2LBWA

Solution structure of the s. cerevisiae h/aca rnp protein nhp2p-s82w mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDIWPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H/ACA ribonucleoprotein complex subunit 2
publication title Structure of H/ACA RNP Protein Nhp2p Reveals Cis/Trans Isomerization of a Conserved Proline at the RNA and Nop10 Binding Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 30
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2lbwA00
5A2QM 5GIOC 2KG4A 2KTVA 1NMUB 3CPWF 1XBIA 3LFOA 1JJ2F 3CCSF 5FLXM 2OTLF 3CC7F 1YJ9F 3O85A 5FJ4C 1KD1H 1GO1A 3LWVC 2FC3A 3CCRF 2QI2A 2QEXF 2I6DA 3N4YA 1E7KA 1ZWZA 1X52A 3E20B 1QVFF 1W40A 4NUTA 3HJWC 2OTJF 2HVYD 5EWRA 3MCAB 3NMUC 1GZ0A 1SDSA 3IR9A 3NK6A 3OBYA 1VQPF 1Q7YH 1VQ9F 5DCVA 3G6EF 3V7EA 3CCVF 3RA6A 2ALEA 1NJIH 2OHWA 3HAXD 3RA5A 3GYQA 1M1KH 1VQ5F 4X3MA 4TZZA 3J7AR 5G4UC 3AGKA 3J81M 1K73H 2LBWA 2AIFA 5GANK 2KTUA 5GINC 3LWOC 3E1YA 2OZBA 4C4WC 5GAPK 3CCMF 5EO3A 1Q82H 3CD6F 4LCKA 1K9MH 1VQ8F 1VQ4F 1RLGA 5G4VC 3CXCF 3SIUA 3G4SF 4BY9D 3CCJF 2QA4F 1M90H 1W3EX 1YIJF 3CMAF 1KQSF 3CC2F 3WXMB 3CG6A 1KC8H 3LWQC 1YHQF 3CPQA 3VMFB 1W42A 4X3LA 1X7OA 3OBWA 2LBXA 1RA4A 3J80M 3NVKE 2BO1A 3I55F 1W2BF 1CN7A 3CMEF 1YJNF 1GO0A 3LWRC 1Q86H 3JCMM 1DT9A 3JAMM 3G71F 1VQKF 1IPAA 2JNBA 1W41A 1VQLF 1Q81H 1N8RH 3NVIB 2WALA 3FFMA 1VQ7F 3N4ZA 1PXWA 2VGNA 4BW0B 1S72F 1YI2F 3VI6A 3ON1A 1CK2A 3CCLF 1H7MA 3PLAC 1YJWF 1T0KB 3CCQF 1YITF 5IT9M 3I56F 1K8AH 2VGMA 3LWPC 1VQMF 1QVGF 3V7QA 1VQNF 1VQ6F 2CZWA 3CC4F 3OW2F 3CCUF 3SIVA 1VQOF 3CCEF 3PAFA 3NK7A 1X7PA 5GIPC
chains in the Genus database with same CATH superfamily
1QAHA 3M84A 1J7HA 4BVTA 4RQOA 1U40A 2HS3A 3JALB 3TD5A 3CPWF 2ZF8A 3WPWA 5IYZA 2VAMA 1IV4A 5HY2A 3VYSC 5EB1B 3CYPB 4O2BA 4TV9B 4TV8B 3JALA 1YJ9F 1FFXA 1KD1H 5FJ4C 2QI2A 3ESJA 5LXTA 3KHNA 4TV9A 4TV8A 3D54A 4BT4A 2LBTA 3E20B 3HJWC 3WJPA 3JARB 3P10A 3F0FA 4O4IB 1T0AA 3VOAA 3NMUC 3IKFA 4I55B 3OBYA 1UFYA 3JARA 3VTIC 1VQVA 1COMA 4O4IA 1ODEA 2OHWA 3HAXD 4ZHQA 4I55A 1GX1A 3WGLA 3ZOPA 2UYPA 5HY1A 3U0OA 4C81A 1QU9A 1K73H 2KTUA 3LWOC 3E1YA 1JD1A 3DC2A 5GAPK 2CHTA 5C8YB 4DXDA 2H8EA 1W5FA 1K9MH 4X1KB 1JFFB 1RLGA 2G9IA 4BY9D 3CCJF 1X25A 5LOVB 3N2GB 4X1KA 1JFFA 3WGJA 1VK3A 4YJ3A 2ZAUA 3N2GA 4DRXB 4X3LA 3WJQA 5MN4A 2LBXA 4TUYA 2R6R1 4G4WA 1RA4A 3VOBA 1W2BF 1CN7A 3CMEF 3VYUC 3LWRC 3KJKA 1Q86H 3JASB 5EYPB 3WGKA 3JAMM 1R1MA 2IQQA 5CB4A 3N2KA 1VQKF 1QD9A 2JNBA 3D00A 3RYIA 3JASA 1W59A 1Z5WA 4BVRA 3JATA 5KX5B 3NVIB 3HKCB 3IEQA 1W5AA 3JAWB 4G4VA 3RYFB 3S03A 1YI2F 5CA1B 1H7MA 3PLAC 3HKCA 4X1IB 2R751 3ELCA 3JAWA 2YXZA 1W5EA 1SA0B 1UI9A 3E22B 4X1IA 2CHSA 5EZYA 4ZK7A 3CCUF 1JY8A 3CCEF 3S06A 5GIPC 1SA0A 3E22A 5A2QM 2ZVYA 4ZI7B 4E6EA 5JVDA 2GLZA 3RYHB 3CCSF 4WBNB 2ZVZA 2OTLF 4G4XA 4O2AB 2N48A 2RHOA 2ZODA 3RYHA 1VHAA 3IKEA 3M1XA 3CCRF 3S02A 5JH7B 3VIUA 4O2AA 3JAKA 4KWEA 3VO8A 5HY0A 3MBMA 3MCAB 1Z5VA 4O4JA 5JH7A 4O4HA 1KNKA 3IR9A 2Z1FA 2DYYA 4NWOB 2HX0A 3CCVF 4O2BB 2ALEA 4HNAB 1FFXB 1VQ5F 5HWEA 5GONB 5LYJB 5LXTB 4C82A 5J2UA 5G4UC 2RHJA 1U43A 3CYQA 1H47A 4U39A 5IYZB 4HNAA 4IHJB 4I4TA 4XCQA 4U3JB 2UYJA 5GONA 5LYJA 4C4WC 1IV1A 3TD3A 3CD6F 3C9SA 4IHJA 4LCKA 3MCQA 1VQ8F 4U3JA 3CXCF 3SIUA 1DBFA 3HKEB 2BTQB 4BT2A 4ZHQB 1W3EX 1YIJF 2Z1UA 1KQSF 4BT6A 3CC2F 4C8GA 3HKEA 3GHZA 3CPQA 2Q1YA 1X7OA 2W8BC 3J80M 3NVKE 3P4EA 5FNVA 4B45A 3JCMM 3LMEA 1FNKA 2HP0A 3LDTA 3WGNA 4YJ3B 1YQNA 3WPXA 3K0TA 2VAPA 1Q81H 2P6YA 1N8RH 4EB6B 3FFMA 3FD5A 1VQ7F 1H48A 2VGNA 1SZQA 3N4ZA 3B6NA 3P0ZA 4EI7A 4TUYB 3OONA 3VI6A 3ON1A 1CK2A 5EAZA 5JCOA 2L26A 4EB6A 3R0PA 3V4DA 3K2XA 1YITF 3V3TA 1KNJA 3LWPC 5LA6B 3V7QA 1VQNF 1VQ6F 5CB4B 3N2KB 3C8LA 3CC4F 1W55A 3RYIB 2UYKA 3EORA 5HXUA 3F0DA 4X1YB 3NK7A 5LA6A 3JATB 4ZHWA 4YJ2B 4ZOLA 5HP7A 4F6RB 1FSZA 2KTVA 5HXZA 1NMUB 4B62A 4X1YA 1XBIA 3LFOA 2IG8A 4YJ2A 1JJ2F 4B46A 4F6RA 3CC7F 3O85A 3LWVC 2RB9A 2FC3A 5EZYB 3DDNA 2I6RA 3ERNA 2I6DA 2PHNA 1QVFF 3WGMA 2LCAA 5J2TA 2HVYD 4ZHYB 3TD4A 3F0GA 4LNUA 3UT5B 2HRYA 5EIBC 4BVSA 5JVDB 1Q7YH 1VQPF 1VQ9F 3S0HA 3MQWA 5DCVA 2Z01A 3G6EF 2OTMA 3V7EA 3T80A 3UT5A 2Z1TA 3RA5A 3GYQA 4I50B 1M1KH 5EIBD 3VCZA 4X3MA 2RHHA 3J7AR 2B33A 4C8EA 2HP3A 3AGKA 1OAPA 2H8CA 5JCOC 4I50A 2YYEA 2AIFA 3JAKB 4X20A 5IJ0B 5GANK 3CCMF 4O4JB 5EO3A 1TUBB 3KE1A 4O4HB 4O4LB 4B5CA 1XHOA 4BT3A 3ZP7A 5IJ0A 5KMGB 2HS4A 1VQ4F 5G4VC 2CW4A 2ZOVA 1VH8A 5EB0A 3G4SF 5IJ9B 3IEWA 1TUBA 4O4LA 1M90H 5KMGA 2UYNB 5J2UB 3CG6A 3Q8HA 1KC8H 5IJ9A 3LWQC 3F0EA 2UYNA 3I3FA 4I4TB 1W42A 4IIJB 1U3LA 3VMFB 1W5BA 1TVKA 1W581 3OBWA 2QTPA 4IIJA 3I55F 3ZO8A 1GO0A 2DT4A 2F9ZC 3VYTC 4ZHVA 3S0YA 4EI9A 1DT9A 2GZLA 2GVIA 3S0WA 3KJJA 2MQEA 4PWTA 1FNJA 1PXWA 5MN5A 3RE3A 4BW0B 3JVHA 3M4SA 3CCLF 5MN6A 3D01A 5FNVB 3RYCB 5IT9M 3QHDA 1K8AH 2VGMA 2HP0B 3C9UA 2CZWA 3F6MA 5BMVB 3FBAA 4BVQA 3OW2F 3RYCA 1VQOF 1X7PA 5BMVA 5GIOC 2KG4A 1W57A 3HWUA 2FGYA 4ERHA 2AMTA 3FPIA 2Q1XA 5FLXM 3ZP4A 4M8IA 1RQ2A 4G4YA 3QTYA 5ITZB 1GO1A 3LYBA 2CSLA 4G88A 4NQ3A 3HKDB 2QEXF 3N4YA 2BTOA 1ZWZA 1X52A 3HKBB 4EI8A 1W40A 4NUTA 5ITZA 1E7KA 2OTJF 3HKDA 3HTNA 4ZOLB 5EWRA 1GZ0A 5C8YA 1SDSA 3C9TA 3GTZA 3NK6A 3HKBA 1U3PA 5LP6B 1PF5A 3RA6A 4C8IA 1NJIH 3L7QA 3BYQA 5LOVA 5LP6A 1XRGA 4TZZA 1JN1A 2KGWA 2HQSC 3J81M 2LBWA 4R40B 5HY4A 1NQ3A 5AVMA 4DRXA 5J2TB 5GINC 2OZBA 5CA0B 4LNUB 1IV3A 2H6LA 1Q82H 2V9YA 4BT7A 3CB2A 1IV2A 3WJRA 2CVLA 5CA0A 1RLUA 2QA4F 1Q8RA 2HRUA 5EYPA 3CMAF 5B8FA 3IMPA 3WXMB 1RQ7A 2VXYA 2BTUA 2CWJA 4X20B 1YHQF 5KX5A 2VAWA 3FD6A 3KIZA 3RYFA 5CA1A 2BO1A 3QUWA 3K12A 5JQGB 1YJNF 2K1SA 2HS0A 2IAFA 3I7TA 2EWCA 3G71F 1IPAA 2PMPA 1W41A 1VQLF 2RHLA 4FFBB 5JQGA 3K14A 2AIZP 4G4ZA 2WALA 1TVKB 4ZI7A 4FFBA 1S72F 3MDOA 1YGYA 4RHAA 5LP6C 1ONIA 1YJWF 1T0KB 3CCQF 4BT5A 1XV2A 1CLIA 4WBNA 3I56F 5HP8A 2UZHA 1VQMF 1QVGF 2Z1EA 2NMUA 1OFUA 3SIVA 3PAFA 3C9RA
chains in the Genus database with same CATH topology
5A2QM 5GIOC 2KG4A 4BVTA 2KTVA 5HXZA 1NMUB 2FGYA 3CPWF 1XBIA 3LFOA 5HY2A 2GLZA 1JJ2F 3CCSF 5FLXM 2OTLF 3CC7F 1YJ9F 3O85A 5FJ4C 1KD1H 1GO1A 3LWVC 4NQ3A 2FC3A 3CCRF 2QI2A 2QEXF 2I6DA 3N4YA 1E7KA 1ZWZA 1X52A 3E20B 4EI8A 1W40A 4NUTA 1QVFF 3HJWC 2OTJF 2HVYD 5HY0A 5EWRA 3MCAB 3NMUC 1GZ0A 4BVSA 1SDSA 3IR9A 3NK6A 3OBYA 1VQPF 1Q7YH 1VQ9F 5DCVA 3G6EF 3V7EA 3CCVF 3RA6A 2ALEA 1NJIH 2OHWA 3HAXD 3RA5A 3GYQA 1M1KH 1VQ5F 4X3MA 5HWEA 4TZZA 3J7AR 5G4UC 5HY1A 3AGKA 3J81M 1K73H 2LBWA 2AIFA 5GANK 5HY4A 2KTUA 4XCQA 5GINC 3LWOC 3E1YA 2OZBA 4C4WC 5GAPK 3CCMF 5EO3A 1Q82H 3CD6F 4LCKA 1K9MH 1VQ8F 1VQ4F 1RLGA 5G4VC 3CXCF 3SIUA 3G4SF 4BY9D 3CCJF 2QA4F 1M90H 1W3EX 1YIJF 3CMAF 1KQSF 3CC2F 3WXMB 3CG6A 1KC8H 3LWQC 1YHQF 3CPQA 3VMFB 1W42A 4X3LA 1X7OA 3OBWA 2LBXA 1RA4A 3J80M 3NVKE 2BO1A 3I55F 1W2BF 1CN7A 3CMEF 1YJNF 1GO0A 2F9ZC 3LWRC 1Q86H 3JCMM 4EI9A 1DT9A 3JAMM 3G71F 1VQKF 1IPAA 2JNBA 1W41A 1VQLF 3D00A 1Q81H 1N8RH 4BVRA 3NVIB 2WALA 3FFMA 1VQ7F 3N4ZA 1PXWA 2VGNA 4EI7A 4BW0B 1S72F 1YI2F 3VI6A 3ON1A 1CK2A 3CCLF 1H7MA 3PLAC 1YJWF 1T0KB 3CCQF 1YITF 5IT9M 3V3TA 3I56F 1K8AH 2VGMA 3LWPC 1VQMF 1QVGF 3V7QA 1VQNF 1VQ6F 2CZWA 3CC4F 4BVQA 3OW2F 3CCUF 3SIVA 5HXUA 1VQOF 3CCEF 3PAFA 3NK7A 1X7PA 5GIPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q M;  5GIO C;  2KG4 A;  2KTV A;  1NMU B;  3CPW F;  1XBI A;  3LFO A;  1JJ2 F;  3CCS F;  5FLX M;  2OTL F;  3CC7 F;  1YJ9 F;  3O85 A;  5FJ4 C;  1KD1 H;  1GO1 A;  3LWV C;  2FC3 A;  3CCR F;  2QI2 A;  2QEX F;  2I6D A;  3N4Y A;  1E7K A;  1ZWZ A;  1X52 A;  3E20 B;  1QVF F;  1W40 A;  4NUT A;  3HJW C;  2OTJ F;  2HVY D;  5EWR A;  3MCA B;  3NMU C;  1GZ0 A;  1SDS A;  3IR9 A;  3NK6 A;  3OBY A;  1VQP F;  1Q7Y H;  1VQ9 F;  5DCV A;  3G6E F;  3V7E A;  3CCV F;  3RA6 A;  2ALE A;  1NJI H;  2OHW A;  3HAX D;  3RA5 A;  3GYQ A;  1M1K H;  1VQ5 F;  4X3M A;  4TZZ A;  3J7A R;  5G4U C;  3AGK A;  3J81 M;  1K73 H;  2LBW A;  2AIF A;  5GAN K;  2KTU A;  5GIN C;  3LWO C;  3E1Y A;  2OZB A;  4C4W C;  5GAP K;  3CCM F;  5EO3 A;  1Q82 H;  3CD6 F;  4LCK A;  1K9M H;  1VQ8 F;  1VQ4 F;  1RLG A;  5G4V C;  3CXC F;  3SIU A;  3G4S F;  4BY9 D;  3CCJ F;  2QA4 F;  1M90 H;  1W3E X;  1YIJ F;  3CMA F;  1KQS F;  3CC2 F;  3WXM B;  3CG6 A;  1KC8 H;  3LWQ C;  1YHQ F;  3CPQ A;  3VMF B;  1W42 A;  4X3L A;  1X7O A;  3OBW A;  2LBX A;  1RA4 A;  3J80 M;  3NVK E;  2BO1 A;  3I55 F;  1W2B F;  1CN7 A;  3CME F;  1YJN F;  1GO0 A;  3LWR C;  1Q86 H;  3JCM M;  1DT9 A;  3JAM M;  3G71 F;  1VQK F;  1IPA A;  2JNB A;  1W41 A;  1VQL F;  1Q81 H;  1N8R H;  3NVI B;  2WAL A;  3FFM A;  1VQ7 F;  3N4Z A;  1PXW A;  2VGN A;  4BW0 B;  1S72 F;  1YI2 F;  3VI6 A;  3ON1 A;  1CK2 A;  3CCL F;  1H7M A;  3PLA C;  1YJW F;  1T0K B;  3CCQ F;  1YIT F;  5IT9 M;  3I56 F;  1K8A H;  2VGM A;  3LWP C;  1VQM F;  1QVG F;  3V7Q A;  1VQN F;  1VQ6 F;  2CZW A;  3CC4 F;  3OW2 F;  3CCU F;  3SIV A;  1VQO F;  3CCE F;  3PAF A;  3NK7 A;  1X7P A;  5GIP C; 
#chains in the Genus database with same CATH topology
 1QAH A;  3M84 A;  1J7H A;  4BVT A;  4RQO A;  1U40 A;  2HS3 A;  3JAL B;  3TD5 A;  3CPW F;  2ZF8 A;  3WPW A;  5IYZ A;  2VAM A;  1IV4 A;  5HY2 A;  3VYS C;  5EB1 B;  3CYP B;  4O2B A;  4TV9 B;  4TV8 B;  3JAL A;  1YJ9 F;  1FFX A;  1KD1 H;  5FJ4 C;  2QI2 A;  3ESJ A;  5LXT A;  3KHN A;  4TV9 A;  4TV8 A;  3D54 A;  4BT4 A;  2LBT A;  3E20 B;  3HJW C;  3WJP A;  3JAR B;  3P10 A;  3F0F A;  4O4I B;  1T0A A;  3VOA A;  3NMU C;  3IKF A;  4I55 B;  3OBY A;  1UFY A;  3JAR A;  3VTI C;  1VQV A;  1COM A;  4O4I A;  1ODE A;  2OHW A;  3HAX D;  4ZHQ A;  4I55 A;  1GX1 A;  3WGL A;  3ZOP A;  2UYP A;  5HY1 A;  3U0O A;  4C81 A;  1QU9 A;  1K73 H;  2KTU A;  3LWO C;  3E1Y A;  1JD1 A;  3DC2 A;  5GAP K;  2CHT A;  5C8Y B;  4DXD A;  2H8E A;  1W5F A;  1K9M H;  4X1K B;  1JFF B;  1RLG A;  2G9I A;  4BY9 D;  3CCJ F;  1X25 A;  5LOV B;  3N2G B;  4X1K A;  1JFF A;  3WGJ A;  1VK3 A;  4YJ3 A;  2ZAU A;  3N2G A;  4DRX B;  4X3L A;  3WJQ A;  5MN4 A;  2LBX A;  4TUY A;  2R6R 1;  4G4W A;  1RA4 A;  3VOB A;  1W2B F;  1CN7 A;  3CME F;  3VYU C;  3LWR C;  3KJK A;  1Q86 H;  3JAS B;  5EYP B;  3WGK A;  3JAM M;  1R1M A;  2IQQ A;  5CB4 A;  3N2K A;  1VQK F;  1QD9 A;  2JNB A;  3D00 A;  3RYI A;  3JAS A;  1W59 A;  1Z5W A;  4BVR A;  3JAT A;  5KX5 B;  3NVI B;  3HKC B;  3IEQ A;  1W5A A;  3JAW B;  4G4V A;  3RYF B;  3S03 A;  1YI2 F;  5CA1 B;  1H7M A;  3PLA C;  3HKC A;  4X1I B;  2R75 1;  3ELC A;  3JAW A;  2YXZ A;  1W5E A;  1SA0 B;  1UI9 A;  3E22 B;  4X1I A;  2CHS A;  5EZY A;  4ZK7 A;  3CCU F;  1JY8 A;  3CCE F;  3S06 A;  5GIP C;  1SA0 A;  3E22 A;  5A2Q M;  2ZVY A;  4ZI7 B;  4E6E A;  5JVD A;  2GLZ A;  3RYH B;  3CCS F;  4WBN B;  2ZVZ A;  2OTL F;  4G4X A;  4O2A B;  2N48 A;  2RHO A;  2ZOD A;  3RYH A;  1VHA A;  3IKE A;  3M1X A;  3CCR F;  3S02 A;  5JH7 B;  3VIU A;  4O2A A;  3JAK A;  4KWE A;  3VO8 A;  5HY0 A;  3MBM A;  3MCA B;  1Z5V A;  4O4J A;  5JH7 A;  4O4H A;  1KNK A;  3IR9 A;  2Z1F A;  2DYY A;  4NWO B;  2HX0 A;  3CCV F;  4O2B B;  2ALE A;  4HNA B;  1FFX B;  1VQ5 F;  5HWE A;  5GON B;  5LYJ B;  5LXT B;  4C82 A;  5J2U A;  5G4U C;  2RHJ A;  1U43 A;  3CYQ A;  1H47 A;  4U39 A;  5IYZ B;  4HNA A;  4IHJ B;  4I4T A;  4XCQ A;  4U3J B;  2UYJ A;  5GON A;  5LYJ A;  4C4W C;  1IV1 A;  3TD3 A;  3CD6 F;  3C9S A;  4IHJ A;  4LCK A;  3MCQ A;  1VQ8 F;  4U3J A;  3CXC F;  3SIU A;  1DBF A;  3HKE B;  2BTQ B;  4BT2 A;  4ZHQ B;  1W3E X;  1YIJ F;  2Z1U A;  1KQS F;  4BT6 A;  3CC2 F;  4C8G A;  3HKE A;  3GHZ A;  3CPQ A;  2Q1Y A;  1X7O A;  2W8B C;  3J80 M;  3NVK E;  3P4E A;  5FNV A;  4B45 A;  3JCM M;  3LME A;  1FNK A;  2HP0 A;  3LDT A;  3WGN A;  4YJ3 B;  1YQN A;  3WPX A;  3K0T A;  2VAP A;  1Q81 H;  2P6Y A;  1N8R H;  4EB6 B;  3FFM A;  3FD5 A;  1VQ7 F;  1H48 A;  2VGN A;  1SZQ A;  3N4Z A;  3B6N A;  3P0Z A;  4EI7 A;  4TUY B;  3OON A;  3VI6 A;  3ON1 A;  1CK2 A;  5EAZ A;  5JCO A;  2L26 A;  4EB6 A;  3R0P A;  3V4D A;  3K2X A;  1YIT F;  3V3T A;  1KNJ A;  3LWP C;  5LA6 B;  3V7Q A;  1VQN F;  1VQ6 F;  5CB4 B;  3N2K B;  3C8L A;  3CC4 F;  1W55 A;  3RYI B;  2UYK A;  3EOR A;  5HXU A;  3F0D A;  4X1Y B;  3NK7 A;  5LA6 A;  3JAT B;  4ZHW A;  4YJ2 B;  4ZOL A;  5HP7 A;  4F6R B;  1FSZ A;  2KTV A;  5HXZ A;  1NMU B;  4B62 A;  4X1Y A;  1XBI A;  3LFO A;  2IG8 A;  4YJ2 A;  1JJ2 F;  4B46 A;  4F6R A;  3CC7 F;  3O85 A;  3LWV C;  2RB9 A;  2FC3 A;  5EZY B;  3DDN A;  2I6R A;  3ERN A;  2I6D A;  2PHN A;  1QVF F;  3WGM A;  2LCA A;  5J2T A;  2HVY D;  4ZHY B;  3TD4 A;  3F0G A;  4LNU A;  3UT5 B;  2HRY A;  5EIB C;  4BVS A;  5JVD B;  1Q7Y H;  1VQP F;  1VQ9 F;  3S0H A;  3MQW A;  5DCV A;  2Z01 A;  3G6E F;  2OTM A;  3V7E A;  3T80 A;  3UT5 A;  2Z1T A;  3RA5 A;  3GYQ A;  4I50 B;  1M1K H;  5EIB D;  3VCZ A;  4X3M A;  2RHH A;  3J7A R;  2B33 A;  4C8E A;  2HP3 A;  3AGK A;  1OAP A;  2H8C A;  5JCO C;  4I50 A;  2YYE A;  2AIF A;  3JAK B;  4X20 A;  5IJ0 B;  5GAN K;  3CCM F;  4O4J B;  5EO3 A;  1TUB B;  3KE1 A;  4O4H B;  4O4L B;  4B5C A;  1XHO A;  4BT3 A;  3ZP7 A;  5IJ0 A;  5KMG B;  2HS4 A;  1VQ4 F;  5G4V C;  2CW4 A;  2ZOV A;  1VH8 A;  5EB0 A;  3G4S F;  5IJ9 B;  3IEW A;  1TUB A;  4O4L A;  1M90 H;  5KMG A;  2UYN B;  5J2U B;  3CG6 A;  3Q8H A;  1KC8 H;  5IJ9 A;  3LWQ C;  3F0E A;  2UYN A;  3I3F A;  4I4T B;  1W42 A;  4IIJ B;  1U3L A;  3VMF B;  1W5B A;  1TVK A;  1W58 1;  3OBW A;  2QTP A;  4IIJ A;  3I55 F;  3ZO8 A;  1GO0 A;  2DT4 A;  2F9Z C;  3VYT C;  4ZHV A;  3S0Y A;  4EI9 A;  1DT9 A;  2GZL A;  2GVI A;  3S0W A;  3KJJ A;  2MQE A;  4PWT A;  1FNJ A;  1PXW A;  5MN5 A;  3RE3 A;  4BW0 B;  3JVH A;  3M4S A;  3CCL F;  5MN6 A;  3D01 A;  5FNV B;  3RYC B;  5IT9 M;  3QHD A;  1K8A H;  2VGM A;  2HP0 B;  3C9U A;  2CZW A;  3F6M A;  5BMV B;  3FBA A;  4BVQ A;  3OW2 F;  3RYC A;  1VQO F;  1X7P A;  5BMV A;  5GIO C;  2KG4 A;  1W57 A;  3HWU A;  2FGY A;  4ERH A;  2AMT A;  3FPI A;  2Q1X A;  5FLX M;  3ZP4 A;  4M8I A;  1RQ2 A;  4G4Y A;  3QTY A;  5ITZ B;  1GO1 A;  3LYB A;  2CSL A;  4G88 A;  4NQ3 A;  3HKD B;  2QEX F;  3N4Y A;  2BTO A;  1ZWZ A;  1X52 A;  3HKB B;  4EI8 A;  1W40 A;  4NUT A;  5ITZ A;  1E7K A;  2OTJ F;  3HKD A;  3HTN A;  4ZOL B;  5EWR A;  1GZ0 A;  5C8Y A;  1SDS A;  3C9T A;  3GTZ A;  3NK6 A;  3HKB A;  1U3P A;  5LP6 B;  1PF5 A;  3RA6 A;  4C8I A;  1NJI H;  3L7Q A;  3BYQ A;  5LOV A;  5LP6 A;  1XRG A;  4TZZ A;  1JN1 A;  2KGW A;  2HQS C;  3J81 M;  2LBW A;  4R40 B;  5HY4 A;  1NQ3 A;  5AVM A;  4DRX A;  5J2T B;  5GIN C;  2OZB A;  5CA0 B;  4LNU B;  1IV3 A;  2H6L A;  1Q82 H;  2V9Y A;  4BT7 A;  3CB2 A;  1IV2 A;  3WJR A;  2CVL A;  5CA0 A;  1RLU A;  2QA4 F;  1Q8R A;  2HRU A;  5EYP A;  3CMA F;  5B8F A;  3IMP A;  3WXM B;  1RQ7 A;  2VXY A;  2BTU A;  2CWJ A;  4X20 B;  1YHQ F;  5KX5 A;  2VAW A;  3FD6 A;  3KIZ A;  3RYF A;  5CA1 A;  2BO1 A;  3QUW A;  3K12 A;  5JQG B;  1YJN F;  2K1S A;  2HS0 A;  2IAF A;  3I7T A;  2EWC A;  3G71 F;  1IPA A;  2PMP A;  1W41 A;  1VQL F;  2RHL A;  4FFB B;  5JQG A;  3K14 A;  2AIZ P;  4G4Z A;  2WAL A;  1TVK B;  4ZI7 A;  4FFB A;  1S72 F;  3MDO A;  1YGY A;  4RHA A;  5LP6 C;  1ONI A;  1YJW F;  1T0K B;  3CCQ F;  4BT5 A;  1XV2 A;  1CLI A;  4WBN A;  3I56 F;  5HP8 A;  2UZH A;  1VQM F;  1QVG F;  2Z1E A;  2NMU A;  1OFU A;  3SIV A;  3PAF A;  3C9R A; 
#chains in the Genus database with same CATH homology
 5A2Q M;  5GIO C;  2KG4 A;  4BVT A;  2KTV A;  5HXZ A;  1NMU B;  2FGY A;  3CPW F;  1XBI A;  3LFO A;  5HY2 A;  2GLZ A;  1JJ2 F;  3CCS F;  5FLX M;  2OTL F;  3CC7 F;  1YJ9 F;  3O85 A;  5FJ4 C;  1KD1 H;  1GO1 A;  3LWV C;  4NQ3 A;  2FC3 A;  3CCR F;  2QI2 A;  2QEX F;  2I6D A;  3N4Y A;  1E7K A;  1ZWZ A;  1X52 A;  3E20 B;  4EI8 A;  1W40 A;  4NUT A;  1QVF F;  3HJW C;  2OTJ F;  2HVY D;  5HY0 A;  5EWR A;  3MCA B;  3NMU C;  1GZ0 A;  4BVS A;  1SDS A;  3IR9 A;  3NK6 A;  3OBY A;  1VQP F;  1Q7Y H;  1VQ9 F;  5DCV A;  3G6E F;  3V7E A;  3CCV F;  3RA6 A;  2ALE A;  1NJI H;  2OHW A;  3HAX D;  3RA5 A;  3GYQ A;  1M1K H;  1VQ5 F;  4X3M A;  5HWE A;  4TZZ A;  3J7A R;  5G4U C;  5HY1 A;  3AGK A;  3J81 M;  1K73 H;  2LBW A;  2AIF A;  5GAN K;  5HY4 A;  2KTU A;  4XCQ A;  5GIN C;  3LWO C;  3E1Y A;  2OZB A;  4C4W C;  5GAP K;  3CCM F;  5EO3 A;  1Q82 H;  3CD6 F;  4LCK A;  1K9M H;  1VQ8 F;  1VQ4 F;  1RLG A;  5G4V C;  3CXC F;  3SIU A;  3G4S F;  4BY9 D;  3CCJ F;  2QA4 F;  1M90 H;  1W3E X;  1YIJ F;  3CMA F;  1KQS F;  3CC2 F;  3WXM B;  3CG6 A;  1KC8 H;  3LWQ C;  1YHQ F;  3CPQ A;  3VMF B;  1W42 A;  4X3L A;  1X7O A;  3OBW A;  2LBX A;  1RA4 A;  3J80 M;  3NVK E;  2BO1 A;  3I55 F;  1W2B F;  1CN7 A;  3CME F;  1YJN F;  1GO0 A;  2F9Z C;  3LWR C;  1Q86 H;  3JCM M;  4EI9 A;  1DT9 A;  3JAM M;  3G71 F;  1VQK F;  1IPA A;  2JNB A;  1W41 A;  1VQL F;  3D00 A;  1Q81 H;  1N8R H;  4BVR A;  3NVI B;  2WAL A;  3FFM A;  1VQ7 F;  3N4Z A;  1PXW A;  2VGN A;  4EI7 A;  4BW0 B;  1S72 F;  1YI2 F;  3VI6 A;  3ON1 A;  1CK2 A;  3CCL F;  1H7M A;  3PLA C;  1YJW F;  1T0K B;  3CCQ F;  1YIT F;  5IT9 M;  3V3T A;  3I56 F;  1K8A H;  2VGM A;  3LWP C;  1VQM F;  1QVG F;  3V7Q A;  1VQN F;  1VQ6 F;  2CZW A;  3CC4 F;  4BVQ A;  3OW2 F;  3CCU F;  3SIV A;  5HXU A;  1VQO F;  3CCE F;  3PAF A;  3NK7 A;  1X7P A;  5GIP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...