2LBSB

Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with aagu tetraloop hairpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (32-MER)
publication title Structure of a Yeast RNase III dsRBD Complex with a Noncanonical RNA Substrate Provides New Insights into Binding Specificity of dsRBDs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lbsB00
4JI4E 4X64E 4AQYE 4DV4E 1HNXE 4X65E 3C4TA 2UUBE 2UUAE 3J7Yp 4DKKA 4LF7E 4YY3E 4JI6E 4LFAE 1T4LB 1GQEA 1WHQA 4LFBE 4DV0E 2N3HA 2EZ6A 2LTRA 2UXBE 2LTSA 1N34E 1IBKE 1FKAE 2UUCE 4LF9E 4LF5E 1J26A 4DR4E 2B3TB 2RS6A 4DR6E 1FJGE 2CPNA 4DV2E 2DB2A 2NA2A 2IHR1 4LF4E 2UU9E 4X8WA 3OTOE 5LMNE 4WFTA 1RC7A 4B3RE 3ADJA 4KHPE 2RTXA 2MDRA 4GKJE 2L2NA 4DV6E 1UHZA 4WYQB 2DMYA 1QU6A 3HTXA 1STUA 1UILA 3P1XA 3T1HE 1N36E 1N32E 3ADGA 4DV3E 1YZ9A 3C4BA 2KHXA 2LRSA 4DV1E 2UXDE 2YT4A 3T1YE 1XMQE 2B7TA 2VQFE 5LMUE 1RQ0A 1X49A 2RS7A 2NUEA 4DR1E 4OX9E 3ADLA 2F4VE 2DIXA 4DV5E 2N3GA 4B3SE 1HNWE 1XNQE 2B7VA 2L2KB 4JV5E 2UXCE 1X47A 2L3JA 1T4OA 4JI2E 4NXNE 2NUGA 4X62E 3LLHA 2E5LE 1WHNA 2ZM6E 2LUPB 4M30A 2L3CA 1N33E 4JI3E 4DUZE 2VQEE 1HR0E 1IBLE 3ADIA 4DR2E 4B3TE 4M2ZA 4LF8E 2NUFA 1IBME 4DR3E 2LUQA 3VYYA 4JI0E 1HNZE 4YHHE 5CFFE 4NXME 1DI2A 4DUYE 1EKZA 4K0KE 1O0WA 1YYOA 2LJHA 5BR8E 2L33A 2L2MA 4X66E 1YYWA 2HHHE 4DR5E 4LFCE 4JI1E 1T4NA 4JYAE 4JI8E 2RSMA 2LBSB 1I94E 1J5EE 3VYXA 4JI5E 1ZBTA 4DR7E 1XMOE 4GKKE 4JI7E 2JY9A 4B3ME 4DV7E 1XNRE 1PKPA 4OOGC 5IWAE 2JVAA 1YYKA 4LF6E 1X48A
chains in the Genus database with same CATH superfamily
2A25A 2EPAA 2H36X 4Q28A 2EMGA 4X64E 3JTZA 5KL5A 4F9AB 4BC9A 1MEYC 2EE8A 2UUBE 1TF3A 3KZYA 1MGTA 4MLVA 4N4RB 1LLMC 4YY3E 2EN1A 4JI6E 4R2CA 1T4LB 1WHQA 1A1HA 3LMLA 2EOZA 2EM0A 3MHHC 1A1LA 2YSOA 2UUCE 2YSPA 2LCEA 2RS6A 4DR6E 2HGHA 1FJGE 4WXDA 4NHRA 1YFHA 2UU9E 4X8WA 5KL7A 3OTOE 1YSAC 4WFTA 1RC7A 4TUIA 2EMBA 5AC4A 1A1JA 2EPCA 2EOMA 2L2NA 4WYQB 2MDGA 2EPMX 2VF1A 3HTXA 1STUA 4BHCA 5A6KA 2EJ4A 4GZNC 3ADGA 4DV3E 5T6JA 2MKNA 5KL6A 2KHXA 2LRSA 4BHBA 4DV1E 2UXDE 2EPRA 2YT4A 1XMQE 4RHBB 4J8ZA 5LMUE 4GEQB 1RMDA 2YTOA 2NUEA 3HPSA 2MC6A 5KL3A 1SFEA 4DR1E 3ADLA 3BIDA 4DV5E 2YZTA 4B3SE 1HNWE 2UXCE 4NXNE 2L3JA 2NUGA 2EM2A 2EMLA 4F6MA 3LLHA 1AAYA 3AUZA 4RH8A 2LUPB 2ELYA 1N33E 3BF2A 2JWOA 4I8OA 2EPPA 3VK6A 1G2DC 2EPLX 1IBME 2LUQA 2YU8A 4JI0E 4YHHE 4NXME 3C6MA 2DLQA 5FLXC 2RSIA 3VHTB 4MLQA 2EM5A 1EKZA 2EM3A 2LJHA 2WZOA 4R2RA 2EOIA 1L4SA 5AC5A 3J7AG 2EMYA 3L00A 4LFCE 1PJQA 4JI1E 4R8OA 1T4NA 2V87A 4JI8E 3HPZA 1J5EE 2EN7A 2EOHA 4JI5E 5KL2A 2YRKA 4DR7E 2I13A 4Q35B 4GKKE 4WSPA 4B3ME 4DV7E 2EOOA 1P47A 3F6HA 4LF6E 1X48A 4R2DA 4JI4E 2DLKA 1YUIA 1GZ6A 4X65E 3C4TA 1IQSA 4ZYDA 2UUAE 2B9DA 1N3GA 2MC5A 5AE3A 1IQOA 2N3HA 2JR1A 4ZYEA 2LTRA 2WBTA 4ZYGA 1N34E 1IBKE 4DMIA 4O24A 2B3TB 2EM4A 2DRPA 4DV2E 2IHR1 2E1MA 5LMNE 2YTGA 2JOBA 4BC7A 2GLIA 2EMAA 4DV6E 1KJKA 2ENAA 2EMFA 2DMYA 1T39A 3IWCA 4HTGA 3BBGA 2EPOA 2LVHA 3T1HE 2YWQA 5DNYA 1UN6B 1N36E 2EPZA 4HEIA 2LMZA 1N32E 1DQ3A 2EL6A 2ELZA 5A6BA 3EPLA 2EL5A 2VQFE 1RQ0A 2EMZA 2V86A 1SR9A 2EN4A 2G7HA 1KYQA 2DIXA 2EN8A 1G2FC 5A69A 2LO3A 1T4OA 4JI2E 4O43A 2KOUA 2E5LE 1TN9A 2YRHA 1F2IG 4P78A 2YU5A 2L3CA 1A1GA 2EOSA 4JI3E 2EPNA 2YTIA 1HR0E 3QG5C 1X6EA 4R2PA 2YPNA 4M2ZA 2GPIA 1AH5A 2FTXB 2EWLA 3VYYA 5A2QC 2DGCA 2JP9A 3THOB 4DUYE 4LTYA 2BB8A 3C6KA 1TF6A 2EM9A 1GTKA 2L2MA 1YYWA 2HHHE 3EPJA 2LBSB 2YTFA 1ZBTA 2N8XA 5IT9C 2JY9A 3MHSC 3FIGA 2YTPA 2CT1A 2KONA 1UBDC 2LE2A 2EPKX 4BMJA 3H09A 4AQYE 1EH8A 1HNXE 2EMXA 1BBGA 2EN2A 2JOXA 1ZR9A 3J7Yp 2EPXA 4DKKA 4LF7E 2LT7A 3KZZA 4LFBE 4DV0E 3JAMC 2BBGA 2ODRC 2DSYA 4LF9E 1Z1BA 5AASA 4WXCA 2JYAA 2M9AA 2CTDA 2DB2A 2NA2A 1DGCA 4LF4E 3ECRA 4B3RE 3ADJA 4NZVA 2RTXA 1WXRA 4GKJE 2I9IA 1YUJA 2RQLA 1QU6A 2EOJA 5AE1A 2HC5A 3P1XA 2YTJA 2E72A 4O5GA 4BBYA 2WBUA 3M99B 3JU0A 3J81C 2EORA 1YZ9A 2NABA 2LV2A 2ENHA 3DF6A 3C4BA 2JXPA 4X9JA 2B7TA 4M0VA 1PJTA 1X49A 1ZU1A 1WRJA 2EL4A 2K7IA 4OX9E 4KWYA 2EPUA 1A1FA 2YRMA 4BS9A 1XNQE 1EH7A 4X62E 2GHFA 2MKDA 4LU9A 2DMIA 2ZM6E 4IJDA 4FK5C 2EMKA 4ZYHA 4DUZE 1ZAAC 4R2EA 3ADIA 2M4IA 4DR2E 2EP3A 4B3TE 4R2QA 4BCAA 2NUFA 2L6MA 4DR3E 2LJUA 3KWRA 3F6GA 4TUGA 2EQ3A 4K0KE 3THNA 2L33A 2V8QB 2WBSA 3AV0A 4X66E 4DR5E 4L8NA 1ZBQA 3VYXA 2EQ1A 1JK1A 2PRTA 5AE2A 4JI7E 4WX9A 4L5NC 1IMUA 2YTEA 2JPAA 2EMCA 1XNRE 2JVAA 1A1IA 3HXLA 2M1SA 4R2AA 2CSHA 4DV4E 3HQ1A 1PDAA 3EQ1A 4M9VC 2ADRA 2EQ0A 4LFAE 1NEIA 1GQEA 1EH6A 3UK3C 2WCC3 5IXMB 2EZ6A 2FGGA 3IWBA 2EMWA 2LTSA 2M7QA 2UXBE 1FKAE 1J26A 4LF5E 4DR4E 3MSWA 2V88A 3EPHA 3EPKA 2CPNA 4F9CB 1T38A 3IWDA 3RMPA 3ZOQB 2EM6A 2EM7A 2EM8A 4KHPE 2FV4B 2HJJA 2MDRA 2D9HA 5A6JA 2Q8UA 2RPCA 4WSGA 1UHZA 1UILA 5KL4A 4R2SA 2EOXA 1X6FA 1PJSA 1NCSA 4F2JC 2ENCA 3T1YE 1B69A 2RS7A 5LL6R 5ADZA 1QNTA 1WJPA 1YPNA 4O4KA 4F54A 2F4VE 4R03A 4F9BB 2N3GA 2B7VA 2L2KB 4IS1C 4JV5E 1X47A 2R76A 1BB8A 2L92A 1WHNA 2V89A 2EOEA 3DJWA 4M30A 2J7JA 2EMHA 2L8TA 2EOQA 2VQEE 4KZSA 1X6HA 1IBLE 1A1KA 2VE7C 3K6QA 2YTNA 4LF8E 5TSEA 3BGHA 2V83A 2EOYA 1HNZE 5CFFE 2EOFA 1BBOA 2EN6A 1DI2A 1X3CA 5A6BD 1O0WA 1YYOA 1JK2A 5BR8E 1X5WA 4P7DA 2YTDA 2R1FA 2EN3A 5A6AA 4JYAE 2RSMA 1I94E 2ODRD 2F8BA 4F6NA 5IV8B 1XMOE 2V85A 2EMIA 5F3WA 4WPYA 5LLQA 2YTQA 1PKPA 2K4VA 2VRDA 4OOGC 5IWAE 3J80C 3TQMA 1YYKA 3OMLA
chains in the Genus database with same CATH topology
2H36X 2LE2A 4Q28A 4JI4E 4BMJA 3H09A 4X64E 4AQYE 3JTZA 4DV4E 4F9AB 1HNXE 1GZ6A 4X65E 3C4TA 3HQ1A 4BC9A 2UUBE 2JOXA 2UUAE 2B9DA 3J7Yp 4DKKA 4LF7E 4YY3E 4JI6E 4LFAE 1T4LB 1GQEA 2MC5A 1WHQA 4LFBE 4DV0E 5AE3A 3JAMC 3LMLA 2N3HA 2JR1A 2EZ6A 2ODRC 2DSYA 2FGGA 2LTRA 2LTSA 3IWBA 2M7QA 1N34E 1IBKE 1FKAE 4DMIA 5AASA 2UUCE 4LF5E 4LF9E 1J26A 4DR4E 2B3TB 2RS6A 3MSWA 4DR6E 2V88A 1FJGE 2CPNA 4F9CB 4DV2E 2DB2A 2NA2A 2IHR1 4LF4E 3IWDA 2UU9E 4X8WA 3OTOE 2E1MA 5LMNE 4WFTA 1RC7A 3RMPA 4TUIA 4B3RE 3ZOQB 2JOBA 3ADJA 4KHPE 2FV4B 2RTXA 4BC7A 2MDRA 1WXRA 4GKJE 2L2NA 4DV6E 1UHZA 4WYQB 2DMYA 1QU6A 2VF1A 3IWCA 5AE1A 3HTXA 1STUA 1UILA 3P1XA 3T1HE 4BBYA 5DNYA 3JU0A 1N36E 2LMZA 3J81C 3ADGA 4DV3E 1N32E 1YZ9A 3OMLA 5T6JA 1DQ3A 3DF6A 3C4BA 2KHXA 2LRSA 4DV1E 2UXDE 2YT4A 3T1YE 1XMQE 2B7TA 4J8ZA 4M0VA 2VQFE 5LMUE 4GEQB 1RQ0A 2V86A 1X49A 2RS7A 5LL6R 1SR9A 2G7HA 3HPSA 2NUEA 2MC6A 5ADZA 4F54A 4DR1E 4OX9E 3ADLA 2F4VE 2DIXA 4DV5E 2YZTA 4R03A 4BS9A 4F9BB 2N3GA 4B3SE 1HNWE 1XNQE 2B7VA 2L2KB 4JV5E 2UXCE 1X47A 2L3JA 1T4OA 2L92A 4JI2E 4NXNE 2KOUA 4X62E 2NUGA 3LLHA 2E5LE 3AUZA 1WHNA 4LU9A 2ZM6E 2V89A 3DJWA 2LUPB 4M30A 2UXBE 4P78A 2L3CA 1N33E 2L8TA 4DUZE 4JI3E 2VQEE 2JWOA 4I8OA 4KZSA 1IBLE 2M4IA 3VK6A 1HR0E 3ADIA 4DR2E 2VE7C 3K6QA 4B3TE 4M2ZA 4LF8E 4BCAA 1IBME 2NUFA 2L6MA 2FTXB 2LUQA 2EWLA 3VYYA 4DR3E 2V83A 1HNZE 4JI0E 5A2QC 4YHHE 5CFFE 4NXME 5FLXC 3KWRA 1DI2A 4DUYE 3F6GA 4TUGA 1EKZA 4LTYA 4K0KE 1O0WA 1YYOA 2LJHA 2WZOA 5BR8E 2L33A 2V8QB 3AV0A 3J7AG 2L2MA 4P7DA 4X66E 1YYWA 2HHHE 4LF6E 4DR5E 4LFCE 4JI1E 4R8OA 1T4NA 2V87A 4JI8E 4L8NA 4JYAE 2RSMA 1X48A 2LBSB 1I94E 3HPZA 2ODRD 2F8BA 1ZBQA 1J5EE 3VYXA 4JI5E 1ZBTA 4DR7E 5AE2A 1XMOE 2V85A 4GKKE 4JI7E 5IT9C 2JY9A 4WSPA 4WPYA 5F3WA 4L5NC 4DV7E 4B3ME 1XNRE 1PKPA 2K4VA 3FIGA 4OOGC 2JVAA 5IWAE 3J80C 1YYKA 3F6HA 3HXLA 2KONA 2M1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 E;  4X64 E;  4AQY E;  4DV4 E;  1HNX E;  4X65 E;  3C4T A;  2UUB E;  2UUA E;  3J7Y p;  4DKK A;  4LF7 E;  4YY3 E;  4JI6 E;  4LFA E;  1T4L B;  1GQE A;  1WHQ A;  4LFB E;  4DV0 E;  2N3H A;  2EZ6 A;  2LTR A;  2UXB E;  2LTS A;  1N34 E;  1IBK E;  1FKA E;  2UUC E;  4LF9 E;  4LF5 E;  1J26 A;  4DR4 E;  2B3T B;  2RS6 A;  4DR6 E;  1FJG E;  2CPN A;  4DV2 E;  2DB2 A;  2NA2 A;  2IHR 1;  4LF4 E;  2UU9 E;  4X8W A;  3OTO E;  5LMN E;  4WFT A;  1RC7 A;  4B3R E;  3ADJ A;  4KHP E;  2RTX A;  2MDR A;  4GKJ E;  2L2N A;  4DV6 E;  1UHZ A;  4WYQ B;  2DMY A;  1QU6 A;  3HTX A;  1STU A;  1UIL A;  3P1X A;  3T1H E;  1N36 E;  1N32 E;  3ADG A;  4DV3 E;  1YZ9 A;  3C4B A;  2KHX A;  2LRS A;  4DV1 E;  2UXD E;  2YT4 A;  3T1Y E;  1XMQ E;  2B7T A;  2VQF E;  5LMU E;  1RQ0 A;  1X49 A;  2RS7 A;  2NUE A;  4DR1 E;  4OX9 E;  3ADL A;  2F4V E;  2DIX A;  4DV5 E;  2N3G A;  4B3S E;  1HNW E;  1XNQ E;  2B7V A;  2L2K B;  4JV5 E;  2UXC E;  1X47 A;  2L3J A;  1T4O A;  4JI2 E;  4NXN E;  2NUG A;  4X62 E;  3LLH A;  2E5L E;  1WHN A;  2ZM6 E;  2LUP B;  4M30 A;  2L3C A;  1N33 E;  4JI3 E;  4DUZ E;  2VQE E;  1HR0 E;  1IBL E;  3ADI A;  4DR2 E;  4B3T E;  4M2Z A;  4LF8 E;  2NUF A;  1IBM E;  4DR3 E;  2LUQ A;  3VYY A;  4JI0 E;  1HNZ E;  4YHH E;  5CFF E;  4NXM E;  1DI2 A;  4DUY E;  1EKZ A;  4K0K E;  1O0W A;  1YYO A;  2LJH A;  5BR8 E;  2L33 A;  2L2M A;  4X66 E;  1YYW A;  2HHH E;  4DR5 E;  4LFC E;  4JI1 E;  1T4N A;  4JYA E;  4JI8 E;  2RSM A;  2LBS B;  1I94 E;  1J5E E;  3VYX A;  4JI5 E;  1ZBT A;  4DR7 E;  1XMO E;  4GKK E;  4JI7 E;  2JY9 A;  4B3M E;  4DV7 E;  1XNR E;  1PKP A;  4OOG C;  5IWA E;  2JVA A;  1YYK A;  4LF6 E;  1X48 A; 
#chains in the Genus database with same CATH topology
 2A25 A;  2EPA A;  2H36 X;  4Q28 A;  2EMG A;  4X64 E;  3JTZ A;  5KL5 A;  4F9A B;  4BC9 A;  1MEY C;  2EE8 A;  2UUB E;  1TF3 A;  3KZY A;  1MGT A;  4MLV A;  4N4R B;  1LLM C;  4YY3 E;  2EN1 A;  4JI6 E;  4R2C A;  1T4L B;  1WHQ A;  1A1H A;  3LML A;  2EOZ A;  2EM0 A;  3MHH C;  1A1L A;  2YSO A;  2UUC E;  2YSP A;  2LCE A;  2RS6 A;  4DR6 E;  2HGH A;  1FJG E;  4WXD A;  4NHR A;  1YFH A;  2UU9 E;  4X8W A;  5KL7 A;  3OTO E;  1YSA C;  4WFT A;  1RC7 A;  4TUI A;  2EMB A;  5AC4 A;  1A1J A;  2EPC A;  2EOM A;  2L2N A;  4WYQ B;  2MDG A;  2EPM X;  2VF1 A;  3HTX A;  1STU A;  4BHC A;  5A6K A;  2EJ4 A;  4GZN C;  3ADG A;  4DV3 E;  5T6J A;  2MKN A;  5KL6 A;  2KHX A;  2LRS A;  4BHB A;  4DV1 E;  2UXD E;  2EPR A;  2YT4 A;  1XMQ E;  4RHB B;  4J8Z A;  5LMU E;  4GEQ B;  1RMD A;  2YTO A;  2NUE A;  3HPS A;  2MC6 A;  5KL3 A;  1SFE A;  4DR1 E;  3ADL A;  3BID A;  4DV5 E;  2YZT A;  4B3S E;  1HNW E;  2UXC E;  4NXN E;  2L3J A;  2NUG A;  2EM2 A;  2EML A;  4F6M A;  3LLH A;  1AAY A;  3AUZ A;  4RH8 A;  2LUP B;  2ELY A;  1N33 E;  3BF2 A;  2JWO A;  4I8O A;  2EPP A;  3VK6 A;  1G2D C;  2EPL X;  1IBM E;  2LUQ A;  2YU8 A;  4JI0 E;  4YHH E;  4NXM E;  3C6M A;  2DLQ A;  5FLX C;  2RSI A;  3VHT B;  4MLQ A;  2EM5 A;  1EKZ A;  2EM3 A;  2LJH A;  2WZO A;  4R2R A;  2EOI A;  1L4S A;  5AC5 A;  3J7A G;  2EMY A;  3L00 A;  4LFC E;  1PJQ A;  4JI1 E;  4R8O A;  1T4N A;  2V87 A;  4JI8 E;  3HPZ A;  1J5E E;  2EN7 A;  2EOH A;  4JI5 E;  5KL2 A;  2YRK A;  4DR7 E;  2I13 A;  4Q35 B;  4GKK E;  4WSP A;  4B3M E;  4DV7 E;  2EOO A;  1P47 A;  3F6H A;  4LF6 E;  1X48 A;  4R2D A;  4JI4 E;  2DLK A;  1YUI A;  1GZ6 A;  4X65 E;  3C4T A;  1IQS A;  4ZYD A;  2UUA E;  2B9D A;  1N3G A;  2MC5 A;  5AE3 A;  1IQO A;  2N3H A;  2JR1 A;  4ZYE A;  2LTR A;  2WBT A;  4ZYG A;  1N34 E;  1IBK E;  4DMI A;  4O24 A;  2B3T B;  2EM4 A;  2DRP A;  4DV2 E;  2IHR 1;  2E1M A;  5LMN E;  2YTG A;  2JOB A;  4BC7 A;  2GLI A;  2EMA A;  4DV6 E;  1KJK A;  2ENA A;  2EMF A;  2DMY A;  1T39 A;  3IWC A;  4HTG A;  3BBG A;  2EPO A;  2LVH A;  3T1H E;  2YWQ A;  5DNY A;  1UN6 B;  1N36 E;  2EPZ A;  4HEI A;  2LMZ A;  1N32 E;  1DQ3 A;  2EL6 A;  2ELZ A;  5A6B A;  3EPL A;  2EL5 A;  2VQF E;  1RQ0 A;  2EMZ A;  2V86 A;  1SR9 A;  2EN4 A;  2G7H A;  1KYQ A;  2DIX A;  2EN8 A;  1G2F C;  5A69 A;  2LO3 A;  1T4O A;  4JI2 E;  4O43 A;  2KOU A;  2E5L E;  1TN9 A;  2YRH A;  1F2I G;  4P78 A;  2YU5 A;  2L3C A;  1A1G A;  2EOS A;  4JI3 E;  2EPN A;  2YTI A;  1HR0 E;  3QG5 C;  1X6E A;  4R2P A;  2YPN A;  4M2Z A;  2GPI A;  1AH5 A;  2FTX B;  2EWL A;  3VYY A;  5A2Q C;  2DGC A;  2JP9 A;  3THO B;  4DUY E;  4LTY A;  2BB8 A;  3C6K A;  1TF6 A;  2EM9 A;  1GTK A;  2L2M A;  1YYW A;  2HHH E;  3EPJ A;  2LBS B;  2YTF A;  1ZBT A;  2N8X A;  5IT9 C;  2JY9 A;  3MHS C;  3FIG A;  2YTP A;  2CT1 A;  2KON A;  1UBD C;  2LE2 A;  2EPK X;  4BMJ A;  3H09 A;  4AQY E;  1EH8 A;  1HNX E;  2EMX A;  1BBG A;  2EN2 A;  2JOX A;  1ZR9 A;  3J7Y p;  2EPX A;  4DKK A;  4LF7 E;  2LT7 A;  3KZZ A;  4LFB E;  4DV0 E;  3JAM C;  2BBG A;  2ODR C;  2DSY A;  4LF9 E;  1Z1B A;  5AAS A;  4WXC A;  2JYA A;  2M9A A;  2CTD A;  2DB2 A;  2NA2 A;  1DGC A;  4LF4 E;  3ECR A;  4B3R E;  3ADJ A;  4NZV A;  2RTX A;  1WXR A;  4GKJ E;  2I9I A;  1YUJ A;  2RQL A;  1QU6 A;  2EOJ A;  5AE1 A;  2HC5 A;  3P1X A;  2YTJ A;  2E72 A;  4O5G A;  4BBY A;  2WBU A;  3M99 B;  3JU0 A;  3J81 C;  2EOR A;  1YZ9 A;  2NAB A;  2LV2 A;  2ENH A;  3DF6 A;  3C4B A;  2JXP A;  4X9J A;  2B7T A;  4M0V A;  1PJT A;  1X49 A;  1ZU1 A;  1WRJ A;  2EL4 A;  2K7I A;  4OX9 E;  4KWY A;  2EPU A;  1A1F A;  2YRM A;  4BS9 A;  1XNQ E;  1EH7 A;  4X62 E;  2GHF A;  2MKD A;  4LU9 A;  2DMI A;  2ZM6 E;  4IJD A;  4FK5 C;  2EMK A;  4ZYH A;  4DUZ E;  1ZAA C;  4R2E A;  3ADI A;  2M4I A;  4DR2 E;  2EP3 A;  4B3T E;  4R2Q A;  4BCA A;  2NUF A;  2L6M A;  4DR3 E;  2LJU A;  3KWR A;  3F6G A;  4TUG A;  2EQ3 A;  4K0K E;  3THN A;  2L33 A;  2V8Q B;  2WBS A;  3AV0 A;  4X66 E;  4DR5 E;  4L8N A;  1ZBQ A;  3VYX A;  2EQ1 A;  1JK1 A;  2PRT A;  5AE2 A;  4JI7 E;  4WX9 A;  4L5N C;  1IMU A;  2YTE A;  2JPA A;  2EMC A;  1XNR E;  2JVA A;  1A1I A;  3HXL A;  2M1S A;  4R2A A;  2CSH A;  4DV4 E;  3HQ1 A;  1PDA A;  3EQ1 A;  4M9V C;  2ADR A;  2EQ0 A;  4LFA E;  1NEI A;  1GQE A;  1EH6 A;  3UK3 C;  2WCC 3;  5IXM B;  2EZ6 A;  2FGG A;  3IWB A;  2EMW A;  2LTS A;  2M7Q A;  2UXB E;  1FKA E;  1J26 A;  4LF5 E;  4DR4 E;  3MSW A;  2V88 A;  3EPH A;  3EPK A;  2CPN A;  4F9C B;  1T38 A;  3IWD A;  3RMP A;  3ZOQ B;  2EM6 A;  2EM7 A;  2EM8 A;  4KHP E;  2FV4 B;  2HJJ A;  2MDR A;  2D9H A;  5A6J A;  2Q8U A;  2RPC A;  4WSG A;  1UHZ A;  1UIL A;  5KL4 A;  4R2S A;  2EOX A;  1X6F A;  1PJS A;  1NCS A;  4F2J C;  2ENC A;  3T1Y E;  1B69 A;  2RS7 A;  5LL6 R;  5ADZ A;  1QNT A;  1WJP A;  1YPN A;  4O4K A;  4F54 A;  2F4V E;  4R03 A;  4F9B B;  2N3G A;  2B7V A;  2L2K B;  4IS1 C;  4JV5 E;  1X47 A;  2R76 A;  1BB8 A;  2L92 A;  1WHN A;  2V89 A;  2EOE A;  3DJW A;  4M30 A;  2J7J A;  2EMH A;  2L8T A;  2EOQ A;  2VQE E;  4KZS A;  1X6H A;  1IBL E;  1A1K A;  2VE7 C;  3K6Q A;  2YTN A;  4LF8 E;  5TSE A;  3BGH A;  2V83 A;  2EOY A;  1HNZ E;  5CFF E;  2EOF A;  1BBO A;  2EN6 A;  1DI2 A;  1X3C A;  5A6B D;  1O0W A;  1YYO A;  1JK2 A;  5BR8 E;  1X5W A;  4P7D A;  2YTD A;  2R1F A;  2EN3 A;  5A6A A;  4JYA E;  2RSM A;  1I94 E;  2ODR D;  2F8B A;  4F6N A;  5IV8 B;  1XMO E;  2V85 A;  2EMI A;  5F3W A;  4WPY A;  5LLQ A;  2YTQ A;  1PKP A;  2K4V A;  2VRD A;  4OOG C;  5IWA E;  3J80 C;  3TQM A;  1YYK A;  3OML A; 
#chains in the Genus database with same CATH homology
 2H36 X;  2LE2 A;  4Q28 A;  4JI4 E;  4BMJ A;  3H09 A;  4X64 E;  4AQY E;  3JTZ A;  4DV4 E;  4F9A B;  1HNX E;  1GZ6 A;  4X65 E;  3C4T A;  3HQ1 A;  4BC9 A;  2UUB E;  2JOX A;  2UUA E;  2B9D A;  3J7Y p;  4DKK A;  4LF7 E;  4YY3 E;  4JI6 E;  4LFA E;  1T4L B;  1GQE A;  2MC5 A;  1WHQ A;  4LFB E;  4DV0 E;  5AE3 A;  3JAM C;  3LML A;  2N3H A;  2JR1 A;  2EZ6 A;  2ODR C;  2DSY A;  2FGG A;  2LTR A;  2LTS A;  3IWB A;  2M7Q A;  1N34 E;  1IBK E;  1FKA E;  4DMI A;  5AAS A;  2UUC E;  4LF5 E;  4LF9 E;  1J26 A;  4DR4 E;  2B3T B;  2RS6 A;  3MSW A;  4DR6 E;  2V88 A;  1FJG E;  2CPN A;  4F9C B;  4DV2 E;  2DB2 A;  2NA2 A;  2IHR 1;  4LF4 E;  3IWD A;  2UU9 E;  4X8W A;  3OTO E;  2E1M A;  5LMN E;  4WFT A;  1RC7 A;  3RMP A;  4TUI A;  4B3R E;  3ZOQ B;  2JOB A;  3ADJ A;  4KHP E;  2FV4 B;  2RTX A;  4BC7 A;  2MDR A;  1WXR A;  4GKJ E;  2L2N A;  4DV6 E;  1UHZ A;  4WYQ B;  2DMY A;  1QU6 A;  2VF1 A;  3IWC A;  5AE1 A;  3HTX A;  1STU A;  1UIL A;  3P1X A;  3T1H E;  4BBY A;  5DNY A;  3JU0 A;  1N36 E;  2LMZ A;  3J81 C;  3ADG A;  4DV3 E;  1N32 E;  1YZ9 A;  3OML A;  5T6J A;  1DQ3 A;  3DF6 A;  3C4B A;  2KHX A;  2LRS A;  4DV1 E;  2UXD E;  2YT4 A;  3T1Y E;  1XMQ E;  2B7T A;  4J8Z A;  4M0V A;  2VQF E;  5LMU E;  4GEQ B;  1RQ0 A;  2V86 A;  1X49 A;  2RS7 A;  5LL6 R;  1SR9 A;  2G7H A;  3HPS A;  2NUE A;  2MC6 A;  5ADZ A;  4F54 A;  4DR1 E;  4OX9 E;  3ADL A;  2F4V E;  2DIX A;  4DV5 E;  2YZT A;  4R03 A;  4BS9 A;  4F9B B;  2N3G A;  4B3S E;  1HNW E;  1XNQ E;  2B7V A;  2L2K B;  4JV5 E;  2UXC E;  1X47 A;  2L3J A;  1T4O A;  2L92 A;  4JI2 E;  4NXN E;  2KOU A;  4X62 E;  2NUG A;  3LLH A;  2E5L E;  3AUZ A;  1WHN A;  4LU9 A;  2ZM6 E;  2V89 A;  3DJW A;  2LUP B;  4M30 A;  2UXB E;  4P78 A;  2L3C A;  1N33 E;  2L8T A;  4DUZ E;  4JI3 E;  2VQE E;  2JWO A;  4I8O A;  4KZS A;  1IBL E;  2M4I A;  3VK6 A;  1HR0 E;  3ADI A;  4DR2 E;  2VE7 C;  3K6Q A;  4B3T E;  4M2Z A;  4LF8 E;  4BCA A;  1IBM E;  2NUF A;  2L6M A;  2FTX B;  2LUQ A;  2EWL A;  3VYY A;  4DR3 E;  2V83 A;  1HNZ E;  4JI0 E;  5A2Q C;  4YHH E;  5CFF E;  4NXM E;  5FLX C;  3KWR A;  1DI2 A;  4DUY E;  3F6G A;  4TUG A;  1EKZ A;  4LTY A;  4K0K E;  1O0W A;  1YYO A;  2LJH A;  2WZO A;  5BR8 E;  2L33 A;  2V8Q B;  3AV0 A;  3J7A G;  2L2M A;  4P7D A;  4X66 E;  1YYW A;  2HHH E;  4LF6 E;  4DR5 E;  4LFC E;  4JI1 E;  4R8O A;  1T4N A;  2V87 A;  4JI8 E;  4L8N A;  4JYA E;  2RSM A;  1X48 A;  2LBS B;  1I94 E;  3HPZ A;  2ODR D;  2F8B A;  1ZBQ A;  1J5E E;  3VYX A;  4JI5 E;  1ZBT A;  4DR7 E;  5AE2 A;  1XMO E;  2V85 A;  4GKK E;  4JI7 E;  5IT9 C;  2JY9 A;  4WSP A;  4WPY A;  5F3W A;  4L5N C;  4DV7 E;  4B3M E;  1XNR E;  1PKP A;  2K4V A;  3FIG A;  4OOG C;  2JVA A;  5IWA E;  3J80 C;  1YYK A;  3F6H A;  3HXL A;  2KON A;  2M1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...