2LBSB

Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with aagu tetraloop hairpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Yeast RNase III dsRBD Complex with a Noncanonical RNA Substrate Provides New Insights into Binding Specificity of dsRBDs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords RNA (32-MER)
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lbsB00
5CFFE 2DMYA 4DR6E 1HNXE 1DI2A 2KHXA 2RSMA 4YY3E 3OTOE 1XMQE 3C4TA 1N32E 5LMUE 5BR8E 4KHPE 1HNZE 2LUPB 1WHNA 2LBSB 2CPNA 1N36E 1YYOA 4DR5E 2VQFE 4JI8E 1QU6A 4GKKE 4B3TE 4LFCE 1J26A 2L2NA 3VYYA 4X8WA 4DUYE 2UXBE 3T1HE 4M30A 2UU9E 2LRSA 2UUAE 3T1YE 1GQEA 2EZ6A 2ZM6E 1STUA 3LLHA 2VQEE 4DR4E 4JV5E 2LUQA 4WFTA 2NUFA 2RS7A 2NUGA 4B3SE 3ADLA 1N33E 4DV2E 4JI4E 2L3CA 1I94E 3J7Yp 4JI5E 3C4BA 1IBKE 4X62E 4AQYE 3ADGA 1N34E 1YYKA 1RQ0A 2L33A 4LF7E 2JVAA 1IBLE 2UXCE 2L3JA 4LFBE 2MDRA 4LF6E 4DV3E 4JI0E 4LF5E 4K0KE 4WYQB 4JI1E 3HTXA 2LJHA 2IHR1 1FKAE 4M2ZA 2JY9A 2LTRA 4X65E 2NUEA 4LF8E 4JI3E 1EKZA 2RTXA 2E5LE 2L2KB 1T4LB 2F4VE 4X66E 4DV4E 1HNWE 1WHQA 1PKPA 4DKKA 4DR7E 2N3GA 4LF9E 3ADIA 1FJGE 4B3ME 1T4NA 2DB2A 4NXNE 2N3HA 2B7VA 1IBME 1HR0E 1UHZA 2UXDE 1ZBTA 4DV7E 4DV6E 1O0WA 1X47A 4OOGC 1YYWA 2HHHE 4B3RE 2RS6A 4OX9E 2UUBE 1YZ9A 3VYXA 2B3TB 2LTSA 1XNRE 3ADJA 4DV0E 2YT4A 5LMNE 4DV5E 1X48A 4DR3E 2B7TA 1T4OA 2UUCE 4X64E 4DV1E 4JI2E 1XNQE 4JYAE 1UILA 4DR2E 4DR1E 4LF4E 2L2MA 2NA2A 4DUZE 4LFAE 1XMOE 4NXME 4JI7E 2DIXA 3P1XA 4YHHE 1RC7A 1J5EE 4JI6E 5IWAE 1X49A 4GKJE
chains in the Genus database with same CATH superfamily
5IT9C 2A25A 2EOFA 4WSPA 1TF6A 3OTOE 3RMPA 1SR9A 3J7AG 5LMUE 4KHPE 1MGTA 2LUPB 4L8NA 4WXCA 2EM2A 2CPNA 1A1GA 4DR5E 2GPIA 2VQFE 1A1IA 4GKKE 3QG5C 2ELYA 4B3TE 2KONA 2L2NA 1IQSA 2V86A 2EP3A 3KZZA 2K4VA 4GZNC 4P7DA 2UXBE 2EMGA 3T1HE 2UU9E 3T1YE 2EOZA 2EOJA 2YTNA 3DJWA 2NUFA 5A69A 3ADLA 3JU0A 4BCAA 1ZU1A 2EPAA 3UK3C 4F9BB 2JP9A 4R2EA 4JI4E 1N33E 2EOEA 2EN2A 4JI5E 3AV0A 5TSEA 1AAYA 5A6KA 2EMBA 2VF1A 3M99B 2LCEA 3AUZA 5IXMB 4AQYE 2HJJA 2EMZA 4M0VA 2EN4A 4WX9A 2L33A 4LF7E 2L6MA 4R8OA 1BB8A 2EOYA 3KWRA 1YSAC 2L3JA 2UXCE 3BGHA 2L8TA 2MDRA 4Q35B 2CTDA 2BBGA 2JXPA 4LF5E 3JAMC 2LO3A 3HTXA 2EL4A 3L00A 3F6HA 4M2ZA 2EQ0A 4LF8E 2RTXA 1A1JA 3MSWA 1X5WA 4ZYEA 1PKPA 4R2CA 4DKKA 5A6JA 2DB2A 2EN8A 5F3WA 2B7VA 4BHCA 2EOMA 2LV2A 2UXDE 1ZBTA 4DV6E 1YYWA 1JK2A 3VYXA 1YUJA 4RH8A 5ADZA 4BC9A 1NEIA 4DV5E 1X48A 1WXRA 5KL4A 2EOOA 4NHRA 1T4OA 1A1KA 2V88A 2EOQA 2YRHA 4JI2E 4JV5E 2L2MA 2L92A 2B9DA 5AE3A 5KL5A 2CSHA 1UBDC 3P1XA 5AE2A 2EOSA 5AC5A 4JI6E 2EWLA 4HTGA 1DQ3A 5CFFE 2LE2A 2YU8A 2CT1A 2FTXB 1HNXE 2V83A 2KHXA 1PJTA 1XMQE 3H09A 4P78A 4J8ZA 5A2QC 5KL2A 2YSOA 4BC7A 2LJUA 3HQ1A 2MDGA 2YWQA 4R2PA 1YYOA 4JI8E 2DMIA 4TUIA 1QU6A 2G7HA 1J26A 3VYYA 4I8OA 3MHSC 2VRDA 4M30A 2LRSA 2UUAE 1BBOA 2DLKA 2ZM6E 4ZYDA 3LLHA 2WBUA 3FIGA 2LUQA 4WFTA 5AASA 1PDAA 2EMKA 2WBSA 2RS7A 4B3SE 3KZYA 4DV2E 1BBGA 2RSIA 2V87A 1I94E 1TF3A 2J7JA 4WPYA 3VHTB 5AC4A 3J7Yp 3C4BA 1IBKE 1LLMC 1A1LA 4WXDA 1EH8A 4LFBE 1TN9A 2EN6A 2HC5A 4LF6E 1KJKA 1PJQA 4JI0E 4WYQB 4R03A 4BBYA 2LJHA 2DRPA 1YUIA 1UN6B 4O43A 3EPLA 4JI3E 4BMJA 1HNWE 4DV4E 2F8BA 2V89A 1X6EA 4F6NA 2JOBA 2EMXA 2EPMX 2EPPA 2YRMA 3ADIA 2WBTA 4DMIA 4NXNE 2EJ4A 2PRTA 1UHZA 1IQOA 1SFEA 2YTDA 4R2SA 4DV7E 1X47A 1F2IG 2KOUA 2EMAA 2HHHE 2JPAA 4OX9E 2EPOA 2YPNA 2EORA 3EPJA 2I13A 3EQ1A 2K7IA 2YSPA 2EPNA 4X9JA 2HGHA 5KL6A 4TUGA 2V85A 1XNQE 4JYAE 2EQ3A 2NA2A 4R2AA 4F2JC 2LVHA 2MC5A 2EPRA 2EQ1A 2EPKX 1J5EE 2RPCA 3JTZA 2R1FA 2DMYA 2EPLX 4GEQB 2DSYA 2RSMA 4YY3E 3C4TA 1N32E 1G2DC 2VE7C 1HNZE 2EMYA 2YRKA 3DF6A 4O24A 5KL7A 4LU9A 2DGCA 2GHFA 2EN1A 2V8QB 1N36E 2DLQA 4F9AB 1L4SA 2EMCA 2ODRD 5LL6R 3VK6A 1JK1A 4R2RA 1RMDA 5LLQA 2FV4B 2NABA 5FLXC 2ENAA 4MLVA 4DR4E 2WCC3 2EMWA 3J81C 1G2FC 1X3CA 1DGCA 4RHBB 2L3CA 1B69A 2ODRC 3K6QA 2ADRA 2YTQA 2EN3A 4KWYA 3ZOQB 1YYKA 1RQ0A 2EMHA 2JVAA 3BF2A 2ELZA 1IBLE 2JR1A 1YFHA 2RQLA 2EPCA 1WRJA 3IWBA 1KYQA 5A6AA 2IHR1 1NCSA 2EMFA 3IWCA 1X6HA 2EM9A 4R2DA 2E5LE 1GZ6A 2L2KB 3TQMA 1T4LB 2F4VE 5A6BD 4X66E 1ZBQA 3HPZA 3HPSA 1IMUA 5A6BA 4IS1C 3BBGA 1Z1BA 2GLIA 5KL3A 1MEYC 1T39A 2EN7A 3IWDA 3MHHC 4B3RE 2RS6A 3OMLA 4BS9A 1YZ9A 2B3TB 1AH5A 5IV8B 4M9VC 4DV0E 2YT4A 1N3GA 1T38A 4DR3E 2B7TA 2M1SA 1UILA 4DR1E 4LF4E 4DUZE 4BHBA 4O5GA 1XMOE 2H36X 4ZYGA 2DIXA 2M9AA 1RC7A 4YHHE 1ZAAC 5IWAE 1X49A 2EM8A 4DR6E 1DI2A 2YTEA 1GTKA 3LMLA 2Q8UA 5BR8E 2YTFA 4O4KA 1WHNA 2LBSB 3EPKA 2M4IA 3THNA 2M7QA 2FGGA 4LFCE 4L5NC 1P47A 2YTJA 1A1HA 4X8WA 2YU5A 4DUYE 2EOHA 1A1FA 1GQEA 2EZ6A 1STUA 2VQEE 2JYAA 2WZOA 3THOB 1EH6A 2JWOA 2NUGA 5DNYA 2D9HA 2EPUA 4ZYHA 2EM7A 1QNTA 1ZR9A 2LT7A 2EM5A 4KZSA 2EM3A 4HEIA 4X62E 2YTGA 2EM0A 3ADGA 1N34E 2BB8A 2R76A 1PJSA 2JOXA 3C6KA 2EPXA 5T6JA 1YPNA 2MKDA 4DV3E 4K0KE 2YTOA 4JI1E 4FK5C 2EL6A 2YTIA 1FKAE 4R2QA 2EM6A 3HXLA 2JY9A 2LTRA 4IJDA 4X65E 4F6MA 2NUEA 1EKZA 2EOIA 1WHQA 2EPZA 4LTYA 2MKNA 3C6MA 2I9IA 4DR7E 2N3GA 2E1MA 4LF9E 1FJGE 4B3ME 1X6FA 1T4NA 2ENCA 2MC6A 2N8XA 2YTPA 2N3HA 1IBME 1HR0E 2EE8A 2EOXA 3ECRA 2ENHA 1O0WA 4Q28A 4OOGC 2YZTA 2UUBE 4MLQA 3BIDA 2EL5A 2LTSA 1XNRE 3ADJA 3J80C 5LMNE 4NZVA 2LMZA 3F6GA 5AE1A 1WJPA 4F54A 2EMIA 2EM4A 2UUCE 4X64E 2EMLA 4F9CB 4DV1E 4N4RB 4DR2E 4NXME 4LFAE 2E72A 4JI7E 1EH7A 4WSGA 3EPHA 4GKJE
chains in the Genus database with same CATH topology
5CFFE 2LE2A 2DMYA 2FTXB 5IT9C 1HNXE 2V83A 4DR6E 1DI2A 4WSPA 4GEQB 2DSYA 2KHXA 2RSMA 4YY3E 3OTOE 3H09A 3C4TA 3LMLA 1SR9A 4P78A 3RMPA 1XMQE 5LMUE 1N32E 4J8ZA 5BR8E 2VE7C 5A2QC 2LUPB 1HNZE 4KHPE 4L8NA 3DF6A 1WHNA 2LBSB 4BC7A 2CPNA 4LU9A 4NXME 2M4IA 3HQ1A 2V8QB 1N36E 1YYOA 4DR5E 2VQFE 4JI8E 2M7QA 2FGGA 4TUIA 1QU6A 4F9AB 4GKKE 2G7HA 4B3TE 4LFCE 1J26A 2KONA 1X49A 2L2NA 4L5NC 3J7AG 2ODRD 5LL6R 3VK6A 3VYYA 2V86A 4I8OA 4X8WA 2K4VA 4P7DA 4DUYE 2UXBE 2FV4B 3T1HE 4M30A 2UU9E 2LRSA 5FLXC 2UUAE 3T1YE 1GQEA 2EZ6A 2ZM6E 1STUA 3LLHA 2VQEE 2WZOA 3FIGA 4DR4E 4JV5E 2LUQA 4WFTA 5AASA 3DJWA 2JWOA 2NUFA 2RS7A 5DNYA 4B3SE 3J81C 2NUGA 3JU0A 4BCAA 3ADLA 4DV2E 4JI4E 4F9BB 1N33E 2V87A 2L3CA 1I94E 4WPYA 2ODRC 3J7Yp 4JI5E 3K6QA 3AV0A 3C4BA 4KZSA 1IBKE 2VF1A 3ZOQB 3AUZA 4X62E 4AQYE 3ADGA 1N34E 1YYKA 4M0VA 1RQ0A 2JOXA 2L33A 4LF7E 2JVAA 2L6MA 4R8OA 5T6JA 3KWRA 1IBLE 2L3JA 4LFBE 2UXCE 2L8TA 2MDRA 4LF6E 1HNWE 2JR1A 4DV3E 4JI0E 4LF5E 4K0KE 4WYQB 3JAMC 4R03A 4BBYA 4JI1E 3HTXA 2LJHA 3IWBA 2IHR1 3F6HA 3IWCA 1FKAE 3HXLA 4M2ZA 2JY9A 2LTRA 4X65E 2NUEA 4LF8E 4JI3E 1EKZA 2RTXA 4BMJA 2E5LE 1GZ6A 2L2KB 1T4LB 2F4VE 4X66E 4DV4E 2F8BA 1WHQA 2V89A 1ZBQA 3HPZA 3HPSA 3MSWA 4LTYA 1PKPA 2JOBA 4DKKA 4DR7E 2N3GA 2E1MA 4LF9E 3ADIA 1FJGE 4B3ME 1T4NA 2DB2A 2MC6A 4DMIA 4NXNE 5F3WA 2N3HA 2B7VA 1IBME 1HR0E 1UHZA 3IWDA 2UXDE 1ZBTA 4DV7E 4DV6E 1O0WA 1X47A 2KOUA 4Q28A 4OOGC 1YYWA 2HHHE 4B3RE 2RS6A 3OMLA 2YZTA 4OX9E 4BS9A 2UUBE 1YZ9A 3VYXA 2B3TB 2LTSA 1XNRE 3ADJA 4DV0E 2YT4A 3J80C 5ADZA 5LMNE 4BC9A 2LMZA 4DV5E 3F6GA 1X48A 5AE1A 1WXRA 4DR3E 4F54A 2B7TA 1T4OA 2M1SA 2V88A 4TUGA 4X64E 2UUCE 4F9CB 2V85A 4DV1E 4JI2E 1XNQE 4JYAE 1UILA 4DR2E 4DR1E 4LF4E 2L2MA 2NA2A 4DUZE 4LFAE 1XMOE 2L92A 2B9DA 2H36X 4JI7E 5AE3A 2DIXA 2MC5A 3P1XA 5AE2A 4YHHE 1RC7A 1J5EE 4JI6E 5IWAE 2EWLA 4GKJE 1DQ3A 3JTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFF E;  2DMY A;  4DR6 E;  1HNX E;  1DI2 A;  2KHX A;  2RSM A;  4YY3 E;  3OTO E;  1XMQ E;  3C4T A;  1N32 E;  5LMU E;  5BR8 E;  4KHP E;  1HNZ E;  2LUP B;  1WHN A;  2LBS B;  2CPN A;  1N36 E;  1YYO A;  4DR5 E;  2VQF E;  4JI8 E;  1QU6 A;  4GKK E;  4B3T E;  4LFC E;  1J26 A;  2L2N A;  3VYY A;  4X8W A;  4DUY E;  2UXB E;  3T1H E;  4M30 A;  2UU9 E;  2LRS A;  2UUA E;  3T1Y E;  1GQE A;  2EZ6 A;  2ZM6 E;  1STU A;  3LLH A;  2VQE E;  4DR4 E;  4JV5 E;  2LUQ A;  4WFT A;  2NUF A;  2RS7 A;  2NUG A;  4B3S E;  3ADL A;  1N33 E;  4DV2 E;  4JI4 E;  2L3C A;  1I94 E;  3J7Y p;  4JI5 E;  3C4B A;  1IBK E;  4X62 E;  4AQY E;  3ADG A;  1N34 E;  1YYK A;  1RQ0 A;  2L33 A;  4LF7 E;  2JVA A;  1IBL E;  2UXC E;  2L3J A;  4LFB E;  2MDR A;  4LF6 E;  4DV3 E;  4JI0 E;  4LF5 E;  4K0K E;  4WYQ B;  4JI1 E;  3HTX A;  2LJH A;  2IHR 1;  1FKA E;  4M2Z A;  2JY9 A;  2LTR A;  4X65 E;  2NUE A;  4LF8 E;  4JI3 E;  1EKZ A;  2RTX A;  2E5L E;  2L2K B;  1T4L B;  2F4V E;  4X66 E;  4DV4 E;  1HNW E;  1WHQ A;  1PKP A;  4DKK A;  4DR7 E;  2N3G A;  4LF9 E;  3ADI A;  1FJG E;  4B3M E;  1T4N A;  2DB2 A;  4NXN E;  2N3H A;  2B7V A;  1IBM E;  1HR0 E;  1UHZ A;  2UXD E;  1ZBT A;  4DV7 E;  4DV6 E;  1O0W A;  1X47 A;  4OOG C;  1YYW A;  2HHH E;  4B3R E;  2RS6 A;  4OX9 E;  2UUB E;  1YZ9 A;  3VYX A;  2B3T B;  2LTS A;  1XNR E;  3ADJ A;  4DV0 E;  2YT4 A;  5LMN E;  4DV5 E;  1X48 A;  4DR3 E;  2B7T A;  1T4O A;  2UUC E;  4X64 E;  4DV1 E;  4JI2 E;  1XNQ E;  4JYA E;  1UIL A;  4DR2 E;  4DR1 E;  4LF4 E;  2L2M A;  2NA2 A;  4DUZ E;  4LFA E;  1XMO E;  4NXM E;  4JI7 E;  2DIX A;  3P1X A;  4YHH E;  1RC7 A;  1J5E E;  4JI6 E;  5IWA E;  1X49 A;  4GKJ E; 
#chains in the Genus database with same CATH topology
 5IT9 C;  2A25 A;  2EOF A;  4WSP A;  1TF6 A;  3OTO E;  3RMP A;  1SR9 A;  3J7A G;  5LMU E;  4KHP E;  1MGT A;  2LUP B;  4L8N A;  4WXC A;  2EM2 A;  2CPN A;  1A1G A;  4DR5 E;  2GPI A;  2VQF E;  1A1I A;  4GKK E;  3QG5 C;  2ELY A;  4B3T E;  2KON A;  2L2N A;  1IQS A;  2V86 A;  2EP3 A;  3KZZ A;  2K4V A;  4GZN C;  4P7D A;  2UXB E;  2EMG A;  3T1H E;  2UU9 E;  3T1Y E;  2EOZ A;  2EOJ A;  2YTN A;  3DJW A;  2NUF A;  5A69 A;  3ADL A;  3JU0 A;  4BCA A;  1ZU1 A;  2EPA A;  3UK3 C;  4F9B B;  2JP9 A;  4R2E A;  4JI4 E;  1N33 E;  2EOE A;  2EN2 A;  4JI5 E;  3AV0 A;  5TSE A;  1AAY A;  5A6K A;  2EMB A;  2VF1 A;  3M99 B;  2LCE A;  3AUZ A;  5IXM B;  4AQY E;  2HJJ A;  2EMZ A;  4M0V A;  2EN4 A;  4WX9 A;  2L33 A;  4LF7 E;  2L6M A;  4R8O A;  1BB8 A;  2EOY A;  3KWR A;  1YSA C;  2L3J A;  2UXC E;  3BGH A;  2L8T A;  2MDR A;  4Q35 B;  2CTD A;  2BBG A;  2JXP A;  4LF5 E;  3JAM C;  2LO3 A;  3HTX A;  2EL4 A;  3L00 A;  3F6H A;  4M2Z A;  2EQ0 A;  4LF8 E;  2RTX A;  1A1J A;  3MSW A;  1X5W A;  4ZYE A;  1PKP A;  4R2C A;  4DKK A;  5A6J A;  2DB2 A;  2EN8 A;  5F3W A;  2B7V A;  4BHC A;  2EOM A;  2LV2 A;  2UXD E;  1ZBT A;  4DV6 E;  1YYW A;  1JK2 A;  3VYX A;  1YUJ A;  4RH8 A;  5ADZ A;  4BC9 A;  1NEI A;  4DV5 E;  1X48 A;  1WXR A;  5KL4 A;  2EOO A;  4NHR A;  1T4O A;  1A1K A;  2V88 A;  2EOQ A;  2YRH A;  4JI2 E;  4JV5 E;  2L2M A;  2L92 A;  2B9D A;  5AE3 A;  5KL5 A;  2CSH A;  1UBD C;  3P1X A;  5AE2 A;  2EOS A;  5AC5 A;  4JI6 E;  2EWL A;  4HTG A;  1DQ3 A;  5CFF E;  2LE2 A;  2YU8 A;  2CT1 A;  2FTX B;  1HNX E;  2V83 A;  2KHX A;  1PJT A;  1XMQ E;  3H09 A;  4P78 A;  4J8Z A;  5A2Q C;  5KL2 A;  2YSO A;  4BC7 A;  2LJU A;  3HQ1 A;  2MDG A;  2YWQ A;  4R2P A;  1YYO A;  4JI8 E;  2DMI A;  4TUI A;  1QU6 A;  2G7H A;  1J26 A;  3VYY A;  4I8O A;  3MHS C;  2VRD A;  4M30 A;  2LRS A;  2UUA E;  1BBO A;  2DLK A;  2ZM6 E;  4ZYD A;  3LLH A;  2WBU A;  3FIG A;  2LUQ A;  4WFT A;  5AAS A;  1PDA A;  2EMK A;  2WBS A;  2RS7 A;  4B3S E;  3KZY A;  4DV2 E;  1BBG A;  2RSI A;  2V87 A;  1I94 E;  1TF3 A;  2J7J A;  4WPY A;  3VHT B;  5AC4 A;  3J7Y p;  3C4B A;  1IBK E;  1LLM C;  1A1L A;  4WXD A;  1EH8 A;  4LFB E;  1TN9 A;  2EN6 A;  2HC5 A;  4LF6 E;  1KJK A;  1PJQ A;  4JI0 E;  4WYQ B;  4R03 A;  4BBY A;  2LJH A;  2DRP A;  1YUI A;  1UN6 B;  4O43 A;  3EPL A;  4JI3 E;  4BMJ A;  1HNW E;  4DV4 E;  2F8B A;  2V89 A;  1X6E A;  4F6N A;  2JOB A;  2EMX A;  2EPM X;  2EPP A;  2YRM A;  3ADI A;  2WBT A;  4DMI A;  4NXN E;  2EJ4 A;  2PRT A;  1UHZ A;  1IQO A;  1SFE A;  2YTD A;  4R2S A;  4DV7 E;  1X47 A;  1F2I G;  2KOU A;  2EMA A;  2HHH E;  2JPA A;  4OX9 E;  2EPO A;  2YPN A;  2EOR A;  3EPJ A;  2I13 A;  3EQ1 A;  2K7I A;  2YSP A;  2EPN A;  4X9J A;  2HGH A;  5KL6 A;  4TUG A;  2V85 A;  1XNQ E;  4JYA E;  2EQ3 A;  2NA2 A;  4R2A A;  4F2J C;  2LVH A;  2MC5 A;  2EPR A;  2EQ1 A;  2EPK X;  1J5E E;  2RPC A;  3JTZ A;  2R1F A;  2DMY A;  2EPL X;  4GEQ B;  2DSY A;  2RSM A;  4YY3 E;  3C4T A;  1N32 E;  1G2D C;  2VE7 C;  1HNZ E;  2EMY A;  2YRK A;  3DF6 A;  4O24 A;  5KL7 A;  4LU9 A;  2DGC A;  2GHF A;  2EN1 A;  2V8Q B;  1N36 E;  2DLQ A;  4F9A B;  1L4S A;  2EMC A;  2ODR D;  5LL6 R;  3VK6 A;  1JK1 A;  4R2R A;  1RMD A;  5LLQ A;  2FV4 B;  2NAB A;  5FLX C;  2ENA A;  4MLV A;  4DR4 E;  2WCC 3;  2EMW A;  3J81 C;  1G2F C;  1X3C A;  1DGC A;  4RHB B;  2L3C A;  1B69 A;  2ODR C;  3K6Q A;  2ADR A;  2YTQ A;  2EN3 A;  4KWY A;  3ZOQ B;  1YYK A;  1RQ0 A;  2EMH A;  2JVA A;  3BF2 A;  2ELZ A;  1IBL E;  2JR1 A;  1YFH A;  2RQL A;  2EPC A;  1WRJ A;  3IWB A;  1KYQ A;  5A6A A;  2IHR 1;  1NCS A;  2EMF A;  3IWC A;  1X6H A;  2EM9 A;  4R2D A;  2E5L E;  1GZ6 A;  2L2K B;  3TQM A;  1T4L B;  2F4V E;  5A6B D;  4X66 E;  1ZBQ A;  3HPZ A;  3HPS A;  1IMU A;  5A6B A;  4IS1 C;  3BBG A;  1Z1B A;  2GLI A;  5KL3 A;  1MEY C;  1T39 A;  2EN7 A;  3IWD A;  3MHH C;  4B3R E;  2RS6 A;  3OML A;  4BS9 A;  1YZ9 A;  2B3T B;  1AH5 A;  5IV8 B;  4M9V C;  4DV0 E;  2YT4 A;  1N3G A;  1T38 A;  4DR3 E;  2B7T A;  2M1S A;  1UIL A;  4DR1 E;  4LF4 E;  4DUZ E;  4BHB A;  4O5G A;  1XMO E;  2H36 X;  4ZYG A;  2DIX A;  2M9A A;  1RC7 A;  4YHH E;  1ZAA C;  5IWA E;  1X49 A;  2EM8 A;  4DR6 E;  1DI2 A;  2YTE A;  1GTK A;  3LML A;  2Q8U A;  5BR8 E;  2YTF A;  4O4K A;  1WHN A;  2LBS B;  3EPK A;  2M4I A;  3THN A;  2M7Q A;  2FGG A;  4LFC E;  4L5N C;  1P47 A;  2YTJ A;  1A1H A;  4X8W A;  2YU5 A;  4DUY E;  2EOH A;  1A1F A;  1GQE A;  2EZ6 A;  1STU A;  2VQE E;  2JYA A;  2WZO A;  3THO B;  1EH6 A;  2JWO A;  2NUG A;  5DNY A;  2D9H A;  2EPU A;  4ZYH A;  2EM7 A;  1QNT A;  1ZR9 A;  2LT7 A;  2EM5 A;  4KZS A;  2EM3 A;  4HEI A;  4X62 E;  2YTG A;  2EM0 A;  3ADG A;  1N34 E;  2BB8 A;  2R76 A;  1PJS A;  2JOX A;  3C6K A;  2EPX A;  5T6J A;  1YPN A;  2MKD A;  4DV3 E;  4K0K E;  2YTO A;  4JI1 E;  4FK5 C;  2EL6 A;  2YTI A;  1FKA E;  4R2Q A;  2EM6 A;  3HXL A;  2JY9 A;  2LTR A;  4IJD A;  4X65 E;  4F6M A;  2NUE A;  1EKZ A;  2EOI A;  1WHQ A;  2EPZ A;  4LTY A;  2MKN A;  3C6M A;  2I9I A;  4DR7 E;  2N3G A;  2E1M A;  4LF9 E;  1FJG E;  4B3M E;  1X6F A;  1T4N A;  2ENC A;  2MC6 A;  2N8X A;  2YTP A;  2N3H A;  1IBM E;  1HR0 E;  2EE8 A;  2EOX A;  3ECR A;  2ENH A;  1O0W A;  4Q28 A;  4OOG C;  2YZT A;  2UUB E;  4MLQ A;  3BID A;  2EL5 A;  2LTS A;  1XNR E;  3ADJ A;  3J80 C;  5LMN E;  4NZV A;  2LMZ A;  3F6G A;  5AE1 A;  1WJP A;  4F54 A;  2EMI A;  2EM4 A;  2UUC E;  4X64 E;  2EML A;  4F9C B;  4DV1 E;  4N4R B;  4DR2 E;  4NXM E;  4LFA E;  2E72 A;  4JI7 E;  1EH7 A;  4WSG A;  3EPH A;  4GKJ E; 
#chains in the Genus database with same CATH homology
 5CFF E;  2LE2 A;  2DMY A;  2FTX B;  5IT9 C;  1HNX E;  2V83 A;  4DR6 E;  1DI2 A;  4WSP A;  4GEQ B;  2DSY A;  2KHX A;  2RSM A;  4YY3 E;  3OTO E;  3H09 A;  3C4T A;  3LML A;  1SR9 A;  4P78 A;  3RMP A;  1XMQ E;  5LMU E;  1N32 E;  4J8Z A;  5BR8 E;  2VE7 C;  5A2Q C;  2LUP B;  1HNZ E;  4KHP E;  4L8N A;  3DF6 A;  1WHN A;  2LBS B;  4BC7 A;  2CPN A;  4LU9 A;  4NXM E;  2M4I A;  3HQ1 A;  2V8Q B;  1N36 E;  1YYO A;  4DR5 E;  2VQF E;  4JI8 E;  2M7Q A;  2FGG A;  4TUI A;  1QU6 A;  4F9A B;  4GKK E;  2G7H A;  4B3T E;  4LFC E;  1J26 A;  2KON A;  1X49 A;  2L2N A;  4L5N C;  3J7A G;  2ODR D;  5LL6 R;  3VK6 A;  3VYY A;  2V86 A;  4I8O A;  4X8W A;  2K4V A;  4P7D A;  4DUY E;  2UXB E;  2FV4 B;  3T1H E;  4M30 A;  2UU9 E;  2LRS A;  5FLX C;  2UUA E;  3T1Y E;  1GQE A;  2EZ6 A;  2ZM6 E;  1STU A;  3LLH A;  2VQE E;  2WZO A;  3FIG A;  4DR4 E;  4JV5 E;  2LUQ A;  4WFT A;  5AAS A;  3DJW A;  2JWO A;  2NUF A;  2RS7 A;  5DNY A;  4B3S E;  3J81 C;  2NUG A;  3JU0 A;  4BCA A;  3ADL A;  4DV2 E;  4JI4 E;  4F9B B;  1N33 E;  2V87 A;  2L3C A;  1I94 E;  4WPY A;  2ODR C;  3J7Y p;  4JI5 E;  3K6Q A;  3AV0 A;  3C4B A;  4KZS A;  1IBK E;  2VF1 A;  3ZOQ B;  3AUZ A;  4X62 E;  4AQY E;  3ADG A;  1N34 E;  1YYK A;  4M0V A;  1RQ0 A;  2JOX A;  2L33 A;  4LF7 E;  2JVA A;  2L6M A;  4R8O A;  5T6J A;  3KWR A;  1IBL E;  2L3J A;  4LFB E;  2UXC E;  2L8T A;  2MDR A;  4LF6 E;  1HNW E;  2JR1 A;  4DV3 E;  4JI0 E;  4LF5 E;  4K0K E;  4WYQ B;  3JAM C;  4R03 A;  4BBY A;  4JI1 E;  3HTX A;  2LJH A;  3IWB A;  2IHR 1;  3F6H A;  3IWC A;  1FKA E;  3HXL A;  4M2Z A;  2JY9 A;  2LTR A;  4X65 E;  2NUE A;  4LF8 E;  4JI3 E;  1EKZ A;  2RTX A;  4BMJ A;  2E5L E;  1GZ6 A;  2L2K B;  1T4L B;  2F4V E;  4X66 E;  4DV4 E;  2F8B A;  1WHQ A;  2V89 A;  1ZBQ A;  3HPZ A;  3HPS A;  3MSW A;  4LTY A;  1PKP A;  2JOB A;  4DKK A;  4DR7 E;  2N3G A;  2E1M A;  4LF9 E;  3ADI A;  1FJG E;  4B3M E;  1T4N A;  2DB2 A;  2MC6 A;  4DMI A;  4NXN E;  5F3W A;  2N3H A;  2B7V A;  1IBM E;  1HR0 E;  1UHZ A;  3IWD A;  2UXD E;  1ZBT A;  4DV7 E;  4DV6 E;  1O0W A;  1X47 A;  2KOU A;  4Q28 A;  4OOG C;  1YYW A;  2HHH E;  4B3R E;  2RS6 A;  3OML A;  2YZT A;  4OX9 E;  4BS9 A;  2UUB E;  1YZ9 A;  3VYX A;  2B3T B;  2LTS A;  1XNR E;  3ADJ A;  4DV0 E;  2YT4 A;  3J80 C;  5ADZ A;  5LMN E;  4BC9 A;  2LMZ A;  4DV5 E;  3F6G A;  1X48 A;  5AE1 A;  1WXR A;  4DR3 E;  4F54 A;  2B7T A;  1T4O A;  2M1S A;  2V88 A;  4TUG A;  4X64 E;  2UUC E;  4F9C B;  2V85 A;  4DV1 E;  4JI2 E;  1XNQ E;  4JYA E;  1UIL A;  4DR2 E;  4DR1 E;  4LF4 E;  2L2M A;  2NA2 A;  4DUZ E;  4LFA E;  1XMO E;  2L92 A;  2B9D A;  2H36 X;  4JI7 E;  5AE3 A;  2DIX A;  2MC5 A;  3P1X A;  5AE2 A;  4YHH E;  1RC7 A;  1J5E E;  4JI6 E;  5IWA E;  2EWL A;  4GKJ E;  1DQ3 A;  3JTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...