2LC1A

Rv0020c_fha structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
100
structure length
100
Chain Sequence
GHGSAGTSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEIIVRMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into the Mycobacterium tuberculosis Rv0020c Protein and Its Interaction with the PknB Kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein binding
molecule keywords Putative uncharacterized protein TB39.8
total genus 20
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2lc1A00
2KB3A 3UOTA 1J4PA 3GQSA 1J4OA 1LGQA 3HUEA 3I0NA 4A0EA 3UNMA 3FM8A 3HUFA 4JONA 1G6GA 1QU5A 2KB4A 3VA4A 5A8IA 3UNNA 1MZKA 2JQJA 2LC1A 3MDBA 3I6WA 3PO8A 1DMZA 1FHQA 3KT9A 4G2SA 1K2NA 2XT9B 1K3QA 2BRFA 5DJOA 1YJ5C 4EGXA 2W3OA 1G3GA 1YJMA 3UV0A 1K2MA 3I0MA 3HX1A 4D9VA 4EJQA 3ELSA 4QCJA 3VA1A 2JQLA 2PIEA 1FHRA 2KFUA 2EH0A 2G1LA 4H87A 1K3NA 2A0TA 1LGPA 2AFFA 2FF4A 3POAA 3ELVA 2KKLA 2JPEA 5E50A 2CSWA 3UN0A 1UHTA 3I6UA 1K3JA 1J4QA 1R21A 1UJXA 2FEZA 1WLNA 2JKDA 2JQIA 3UMZA 1J4KA 3OUNA 3VPYA 1GXCA 1WV3A 1J4LA
chains in the Genus database with same CATH superfamily
2I2AA 3UOTA 3GQSA 3DITA 1J4OA 5JEOA 4HAOA 3FM8A 3VA4A 3UNNA 1MZKA 5DHPA 2I29A 3VZCA 5JERA 3MDBA 4G2SA 3S40A 2JGRA 2BRFA 5EJHA 5DHRA 5BVIA 2W3OA 1G3GA 5EJFA 2I2CA 1K2MA 1Z0ZA 3T5PA 2P1RA 3VA1A 2JQLA 3V7UA 3VZDA 2G1LA 4DY6A 2QVLA 1U7FA 2AFFA 2XXSA 2Q5FA 2I2FA 3ELVA 5E50A 1UHTA 1Z0SA 1J4QA 4L02A 1SUWA 3V7YA 1KHXA 3PFNA 1GXCA 1WV3A 1G88A 3HX1A 1U7VA 1J4PA 4V24A 3HUEA 3I0NA 4JONA 2KB4A 3GMJA 4WERA 5C4VA 1ZOQA 1DD1A 5EJGA 4R9PA 1MJSA 3UV0A 5DHQA 4EJQA 4QCJA 1K3NA 5EJIA 4KU0D 1LGPA 3A77A 2FF4A 5DHSA 3V8QA 3V8PA 1R21A 1UJXA 2FEZA 3VPYA 4JIVD 3OUNA 3V8NA 1J4LA 1LGQA 4A0EA 3UNMA 1QU5A 1J2FA 1YGSA 1MR1A 2LC1A 3PO8A 4A4YA 1DMZA 1K2NA 3AFOA 1QWTA 3V8MA 5JEJA 1U0TA 3I0MA 2QV7A 3V8RA 4D9VA 3ELSA 4JIWD 1FHRA 2EH0A 1KHUA 3V80A 2A0TA 3POAA 4WRRA 2CSWA 2AN1A 2JKDA 3UMZA 2JQIA 1J4KA 2BONA 2XT9B 2KB3A 5DHTA 3HUFA 1G6GA 5A8IA 2JQJA 1DEVA 3I6WA 1Z0UA 1FHQA 3KT9A 3V7WA 5DJOA 4EGXA 1YJ5C 1U7FB 5JEMA 1YJMA 1YT5A 3DSHA 5JELA 1Y3HA 2I2DA 1Y3IA 2PIEA 2KFUA 1U0RA 4H87A 1MK2A 5JEKA 2I2BA 2KKLA 2JPEA 3VZBA 2I1WA 5DHUA 1K3JA 3I6UA 1U7VB 1WLNA 1K3QA 3UN0A
chains in the Genus database with same CATH topology
3UOTA 3GQSA 3DITA 1J4OA 5JEOA 3VA4A 3FM8A 3UNNA 1MZKA 3VZCA 5JERA 3MDBA 4G2SA 3S40A 2JGRA 2BRFA 5BVIA 1G3GA 2W3OA 1K2MA 3T5PA 2P1RA 3VA1A 2JQLA 3VZDA 2G1LA 1U7FA 2AFFA 2QVLA 2XXSA 3ELVA 5E50A 1UHTA 1J4QA 4L02A 1KHXA 3HX1A 1WV3A 1GXCA 1G88A 1U7VA 1J4PA 4V24A 3HUEA 3I0NA 4JONA 2KB4A 3GMJA 4WERA 5C4VA 1ZOQA 1DD1A 4R9PA 1MJSA 3UV0A 4EJQA 4QCJA 1K3NA 4KU0D 1LGPA 2FF4A 3A77A 1R21A 1UJXA 2FEZA 3VPYA 4JIVD 3OUNA 1J4LA 1LGQA 4A0EA 3UNMA 1QU5A 1J2FA 1YGSA 1MR1A 2LC1A 3PO8A 4A4YA 1DMZA 1K2NA 1QWTA 5JEJA 3I0MA 2QV7A 4D9VA 3ELSA 4JIWD 1FHRA 2EH0A 1KHUA 2A0TA 3POAA 4WRRA 2CSWA 2JKDA 3UMZA 2JQIA 1J4KA 2BONA 2XT9B 2KB3A 3HUFA 1G6GA 5A8IA 2JQJA 1DEVA 3I6WA 1FHQA 3KT9A 5DJOA 4EGXA 1YJ5C 1U7FB 5JEMA 1YJMA 3DSHA 5JELA 2PIEA 2KFUA 4H87A 1MK2A 5JEKA 2KKLA 2JPEA 3VZBA 1K3JA 3I6UA 1U7VB 1WLNA 1K3QA 3UN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KB3 A;  3UOT A;  1J4P A;  3GQS A;  1J4O A;  1LGQ A;  3HUE A;  3I0N A;  4A0E A;  3UNM A;  3FM8 A;  3HUF A;  4JON A;  1G6G A;  1QU5 A;  2KB4 A;  3VA4 A;  5A8I A;  3UNN A;  1MZK A;  2JQJ A;  2LC1 A;  3MDB A;  3I6W A;  3PO8 A;  1DMZ A;  1FHQ A;  3KT9 A;  4G2S A;  1K2N A;  2XT9 B;  1K3Q A;  2BRF A;  5DJO A;  1YJ5 C;  4EGX A;  2W3O A;  1G3G A;  1YJM A;  3UV0 A;  1K2M A;  3I0M A;  3HX1 A;  4D9V A;  4EJQ A;  3ELS A;  4QCJ A;  3VA1 A;  2JQL A;  2PIE A;  1FHR A;  2KFU A;  2EH0 A;  2G1L A;  4H87 A;  1K3N A;  2A0T A;  1LGP A;  2AFF A;  2FF4 A;  3POA A;  3ELV A;  2KKL A;  2JPE A;  5E50 A;  2CSW A;  3UN0 A;  1UHT A;  3I6U A;  1K3J A;  1J4Q A;  1R21 A;  1UJX A;  2FEZ A;  1WLN A;  2JKD A;  2JQI A;  3UMZ A;  1J4K A;  3OUN A;  3VPY A;  1GXC A;  1WV3 A;  1J4L A; 
#chains in the Genus database with same CATH topology
 2I2A A;  3UOT A;  3GQS A;  3DIT A;  1J4O A;  5JEO A;  4HAO A;  3FM8 A;  3VA4 A;  3UNN A;  1MZK A;  5DHP A;  2I29 A;  3VZC A;  5JER A;  3MDB A;  4G2S A;  3S40 A;  2JGR A;  2BRF A;  5EJH A;  5DHR A;  5BVI A;  2W3O A;  1G3G A;  5EJF A;  2I2C A;  1K2M A;  1Z0Z A;  3T5P A;  2P1R A;  3VA1 A;  2JQL A;  3V7U A;  3VZD A;  2G1L A;  4DY6 A;  2QVL A;  1U7F A;  2AFF A;  2XXS A;  2Q5F A;  2I2F A;  3ELV A;  5E50 A;  1UHT A;  1Z0S A;  1J4Q A;  4L02 A;  1SUW A;  3V7Y A;  1KHX A;  3PFN A;  1GXC A;  1WV3 A;  1G88 A;  3HX1 A;  1U7V A;  1J4P A;  4V24 A;  3HUE A;  3I0N A;  4JON A;  2KB4 A;  3GMJ A;  4WER A;  5C4V A;  1ZOQ A;  1DD1 A;  5EJG A;  4R9P A;  1MJS A;  3UV0 A;  5DHQ A;  4EJQ A;  4QCJ A;  1K3N A;  5EJI A;  4KU0 D;  1LGP A;  3A77 A;  2FF4 A;  5DHS A;  3V8Q A;  3V8P A;  1R21 A;  1UJX A;  2FEZ A;  3VPY A;  4JIV D;  3OUN A;  3V8N A;  1J4L A;  1LGQ A;  4A0E A;  3UNM A;  1QU5 A;  1J2F A;  1YGS A;  1MR1 A;  2LC1 A;  3PO8 A;  4A4Y A;  1DMZ A;  1K2N A;  3AFO A;  1QWT A;  3V8M A;  5JEJ A;  1U0T A;  3I0M A;  2QV7 A;  3V8R A;  4D9V A;  3ELS A;  4JIW D;  1FHR A;  2EH0 A;  1KHU A;  3V80 A;  2A0T A;  3POA A;  4WRR A;  2CSW A;  2AN1 A;  2JKD A;  3UMZ A;  2JQI A;  1J4K A;  2BON A;  2XT9 B;  2KB3 A;  5DHT A;  3HUF A;  1G6G A;  5A8I A;  2JQJ A;  1DEV A;  3I6W A;  1Z0U A;  1FHQ A;  3KT9 A;  3V7W A;  5DJO A;  4EGX A;  1YJ5 C;  1U7F B;  5JEM A;  1YJM A;  1YT5 A;  3DSH A;  5JEL A;  1Y3H A;  2I2D A;  1Y3I A;  2PIE A;  2KFU A;  1U0R A;  4H87 A;  1MK2 A;  5JEK A;  2I2B A;  2KKL A;  2JPE A;  3VZB A;  2I1W A;  5DHU A;  1K3J A;  3I6U A;  1U7V B;  1WLN A;  1K3Q A;  3UN0 A; 
#chains in the Genus database with same CATH homology
 3UOT A;  3GQS A;  3DIT A;  1J4O A;  5JEO A;  3VA4 A;  3FM8 A;  3UNN A;  1MZK A;  3VZC A;  5JER A;  3MDB A;  4G2S A;  3S40 A;  2JGR A;  2BRF A;  5BVI A;  1G3G A;  2W3O A;  1K2M A;  3T5P A;  2P1R A;  3VA1 A;  2JQL A;  3VZD A;  2G1L A;  1U7F A;  2AFF A;  2QVL A;  2XXS A;  3ELV A;  5E50 A;  1UHT A;  1J4Q A;  4L02 A;  1KHX A;  3HX1 A;  1WV3 A;  1GXC A;  1G88 A;  1U7V A;  1J4P A;  4V24 A;  3HUE A;  3I0N A;  4JON A;  2KB4 A;  3GMJ A;  4WER A;  5C4V A;  1ZOQ A;  1DD1 A;  4R9P A;  1MJS A;  3UV0 A;  4EJQ A;  4QCJ A;  1K3N A;  4KU0 D;  1LGP A;  2FF4 A;  3A77 A;  1R21 A;  1UJX A;  2FEZ A;  3VPY A;  4JIV D;  3OUN A;  1J4L A;  1LGQ A;  4A0E A;  3UNM A;  1QU5 A;  1J2F A;  1YGS A;  1MR1 A;  2LC1 A;  3PO8 A;  4A4Y A;  1DMZ A;  1K2N A;  1QWT A;  5JEJ A;  3I0M A;  2QV7 A;  4D9V A;  3ELS A;  4JIW D;  1FHR A;  2EH0 A;  1KHU A;  2A0T A;  3POA A;  4WRR A;  2CSW A;  2JKD A;  3UMZ A;  2JQI A;  1J4K A;  2BON A;  2XT9 B;  2KB3 A;  3HUF A;  1G6G A;  5A8I A;  2JQJ A;  1DEV A;  3I6W A;  1FHQ A;  3KT9 A;  5DJO A;  4EGX A;  1YJ5 C;  1U7F B;  5JEM A;  1YJM A;  3DSH A;  5JEL A;  2PIE A;  2KFU A;  4H87 A;  1MK2 A;  5JEK A;  2KKL A;  2JPE A;  3VZB A;  1K3J A;  3I6U A;  1U7V B;  1WLN A;  1K3Q A;  3UN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...