2LBSB

Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with aagu tetraloop hairpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Yeast RNase III dsRBD Complex with a Noncanonical RNA Substrate Provides New Insights into Binding Specificity of dsRBDs.
pubmed doi rcsb
molecule keywords RNA (32-MER)
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lbsB00
4DV3E 4JI7E 4X66E 1XMQE 4DV4E 2UUCE 2LUPB 2CPNA 2RS6A 2JY9A 1YYOA 4LF7E 2L2NA 1WHNA 4JV5E 3P1XA 4JI0E 4DR4E 2JVAA 4DV6E 1X49A 1N33E 1FKAE 1HR0E 4DR6E 2UXBE 2B7TA 1N36E 4JI3E 4DV0E 1J26A 1HNWE 4B3RE 1IBKE 4JI8E 2L3CA 4GKKE 2N3HA 2LJHA 4YHHE 4DR5E 4B3ME 1XNRE 4DR7E 4AQYE 4GKJE 4LF4E 1YYWA 1XNQE 1GQEA 2LRSA 3T1YE 4KHPE 4DV7E 3HTXA 2RTXA 4X64E 1T4OA 4JI6E 4DV5E 1WHQA 4JI1E 5BR8E 1YYKA 5IWAE 5LMUE 4B3SE 1IBME 2L33A 2ZM6E 4YY3E 1DI2A 2LTRA 2UU9E 1T4LB 2NA2A 2L2MA 3LLHA 4DR3E 3ADIA 4OX9E 2LTSA 4M30A 1UHZA 2UXDE 2LUQA 1T4NA 4LFAE 1RC7A 2NUEA 2DB2A 4LF8E 1J5EE 5CFFE 4NXME 3OTOE 4K0KE 4JI4E 1HNZE 4X62E 2UXCE 4DUZE 2NUFA 3J7Yp 1RQ0A 1I94E 2IHR1 4LFBE 3C4BA 4JYAE 2F4VE 4LF5E 3VYYA 4LFCE 3ADLA 1EKZA 1PKPA 1XMOE 2N3GA 4JI5E 4DV2E 2RS7A 2E5LE 2B7VA 4B3TE 1STUA 2KHXA 1N32E 2MDRA 1IBLE 1YZ9A 4LF9E 4X8WA 1QU6A 4WYQB 2L3JA 4JI2E 1X48A 2UUAE 1N34E 1HNXE 4OOGC 4DV1E 3VYXA 1ZBTA 3T1HE 2RSMA 2VQFE 4DR1E 3ADJA 1X47A 4LF6E 2LBSB 2B3TB 3ADGA 2UUBE 2VQEE 5LMNE 1FJGE 4X65E 4NXNE 2DMYA 1O0WA 4DKKA 2NUGA 4WFTA 4DR2E 1UILA 2DIXA 2L2KB 4DUYE 2EZ6A 2YT4A 2HHHE 4M2ZA 3C4TA
chains in the Genus database with same CATH superfamily
5A6BA 4DV3E 3TQMA 4X66E 4DV4E 2RS6A 2EN4A 2EOIA 1YYOA 3H09A 4LF7E 4P78A 4JI0E 2EPRA 4DR4E 3UK3C 4DV6E 2EPXA 2EMXA 1FKAE 3BGHA 2BB8A 2EPLX 1G2DC 4JI3E 2EMAA 1J26A 1DQ3A 4MLQA 4JI8E 2N3HA 2EOXA 2FGGA 2D9HA 3DJWA 4LF4E 1YYWA 2EN7A 4GEQB 1XNQE 2LV2A 4WPYA 4N4RB 2RTXA 1YUIA 1T4OA 3J80C 2DGCA 4DV5E 2G7HA 2DLKA 2JPAA 5T6JA 1PJTA 5LMUE 1IBME 2V87A 2WBTA 5AC4A 2YRMA 4LTYA 3ADIA 3AV0A 4O24A 2EMGA 2EPAA 2Q8UA 3IWBA 2YSPA 4M30A 4TUIA 1G2FC 1TN9A 2LUQA 1X5WA 1B69A 2LMZA 2DB2A 1A1HA 2JYAA 4R2EA 3THOB 4DUZE 1PJSA 2HGHA 2NUFA 1EH8A 4BC7A 1WRJA 1KYQA 2N8XA 2YZTA 3C4BA 4BC9A 2BBGA 1MEYC 1JK2A 3VYYA 1PKPA 4BCAA 4DV2E 2E5LE 1STUA 3DF6A 1IQSA 1P47A 1IBLE 2HJJA 4LF9E 4X8WA 1L4SA 1QU6A 2EOQA 2GHFA 2B9DA 1X48A 2UUAE 3VK6A 2FTXB 5LL6R 2YTOA 2MKDA 3T1HE 2RSMA 3THNA 2VQFE 3ADGA 2RSIA 3IWDA 2VQEE 2EN2A 5TSEA 4X65E 2ODRD 3C6KA 4LU9A 3J7AG 4R8OA 4GZNC 4NHRA 2CTDA 2HHHE 2I9IA 4JI7E 2H36X 2HC5A 1SR9A 3ECRA 2CPNA 2JY9A 2L2NA 1WHNA 5KL7A 2YRKA 2K4VA 5LLQA 2LVHA 2YRHA 1N33E 2EMCA 2JOBA 1IBKE 2L3CA 4GKKE 2JP9A 2EN1A 4AQYE 4GKJE 2K7IA 2JWOA 2LRSA 4DV7E 3HTXA 4X64E 4FK5C 1EH7A 4HTGA 4R2RA 1DGCA 1WHQA 4WX9A 2EOOA 3MHHC 5IWAE 3QG5C 2EMHA 2V8QB 4F54A 1ZAAC 2DLQA 3HXLA 2LTRA 1T4LB 3C6MA 3LLHA 4DR3E 2EQ3A 1UHZA 2EORA 2M4IA 4LFAE 2LE2A 1RC7A 2NUEA 2EMWA 4LF8E 4NXME 4I8OA 1HNZE 4X62E 2YPNA 2YU5A 2UXCE 2YTNA 3J7Yp 5AE1A 2YWQA 1PJQA 5FLXC 4LFBE 4ZYHA 4JYAE 2EPCA 3JU0A 1A1FA 3LMLA 4LFCE 2EMKA 4ZYGA 2LT7A 1EKZA 3ADLA 2V89A 2YTIA 1GTKA 5IT9C 4JI5E 2RS7A 4R2PA 2FV4B 2MDGA 3OMLA 2CT1A 2ENCA 1YPNA 5A6AA 1YZ9A 2EM4A 4KWYA 3F6GA 1N34E 2YTPA 1HNXE 3JAMC 1LLMC 2EOYA 4BHBA 4TUGA 4F2JC 2B3TB 4BBYA 2EPZA 4M9VC 4IS1C 1X6FA 2DMYA 4L8NA 2L92A 4DKKA 2NUGA 2ODRC 2L2KB 4DUYE 2EZ6A 1A1JA 2F8BA 4RH8A 3KZYA 2ELYA 4Q28A 1A1IA 2ADRA 2VE7C 2EL5A 2EM9A 2EOFA 2KONA 2LUPB 2EM3A 1A1KA 4R03A 4JV5E 3P1XA 1N3GA 1JK1A 5A2QC 1X49A 1HR0E 2UXBE 5KL4A 1N36E 1MGTA 2JR1A 4DV0E 2EPUA 2DSYA 1F2IG 2EOZA 1SFEA 2DRPA 4B3RE 1IQOA 2LJHA 2EPOA 4M0VA 2EOEA 4DR5E 3EPLA 1XNRE 4ZYDA 3KZZA 2EPMX 2V85A 1GQEA 3T1YE 5IV8B 4JI6E 5AASA 1BBOA 3ZOQB 4JI1E 2YU8A 2EWLA 2YTJA 2EMYA 1YYKA 1BB8A 1ZBQA 2LJUA 2NABA 2E72A 3MSWA 5IXMB 4YY3E 2UU9E 2NA2A 2L2MA 3KWRA 1ZR9A 2EQ0A 2M1SA 2PRTA 4F6MA 4MLVA 2EMZA 4R2CA 2UXDE 2EMBA 1T4NA 3K6QA 2EPKX 1BBGA 4WSGA 2WBSA 1J5EE 4K0KE 1PDAA 4JI4E 3MHSC 1X6HA 4L5NC 1WJPA 2DMIA 2EN8A 2EOMA 5ADZA 5A6KA 2F4VE 1YFHA 4O4KA 3EPJA 5DNYA 3F6HA 1WXRA 2ENHA 1XMOE 2YTDA 2V83A 3AUZA 2WZOA 3RMPA 2B7VA 4BHCA 4R2SA 2EL4A 5F3WA 4B3TE 2KHXA 1N32E 3FIGA 2MDRA 4IJDA 2EOJA 4WYQB 2EM6A 4BMJA 2YSOA 4WXDA 4R2AA 2L8TA 2EM2A 3VHTB 1ZBTA 1YSAC 3L00A 2M7QA 1UN6B 3ADJA 2EMFA 2MC5A 1TF3A 2UUBE 5KL3A 3EPHA 1FJGE 4NXNE 2ELZA 4BS9A 2MC6A 5A6JA 4WFTA 1AAYA 2VRDA 1UILA 2RQLA 4F9AB 2GPIA 4M2ZA 5AE2A 5KL6A 2EQ1A 4DR1E 2EMIA 2L6MA 1XMQE 2UUCE 2CSHA 4WSPA 1ZU1A 2M9AA 4KZSA 5KL2A 2JVAA 3EPKA 4DR6E 4WXCA 2B7TA 2RPCA 5KL5A 2EM5A 1HNWE 4DMIA 2GLIA 1YUJA 2YTFA 2EN3A 4YHHE 4B3ME 2LCEA 4DR7E 4R2QA 1T39A 2EP3A 1T38A 1EH6A 4KHPE 2ENAA 2R76A 4X9JA 2I13A 4O43A 2EE8A 5BR8E 2KOUA 4B3SE 1NEIA 2JOXA 3HQ1A 2EM8A 1X3CA 2L33A 3IWCA 2ZM6E 2MKNA 1DI2A 2YTEA 1GZ6A 4F9BB 4OX9E 4F9CB 2EL6A 2LTSA 2J7JA 2EN6A 4O5GA 2EM7A 1A1GA 2E1MA 1TF6A 3EQ1A 2EM0A 3BF2A 5AC5A 2A25A 5AE3A 5CFFE 3OTOE 2YTQA 1Z1BA 2EOSA 2EJ4A 1RQ0A 3HPZA 3JTZA 4ZYEA 1I94E 2IHR1 1X6EA 2WBUA 2WCC3 4LF5E 1KJKA 1NCSA 2EOHA 4J8ZA 2N3GA 4P7DA 3BBGA 4NZVA 2EPPA 2V88A 4F6NA 2VF1A 1AH5A 1A1LA 4Q35B 2YTGA 2R1FA 2L3JA 2JXPA 1QNTA 4JI2E 1UBDC 4HEIA 4OOGC 4DV1E 3VYXA 1IMUA 4RHBB 2V86A 3M99B 1X47A 4LF6E 2LBSB 5A69A 5LMNE 2EMLA 2LO3A 1O0WA 3HPSA 3J81C 1RMDA 4DR2E 4R2DA 2DIXA 5A6BD 2EPNA 2YT4A 3BIDA 3C4TA
chains in the Genus database with same CATH topology
4DV3E 2VE7C 4JI7E 2H36X 2L6MA 1SR9A 4X66E 1XMQE 2KONA 4DV4E 2LUPB 2CPNA 2RS6A 2JY9A 1YYOA 4WSPA 2UUCE 3H09A 2L2NA 4LF7E 1WHNA 4KZSA 2UXDE 4R03A 4JV5E 4P78A 2K4VA 3P1XA 4JI0E 4DR4E 2JVAA 4DV6E 5A2QC 1X49A 1N33E 1FKAE 1HR0E 4DR6E 2UXBE 2B7TA 1N36E 4JI3E 2JR1A 2JOBA 4DV0E 1J26A 1HNWE 2DSYA 4DMIA 4B3RE 1DQ3A 1IBKE 4JI8E 2L3CA 4GKKE 2N3HA 2LJHA 4M0VA 4YHHE 4DR5E 4B3ME 1XNRE 2FGGA 4DR7E 4AQYE 4GKJE 3DJWA 4LF4E 1YYWA 2V85A 4GEQB 1XNQE 1GQEA 4WPYA 2JWOA 2LRSA 3T1YE 4KHPE 4DV7E 3HTXA 2RTXA 4X64E 1T4OA 4JI6E 5AASA 3J80C 4DV5E 3ZOQB 2G7HA 1WHQA 4JI1E 5T6JA 2EWLA 5BR8E 1YYKA 5IWAE 1ZBQA 2KOUA 5LMUE 4B3SE 2JOXA 3HQ1A 1IBME 2V8QB 4F54A 2V87A 3MSWA 2L33A 3IWCA 2ZM6E 4YY3E 3HXLA 2LTRA 1DI2A 2UU9E 1T4LB 4LTYA 2NA2A 1GZ6A 2L2MA 3KWRA 3LLHA 4DR3E 3ADIA 4F9BB 3AV0A 4OX9E 4F9CB 2LTSA 2M1SA 3IWBA 4M30A 1UHZA 2M4IA 4TUIA 2LUQA 1T4NA 2LE2A 2E1MA 3K6QA 1RC7A 4LFAE 2NUEA 2LMZA 2DB2A 4LF8E 5AE3A 5CFFE 1J5EE 3OTOE 4NXME 4K0KE 4I8OA 4JI4E 1HNZE 4X62E 2UXCE 4DUZE 2NUFA 3J7Yp 1RQ0A 4L5NC 5AE1A 4BC7A 5FLXC 3HPZA 3JTZA 1I94E 2IHR1 2YZTA 4LFBE 3C4BA 4BC9A 3JU0A 5ADZA 4JYAE 2F4VE 4LF5E 3VYYA 3LMLA 4LFCE 3ADLA 1EKZA 5DNYA 3F6HA 1PKPA 2V89A 4J8ZA 1WXRA 2N3GA 4P7DA 1XMOE 4BCAA 4DV2E 2RS7A 2V83A 3AUZA 5IT9C 2FV4B 2WZOA 2B7VA 3RMPA 2E5LE 3OMLA 5F3WA 2V88A 1STUA 2VF1A 2KHXA 4B3TE 3FIGA 2MDRA 3DF6A 1N32E 1IBLE 1YZ9A 4LF9E 4X8WA 1QU6A 4WYQB 2L3JA 4BMJA 3F6GA 2B9DA 1X48A 4JI2E 2UUAE 1N34E 3VK6A 2FTXB 1HNXE 5LL6R 4OOGC 3JAMC 2L8TA 4DV1E 3VYXA 1ZBTA 3T1HE 2V86A 2RSMA 2M7QA 2VQFE 4DR1E 3ADJA 1X47A 4TUGA 2LBSB 4LF6E 2B3TB 2MC5A 3ADGA 3IWDA 4BBYA 2UUBE 2VQEE 5LMNE 1FJGE 4X65E 4NXNE 2DMYA 1O0WA 4L8NA 2ODRD 2L92A 3HPSA 4DKKA 3J81C 2NUGA 2ODRC 2MC6A 4BS9A 4LU9A 4WFTA 4DR2E 3J7AG 1UILA 2DIXA 2L2KB 4R8OA 4DUYE 2EZ6A 4F9AB 2F8BA 2YT4A 2HHHE 4M2ZA 4Q28A 5AE2A 4JI5E 3C4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 E;  4JI7 E;  4X66 E;  1XMQ E;  4DV4 E;  2UUC E;  2LUP B;  2CPN A;  2RS6 A;  2JY9 A;  1YYO A;  4LF7 E;  2L2N A;  1WHN A;  4JV5 E;  3P1X A;  4JI0 E;  4DR4 E;  2JVA A;  4DV6 E;  1X49 A;  1N33 E;  1FKA E;  1HR0 E;  4DR6 E;  2UXB E;  2B7T A;  1N36 E;  4JI3 E;  4DV0 E;  1J26 A;  1HNW E;  4B3R E;  1IBK E;  4JI8 E;  2L3C A;  4GKK E;  2N3H A;  2LJH A;  4YHH E;  4DR5 E;  4B3M E;  1XNR E;  4DR7 E;  4AQY E;  4GKJ E;  4LF4 E;  1YYW A;  1XNQ E;  1GQE A;  2LRS A;  3T1Y E;  4KHP E;  4DV7 E;  3HTX A;  2RTX A;  4X64 E;  1T4O A;  4JI6 E;  4DV5 E;  1WHQ A;  4JI1 E;  5BR8 E;  1YYK A;  5IWA E;  5LMU E;  4B3S E;  1IBM E;  2L33 A;  2ZM6 E;  4YY3 E;  1DI2 A;  2LTR A;  2UU9 E;  1T4L B;  2NA2 A;  2L2M A;  3LLH A;  4DR3 E;  3ADI A;  4OX9 E;  2LTS A;  4M30 A;  1UHZ A;  2UXD E;  2LUQ A;  1T4N A;  4LFA E;  1RC7 A;  2NUE A;  2DB2 A;  4LF8 E;  1J5E E;  5CFF E;  4NXM E;  3OTO E;  4K0K E;  4JI4 E;  1HNZ E;  4X62 E;  2UXC E;  4DUZ E;  2NUF A;  3J7Y p;  1RQ0 A;  1I94 E;  2IHR 1;  4LFB E;  3C4B A;  4JYA E;  2F4V E;  4LF5 E;  3VYY A;  4LFC E;  3ADL A;  1EKZ A;  1PKP A;  1XMO E;  2N3G A;  4JI5 E;  4DV2 E;  2RS7 A;  2E5L E;  2B7V A;  4B3T E;  1STU A;  2KHX A;  1N32 E;  2MDR A;  1IBL E;  1YZ9 A;  4LF9 E;  4X8W A;  1QU6 A;  4WYQ B;  2L3J A;  4JI2 E;  1X48 A;  2UUA E;  1N34 E;  1HNX E;  4OOG C;  4DV1 E;  3VYX A;  1ZBT A;  3T1H E;  2RSM A;  2VQF E;  4DR1 E;  3ADJ A;  1X47 A;  4LF6 E;  2LBS B;  2B3T B;  3ADG A;  2UUB E;  2VQE E;  5LMN E;  1FJG E;  4X65 E;  4NXN E;  2DMY A;  1O0W A;  4DKK A;  2NUG A;  4WFT A;  4DR2 E;  1UIL A;  2DIX A;  2L2K B;  4DUY E;  2EZ6 A;  2YT4 A;  2HHH E;  4M2Z A;  3C4T A; 
#chains in the Genus database with same CATH topology
 5A6B A;  4DV3 E;  3TQM A;  4X66 E;  4DV4 E;  2RS6 A;  2EN4 A;  2EOI A;  1YYO A;  3H09 A;  4LF7 E;  4P78 A;  4JI0 E;  2EPR A;  4DR4 E;  3UK3 C;  4DV6 E;  2EPX A;  2EMX A;  1FKA E;  3BGH A;  2BB8 A;  2EPL X;  1G2D C;  4JI3 E;  2EMA A;  1J26 A;  1DQ3 A;  4MLQ A;  4JI8 E;  2N3H A;  2EOX A;  2FGG A;  2D9H A;  3DJW A;  4LF4 E;  1YYW A;  2EN7 A;  4GEQ B;  1XNQ E;  2LV2 A;  4WPY A;  4N4R B;  2RTX A;  1YUI A;  1T4O A;  3J80 C;  2DGC A;  4DV5 E;  2G7H A;  2DLK A;  2JPA A;  5T6J A;  1PJT A;  5LMU E;  1IBM E;  2V87 A;  2WBT A;  5AC4 A;  2YRM A;  4LTY A;  3ADI A;  3AV0 A;  4O24 A;  2EMG A;  2EPA A;  2Q8U A;  3IWB A;  2YSP A;  4M30 A;  4TUI A;  1G2F C;  1TN9 A;  2LUQ A;  1X5W A;  1B69 A;  2LMZ A;  2DB2 A;  1A1H A;  2JYA A;  4R2E A;  3THO B;  4DUZ E;  1PJS A;  2HGH A;  2NUF A;  1EH8 A;  4BC7 A;  1WRJ A;  1KYQ A;  2N8X A;  2YZT A;  3C4B A;  4BC9 A;  2BBG A;  1MEY C;  1JK2 A;  3VYY A;  1PKP A;  4BCA A;  4DV2 E;  2E5L E;  1STU A;  3DF6 A;  1IQS A;  1P47 A;  1IBL E;  2HJJ A;  4LF9 E;  4X8W A;  1L4S A;  1QU6 A;  2EOQ A;  2GHF A;  2B9D A;  1X48 A;  2UUA E;  3VK6 A;  2FTX B;  5LL6 R;  2YTO A;  2MKD A;  3T1H E;  2RSM A;  3THN A;  2VQF E;  3ADG A;  2RSI A;  3IWD A;  2VQE E;  2EN2 A;  5TSE A;  4X65 E;  2ODR D;  3C6K A;  4LU9 A;  3J7A G;  4R8O A;  4GZN C;  4NHR A;  2CTD A;  2HHH E;  2I9I A;  4JI7 E;  2H36 X;  2HC5 A;  1SR9 A;  3ECR A;  2CPN A;  2JY9 A;  2L2N A;  1WHN A;  5KL7 A;  2YRK A;  2K4V A;  5LLQ A;  2LVH A;  2YRH A;  1N33 E;  2EMC A;  2JOB A;  1IBK E;  2L3C A;  4GKK E;  2JP9 A;  2EN1 A;  4AQY E;  4GKJ E;  2K7I A;  2JWO A;  2LRS A;  4DV7 E;  3HTX A;  4X64 E;  4FK5 C;  1EH7 A;  4HTG A;  4R2R A;  1DGC A;  1WHQ A;  4WX9 A;  2EOO A;  3MHH C;  5IWA E;  3QG5 C;  2EMH A;  2V8Q B;  4F54 A;  1ZAA C;  2DLQ A;  3HXL A;  2LTR A;  1T4L B;  3C6M A;  3LLH A;  4DR3 E;  2EQ3 A;  1UHZ A;  2EOR A;  2M4I A;  4LFA E;  2LE2 A;  1RC7 A;  2NUE A;  2EMW A;  4LF8 E;  4NXM E;  4I8O A;  1HNZ E;  4X62 E;  2YPN A;  2YU5 A;  2UXC E;  2YTN A;  3J7Y p;  5AE1 A;  2YWQ A;  1PJQ A;  5FLX C;  4LFB E;  4ZYH A;  4JYA E;  2EPC A;  3JU0 A;  1A1F A;  3LML A;  4LFC E;  2EMK A;  4ZYG A;  2LT7 A;  1EKZ A;  3ADL A;  2V89 A;  2YTI A;  1GTK A;  5IT9 C;  4JI5 E;  2RS7 A;  4R2P A;  2FV4 B;  2MDG A;  3OML A;  2CT1 A;  2ENC A;  1YPN A;  5A6A A;  1YZ9 A;  2EM4 A;  4KWY A;  3F6G A;  1N34 E;  2YTP A;  1HNX E;  3JAM C;  1LLM C;  2EOY A;  4BHB A;  4TUG A;  4F2J C;  2B3T B;  4BBY A;  2EPZ A;  4M9V C;  4IS1 C;  1X6F A;  2DMY A;  4L8N A;  2L92 A;  4DKK A;  2NUG A;  2ODR C;  2L2K B;  4DUY E;  2EZ6 A;  1A1J A;  2F8B A;  4RH8 A;  3KZY A;  2ELY A;  4Q28 A;  1A1I A;  2ADR A;  2VE7 C;  2EL5 A;  2EM9 A;  2EOF A;  2KON A;  2LUP B;  2EM3 A;  1A1K A;  4R03 A;  4JV5 E;  3P1X A;  1N3G A;  1JK1 A;  5A2Q C;  1X49 A;  1HR0 E;  2UXB E;  5KL4 A;  1N36 E;  1MGT A;  2JR1 A;  4DV0 E;  2EPU A;  2DSY A;  1F2I G;  2EOZ A;  1SFE A;  2DRP A;  4B3R E;  1IQO A;  2LJH A;  2EPO A;  4M0V A;  2EOE A;  4DR5 E;  3EPL A;  1XNR E;  4ZYD A;  3KZZ A;  2EPM X;  2V85 A;  1GQE A;  3T1Y E;  5IV8 B;  4JI6 E;  5AAS A;  1BBO A;  3ZOQ B;  4JI1 E;  2YU8 A;  2EWL A;  2YTJ A;  2EMY A;  1YYK A;  1BB8 A;  1ZBQ A;  2LJU A;  2NAB A;  2E72 A;  3MSW A;  5IXM B;  4YY3 E;  2UU9 E;  2NA2 A;  2L2M A;  3KWR A;  1ZR9 A;  2EQ0 A;  2M1S A;  2PRT A;  4F6M A;  4MLV A;  2EMZ A;  4R2C A;  2UXD E;  2EMB A;  1T4N A;  3K6Q A;  2EPK X;  1BBG A;  4WSG A;  2WBS A;  1J5E E;  4K0K E;  1PDA A;  4JI4 E;  3MHS C;  1X6H A;  4L5N C;  1WJP A;  2DMI A;  2EN8 A;  2EOM A;  5ADZ A;  5A6K A;  2F4V E;  1YFH A;  4O4K A;  3EPJ A;  5DNY A;  3F6H A;  1WXR A;  2ENH A;  1XMO E;  2YTD A;  2V83 A;  3AUZ A;  2WZO A;  3RMP A;  2B7V A;  4BHC A;  4R2S A;  2EL4 A;  5F3W A;  4B3T E;  2KHX A;  1N32 E;  3FIG A;  2MDR A;  4IJD A;  2EOJ A;  4WYQ B;  2EM6 A;  4BMJ A;  2YSO A;  4WXD A;  4R2A A;  2L8T A;  2EM2 A;  3VHT B;  1ZBT A;  1YSA C;  3L00 A;  2M7Q A;  1UN6 B;  3ADJ A;  2EMF A;  2MC5 A;  1TF3 A;  2UUB E;  5KL3 A;  3EPH A;  1FJG E;  4NXN E;  2ELZ A;  4BS9 A;  2MC6 A;  5A6J A;  4WFT A;  1AAY A;  2VRD A;  1UIL A;  2RQL A;  4F9A B;  2GPI A;  4M2Z A;  5AE2 A;  5KL6 A;  2EQ1 A;  4DR1 E;  2EMI A;  2L6M A;  1XMQ E;  2UUC E;  2CSH A;  4WSP A;  1ZU1 A;  2M9A A;  4KZS A;  5KL2 A;  2JVA A;  3EPK A;  4DR6 E;  4WXC A;  2B7T A;  2RPC A;  5KL5 A;  2EM5 A;  1HNW E;  4DMI A;  2GLI A;  1YUJ A;  2YTF A;  2EN3 A;  4YHH E;  4B3M E;  2LCE A;  4DR7 E;  4R2Q A;  1T39 A;  2EP3 A;  1T38 A;  1EH6 A;  4KHP E;  2ENA A;  2R76 A;  4X9J A;  2I13 A;  4O43 A;  2EE8 A;  5BR8 E;  2KOU A;  4B3S E;  1NEI A;  2JOX A;  3HQ1 A;  2EM8 A;  1X3C A;  2L33 A;  3IWC A;  2ZM6 E;  2MKN A;  1DI2 A;  2YTE A;  1GZ6 A;  4F9B B;  4OX9 E;  4F9C B;  2EL6 A;  2LTS A;  2J7J A;  2EN6 A;  4O5G A;  2EM7 A;  1A1G A;  2E1M A;  1TF6 A;  3EQ1 A;  2EM0 A;  3BF2 A;  5AC5 A;  2A25 A;  5AE3 A;  5CFF E;  3OTO E;  2YTQ A;  1Z1B A;  2EOS A;  2EJ4 A;  1RQ0 A;  3HPZ A;  3JTZ A;  4ZYE A;  1I94 E;  2IHR 1;  1X6E A;  2WBU A;  2WCC 3;  4LF5 E;  1KJK A;  1NCS A;  2EOH A;  4J8Z A;  2N3G A;  4P7D A;  3BBG A;  4NZV A;  2EPP A;  2V88 A;  4F6N A;  2VF1 A;  1AH5 A;  1A1L A;  4Q35 B;  2YTG A;  2R1F A;  2L3J A;  2JXP A;  1QNT A;  4JI2 E;  1UBD C;  4HEI A;  4OOG C;  4DV1 E;  3VYX A;  1IMU A;  4RHB B;  2V86 A;  3M99 B;  1X47 A;  4LF6 E;  2LBS B;  5A69 A;  5LMN E;  2EML A;  2LO3 A;  1O0W A;  3HPS A;  3J81 C;  1RMD A;  4DR2 E;  4R2D A;  2DIX A;  5A6B D;  2EPN A;  2YT4 A;  3BID A;  3C4T A; 
#chains in the Genus database with same CATH homology
 4DV3 E;  2VE7 C;  4JI7 E;  2H36 X;  2L6M A;  1SR9 A;  4X66 E;  1XMQ E;  2KON A;  4DV4 E;  2LUP B;  2CPN A;  2RS6 A;  2JY9 A;  1YYO A;  4WSP A;  2UUC E;  3H09 A;  2L2N A;  4LF7 E;  1WHN A;  4KZS A;  2UXD E;  4R03 A;  4JV5 E;  4P78 A;  2K4V A;  3P1X A;  4JI0 E;  4DR4 E;  2JVA A;  4DV6 E;  5A2Q C;  1X49 A;  1N33 E;  1FKA E;  1HR0 E;  4DR6 E;  2UXB E;  2B7T A;  1N36 E;  4JI3 E;  2JR1 A;  2JOB A;  4DV0 E;  1J26 A;  1HNW E;  2DSY A;  4DMI A;  4B3R E;  1DQ3 A;  1IBK E;  4JI8 E;  2L3C A;  4GKK E;  2N3H A;  2LJH A;  4M0V A;  4YHH E;  4DR5 E;  4B3M E;  1XNR E;  2FGG A;  4DR7 E;  4AQY E;  4GKJ E;  3DJW A;  4LF4 E;  1YYW A;  2V85 A;  4GEQ B;  1XNQ E;  1GQE A;  4WPY A;  2JWO A;  2LRS A;  3T1Y E;  4KHP E;  4DV7 E;  3HTX A;  2RTX A;  4X64 E;  1T4O A;  4JI6 E;  5AAS A;  3J80 C;  4DV5 E;  3ZOQ B;  2G7H A;  1WHQ A;  4JI1 E;  5T6J A;  2EWL A;  5BR8 E;  1YYK A;  5IWA E;  1ZBQ A;  2KOU A;  5LMU E;  4B3S E;  2JOX A;  3HQ1 A;  1IBM E;  2V8Q B;  4F54 A;  2V87 A;  3MSW A;  2L33 A;  3IWC A;  2ZM6 E;  4YY3 E;  3HXL A;  2LTR A;  1DI2 A;  2UU9 E;  1T4L B;  4LTY A;  2NA2 A;  1GZ6 A;  2L2M A;  3KWR A;  3LLH A;  4DR3 E;  3ADI A;  4F9B B;  3AV0 A;  4OX9 E;  4F9C B;  2LTS A;  2M1S A;  3IWB A;  4M30 A;  1UHZ A;  2M4I A;  4TUI A;  2LUQ A;  1T4N A;  2LE2 A;  2E1M A;  3K6Q A;  1RC7 A;  4LFA E;  2NUE A;  2LMZ A;  2DB2 A;  4LF8 E;  5AE3 A;  5CFF E;  1J5E E;  3OTO E;  4NXM E;  4K0K E;  4I8O A;  4JI4 E;  1HNZ E;  4X62 E;  2UXC E;  4DUZ E;  2NUF A;  3J7Y p;  1RQ0 A;  4L5N C;  5AE1 A;  4BC7 A;  5FLX C;  3HPZ A;  3JTZ A;  1I94 E;  2IHR 1;  2YZT A;  4LFB E;  3C4B A;  4BC9 A;  3JU0 A;  5ADZ A;  4JYA E;  2F4V E;  4LF5 E;  3VYY A;  3LML A;  4LFC E;  3ADL A;  1EKZ A;  5DNY A;  3F6H A;  1PKP A;  2V89 A;  4J8Z A;  1WXR A;  2N3G A;  4P7D A;  1XMO E;  4BCA A;  4DV2 E;  2RS7 A;  2V83 A;  3AUZ A;  5IT9 C;  2FV4 B;  2WZO A;  2B7V A;  3RMP A;  2E5L E;  3OML A;  5F3W A;  2V88 A;  1STU A;  2VF1 A;  2KHX A;  4B3T E;  3FIG A;  2MDR A;  3DF6 A;  1N32 E;  1IBL E;  1YZ9 A;  4LF9 E;  4X8W A;  1QU6 A;  4WYQ B;  2L3J A;  4BMJ A;  3F6G A;  2B9D A;  1X48 A;  4JI2 E;  2UUA E;  1N34 E;  3VK6 A;  2FTX B;  1HNX E;  5LL6 R;  4OOG C;  3JAM C;  2L8T A;  4DV1 E;  3VYX A;  1ZBT A;  3T1H E;  2V86 A;  2RSM A;  2M7Q A;  2VQF E;  4DR1 E;  3ADJ A;  1X47 A;  4TUG A;  2LBS B;  4LF6 E;  2B3T B;  2MC5 A;  3ADG A;  3IWD A;  4BBY A;  2UUB E;  2VQE E;  5LMN E;  1FJG E;  4X65 E;  4NXN E;  2DMY A;  1O0W A;  4L8N A;  2ODR D;  2L92 A;  3HPS A;  4DKK A;  3J81 C;  2NUG A;  2ODR C;  2MC6 A;  4BS9 A;  4LU9 A;  4WFT A;  4DR2 E;  3J7A G;  1UIL A;  2DIX A;  2L2K B;  4R8O A;  4DUY E;  2EZ6 A;  4F9A B;  2F8B A;  2YT4 A;  2HHH E;  4M2Z A;  4Q28 A;  5AE2 A;  4JI5 E;  3C4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...