2LBSB

Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with aagu tetraloop hairpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
b'GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (32-MER)
publication title Structure of a Yeast RNase III dsRBD Complex with a Noncanonical RNA Substrate Provides New Insights into Binding Specificity of dsRBDs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lbsB00
2MDRA 2L2KB 2L3CA 1N34E 3ADIA 1XMOE 1UILA 1X47A 4DV1E 4NXNE 1HNZE 1IBME 4DV6E 4OOGC 1N32E 2N3GA 1DI2A 4LF5E 1YYOA 4NXME 4LF9E 1WHNA 2L33A 4DV7E 4WFTA 4DR2E 2DMYA 2KHXA 3J7Yp 3C4BA 5LMNE 4X8WA 4X64E 4DKKA 2L2MA 2L2NA 1XNQE 2LJHA 2EZ6A 2LUQA 2RTXA 2UUAE 4DR3E 2F4VE 5LMUE 2LTSA 1O0WA 3ADLA 3VYYA 4LFBE 2LTRA 4LF7E 4DR6E 4JI2E 2UXBE 4LFAE 2JVAA 3OTOE 2UUCE 4X65E 4JI6E 4JI5E 1N33E 4DV0E 3P1XA 4DUYE 3VYXA 1T4OA 1GQEA 1FKAE 2VQEE 5CFFE 4OX9E 1QU6A 4GKKE 4X62E 4DV2E 4B3RE 2NUGA 2B3TB 2NUFA 2UU9E 4DR5E 4DV5E 4K0KE 4WYQB 4YY3E 1XNRE 4DR4E 2RS6A 2LBSB 4DV3E 4JI1E 4JI0E 2ZM6E 3LLHA 1IBKE 2B7VA 1J5EE 4JI7E 2B7TA 1X48A 2VQFE 5BR8E 4YHHE 1RQ0A 2L3JA 1X49A 2RS7A 2LUPB 1T4NA 3ADGA 4DV4E 1N36E 4AQYE 4LF6E 1YZ9A 3HTXA 1HNXE 1XMQE 4JI4E 4JI8E 2DB2A 4M2ZA 2JY9A 1STUA 4KHPE 1IBLE 2UXCE 2DIXA 1YYKA 1WHQA 3T1YE 1EKZA 4M30A 4JYAE 2RSMA 1YYWA 1ZBTA 3T1HE 4B3ME 5IWAE 1PKPA 2YT4A 2NUEA 1UHZA 4DR7E 3ADJA 1HR0E 4LFCE 2N3HA 1RC7A 2LRSA 4X66E 1FJGE 3C4TA 4B3SE 4LF8E 4B3TE 4GKJE 4JI3E 4DR1E 1I94E 2UXDE 1T4LB 4JV5E 1J26A 2HHHE 4LF4E 1HNWE 2NA2A 2IHR1 2CPNA 2UUBE 2E5LE 4DUZE
chains in the Genus database with same CATH superfamily
2HJJA 2EJ4A 1UILA 4DV1E 1N32E 2EWLA 4R03A 4OOGC 4DV6E 2FTXB 1YFHA 1WHNA 2JR1A 2ODRC 4DV7E 3J80C 1MEYC 2GLIA 4WFTA 2YRKA 3EPKA 3J7AG 2DMYA 4RHBB 4O4KA 5LMNE 4X8WA 4X64E 4GZNC 4DKKA 2L2MA 2EOQA 2EM2A 4WSGA 2DLQA 1PJSA 3VK6A 2EZ6A 1WJPA 2UUAE 3IWDA 2Q8UA 2F4VE 2EPXA 2LTSA 1PJQA 2YTOA 4R2QA 1AAYA 3ADLA 1BBGA 2EMIA 2UXBE 4LFAE 5FLXC 2EE8A 2YPNA 2LE2A 4F6NA 4X65E 4TUGA 4JI5E 4DV0E 2M9AA 2YTQA 2YTIA 4HEIA 3VYXA 1FKAE 2EOZA 4M0VA 2ODRD 2EMLA 2ELYA 3EPLA 2NUGA 2NUFA 2YTGA 1B69A 2EPZA 3MHSC 2EM9A 2EOSA 2R76A 5AE1A 4JI0E 4O5GA 4X9JA 1YUIA 2EPPA 2EMBA 2ZM6E 2EM7A 1J5EE 1X6FA 2EORA 1X48A 5KL6A 3J81C 2LJUA 4YHHE 4O43A 1RQ0A 2L3JA 2RS7A 2DLKA 3HTXA 1JK1A 3VHTB 2I9IA 4ZYEA 2DB2A 3QG5C 1IBLE 2K4VA 2EM6A 1YYKA 2MDGA 3EPHA 3T1YE 4M30A 2RSMA 1YYWA 5LLQA 5AASA 3JTZA 2YRHA 2EL4A 2WBSA 1RMDA 1A1KA 1HR0E 2DMIA 1RC7A 4Q35B 2LRSA 3BBGA 3C4TA 3F6GA 5IV8B 1N3GA 2R1FA 1EH7A 4B3TE 2WCC3 1J26A 4GEQB 2HC5A 2HHHE 1HNWE 2EMKA 2DRPA 1A1LA 1XNQE 4IJDA 2MDRA 2YTDA 3ADIA 1XMOE 4F54A 1GZ6A 4NXNE 1DI2A 4LF5E 1YYOA 3DJWA 3BIDA 2M7QA 2L33A 4HTGA 5A69A 2LCEA 4DR2E 1IQOA 2EM5A 3THOB 4WX9A 1X6EA 3TQMA 2EMZA 1A1GA 1ZAAC 5AC5A 1WXRA 4DR3E 2B9DA 1O0WA 2EOEA 4I8OA 2JYAA 2LTRA 2YWQA 2H36X 5A6BA 4JI2E 4F2JC 2YTFA 1NEIA 4JI6E 1BB8A 1N33E 2EPUA 3P1XA 3HQ1A 2RQLA 2NABA 5CFFE 5KL2A 1TF6A 4DV2E 2B3TB 3C6KA 2EQ3A 1JK2A 2LV2A 2I13A 2UU9E 2MKNA 4DV5E 4K0KE 3HPSA 2JOXA 2GHFA 4ZYDA 4DR4E 1IBKE 2EN1A 5KL3A 2EL5A 2EMGA 1X49A 2HGHA 3F6HA 4BHBA 1P47A 2YZTA 2EOXA 2EPRA 4DMIA 3ADGA 1N36E 3UK3C 4NHRA 1YZ9A 2EPMX 2LMZA 4F9BB 4ZYGA 2WZOA 4M2ZA 4KHPE 2FV4B 2J7JA 2UXCE 3AV0A 1TN9A 2DIXA 2EN2A 1TF3A 3AUZA 1WHQA 2EOYA 2BBGA 3T1HE 4IS1C 2EPKX 2V86A 5F3WA 4TUIA 1PKPA 2YT4A 2NUEA 3OMLA 3FIGA 2L6MA 3ADJA 4LTYA 2YSPA 4MLQA 2EM8A 4R2DA 2EN3A 2YTPA 2DSYA 4JI3E 1I94E 2EQ0A 2JPAA 2VF1A 2EPCA 2NA2A 1IQSA 5A6BD 3EPJA 4L8NA 4BBYA 1QNTA 4R2SA 2L2KB 2L3CA 1N34E 1A1JA 1UBDC 2RPCA 4F6MA 3THNA 1G2FC 1IBME 2N3GA 3KZZA 3M99B 4NXME 4ZYHA 1WRJA 2JOBA 4P7DA 2EM3A 1ZBQA 2YTJA 2BB8A 2EPOA 3MSWA 2ENHA 4O24A 2KHXA 1Z1BA 2EMFA 1AH5A 2LJHA 2EP3A 2LUQA 1ZR9A 2EMHA 1BBOA 4BCAA 2EM0A 2V89A 1A1FA 4LFBE 4LF7E 4DR6E 2YTEA 2JVAA 2UUCE 1IMUA 2GPIA 2EOJA 5A6AA 1A1HA 5LL6R 4R2AA 2VQEE 4R8OA 2ADRA 4L5NC 1YPNA 1L4SA 2EN4A 4J8ZA 1KYQA 3ECRA 4WYQB 2D9HA 4KWYA 1XNRE 2ENAA 2JXPA 5IXMB 4DV3E 1EH8A 1YUJA 2EOFA 3LLHA 2B7VA 3BF2A 1UN6B 1MGTA 5DNYA 4BC9A 5IT9C 2VQFE 5BR8E 4WXDA 1X5WA 4M9VC 1T4NA 4BS9A 4AQYE 1HNXE 2EOOA 1XMQE 4JI8E 2M1SA 4JYAE 2EPNA 1ZBTA 4B3ME 2EL6A 2EMAA 5IWAE 1X6HA 2E1MA 1UHZA 4DR7E 3JAMC 2JP9A 3BGHA 2E72A 3H09A 5KL4A 4B3SE 2EMXA 1G2DC 2EMCA 4JV5E 4LF4E 3HXLA 5TSEA 2EPLX 2L92A 2IHR1 4WXCA 4BHCA 2UUBE 5KL5A 2CTDA 2EN6A 5AE2A 2JWOA 3KZYA 4WPYA 3EQ1A 1X47A 1HNZE 2LT7A 2YU8A 4LF9E 2EMWA 2DGCA 2MKDA 3IWCA 2ENCA 1KJKA 2PRTA 2VE7C 2EMYA 3C6MA 1PJTA 4R2CA 3J7Yp 2A25A 2EOMA 4KZSA 3C4BA 4BC7A 1A1IA 2L2NA 2V87A 2L8TA 4N4RB 2RTXA 4R2PA 2VRDA 3KWRA 5LMUE 3L00A 3K6QA 3VYYA 2EN8A 1GTKA 4P78A 2EQ1A 2EOIA 1LLMC 4WSPA 3OTOE 2G7HA 2YSOA 1DGCA 4DUYE 4F9AB 1T4OA 1GQEA 5A2QC 2M4IA 2CT1A 4OX9E 1QU6A 4GKKE 4X62E 1X3CA 4B3RE 4F9CB 2K7IA 4DR5E 2V85A 4YY3E 3MHHC 2CSHA 1ZU1A 2RS6A 2LBSB 1T38A 4RH8A 2YRMA 2EPAA 3IWBA 4JI1E 2V83A 1YSAC 4JI7E 2B7TA 2EN7A 3LMLA 5AC4A 5T6JA 2LVHA 2FGGA 3RMPA 2V8QB 5KL7A 2YTNA 1T39A 2LUPB 4R2RA 4DV4E 2LO3A 2WBTA 2N8XA 1F2IG 4LF6E 2MC6A 2F8BA 4Q28A 4JI4E 4BMJA 2JY9A 1STUA 2EOHA 1EH6A 3DF6A 1EKZA 5ADZA 1PDAA 2RSIA 2YU5A 3JU0A 1NCSA 2ELZA 3ZOQB 2KOUA 1SFEA 4FK5C 4LFCE 2N3HA 5A6JA 5A6KA 2WBUA 4X66E 1FJGE 2V88A 4LF8E 3HPZA 4GKJE 4DR1E 4LU9A 2UXDE 2EM4A 4NZVA 1T4LB 5AE3A 4MLVA 1SR9A 1DQ3A 2CPNA 2KONA 4R2EA 2E5LE 4DUZE 2MC5A
chains in the Genus database with same CATH topology
2MDRA 2L2KB 2L3CA 1N34E 3ADIA 5AE2A 2JWOA 1XMOE 4WPYA 4F54A 1UILA 1GZ6A 1X47A 4DV1E 4NXNE 1HNZE 1IBME 2EWLA 4R03A 4OOGC 2N3GA 4DV6E 1N32E 1DI2A 4LF5E 2FTXB 1YYOA 3DJWA 4NXME 4LF9E 2M7QA 1WHNA 2JOBA 2JR1A 4P7DA 2L33A 2ODRC 3J80C 4DV7E 1ZBQA 4DR7E 3IWCA 4WFTA 4DR2E 3J7AG 2VE7C 2DMYA 3MSWA 2KHXA 3J7Yp 4KZSA 3C4BA 5LMNE 4X8WA 4BC7A 4X64E 4DKKA 2L2MA 2L2NA 2V87A 2LJHA 3VK6A 2L8TA 1XNQE 2EZ6A 2LUQA 2RTXA 2UUAE 3IWDA 1WXRA 3KWRA 4DR3E 2B9DA 2F4VE 5LMUE 4BCAA 2LTSA 5IT9C 2V89A 1O0WA 3K6QA 3ADLA 4I8OA 3VYYA 4LFBE 2LTRA 4P78A 4LF7E 4DR6E 2H36X 4JI2E 2UXBE 4LFAE 5FLXC 2JVAA 4WSPA 2LE2A 3OTOE 2G7HA 2UUCE 4X65E 4JI6E 4TUGA 4JI5E 1N33E 4DV0E 3P1XA 4DUYE 4F9AB 3HQ1A 5LL6R 3VYXA 1T4OA 1GQEA 5A2QC 1FKAE 2VQEE 2M4IA 4M0VA 4R8OA 5CFFE 4OX9E 1QU6A 2ODRD 4GKKE 4X62E 4L5NC 4DV2E 4B3RE 2NUGA 2B3TB 4F9CB 2NUFA 2UU9E 4DR5E 4J8ZA 2V85A 4DV5E 4K0KE 3HPSA 4WYQB 2JOXA 4YY3E 1XNRE 4DR4E 2RS6A 5AE1A 2LBSB 4DV3E 4JI1E 4JI0E 3IWBA 2V83A 3LLHA 2ZM6E 1IBKE 2B7VA 1J5EE 4JI7E 2B7TA 1X48A 3LMLA 5DNYA 4BC9A 5T6JA 3J81C 2VQFE 5BR8E 4YHHE 1RQ0A 2FGGA 1X49A 2V8QB 3F6HA 2L3JA 3RMPA 2RS7A 2YZTA 2LUPB 1T4NA 4DMIA 3ADGA 4BS9A 4DV4E 1N36E 4AQYE 4LF6E 1YZ9A 3HTXA 1HNXE 2MC6A 2F8BA 2LMZA 4F9BB 4Q28A 1XMQE 2WZOA 4JI4E 4JI8E 2DB2A 4BMJA 2JY9A 4M2ZA 1STUA 2FV4B 4KHPE 2M1SA 1IBLE 3AV0A 2UXCE 2K4VA 2DIXA 1YYKA 3AUZA 1WHQA 3DF6A 3T1YE 1EKZA 4M30A 4JYAE 2RSMA 1YYWA 5ADZA 1ZBTA 5AASA 3JU0A 3T1HE 3JTZA 4B3ME 5F3WA 2V86A 3ZOQB 4TUIA 2KOUA 1PKPA 2E1MA 2YT4A 5IWAE 1UHZA 3OMLA 3FIGA 2L6MA 3ADJA 4LTYA 3JAMC 1HR0E 2NUEA 4LFCE 2N3HA 1RC7A 2LRSA 4X66E 1FJGE 3H09A 3C4TA 4B3SE 2V88A 3F6GA 4LF8E 3HPZA 4B3TE 2DSYA 4GKJE 4JI3E 4DR1E 4LU9A 1I94E 2UXDE 2VF1A 1T4LB 4GEQB 4JV5E 5AE3A 2HHHE 4LF4E 3HXLA 1J26A 1HNWE 2NA2A 2L92A 1SR9A 2IHR1 1DQ3A 2CPNA 4L8NA 2KONA 4BBYA 2UUBE 2E5LE 4DUZE 2MC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDR A;  2L2K B;  2L3C A;  1N34 E;  3ADI A;  1XMO E;  1UIL A;  1X47 A;  4DV1 E;  4NXN E;  1HNZ E;  1IBM E;  4DV6 E;  4OOG C;  1N32 E;  2N3G A;  1DI2 A;  4LF5 E;  1YYO A;  4NXM E;  4LF9 E;  1WHN A;  2L33 A;  4DV7 E;  4WFT A;  4DR2 E;  2DMY A;  2KHX A;  3J7Y p;  3C4B A;  5LMN E;  4X8W A;  4X64 E;  4DKK A;  2L2M A;  2L2N A;  1XNQ E;  2LJH A;  2EZ6 A;  2LUQ A;  2RTX A;  2UUA E;  4DR3 E;  2F4V E;  5LMU E;  2LTS A;  1O0W A;  3ADL A;  3VYY A;  4LFB E;  2LTR A;  4LF7 E;  4DR6 E;  4JI2 E;  2UXB E;  4LFA E;  2JVA A;  3OTO E;  2UUC E;  4X65 E;  4JI6 E;  4JI5 E;  1N33 E;  4DV0 E;  3P1X A;  4DUY E;  3VYX A;  1T4O A;  1GQE A;  1FKA E;  2VQE E;  5CFF E;  4OX9 E;  1QU6 A;  4GKK E;  4X62 E;  4DV2 E;  4B3R E;  2NUG A;  2B3T B;  2NUF A;  2UU9 E;  4DR5 E;  4DV5 E;  4K0K E;  4WYQ B;  4YY3 E;  1XNR E;  4DR4 E;  2RS6 A;  2LBS B;  4DV3 E;  4JI1 E;  4JI0 E;  2ZM6 E;  3LLH A;  1IBK E;  2B7V A;  1J5E E;  4JI7 E;  2B7T A;  1X48 A;  2VQF E;  5BR8 E;  4YHH E;  1RQ0 A;  2L3J A;  1X49 A;  2RS7 A;  2LUP B;  1T4N A;  3ADG A;  4DV4 E;  1N36 E;  4AQY E;  4LF6 E;  1YZ9 A;  3HTX A;  1HNX E;  1XMQ E;  4JI4 E;  4JI8 E;  2DB2 A;  4M2Z A;  2JY9 A;  1STU A;  4KHP E;  1IBL E;  2UXC E;  2DIX A;  1YYK A;  1WHQ A;  3T1Y E;  1EKZ A;  4M30 A;  4JYA E;  2RSM A;  1YYW A;  1ZBT A;  3T1H E;  4B3M E;  5IWA E;  1PKP A;  2YT4 A;  2NUE A;  1UHZ A;  4DR7 E;  3ADJ A;  1HR0 E;  4LFC E;  2N3H A;  1RC7 A;  2LRS A;  4X66 E;  1FJG E;  3C4T A;  4B3S E;  4LF8 E;  4B3T E;  4GKJ E;  4JI3 E;  4DR1 E;  1I94 E;  2UXD E;  1T4L B;  4JV5 E;  1J26 A;  2HHH E;  4LF4 E;  1HNW E;  2NA2 A;  2IHR 1;  2CPN A;  2UUB E;  2E5L E;  4DUZ E; 
#chains in the Genus database with same CATH topology
 2HJJ A;  2EJ4 A;  1UIL A;  4DV1 E;  1N32 E;  2EWL A;  4R03 A;  4OOG C;  4DV6 E;  2FTX B;  1YFH A;  1WHN A;  2JR1 A;  2ODR C;  4DV7 E;  3J80 C;  1MEY C;  2GLI A;  4WFT A;  2YRK A;  3EPK A;  3J7A G;  2DMY A;  4RHB B;  4O4K A;  5LMN E;  4X8W A;  4X64 E;  4GZN C;  4DKK A;  2L2M A;  2EOQ A;  2EM2 A;  4WSG A;  2DLQ A;  1PJS A;  3VK6 A;  2EZ6 A;  1WJP A;  2UUA E;  3IWD A;  2Q8U A;  2F4V E;  2EPX A;  2LTS A;  1PJQ A;  2YTO A;  4R2Q A;  1AAY A;  3ADL A;  1BBG A;  2EMI A;  2UXB E;  4LFA E;  5FLX C;  2EE8 A;  2YPN A;  2LE2 A;  4F6N A;  4X65 E;  4TUG A;  4JI5 E;  4DV0 E;  2M9A A;  2YTQ A;  2YTI A;  4HEI A;  3VYX A;  1FKA E;  2EOZ A;  4M0V A;  2ODR D;  2EML A;  2ELY A;  3EPL A;  2NUG A;  2NUF A;  2YTG A;  1B69 A;  2EPZ A;  3MHS C;  2EM9 A;  2EOS A;  2R76 A;  5AE1 A;  4JI0 E;  4O5G A;  4X9J A;  1YUI A;  2EPP A;  2EMB A;  2ZM6 E;  2EM7 A;  1J5E E;  1X6F A;  2EOR A;  1X48 A;  5KL6 A;  3J81 C;  2LJU A;  4YHH E;  4O43 A;  1RQ0 A;  2L3J A;  2RS7 A;  2DLK A;  3HTX A;  1JK1 A;  3VHT B;  2I9I A;  4ZYE A;  2DB2 A;  3QG5 C;  1IBL E;  2K4V A;  2EM6 A;  1YYK A;  2MDG A;  3EPH A;  3T1Y E;  4M30 A;  2RSM A;  1YYW A;  5LLQ A;  5AAS A;  3JTZ A;  2YRH A;  2EL4 A;  2WBS A;  1RMD A;  1A1K A;  1HR0 E;  2DMI A;  1RC7 A;  4Q35 B;  2LRS A;  3BBG A;  3C4T A;  3F6G A;  5IV8 B;  1N3G A;  2R1F A;  1EH7 A;  4B3T E;  2WCC 3;  1J26 A;  4GEQ B;  2HC5 A;  2HHH E;  1HNW E;  2EMK A;  2DRP A;  1A1L A;  1XNQ E;  4IJD A;  2MDR A;  2YTD A;  3ADI A;  1XMO E;  4F54 A;  1GZ6 A;  4NXN E;  1DI2 A;  4LF5 E;  1YYO A;  3DJW A;  3BID A;  2M7Q A;  2L33 A;  4HTG A;  5A69 A;  2LCE A;  4DR2 E;  1IQO A;  2EM5 A;  3THO B;  4WX9 A;  1X6E A;  3TQM A;  2EMZ A;  1A1G A;  1ZAA C;  5AC5 A;  1WXR A;  4DR3 E;  2B9D A;  1O0W A;  2EOE A;  4I8O A;  2JYA A;  2LTR A;  2YWQ A;  2H36 X;  5A6B A;  4JI2 E;  4F2J C;  2YTF A;  1NEI A;  4JI6 E;  1BB8 A;  1N33 E;  2EPU A;  3P1X A;  3HQ1 A;  2RQL A;  2NAB A;  5CFF E;  5KL2 A;  1TF6 A;  4DV2 E;  2B3T B;  3C6K A;  2EQ3 A;  1JK2 A;  2LV2 A;  2I13 A;  2UU9 E;  2MKN A;  4DV5 E;  4K0K E;  3HPS A;  2JOX A;  2GHF A;  4ZYD A;  4DR4 E;  1IBK E;  2EN1 A;  5KL3 A;  2EL5 A;  2EMG A;  1X49 A;  2HGH A;  3F6H A;  4BHB A;  1P47 A;  2YZT A;  2EOX A;  2EPR A;  4DMI A;  3ADG A;  1N36 E;  3UK3 C;  4NHR A;  1YZ9 A;  2EPM X;  2LMZ A;  4F9B B;  4ZYG A;  2WZO A;  4M2Z A;  4KHP E;  2FV4 B;  2J7J A;  2UXC E;  3AV0 A;  1TN9 A;  2DIX A;  2EN2 A;  1TF3 A;  3AUZ A;  1WHQ A;  2EOY A;  2BBG A;  3T1H E;  4IS1 C;  2EPK X;  2V86 A;  5F3W A;  4TUI A;  1PKP A;  2YT4 A;  2NUE A;  3OML A;  3FIG A;  2L6M A;  3ADJ A;  4LTY A;  2YSP A;  4MLQ A;  2EM8 A;  4R2D A;  2EN3 A;  2YTP A;  2DSY A;  4JI3 E;  1I94 E;  2EQ0 A;  2JPA A;  2VF1 A;  2EPC A;  2NA2 A;  1IQS A;  5A6B D;  3EPJ A;  4L8N A;  4BBY A;  1QNT A;  4R2S A;  2L2K B;  2L3C A;  1N34 E;  1A1J A;  1UBD C;  2RPC A;  4F6M A;  3THN A;  1G2F C;  1IBM E;  2N3G A;  3KZZ A;  3M99 B;  4NXM E;  4ZYH A;  1WRJ A;  2JOB A;  4P7D A;  2EM3 A;  1ZBQ A;  2YTJ A;  2BB8 A;  2EPO A;  3MSW A;  2ENH A;  4O24 A;  2KHX A;  1Z1B A;  2EMF A;  1AH5 A;  2LJH A;  2EP3 A;  2LUQ A;  1ZR9 A;  2EMH A;  1BBO A;  4BCA A;  2EM0 A;  2V89 A;  1A1F A;  4LFB E;  4LF7 E;  4DR6 E;  2YTE A;  2JVA A;  2UUC E;  1IMU A;  2GPI A;  2EOJ A;  5A6A A;  1A1H A;  5LL6 R;  4R2A A;  2VQE E;  4R8O A;  2ADR A;  4L5N C;  1YPN A;  1L4S A;  2EN4 A;  4J8Z A;  1KYQ A;  3ECR A;  4WYQ B;  2D9H A;  4KWY A;  1XNR E;  2ENA A;  2JXP A;  5IXM B;  4DV3 E;  1EH8 A;  1YUJ A;  2EOF A;  3LLH A;  2B7V A;  3BF2 A;  1UN6 B;  1MGT A;  5DNY A;  4BC9 A;  5IT9 C;  2VQF E;  5BR8 E;  4WXD A;  1X5W A;  4M9V C;  1T4N A;  4BS9 A;  4AQY E;  1HNX E;  2EOO A;  1XMQ E;  4JI8 E;  2M1S A;  4JYA E;  2EPN A;  1ZBT A;  4B3M E;  2EL6 A;  2EMA A;  5IWA E;  1X6H A;  2E1M A;  1UHZ A;  4DR7 E;  3JAM C;  2JP9 A;  3BGH A;  2E72 A;  3H09 A;  5KL4 A;  4B3S E;  2EMX A;  1G2D C;  2EMC A;  4JV5 E;  4LF4 E;  3HXL A;  5TSE A;  2EPL X;  2L92 A;  2IHR 1;  4WXC A;  4BHC A;  2UUB E;  5KL5 A;  2CTD A;  2EN6 A;  5AE2 A;  2JWO A;  3KZY A;  4WPY A;  3EQ1 A;  1X47 A;  1HNZ E;  2LT7 A;  2YU8 A;  4LF9 E;  2EMW A;  2DGC A;  2MKD A;  3IWC A;  2ENC A;  1KJK A;  2PRT A;  2VE7 C;  2EMY A;  3C6M A;  1PJT A;  4R2C A;  3J7Y p;  2A25 A;  2EOM A;  4KZS A;  3C4B A;  4BC7 A;  1A1I A;  2L2N A;  2V87 A;  2L8T A;  4N4R B;  2RTX A;  4R2P A;  2VRD A;  3KWR A;  5LMU E;  3L00 A;  3K6Q A;  3VYY A;  2EN8 A;  1GTK A;  4P78 A;  2EQ1 A;  2EOI A;  1LLM C;  4WSP A;  3OTO E;  2G7H A;  2YSO A;  1DGC A;  4DUY E;  4F9A B;  1T4O A;  1GQE A;  5A2Q C;  2M4I A;  2CT1 A;  4OX9 E;  1QU6 A;  4GKK E;  4X62 E;  1X3C A;  4B3R E;  4F9C B;  2K7I A;  4DR5 E;  2V85 A;  4YY3 E;  3MHH C;  2CSH A;  1ZU1 A;  2RS6 A;  2LBS B;  1T38 A;  4RH8 A;  2YRM A;  2EPA A;  3IWB A;  4JI1 E;  2V83 A;  1YSA C;  4JI7 E;  2B7T A;  2EN7 A;  3LML A;  5AC4 A;  5T6J A;  2LVH A;  2FGG A;  3RMP A;  2V8Q B;  5KL7 A;  2YTN A;  1T39 A;  2LUP B;  4R2R A;  4DV4 E;  2LO3 A;  2WBT A;  2N8X A;  1F2I G;  4LF6 E;  2MC6 A;  2F8B A;  4Q28 A;  4JI4 E;  4BMJ A;  2JY9 A;  1STU A;  2EOH A;  1EH6 A;  3DF6 A;  1EKZ A;  5ADZ A;  1PDA A;  2RSI A;  2YU5 A;  3JU0 A;  1NCS A;  2ELZ A;  3ZOQ B;  2KOU A;  1SFE A;  4FK5 C;  4LFC E;  2N3H A;  5A6J A;  5A6K A;  2WBU A;  4X66 E;  1FJG E;  2V88 A;  4LF8 E;  3HPZ A;  4GKJ E;  4DR1 E;  4LU9 A;  2UXD E;  2EM4 A;  4NZV A;  1T4L B;  5AE3 A;  4MLV A;  1SR9 A;  1DQ3 A;  2CPN A;  2KON A;  4R2E A;  2E5L E;  4DUZ E;  2MC5 A; 
#chains in the Genus database with same CATH homology
 2MDR A;  2L2K B;  2L3C A;  1N34 E;  3ADI A;  5AE2 A;  2JWO A;  1XMO E;  4WPY A;  4F54 A;  1UIL A;  1GZ6 A;  1X47 A;  4DV1 E;  4NXN E;  1HNZ E;  1IBM E;  2EWL A;  4R03 A;  4OOG C;  2N3G A;  4DV6 E;  1N32 E;  1DI2 A;  4LF5 E;  2FTX B;  1YYO A;  3DJW A;  4NXM E;  4LF9 E;  2M7Q A;  1WHN A;  2JOB A;  2JR1 A;  4P7D A;  2L33 A;  2ODR C;  3J80 C;  4DV7 E;  1ZBQ A;  4DR7 E;  3IWC A;  4WFT A;  4DR2 E;  3J7A G;  2VE7 C;  2DMY A;  3MSW A;  2KHX A;  3J7Y p;  4KZS A;  3C4B A;  5LMN E;  4X8W A;  4BC7 A;  4X64 E;  4DKK A;  2L2M A;  2L2N A;  2V87 A;  2LJH A;  3VK6 A;  2L8T A;  1XNQ E;  2EZ6 A;  2LUQ A;  2RTX A;  2UUA E;  3IWD A;  1WXR A;  3KWR A;  4DR3 E;  2B9D A;  2F4V E;  5LMU E;  4BCA A;  2LTS A;  5IT9 C;  2V89 A;  1O0W A;  3K6Q A;  3ADL A;  4I8O A;  3VYY A;  4LFB E;  2LTR A;  4P78 A;  4LF7 E;  4DR6 E;  2H36 X;  4JI2 E;  2UXB E;  4LFA E;  5FLX C;  2JVA A;  4WSP A;  2LE2 A;  3OTO E;  2G7H A;  2UUC E;  4X65 E;  4JI6 E;  4TUG A;  4JI5 E;  1N33 E;  4DV0 E;  3P1X A;  4DUY E;  4F9A B;  3HQ1 A;  5LL6 R;  3VYX A;  1T4O A;  1GQE A;  5A2Q C;  1FKA E;  2VQE E;  2M4I A;  4M0V A;  4R8O A;  5CFF E;  4OX9 E;  1QU6 A;  2ODR D;  4GKK E;  4X62 E;  4L5N C;  4DV2 E;  4B3R E;  2NUG A;  2B3T B;  4F9C B;  2NUF A;  2UU9 E;  4DR5 E;  4J8Z A;  2V85 A;  4DV5 E;  4K0K E;  3HPS A;  4WYQ B;  2JOX A;  4YY3 E;  1XNR E;  4DR4 E;  2RS6 A;  5AE1 A;  2LBS B;  4DV3 E;  4JI1 E;  4JI0 E;  3IWB A;  2V83 A;  3LLH A;  2ZM6 E;  1IBK E;  2B7V A;  1J5E E;  4JI7 E;  2B7T A;  1X48 A;  3LML A;  5DNY A;  4BC9 A;  5T6J A;  3J81 C;  2VQF E;  5BR8 E;  4YHH E;  1RQ0 A;  2FGG A;  1X49 A;  2V8Q B;  3F6H A;  2L3J A;  3RMP A;  2RS7 A;  2YZT A;  2LUP B;  1T4N A;  4DMI A;  3ADG A;  4BS9 A;  4DV4 E;  1N36 E;  4AQY E;  4LF6 E;  1YZ9 A;  3HTX A;  1HNX E;  2MC6 A;  2F8B A;  2LMZ A;  4F9B B;  4Q28 A;  1XMQ E;  2WZO A;  4JI4 E;  4JI8 E;  2DB2 A;  4BMJ A;  2JY9 A;  4M2Z A;  1STU A;  2FV4 B;  4KHP E;  2M1S A;  1IBL E;  3AV0 A;  2UXC E;  2K4V A;  2DIX A;  1YYK A;  3AUZ A;  1WHQ A;  3DF6 A;  3T1Y E;  1EKZ A;  4M30 A;  4JYA E;  2RSM A;  1YYW A;  5ADZ A;  1ZBT A;  5AAS A;  3JU0 A;  3T1H E;  3JTZ A;  4B3M E;  5F3W A;  2V86 A;  3ZOQ B;  4TUI A;  2KOU A;  1PKP A;  2E1M A;  2YT4 A;  5IWA E;  1UHZ A;  3OML A;  3FIG A;  2L6M A;  3ADJ A;  4LTY A;  3JAM C;  1HR0 E;  2NUE A;  4LFC E;  2N3H A;  1RC7 A;  2LRS A;  4X66 E;  1FJG E;  3H09 A;  3C4T A;  4B3S E;  2V88 A;  3F6G A;  4LF8 E;  3HPZ A;  4B3T E;  2DSY A;  4GKJ E;  4JI3 E;  4DR1 E;  4LU9 A;  1I94 E;  2UXD E;  2VF1 A;  1T4L B;  4GEQ B;  4JV5 E;  5AE3 A;  2HHH E;  4LF4 E;  3HXL A;  1J26 A;  1HNW E;  2NA2 A;  2L92 A;  1SR9 A;  2IHR 1;  1DQ3 A;  2CPN A;  4L8N A;  2KON A;  4BBY A;  2UUB E;  2E5L E;  4DUZ E;  2MC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...