2LBSB

Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with aagu tetraloop hairpin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (32-MER)
publication title Structure of a Yeast RNase III dsRBD Complex with a Noncanonical RNA Substrate Provides New Insights into Binding Specificity of dsRBDs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lbsB00
4X8WA 5IWAE 4DUYE 1XMOE 4X62E 2L33A 2NUEA 2NUFA 4KHPE 1YYWA 2B7TA 1X48A 4DR1E 2EZ6A 4DR4E 1UHZA 4JI0E 2LJHA 2LUQA 4JI4E 1FJGE 4DR5E 2DB2A 3ADJA 4LF4E 3ADGA 2UUBE 4DV5E 2IHR1 1XMQE 1STUA 4DV3E 2F4VE 1WHQA 2DIXA 2VQEE 4DUZE 2UXDE 4GKKE 1XNQE 2NUGA 1T4NA 4OX9E 4LFAE 4DR6E 1WHNA 4DV1E 2ZM6E 4K0KE 4WYQB 2LTSA 2L3JA 4B3RE 4DV4E 1GQEA 1J5EE 2RTXA 3C4BA 5LMNE 2JVAA 4LF9E 2NA2A 1X47A 4DKKA 2N3GA 2LUPB 2B3TB 4YHHE 4DR3E 1XNRE 1YYOA 1ZBTA 1YZ9A 1HNWE 1RQ0A 4NXNE 4JI5E 3LLHA 4M30A 1RC7A 4LF6E 4WFTA 1YYKA 1HR0E 1IBKE 3ADLA 2L2NA 4YY3E 1QU6A 4DR7E 2L2KB 2VQFE 4LF8E 4JI2E 4LFCE 4JI7E 4DV2E 4OOGC 3J7Yp 3HTXA 5CFFE 1FKAE 5BR8E 1J26A 1N32E 2UU9E 1T4OA 2LRSA 4LF5E 1N33E 2JY9A 2UUAE 4JV5E 2UUCE 1UILA 4LF7E 3C4TA 4DR2E 4X65E 4X66E 1N34E 1N36E 2MDRA 4DV7E 3VYYA 2LBSB 3T1YE 4AQYE 2N3HA 4B3ME 4GKJE 4JI1E 4JI3E 2KHXA 4DV6E 4JYAE 1IBLE 1X49A 2DMYA 1I94E 2E5LE 3VYXA 2YT4A 1IBME 2L2MA 1PKPA 3T1HE 1O0WA 1EKZA 4JI6E 2B7VA 4NXME 3OTOE 2RS6A 4LFBE 4DV0E 3ADIA 1HNZE 4B3SE 2RS7A 2UXBE 4B3TE 2L3CA 1HNXE 4X64E 1T4LB 1DI2A 2CPNA 3P1XA 4JI8E 2UXCE 2LTRA 4M2ZA 2RSMA 5LMUE 2HHHE
chains in the Genus database with same CATH superfamily
2K4VA 4DUYE 1F2IG 1RMDA 3K6QA 4X62E 2NUEA 1IQOA 4KHPE 2D9HA 2K7IA 2B7TA 1YFHA 4JI0E 2M1SA 2YTEA 2UUBE 3IWBA 2YRHA 3EPHA 5KL7A 4DV5E 4BCAA 2EPOA 5A2QC 2Q8UA 4GKKE 4OX9E 1TF6A 4LFAE 1WHNA 4WYQB 1YUJA 2L3JA 1YSAC 4B3RE 2EMKA 1BB8A 1PJQA 2RTXA 3DJWA 1L4SA 1X47A 2YPNA 2EOMA 3ZOQB 1YPNA 3BIDA 2LUPB 2EJ4A 5TSEA 1EH8A 2VE7C 4DR3E 3HPSA 1ZBTA 2V86A 2FV4B 1ZR9A 2V83A 1YYOA 1HNWE 4JI5E 1DGCA 1G2DC 5AE2A 4YY3E 1QU6A 2F8BA 2EPMX 2YSPA 1TN9A 2EOXA 2EORA 4JI2E 2EOOA 2JOXA 4OOGC 2YTQA 1FKAE 1J26A 4F2JC 1UBDC 2J7JA 1A1KA 3C6MA 1X5WA 3C4TA 2LJUA 4X66E 2DLQA 3BBGA 5AASA 1MGTA 2EOHA 4HTGA 4IJDA 1A1IA 4GKJE 4JI1E 2KHXA 4JYAE 1IBLE 2DRPA 4TUIA 1O0WA 3BF2A 2V89A 1WRJA 3MHHC 2EMWA 2EM5A 4L8NA 2ENCA 4DV0E 2UXBE 2EN3A 1PDAA 2CPNA 2R1FA 2CSHA 2JPAA 3IWCA 3JTZA 2LTRA 3ECRA 5LMUE 2EM6A 4X8WA 4NZVA 5KL2A 1T39A 2M4IA 1IMUA 2L33A 2LCEA 2MC5A 2YTIA 3J7AG 2LVHA 1YYWA 4BHCA 1X48A 4DR1E 1UHZA 2LJHA 2EMXA 2DB2A 3ADJA 2EQ0A 2IHR1 1STUA 4DV3E 1WHQA 2YRKA 2YU5A 2VQEE 4DUZE 2BB8A 2UXDE 2EP3A 2EL4A 2NUGA 3JU0A 2HHHE 4DR6E 5ADZA 4K0KE 2B9DA 3HPZA 4O24A 2JOBA 4DV4E 1J5EE 2RSIA 2DGCA 3M99B 1A1JA 1WJPA 4ZYEA 2N3GA 4BC9A 4ZYHA 2EMCA 2FGGA 5IT9C 1TF3A 2V87A 4Q28A 1YZ9A 4R03A 3F6GA 1A1LA 2EM7A 2EOJA 3LLHA 2A25A 4WFTA 1T38A 1HR0E 1LLMC 1QNTA 2FTXB 2LV2A 1IBKE 2ENHA 2EM3A 2DSYA 2EOYA 4LFCE 4DV2E 5BR8E 1N32E 3MHSC 1KJKA 4LF5E 2H36X 4R2PA 2UUAE 3IWDA 1GZ6A 2M7QA 2GLIA 4LF7E 4R2QA 2ELZA 3MSWA 2JR1A 4R2SA 1N36E 2MDRA 2EL5A 4F9BB 3HQ1A 2N3HA 4R8OA 4B3ME 2WZOA 2EMHA 1ZU1A 5KL3A 1X49A 2DMYA 2YSOA 2EMLA 1IBME 2BBGA 2JXPA 4I8OA 4X9JA 1MEYC 2EE8A 1AAYA 2B7VA 2EOZA 5KL5A 3KWRA 2R76A 4LFBE 4O5GA 3ADIA 1HNZE 2EM2A 2RS7A 4B3TE 2EPPA 1T4LB 2VRDA 4M0VA 1X6HA 5IV8B 1JK1A 2ODRC 3LMLA 2LT7A 2YTGA 1AH5A 2V85A 2WBSA 1WXRA 4BS9A 2NUFA 4F6MA 2RQLA 2I13A 5A6AA 1GTKA 2JWOA 2EZ6A 2LUQA 2ENAA 4JI4E 4RHBB 4DR5E 3ADGA 1BBOA 4O43A 4R2DA 2EMGA 4HEIA 1ZAAC 1XMQE 3C6KA 4O4KA 2EOQA 2EPNA 1XNQE 4DV1E 2ZM6E 3H09A 2E1MA 3VHTB 4F9AB 1GQEA 2EMYA 4BMJA 2EPLX 3EPKA 1PJSA 3C4BA 1X6FA 2NA2A 2GPIA 4L5NC 4DKKA 4ZYDA 1B69A 2EL6A 2E72A 1EH6A 4J8ZA 5A6KA 2YTJA 1RQ0A 3JAMC 4NXNE 1SFEA 1YUIA 1RC7A 4LF6E 4KWYA 1YYKA 5A6BD 2G7HA 3ADLA 2L2KB 2VQFE 3EQ1A 1UN6B 2EOEA 3J7Yp 2N8XA 4R2CA 2YTOA 2UU9E 2L6MA 1T4OA 4LU9A 4R2AA 2ELYA 2UUCE 1UILA 4DR2E 2HC5A 2CT1A 1N34E 2EQ1A 2EPUA 2EN6A 4LTYA 3TQMA 1P47A 3VYYA 4R2RA 5A6JA 3T1YE 3AUZA 1PJTA 4JI3E 4DV6E 2MKNA 2EM4A 3VYXA 1I94E 4GZNC 2KOUA 5LL6R 1PKPA 2EPXA 5AC4A 2EPKX 3T1HE 3L00A 1EKZA 4JI6E 2EMBA 4WXCA 3OTOE 4GEQB 2EQ3A 1N3GA 2MDGA 2YU8A 3VK6A 5LLQA 1A1GA 3RMPA 4B3SE 4IS1C 2L3CA 4X64E 2WCC3 1DI2A 2UXCE 5DNYA 3J81C 5KL6A 4LF4E 4TUGA 2I9IA 1EH7A 5KL4A 2L8TA 1Z1BA 5IWAE 3EPJA 2EWLA 5AC5A 3THOB 1XMOE 2YTNA 4DMIA 2EOSA 3KZYA 2EM0A 2MKDA 1DQ3A 4DR4E 2HGHA 3OMLA 2LE2A 1FJGE 5F3WA 2V8QB 1X6EA 2EMIA 1JK2A 2WBUA 3HXLA 2F4VE 2DIXA 2YTPA 1G2FC 5IXMB 1T4NA 4BC7A 1X3CA 2MC6A 3AV0A 2PRTA 2DLKA 4RH8A 2EOFA 2LTSA 1NEIA 3KZZA 4FK5C 2NABA 5T6JA 5A69A 2EN7A 5AE3A 5LMNE 2JVAA 2RPCA 3EPLA 2YZTA 4N4RB 4LF9E 1KYQA 1A1HA 4ZYGA 2M9AA 2WBTA 4MLQA 2B3TB 4YHHE 2LMZA 4MLVA 1XNRE 4WPYA 2KONA 2GHFA 4M30A 2L2NA 3THNA 2EPZA 1A1FA 4DR7E 2DMIA 3QG5C 2YRMA 4LF8E 4F6NA 2EPAA 4JI7E 4WXDA 2L92A 2YTFA 5CFFE 4WSPA 3HTXA 4P78A 2EN2A 2LRSA 2ADRA 1N33E 2JY9A 3UK3C 4M9VC 3BGHA 4JV5E 2EOIA 4X65E 1IQSA 2EM9A 1SR9A 4BBYA 2EPCA 5FLXC 2LO3A 2YWQA 4DV7E 5A6BA 2LBSB 2YTDA 4R2EA 4P7DA 1BBGA 4AQYE 5AE1A 4F54A 4WX9A 4NHRA 1NCSA 2CTDA 2E5LE 2EPRA 2VF1A 2YT4A 2EMAA 2L2MA 2EN1A 2EN8A 2EMFA 2JYAA 4WSGA 4NXME 2JP9A 2RS6A 2EN4A 2EM8A 2EMZA 2ODRD 4F9CB 3DF6A 3F6HA 4KZSA 4BHBA 1HNXE 2HJJA 2V88A 3FIGA 3P1XA 4JI8E 1ZBQA 4M2ZA 3J80C 2RSMA 4Q35B
chains in the Genus database with same CATH topology
2L8TA 2V85A 4X8WA 1WXRA 2K4VA 4BS9A 2EWLA 5IWAE 4DUYE 2UXBE 2M4IA 1XMOE 4X62E 2L33A 2MC5A 3K6QA 4DMIA 2NUFA 2NUEA 3J7AG 4KHPE 1YYWA 1DQ3A 2B7TA 1X48A 4DR1E 2JWOA 2EZ6A 4DR4E 1UHZA 4JI0E 2LJHA 2LUQA 4JI4E 3OMLA 2M1SA 2LE2A 4DR5E 2DB2A 1FJGE 3ADJA 4LF4E 1HNWE 3ADGA 5F3WA 2UUBE 3IWBA 2V8QB 4DV5E 2IHR1 4BCAA 1XMQE 1STUA 4DV3E 3HXLA 2F4VE 1WHQA 2DIXA 2VQEE 4DUZE 5A2QC 2UXDE 4GKKE 1XNQE 2NUGA 1T4NA 3JU0A 4BC7A 4LFAE 4OX9E 4DR6E 1WHNA 5ADZA 4DV1E 2ZM6E 4K0KE 3H09A 2E1MA 2MC6A 2B9DA 3AV0A 3HPZA 4WYQB 2LTSA 2L3JA 5T6JA 4B3RE 4F9AB 2JOBA 1GQEA 4DV4E 1J5EE 4BMJA 2RTXA 3C4BA 3DJWA 5AE3A 5LMNE 2JVAA 2YZTA 4LF9E 2NA2A 1X47A 4L5NC 4DKKA 3ZOQB 2N3GA 4BC9A 2LUPB 2FGGA 5IT9C 4J8ZA 2V87A 2B3TB 4Q28A 2VE7C 2LMZA 4YHHE 4DR3E 1YZ9A 1XNRE 3HPSA 1ZBTA 2V86A 2FV4B 2KONA 1RQ0A 2V83A 3F6GA 4R03A 4WPYA 3JAMC 3LLHA 4M30A 1RC7A 4JI5E 4WFTA 4LF6E 5AE2A 1YYKA 1HR0E 2G7HA 2FTXB 1IBKE 3ADLA 2L2NA 4YY3E 1QU6A 2F8BA 2L2KB 2VQFE 4DR7E 4LF8E 2DSYA 4NXNE 4JI2E 4LFCE 4JI7E 4DV2E 2JOXA 4OOGC 2L92A 5CFFE 3J7Yp 4WSPA 3HTXA 1FKAE 5BR8E 1J26A 1N32E 4P78A 2UU9E 2L6MA 1T4OA 4LU9A 2LRSA 4LF5E 1N33E 2JY9A 2H36X 2UUAE 3IWDA 1GZ6A 2M7QA 4JV5E 2UUCE 1UILA 4LF7E 3C4TA 4DR2E 4X65E 4X66E 4BBYA 1SR9A 3MSWA 5AASA 2JR1A 1N34E 4LTYA 5FLXC 1N36E 2MDRA 4DV7E 4F9BB 3VYYA 2LBSB 4P7DA 3T1YE 3AUZA 3HQ1A 4AQYE 2N3HA 4R8OA 4B3ME 4GKJE 2WZOA 4JI1E 5AE1A 4JI3E 4F54A 2KHXA 4DV6E 4JYAE 1IBLE 1X49A 2DMYA 1I94E 2E5LE 3VYXA 2VF1A 2KOUA 2YT4A 5LL6R 2L2MA 1PKPA 4I8OA 1IBME 4TUIA 3T1HE 1O0WA 1EKZA 4JI6E 2B7VA 4NXME 3KWRA 3OTOE 2RS6A 2V89A 4GEQB 4LFBE 4L8NA 4DV0E 3ADIA 1HNZE 2ODRD 3VK6A 2RS7A 3DF6A 3F6HA 4F9CB 3RMPA 1YYOA 4B3SE 2L3CA 4KZSA 1HNXE 4B3TE 4X64E 1T4LB 2V88A 4M0VA 1DI2A 3FIGA 2CPNA 3P1XA 3IWCA 4JI8E 3JTZA 1ZBQA 2ODRC 2LTRA 3LMLA 5DNYA 2UXCE 4M2ZA 3J80C 3J81C 2RSMA 4TUGA 5LMUE 2HHHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8W A;  5IWA E;  4DUY E;  1XMO E;  4X62 E;  2L33 A;  2NUE A;  2NUF A;  4KHP E;  1YYW A;  2B7T A;  1X48 A;  4DR1 E;  2EZ6 A;  4DR4 E;  1UHZ A;  4JI0 E;  2LJH A;  2LUQ A;  4JI4 E;  1FJG E;  4DR5 E;  2DB2 A;  3ADJ A;  4LF4 E;  3ADG A;  2UUB E;  4DV5 E;  2IHR 1;  1XMQ E;  1STU A;  4DV3 E;  2F4V E;  1WHQ A;  2DIX A;  2VQE E;  4DUZ E;  2UXD E;  4GKK E;  1XNQ E;  2NUG A;  1T4N A;  4OX9 E;  4LFA E;  4DR6 E;  1WHN A;  4DV1 E;  2ZM6 E;  4K0K E;  4WYQ B;  2LTS A;  2L3J A;  4B3R E;  4DV4 E;  1GQE A;  1J5E E;  2RTX A;  3C4B A;  5LMN E;  2JVA A;  4LF9 E;  2NA2 A;  1X47 A;  4DKK A;  2N3G A;  2LUP B;  2B3T B;  4YHH E;  4DR3 E;  1XNR E;  1YYO A;  1ZBT A;  1YZ9 A;  1HNW E;  1RQ0 A;  4NXN E;  4JI5 E;  3LLH A;  4M30 A;  1RC7 A;  4LF6 E;  4WFT A;  1YYK A;  1HR0 E;  1IBK E;  3ADL A;  2L2N A;  4YY3 E;  1QU6 A;  4DR7 E;  2L2K B;  2VQF E;  4LF8 E;  4JI2 E;  4LFC E;  4JI7 E;  4DV2 E;  4OOG C;  3J7Y p;  3HTX A;  5CFF E;  1FKA E;  5BR8 E;  1J26 A;  1N32 E;  2UU9 E;  1T4O A;  2LRS A;  4LF5 E;  1N33 E;  2JY9 A;  2UUA E;  4JV5 E;  2UUC E;  1UIL A;  4LF7 E;  3C4T A;  4DR2 E;  4X65 E;  4X66 E;  1N34 E;  1N36 E;  2MDR A;  4DV7 E;  3VYY A;  2LBS B;  3T1Y E;  4AQY E;  2N3H A;  4B3M E;  4GKJ E;  4JI1 E;  4JI3 E;  2KHX A;  4DV6 E;  4JYA E;  1IBL E;  1X49 A;  2DMY A;  1I94 E;  2E5L E;  3VYX A;  2YT4 A;  1IBM E;  2L2M A;  1PKP A;  3T1H E;  1O0W A;  1EKZ A;  4JI6 E;  2B7V A;  4NXM E;  3OTO E;  2RS6 A;  4LFB E;  4DV0 E;  3ADI A;  1HNZ E;  4B3S E;  2RS7 A;  2UXB E;  4B3T E;  2L3C A;  1HNX E;  4X64 E;  1T4L B;  1DI2 A;  2CPN A;  3P1X A;  4JI8 E;  2UXC E;  2LTR A;  4M2Z A;  2RSM A;  5LMU E;  2HHH E; 
#chains in the Genus database with same CATH topology
 2K4V A;  4DUY E;  1F2I G;  1RMD A;  3K6Q A;  4X62 E;  2NUE A;  1IQO A;  4KHP E;  2D9H A;  2K7I A;  2B7T A;  1YFH A;  4JI0 E;  2M1S A;  2YTE A;  2UUB E;  3IWB A;  2YRH A;  3EPH A;  5KL7 A;  4DV5 E;  4BCA A;  2EPO A;  5A2Q C;  2Q8U A;  4GKK E;  4OX9 E;  1TF6 A;  4LFA E;  1WHN A;  4WYQ B;  1YUJ A;  2L3J A;  1YSA C;  4B3R E;  2EMK A;  1BB8 A;  1PJQ A;  2RTX A;  3DJW A;  1L4S A;  1X47 A;  2YPN A;  2EOM A;  3ZOQ B;  1YPN A;  3BID A;  2LUP B;  2EJ4 A;  5TSE A;  1EH8 A;  2VE7 C;  4DR3 E;  3HPS A;  1ZBT A;  2V86 A;  2FV4 B;  1ZR9 A;  2V83 A;  1YYO A;  1HNW E;  4JI5 E;  1DGC A;  1G2D C;  5AE2 A;  4YY3 E;  1QU6 A;  2F8B A;  2EPM X;  2YSP A;  1TN9 A;  2EOX A;  2EOR A;  4JI2 E;  2EOO A;  2JOX A;  4OOG C;  2YTQ A;  1FKA E;  1J26 A;  4F2J C;  1UBD C;  2J7J A;  1A1K A;  3C6M A;  1X5W A;  3C4T A;  2LJU A;  4X66 E;  2DLQ A;  3BBG A;  5AAS A;  1MGT A;  2EOH A;  4HTG A;  4IJD A;  1A1I A;  4GKJ E;  4JI1 E;  2KHX A;  4JYA E;  1IBL E;  2DRP A;  4TUI A;  1O0W A;  3BF2 A;  2V89 A;  1WRJ A;  3MHH C;  2EMW A;  2EM5 A;  4L8N A;  2ENC A;  4DV0 E;  2UXB E;  2EN3 A;  1PDA A;  2CPN A;  2R1F A;  2CSH A;  2JPA A;  3IWC A;  3JTZ A;  2LTR A;  3ECR A;  5LMU E;  2EM6 A;  4X8W A;  4NZV A;  5KL2 A;  1T39 A;  2M4I A;  1IMU A;  2L33 A;  2LCE A;  2MC5 A;  2YTI A;  3J7A G;  2LVH A;  1YYW A;  4BHC A;  1X48 A;  4DR1 E;  1UHZ A;  2LJH A;  2EMX A;  2DB2 A;  3ADJ A;  2EQ0 A;  2IHR 1;  1STU A;  4DV3 E;  1WHQ A;  2YRK A;  2YU5 A;  2VQE E;  4DUZ E;  2BB8 A;  2UXD E;  2EP3 A;  2EL4 A;  2NUG A;  3JU0 A;  2HHH E;  4DR6 E;  5ADZ A;  4K0K E;  2B9D A;  3HPZ A;  4O24 A;  2JOB A;  4DV4 E;  1J5E E;  2RSI A;  2DGC A;  3M99 B;  1A1J A;  1WJP A;  4ZYE A;  2N3G A;  4BC9 A;  4ZYH A;  2EMC A;  2FGG A;  5IT9 C;  1TF3 A;  2V87 A;  4Q28 A;  1YZ9 A;  4R03 A;  3F6G A;  1A1L A;  2EM7 A;  2EOJ A;  3LLH A;  2A25 A;  4WFT A;  1T38 A;  1HR0 E;  1LLM C;  1QNT A;  2FTX B;  2LV2 A;  1IBK E;  2ENH A;  2EM3 A;  2DSY A;  2EOY A;  4LFC E;  4DV2 E;  5BR8 E;  1N32 E;  3MHS C;  1KJK A;  4LF5 E;  2H36 X;  4R2P A;  2UUA E;  3IWD A;  1GZ6 A;  2M7Q A;  2GLI A;  4LF7 E;  4R2Q A;  2ELZ A;  3MSW A;  2JR1 A;  4R2S A;  1N36 E;  2MDR A;  2EL5 A;  4F9B B;  3HQ1 A;  2N3H A;  4R8O A;  4B3M E;  2WZO A;  2EMH A;  1ZU1 A;  5KL3 A;  1X49 A;  2DMY A;  2YSO A;  2EML A;  1IBM E;  2BBG A;  2JXP A;  4I8O A;  4X9J A;  1MEY C;  2EE8 A;  1AAY A;  2B7V A;  2EOZ A;  5KL5 A;  3KWR A;  2R76 A;  4LFB E;  4O5G A;  3ADI A;  1HNZ E;  2EM2 A;  2RS7 A;  4B3T E;  2EPP A;  1T4L B;  2VRD A;  4M0V A;  1X6H A;  5IV8 B;  1JK1 A;  2ODR C;  3LML A;  2LT7 A;  2YTG A;  1AH5 A;  2V85 A;  2WBS A;  1WXR A;  4BS9 A;  2NUF A;  4F6M A;  2RQL A;  2I13 A;  5A6A A;  1GTK A;  2JWO A;  2EZ6 A;  2LUQ A;  2ENA A;  4JI4 E;  4RHB B;  4DR5 E;  3ADG A;  1BBO A;  4O43 A;  4R2D A;  2EMG A;  4HEI A;  1ZAA C;  1XMQ E;  3C6K A;  4O4K A;  2EOQ A;  2EPN A;  1XNQ E;  4DV1 E;  2ZM6 E;  3H09 A;  2E1M A;  3VHT B;  4F9A B;  1GQE A;  2EMY A;  4BMJ A;  2EPL X;  3EPK A;  1PJS A;  3C4B A;  1X6F A;  2NA2 A;  2GPI A;  4L5N C;  4DKK A;  4ZYD A;  1B69 A;  2EL6 A;  2E72 A;  1EH6 A;  4J8Z A;  5A6K A;  2YTJ A;  1RQ0 A;  3JAM C;  4NXN E;  1SFE A;  1YUI A;  1RC7 A;  4LF6 E;  4KWY A;  1YYK A;  5A6B D;  2G7H A;  3ADL A;  2L2K B;  2VQF E;  3EQ1 A;  1UN6 B;  2EOE A;  3J7Y p;  2N8X A;  4R2C A;  2YTO A;  2UU9 E;  2L6M A;  1T4O A;  4LU9 A;  4R2A A;  2ELY A;  2UUC E;  1UIL A;  4DR2 E;  2HC5 A;  2CT1 A;  1N34 E;  2EQ1 A;  2EPU A;  2EN6 A;  4LTY A;  3TQM A;  1P47 A;  3VYY A;  4R2R A;  5A6J A;  3T1Y E;  3AUZ A;  1PJT A;  4JI3 E;  4DV6 E;  2MKN A;  2EM4 A;  3VYX A;  1I94 E;  4GZN C;  2KOU A;  5LL6 R;  1PKP A;  2EPX A;  5AC4 A;  2EPK X;  3T1H E;  3L00 A;  1EKZ A;  4JI6 E;  2EMB A;  4WXC A;  3OTO E;  4GEQ B;  2EQ3 A;  1N3G A;  2MDG A;  2YU8 A;  3VK6 A;  5LLQ A;  1A1G A;  3RMP A;  4B3S E;  4IS1 C;  2L3C A;  4X64 E;  2WCC 3;  1DI2 A;  2UXC E;  5DNY A;  3J81 C;  5KL6 A;  4LF4 E;  4TUG A;  2I9I A;  1EH7 A;  5KL4 A;  2L8T A;  1Z1B A;  5IWA E;  3EPJ A;  2EWL A;  5AC5 A;  3THO B;  1XMO E;  2YTN A;  4DMI A;  2EOS A;  3KZY A;  2EM0 A;  2MKD A;  1DQ3 A;  4DR4 E;  2HGH A;  3OML A;  2LE2 A;  1FJG E;  5F3W A;  2V8Q B;  1X6E A;  2EMI A;  1JK2 A;  2WBU A;  3HXL A;  2F4V E;  2DIX A;  2YTP A;  1G2F C;  5IXM B;  1T4N A;  4BC7 A;  1X3C A;  2MC6 A;  3AV0 A;  2PRT A;  2DLK A;  4RH8 A;  2EOF A;  2LTS A;  1NEI A;  3KZZ A;  4FK5 C;  2NAB A;  5T6J A;  5A69 A;  2EN7 A;  5AE3 A;  5LMN E;  2JVA A;  2RPC A;  3EPL A;  2YZT A;  4N4R B;  4LF9 E;  1KYQ A;  1A1H A;  4ZYG A;  2M9A A;  2WBT A;  4MLQ A;  2B3T B;  4YHH E;  2LMZ A;  4MLV A;  1XNR E;  4WPY A;  2KON A;  2GHF A;  4M30 A;  2L2N A;  3THN A;  2EPZ A;  1A1F A;  4DR7 E;  2DMI A;  3QG5 C;  2YRM A;  4LF8 E;  4F6N A;  2EPA A;  4JI7 E;  4WXD A;  2L92 A;  2YTF A;  5CFF E;  4WSP A;  3HTX A;  4P78 A;  2EN2 A;  2LRS A;  2ADR A;  1N33 E;  2JY9 A;  3UK3 C;  4M9V C;  3BGH A;  4JV5 E;  2EOI A;  4X65 E;  1IQS A;  2EM9 A;  1SR9 A;  4BBY A;  2EPC A;  5FLX C;  2LO3 A;  2YWQ A;  4DV7 E;  5A6B A;  2LBS B;  2YTD A;  4R2E A;  4P7D A;  1BBG A;  4AQY E;  5AE1 A;  4F54 A;  4WX9 A;  4NHR A;  1NCS A;  2CTD A;  2E5L E;  2EPR A;  2VF1 A;  2YT4 A;  2EMA A;  2L2M A;  2EN1 A;  2EN8 A;  2EMF A;  2JYA A;  4WSG A;  4NXM E;  2JP9 A;  2RS6 A;  2EN4 A;  2EM8 A;  2EMZ A;  2ODR D;  4F9C B;  3DF6 A;  3F6H A;  4KZS A;  4BHB A;  1HNX E;  2HJJ A;  2V88 A;  3FIG A;  3P1X A;  4JI8 E;  1ZBQ A;  4M2Z A;  3J80 C;  2RSM A;  4Q35 B; 
#chains in the Genus database with same CATH homology
 2L8T A;  2V85 A;  4X8W A;  1WXR A;  2K4V A;  4BS9 A;  2EWL A;  5IWA E;  4DUY E;  2UXB E;  2M4I A;  1XMO E;  4X62 E;  2L33 A;  2MC5 A;  3K6Q A;  4DMI A;  2NUF A;  2NUE A;  3J7A G;  4KHP E;  1YYW A;  1DQ3 A;  2B7T A;  1X48 A;  4DR1 E;  2JWO A;  2EZ6 A;  4DR4 E;  1UHZ A;  4JI0 E;  2LJH A;  2LUQ A;  4JI4 E;  3OML A;  2M1S A;  2LE2 A;  4DR5 E;  2DB2 A;  1FJG E;  3ADJ A;  4LF4 E;  1HNW E;  3ADG A;  5F3W A;  2UUB E;  3IWB A;  2V8Q B;  4DV5 E;  2IHR 1;  4BCA A;  1XMQ E;  1STU A;  4DV3 E;  3HXL A;  2F4V E;  1WHQ A;  2DIX A;  2VQE E;  4DUZ E;  5A2Q C;  2UXD E;  4GKK E;  1XNQ E;  2NUG A;  1T4N A;  3JU0 A;  4BC7 A;  4LFA E;  4OX9 E;  4DR6 E;  1WHN A;  5ADZ A;  4DV1 E;  2ZM6 E;  4K0K E;  3H09 A;  2E1M A;  2MC6 A;  2B9D A;  3AV0 A;  3HPZ A;  4WYQ B;  2LTS A;  2L3J A;  5T6J A;  4B3R E;  4F9A B;  2JOB A;  1GQE A;  4DV4 E;  1J5E E;  4BMJ A;  2RTX A;  3C4B A;  3DJW A;  5AE3 A;  5LMN E;  2JVA A;  2YZT A;  4LF9 E;  2NA2 A;  1X47 A;  4L5N C;  4DKK A;  3ZOQ B;  2N3G A;  4BC9 A;  2LUP B;  2FGG A;  5IT9 C;  4J8Z A;  2V87 A;  2B3T B;  4Q28 A;  2VE7 C;  2LMZ A;  4YHH E;  4DR3 E;  1YZ9 A;  1XNR E;  3HPS A;  1ZBT A;  2V86 A;  2FV4 B;  2KON A;  1RQ0 A;  2V83 A;  3F6G A;  4R03 A;  4WPY A;  3JAM C;  3LLH A;  4M30 A;  1RC7 A;  4JI5 E;  4WFT A;  4LF6 E;  5AE2 A;  1YYK A;  1HR0 E;  2G7H A;  2FTX B;  1IBK E;  3ADL A;  2L2N A;  4YY3 E;  1QU6 A;  2F8B A;  2L2K B;  2VQF E;  4DR7 E;  4LF8 E;  2DSY A;  4NXN E;  4JI2 E;  4LFC E;  4JI7 E;  4DV2 E;  2JOX A;  4OOG C;  2L92 A;  5CFF E;  3J7Y p;  4WSP A;  3HTX A;  1FKA E;  5BR8 E;  1J26 A;  1N32 E;  4P78 A;  2UU9 E;  2L6M A;  1T4O A;  4LU9 A;  2LRS A;  4LF5 E;  1N33 E;  2JY9 A;  2H36 X;  2UUA E;  3IWD A;  1GZ6 A;  2M7Q A;  4JV5 E;  2UUC E;  1UIL A;  4LF7 E;  3C4T A;  4DR2 E;  4X65 E;  4X66 E;  4BBY A;  1SR9 A;  3MSW A;  5AAS A;  2JR1 A;  1N34 E;  4LTY A;  5FLX C;  1N36 E;  2MDR A;  4DV7 E;  4F9B B;  3VYY A;  2LBS B;  4P7D A;  3T1Y E;  3AUZ A;  3HQ1 A;  4AQY E;  2N3H A;  4R8O A;  4B3M E;  4GKJ E;  2WZO A;  4JI1 E;  5AE1 A;  4JI3 E;  4F54 A;  2KHX A;  4DV6 E;  4JYA E;  1IBL E;  1X49 A;  2DMY A;  1I94 E;  2E5L E;  3VYX A;  2VF1 A;  2KOU A;  2YT4 A;  5LL6 R;  2L2M A;  1PKP A;  4I8O A;  1IBM E;  4TUI A;  3T1H E;  1O0W A;  1EKZ A;  4JI6 E;  2B7V A;  4NXM E;  3KWR A;  3OTO E;  2RS6 A;  2V89 A;  4GEQ B;  4LFB E;  4L8N A;  4DV0 E;  3ADI A;  1HNZ E;  2ODR D;  3VK6 A;  2RS7 A;  3DF6 A;  3F6H A;  4F9C B;  3RMP A;  1YYO A;  4B3S E;  2L3C A;  4KZS A;  1HNX E;  4B3T E;  4X64 E;  1T4L B;  2V88 A;  4M0V A;  1DI2 A;  3FIG A;  2CPN A;  3P1X A;  3IWC A;  4JI8 E;  3JTZ A;  1ZBQ A;  2ODR C;  2LTR A;  3LML A;  5DNY A;  2UXC E;  4M2Z A;  3J80 C;  3J81 C;  2RSM A;  4TUG A;  5LMU E;  2HHH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...