJXA 4BPBA 3EIWA 4A92A 4DG8A 1CHDA 2F64A 3K8YA 3MJFA 2CJFA 3BSSA 3GJZA 5CT9A 3SHVA 4BEJA 3KQLA 2PZKA 2FP3A 2DPYA 2FPIA 3CX3A 4IOLA 5CURA 1MW8X 1G1MA 5LQAA 4F72A 4DB4A 4HUJA 1V8BA 1XJQA 3N75A 3OQ1A 4X1YB 2Q50A 3UIEA 3TQRA 4UZSA 4LYGA 1N32B 1U3VA 4ZMSA 1AO3A 4OSOA 4ZU3A 3DUWA 4J6EA 1NYLA 3G5TA 1P18A 3B9QA 3GWGA 5CJ2A 1A4XA 4DNXA 1FZQA 1DEOA 1PLLA 5GVSA 1P45A 1JHPA 1FFBA 3QXGA 4G3XA 4MQ5A 4X7PA 1X7WB 4AJKA 5I51A 1L5SA 1V2HE 1NI5A 2L42A 3FRIA 4BVFA 5HWSA 4GR9A 3ITDA 3DEZA 1Q44A 3R6DA 1VKRA 3E3LA 4MR7A 4G97A 4KQ1A 4L74A 4MVJH 3SEFA 2KBEA 4GGMX 2VBCA 1D0VA 3GUVA 2W93A 3K0HA 1SOUA 2UYOA 4HGQA 3SBDA 2C0CA 3M89A 2WV9A 4IG9A 1JF8A 2RGNA 2NAPA 1CR4A 4XQGA 2YW2A 2IHJA 3RFUA 4B7ZA 4FYKA 4YDHB 2W2OA 2BEKA 4WXRA 3K92A 2R6HA 1T1GA 3S8EA 4RH0A 1C0IA 2CJXA 5JNSA 4K0KB 1SCIA 2PGAA 5IZCA 2DMRA 3PF8A 1VPWA 3ONVA 4XDYA 5IJ0B 4AUEA 1NVVR 1SUPA 1KY5A 1RQPA 1ND5A 2RHTA 5IEBA 4QU0A 5EZQA 3TRJA 2I71A 4OHUA 1I0ZA 1GGMA 3AM4A 1RLJA 5AKIA 4CN9A 2XYQA 1C3LA 2Q99A 3GDOA 3K1AA 4OYHA 4ZQIA 3LPLA 3C3KA 1E3MA 4X3OA 2I8LA 1NZFA 3GV0A 2WSLA 3EPPA 1GCIA 1R0WA 1S8AA 2XQFA 3E4CA 3GEBA 1B6GA 4HLDA 4IOJA 4OQQA 5TT0A 5J4KA 4LDZA 3SLGA 3PRHA 1GPUA 2ZRHA 3IPXA 3LD9A 4LYAA 1F0YA 1MPXA 1QGDA 4KR9A 3V4PB 3JVUA 3TZQA 3WJAA 4PPYA 1PFGA 2JLSA 1TO1E 4A5OA 1Z75A 4J0GA 4C06A 2K2QB 1NVWQ 5LBUA 4DMUB 4XUEA 5LJIA 1ECPA 3IUBA 5TS3A 4FCWA 3WB1A 2ZR7A 4MPTA 4NYIR 3TNLA 3V5NA 3V4FA 1BE6A 4F3TA 4I8IA 3T35A 1GQFA 2PVPA 4WWHA 3D3QA 2PD4A 4NDAA 2I62A 3LP8A 1C9EA 4L5AA 3IOCA 2APJA 3O8CA 3H5LA 1P1IA 2ICAA 1WKVA 5KQLA 4HAXA 1FU8A 3VNRA 1LV7A 3MYRA 4EUHA 1PLKA 2VJLA 3DEAA 4RF5A 1VCHA 1VE1A 5AI4A 3PFBA 2BEUB 1T9BA 2D0PB 4JDPA 3I1JA 1QFSA 3NXKA 2AC4A 4QBGB 2RHWA 3HDJA 4DREA 5LNK1 3FCAA 3NALA 3UV7A 1VP3A 2R7KA 1DOAA 1GZUA 1ACMA 1K98A 2BEWB 1IPFA 3G2IA 1JKMA 4ZEWA 4S04A 2DUJA 3PUKA 4BNIA 4TXLA 1YMQA 1EEXB 1RZVA 3OQPA 4US0R 3IB6A 1CBUA 2BFDB 1H6DA 3LDAA 1L0BA 2ODBA 3GRAA 4P8RA 4S1WA 4KPUA 5K2MA 4PS0A 3RRYA 3TLMA 2YMMA 3O7WA 1JZTA 1UFKA 2XUAA 2QRGA 4FD2A 3UHPA 1CUYA 1Z82A 1BA3A 3A25A 4QUKA 5CM9C 5DHUA 3ROMA 4CWAA 4B44A 4DLVA 2IWHA 3Q6NA 4NHOA 2QN8A 2V7TA 2ZQZA 4R51A 1D5WA 2YFQA 1OLUB 2VRCD 3F6PA 3MK31 4ITVA 4A8PA 1CJCA 1OLSA 1V26A 1MB2A 4I4LA 5JQGF 2HLHA 3IP8A 5HGXA 5MFZA 4CFZA 4S35A 3M2TA 3RRFA 4S1PA 1A0OA 1D4AA 1DPFA 4KACA 3HCAA 4MR8A 4N5HX 4UUBA 1UXHA 5HXAA 1RACA 1P0MA 3FMGA 4GFDA 4ND2A 2VJDA 4B09A 5A5VA 1XD8A 2YN2A 4KVFA 2ZBEA 2ZP1A 1BKDR 2JA2A 3OIGA 3KFVA 3OF5A 3JQFC 4O4HF 1SU6A 1UWKA 3DMDA 3IIEA 2O3SA 2R66A 3WGKA 2CE2X 4UARA 1N36B 3BK7A 2WJHA 4DLAA 3VKVA 3L4BA 4LCJA 4UNQA 2MINA 2PX0A 2ZBQA 1QCZA 2YV3A 3SZRA 1DV1A 1WV0A 1T9KA 2WVJA 3TQCA 4F3KA 4YPOA 2H1OA 1G4HA 5ELLA 1FFYA 3B6IA 3RD5A 4RUKA 4DLRA 1IPHA 1ZJ6A 1TJ3A 2V3VA 3D43A 1ODLA 4G5GA 1W0KA 1GZ7A 2AN1A 3SK0A 1SCUA 1Q3KA 3MT0A 4BTLA 3CVYA 1ECLA 5DHRA 3SS8A 3VGJA 1OV4A 1EUDA 4PC7A 3NBQA 2I6UA 3BC1A 3P0RA 4ZOAA 4BOYA 4YCCA 2FUG6 4H6PA 3QX7A 4FDVA 4URVR 4KMSA 1L4BA 4PQYA 4CL3A 1HOTA 1X87A 3EQ2A 3KJEA 3VPXA 3D02A 2VTEA 3N8DA 3K70C 4M60A 1KKLA 5KKNB 4FGZA 2ZRNA 3BGOS 3WYAA 4QEDA 3AESB 3BOSA 1HRKA 1J20A 3RRJA 4ZAXA 1P6XA 4DUZB 5K09A 1L8LA 2FSVC 3AL3A 1P7WA 2HC9A 1JVSA 4QJ3A 1X13A 3KYIB 5HF5A 3ZW7A 7ABPA 1OWLA 1N2XA 2EFJA 4U6NA 1DX9A 1W4ZA 3KIPA 2C77A 1Y34E 2O8FB 4EKGA 2V97A 4EPRA 5JAZA 3TVYA 3I9V6 4N5NA 3INNA 1ZD2P 2NUPB 1IHXA 4PQEA 5TLSA 4GLLA 3VSDA 3ROPA 2TMKA 1XPOA 1E2IA 2C8LA 1C1XB 2Z2XA 2XA1A 1VA4A 1SVSA 3LQRA 4BZWA 5I4KA 1RYBA 1CY8A 1T3TA 2ZJYA 2AXEA 3HE3A 2QW0X 2F7SA 5D85A 1NQTA 2JVJA 3T15A 3DL7A 1M2FA 1XG5A 1HLFA 1FP1D 4UUMA 3UGTA 3VU8A 2Z57A 4TMFA 1USGA 1JHDA 4Y1RA 4BRUA 5M2QA 2OECA 4NENB 4EKNB 3UJAA 1UK9A 5ALKA 2Y0DA 2QT9A 2GZHA 3HXPA 1MTOA 2GM9A 3KRTA 5FUBA 2G7MC 3GRVA 3P19A 4D9FA 3FDXA 2YHIA 3BQ9A 3GHYA 1SRQA 4KMOA 5DW0A 3VTAA 4RJTA 3R8CA 3INYA 4RZSA 5ITZA 1NUQA 1UBCA 3EZ9A 1E4OA 1HZZA 4DR7B 1NN5A 1H0RA 3TQFA 1CSEE 1J8VA 3VDQA 5D6OA 1DC4A 3SZOA 4ENSA 3ZE7A 3BILA 1V0JA 5FBRB 4AY3A 4DV6B 3PVZA 1RQNA 2XT0A 3N74A 1R8QA 1QPZA 3DMTA 5ILQA 4F3CA 4R3NA 1JQAA 5J4HA 1SAYA 4CTMA 1YCHA 1KSFX 3EGCA 4ZREA 4N1AA 2VPXA 4BNZA 4J94A 1E2FA 5KQRA 1F2TA 4WH0A 3PWKA 1XL0A 3BMCA 1CUDA 3N28A 3CQ9A 4KDFA 2G1JA 2Y1OA 3LSTA 1V7PC 4KXFB 5BY2A 1KMMA 1OUMA 1XVAA 3QF7A 2OFWA 3RSSA 3R40A 2K6GA 4I4CA 4AJHA 3K32A 2C2BA 1L5VA 3LCVB 1VE5A 3QXXA 3GLRA 2FQXA 1YFZA 3HDGA 4AYWA 3WHKA 2YASA 3LWBA 1IB6A 2IW3A 3ETNA 4O3FA 1Z47A 3FD8A 2Q0HA 2XHZA 3FW1A 4IIVA 1XMIA 1GPBA 4L2IB 5HKBA 1NNUA 2I55A 3CG4A 5E2BA 1RVV1 4OXRA 5IFKA 1FUYB 5AP9A 1SBQA 1CR1A 4HVLA 4ZXPA 1Z2PX 4FN5A 4LJ9A 4F5EA 4QUJA 3GROA 4KO4S 1WSAA 2C5SA 2IIBA 1IL0A 3AEKA 4C4YA 4KQ9A 3UB2A 2P5SA 2HA6A 5E1OA 3T1OA 1ZRSA 3HRHA 4Y9RA 4FDLA 5FI5A 5FOTA 5KQMA 3HUTA 1BQ4A 4BQRA 1D7OA 1D2GA 3LTEA 1IY2A 1RBZA 3NTRA 4JBWA 1F2DA 1GOTA 1X2BA 3LBAA 4RK6A 4AC9A 4F84A 1VBNA 5AKGA 3A58B 5KYWA 1E7WA