2LCCA

Solution structure of rbbp1 chromobarrel domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
b'EDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT-rich interactive domain-containing protein 4A
molecule tags Transcription
source organism Homo sapiens
publication title Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1.
pubmed doi rcsb
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lccA00
2EQMA 3OYIA 5IN1A 5C6SA 3H6ZA 3LH0A 5CIUA 3NTKA 4NS5A 4N4HA 2LCCA 3L2UA 4E7JA 3MEUA 2P0KA 1WJSA 4Z02A 4IUPA 3OYNA 2CKKA 2DIQA 3F70A 2K3XA 3OQ5A 4E7HA 2L89A 3MEAA 3MP8A 2RHXA 4BE1A 2M1HA 2GFUA 2JTFA 3MP6A 4QQDA 3ZEHA 3OYBA 2X4YA 5D6WA 1WJQA 2RHIA 4QVZA 3L2QA 4BDYA 2YRVA 3M9QA 5FROA 1OYXA 3S3NA 3OMGA 1N27A 3OMCA 2QQSA 3OYMA 3DLMA 4IUTA 4N4IA 4C5IA 3OS2A 1RI0A 3OB9A 2E6NA 2EQJA 4BE0A 2LVMA 3O8VA 2G3RA 3BDLA 3QIIA 4C5GA 3L42A 2HQEA 3FEOA 3LGFA 3OYJA 2R57A 2X4XA 2EFIA 1WGSA 1G5VA 2X35A 2F5KA 2WACA 3FC3A 2DIGA 4QQ6A 2DAQA 3LYIA 5KCHA 4BDZA 2O4XA 2VYTA 4B9WA 4C5HA 2RI2A 3DB4A 2O4XB 5J39A 5FRMA 1XNIA 2L8DA 3QJ6A 3MO8A 2EKOA 3L2WA 4B9XA 4RG2A 3L2RA 4UC4A 2R5AA 3S3OA 2RJEA 2BKDN 4HCZA 3SD4A 4A4HA 2QQRA 2R58A 4ZTFA 5J26A 4E7LA 4EDUA 2E5QA 2MWPA 3H8ZA 2RJCA 3OYHA 3OYEA 2GFAA 3META 3OS0A 2IG0A 2PQWA 2X4WA 5FRNA 3DB3A 3KUFA 3LLRA 4N4GA 2BIVA 2EQKA 3CEYA 2HQXA 4II1A 1H3ZA 3EAEA 5KE2A 4A4GA 4E7IA 4C5EA 4QW2A 2XK0A 3C4SA 2LTOA 2JZ2A 1MHNA 2D9TA 4PLLA 4BACA 3OY9A 2LDMA 5D6YA 3OYAA 2K3YA 4Q5WA 4IKFA 4PL6A 1OI1A 3UWNA 3OS1A 3LX7A 3OYGA 2M0OA 3QKJA 3UT1A 3MP1A 3L2VA 2BUDA 3OA6A 3MEWA 4IUUA 3S6WA 3E9GA 2RI3A 3PMTA 2EQUA 2RJFA 3LGLA 2NLUA 3FDRA 2LRQA 1KHCA 5C0MA 2B8AA 5D6XA 4OVAA 2RJDA 4PLIA 3MEVA 2M16A 4IUVA 3PMIA 2FHDA 3FLGA 4LD6A 3OYKA 1SSFA 3QBYA 3NTIA 5IAYA 3OYLA 3ME9A 2RHYA 3PNWC 4GY5A 3E9FA 4BD3A 2GF7A 3OYDA 3OYFA 4CRIA 4IURA 3OYCA 1OZ3A 4FU6A 5KCOA 2RHZA 3ASKA 4A4FA 3Q1JA 4QQGA 3PFSA 3GOXA 2MWOA 2R5MA 3NTHA 4IUQA 2RI5A 2XDPA 2RO0A 3S3MA 2L3RA 2RHUA 5KE3A 3P8DA 4L59A 5KH6A 5M9OA 4ZTJA 4FL6A 1WJRA 4X34A 4A4EA 3P8HA 4BE2A 4E7KA 1OZ2A
chains in the Genus database with same CATH superfamily
4OB2B 4HVWA 4BI3A 3PGGA 1B34A 4C8QG 2DXBA 4N4HA 5GAMf 1QVFA 2JMAA 1GCQC 1RL2A 3PIPA 2JW4A 2CKKA 3CCMT 5KYXA 5FU6B 2E65A 3MP8A 4F17A 5FLXE 4ORZA 1G2BA 3D7SB 4QQDA 1U1SA 1Q86C 1VOMA 2PTKA 1T0HA 3OYMA 2E6NA 2SRCA 1TSFA 1WHHA 3QIIA 4J8OA 4JJDA 2ZPEB 5ECAA 2HL3A 4ESRA 3EG9A 1YI2Q 1YCSB 2LJ0A 2WACA 3LYIA 1RABB 5KCHA 2MAMA 4BDZA 2O4XA 3PIOA 1UJYA 2HAXA 2L2PA 2E6ZA 4J5YA 4NL2A 2XDBA 1WFWA 2JNGA 5CCAA 2EYWA 1TU0B 2R5AA 2DL8A 3S3OA 4A4HA 3VYHB 1KK7A 3CCRT 3JCMf 1Q81U 3M0SA 2I0NA 3CCSA 1C1AA 2E41A 3OYEA 1ABQA 1AOJA 4HT8A 1C0MA 2QGGA 5IHNA 1N8RC 2EGEA 3REAB 1KQSP 1NZ9A 3EHQA 1R0BG 1S1NA 1QQJA 2K3YA 4C8QB 2OAWA 3R6OA 3AHUA 2E3IA 4RCCA 3SDZA 3EFRA 1YJNA 2NLUA 1DJ7B 2DRKA 1FMWA 2V8KA 4BI8B 1GXIE 1Y7XA 6AT1B 4QVCA 3CMAQ 2VVKA 3C94A 2K2MA 1K9MU 5KYYB 2QTVA 1VQKQ 2LMJA 4FSSA 2IPOB 3EG3A 2XDPA 2L3RA 2CUBA 1T3SA 1MV3A 1RI9A 1QVGA 4CI0C 5IN1A 1MMGA 3VUBA 1VQ4Q 3TSWA 1GRIA 1M8VA 1RAGB 3RKYA 1X69A 2Z0WA 2EBPA 4M75D 3M4GA 3CC2T 3M53A 2KK4A 4C0GA 5CKEA 2D0QB 3A98A 5GAOp 4BY6B 4PFPA 4BDYA 5IT9E 1X6OA 2DVJA 2ZPIB 4ZNXA 1TUCA 1ZUYA 3CCEA 2CYZB 4N4IA 4PK4A 3OB9A 3TVTA 2MOXA 5LJ3d 2CH4A 2K3BA 1K1ZA 3G71Q 3V7RA 2L3SA 5IHIA 4Z8AA 4RTXA 4C0DC 2VYTA 2VXFA 3M55A 1YJWT 5GMKl 3GBQA 3QJ6A 3QYGB 5GJVB 5HK3A 2CP0A 5J26A 2F2VA 1PKTA 2KT1A 4FYXB 4WTOB 1N8RU 2RA2A 3BE3A 4C8QD 2OTJT 2GTOA 1QP2A 3L2VA 1M1KR 1VYUA 4M7AC 1KG1A 1I5OB 3JB9H 3L1AA 3CD6A 3QXEB 1D0XA 1IXDA 3CC4Q 4GY5A 2XIDA 1JO8A 4DBHA 1QCFA 3PFSA 4JPBW 2NUTB 3NTHA 2X3XD 2V1RA 4PJOA 4PJOE 2DTOA 4L59A 4FL6A 4OMNA 1AVZC 1TG0A 1Q82R 1OEBA 1VQ8Q 3H9NA 1JXMA 1MGQA 3MEUA 1ZBJA 1E7OA 1OU8A 2MYSA 1OOTA 1BIBA 1VQPA 3ZEHA 3CPWA 2RHIA 4MDXA 4XTUA 3SHWA 2DXTA 2QXFA 1ZUKA 4C92C 1M5Q1 2DRMA 4C5IA 2P0QA 2VKNA 2LVMA 2YUOA 3SWNB 3L42A 2AKKA 2GTJA 3TREA 2DL5A 3BFMA 3MKDA 2FL7A 2QQAA 1VQNT 3VS6A 2XDDA 4PJOB 2VC8A 1KQSA 2JMCA 3SFMA 1BU1A 3U23A 1I4K1 5LJ5g 3A8GB 3DB4A 2A08A 4JDSA 2DZCA 1ARKA 4M7DC 3CC4T 1YI2T 3AT1B 1QKXA 2JM8A 1PHTA 4M77C 4XTVA 5DM7R 1XQHA 5GMKm 1UEBA 2ED1A 3MCAB 1N9SA 1YHQQ 1TUDA 3QO3A 3GLXA 3JB9I 1U06A 1UB4A 2EGCA 1UGQB 2EAYA 4AT1B 3QKJA 2QEXT 2DXCA 3EGDA 3O5ZA 1M8MA 4XU3A 4AFQC 2HQHA 2COWA 3E1SA 3OBYA 1LOJA 3OSVA 1X27A 1S72T 3CCLA 4M78F 4OMQA 3E9FA 4QT7A 3EGXA 1TTHB 1RADB 2M9UA 3Q1JA 2HBWA 5HY6A 2R5MA 3EGXB 1YJ9T 4K11A 2RN8A 2CZ0B 1WXBA 3QZ5B 2AHJB 3H6ZA 4QKUA 2DL4A 1VQMA 1VQ6Q 2E64A 1NM7A 1GL5A 1BI0A 2RD1A 2RHXA 3A1PA 1PG5B 4M78D 1M27C 2FZKB 1WJQA 1YP5A 3L2QA 3JCMP 4L5GA 1JXOA 2KE9A 4M78E 4M78A 2PNIA 1N27A 1BI3A 2I2LA 1I81A 4J9GA 4BE0A 2EQJA 5FWBA 3A8LB 1ACMB 2GQVA 2M02A 1K8AR 2DYIA 1W2BA 3TU4K 3JB9G 3FRNA 3GNFB 1SKUB 4J7FA 3HRUA 1W4SA 3HL8A 1KQ1A 1K8AU 5GAN2 3CCJT 3VS0A 4M4ZA 2ROTA 2CT4A 1MMNA 1NJIC 4KGZB 5FU6C 4CC3A 3H8ZA 1WPYA 3OS0A 2X4WA 5FRNA 3DB3A 3LLRA 2HDAA 3EG0A 2NUPA 3OY9A 4OMPA 4JZ4A 3CXCA 2NWMA 3OS1A 1NPPA 2M0OA 4CC2A 3MP1A 2YUNA 2WSCE 3G4SQ 1D1AA 3E9GA 2RJFA 2FPFA 3VU3C 1LJOA 2XMFA 2M16A 4LUDA 4XTWA 1H3HA 1HYOA 1OZ3A 5LJ5h 2D1XA 4IIMA 2MWOA 2EIFA 2RI5A 3QG1A 4X1VA 5GAOn 5LJ5e 3GF5A 4ZTJA 1TUGB 3CPWP 4A4EA 4V2SA 3NGPA 1ZSZB 1AZGB 4RTTA 5IH2A 2LCCA 1M1KU 3NMZC 4P5NA 2LQ8A 4JRIA 4E7HA 2HMAA 4DOVA 3TEEA 1O75A 5CAIA 4J6YA 9ATCB 4A53A 1FYNA 2WSFE 5D6WA 1P92A 1FXXA 2J06A 3X20B 2KRNA 1KC8C 3DLMA 1AD5A 4J9HA 3V8LA 1B7TA 3FEOA 2AT1B 2X4XA 3V7SA 3JCMc 2NUTA 1UGRB 2L0AA 4QQ6A 4KGXB 1YFNA 2P0PA 2CSQA 5FWCA 2HSPA 3QHSA 2OAUA 1TOVA 2KR3A 2EKOA 3JCMW 2BZYA 4XTYA 4LDYA 1CKBA 1ZA1B 2RJCA 1GCQA 2AKLA 2ECZA 4PJLA 4RTUA 1D0ZA 1B3QA 3RR6A 3NPFA 2KYBA 1UGPB 2XU8A 4EMKC 2DYBA 2JVVA 5DLQE 2AZSA 4C92G 1OI1A 4AFSC 2E5KA 1D1BA 3UT1A 1SHGA 3RDVA 2L3QA 1Y07A 3I5SA 1C6VX 1OPKA 1KHCA 2B8AA 4DBRA 3TSZA 1RAIB 1VQ9Q 2GF7A 2H3JA 4Z88A 3I55A 2LT4A 3HPWA 4RTYA 4F16A 1VQ9A 3RESA 5GANe 4MMKA 2E12A 2YHTA 4BE2A 1OZ2A 1U1TA 2XG8D 4XTZA 2KRMA 1YJNQ 4ELZC 1AEYA 3A8OB 2D8JA 2ATCB 4C0DB 5LJ3e 1VIEA 4D6WA 4HKEA 3OQ5A 1PC0A 2MF2A 5FU7B 1VQPQ 3JSCA 2LQWA 2MIOA 2BZXA 3MP6A 2K57A 3OSSC 2SEMA 3OYBA 1NG2A 1XOVA 1G3YA 3QZ9B 2XD0A 3SEMA 4M75C 3S3NA 4TVRA 1EIFA 1SPKA 2RB6A 2OJ2A 1Y96A 3O8VA 1QCNA 4EMKB 3VRYA 2H8HA 1VYVA 5FW9A 1WI7A 3G6EQ 1B34B 1PRMC 2FRWA 1SEMA 1WYXA 1TH7A 2JS2A 1UHCA 2ROLA 1S72A 3OW2P 2O4XB 4GBQA 1W2BP 1VQ5Q 3SB2A 1K0XA 3LWHA 2YUQA 1LCKA 1EX4A 2QEXA 4E7LA 4E7ZA 3I35A 1Q82U 3QJYA 2PQWA 3KUFA 3HTRA 2XHCA 5KYUB 1G3WA 1ZQ1A 2KI7A 4HCBA 4FW1A 2YRCA 3C0CA 3RMSA 2P84A 4OMOA 5HKCA 4D8KA 1YBYA 1NBEB 1Q7YR 4LNPA 1VQNQ 4MDWA 2DBKA 3GPLA 3RNJA 1WNLA 2YSQA 2LRQA 4F04B 2CDTA 2BE9B 2CREA 2RJDA 4OVAA 4FCYA 3OW2A 3HHTB 3M54A 1R0CB 3NTIA 4LUEA 2DVEA 5KYYA 2YRDA 2A7YA 1VQ6A 1QW1A 4WCIA 2J7IA 2RHZA 5D7UA 3TQ7P 1SRMA 2ZPGB 1RLPC 2PVOB 5GMKj 1KC8U 2MK5A 3PVLA 5CKHA 5KH6A 2Y4XA 5CKFA 1NPRA 3VYGA 4PJOF 3X26B 1VQOQ 2DM1A 1BCMA 3HRSA 1Q86R 4OMLA 1V29B 5I2MA 1JQQA 1ZA2B 3UF4A 4PJJA 1D09B 1JRIA 2LQKA 4Z02A 1HJDA 1WX6A 3OYNA 3RERA 3GNGA 2RPNA 4BE1A 2O88A 2JTFA 2ZZDA 1NJIU 1RAFB 1K73C 2PU9B 1SHFA 4MZTA 4E6RA 2QQSA 1KHIA 1H92A 1YWPA 3CC2Q 1GFDA 4C5GA 1Q7YC 1ZHIA 1MUZA 1NJIR 4DBFA 2DIGA 2DAQA 3OYYA 1AWWA 1K0SA 1VQOA 3RKXA 3RBBB 4C5HA 1KFZA 1JJ2P 3UATA 3CD6T 1M1GA 3KXTA 4M7AF 1ZSZA 5EC7A 4HCZA 1MNEA 1R8OB 2R58A 1UFFA 3REBB 2DX1A 3MHXA 4ANJA 4M77G 4A4GA 5GAMh 4FSXA 1BCOA 2DERA 3C4SA 2MCNA 2FRYA 4KUIA 4ZGEB 4RMOA 3CCVQ 1VQOT 1JB0E 4PJOC 4Q5WA 4PL6A 3CCMQ 5GAN6 3IQLA 3MEWA 1BB9A 3HRTA 4FT4A 2RI3A 3CCUQ 2LX9A 3LGLA 3JCMJ 5GAMj 4M78B 1JJ2S 1Q7YU 5GANg 2HNIA 2J6KA 2JTEA 4KH0B 1U5SA 5I22A 5GAMe 2OTLQ 3JCMh 1YJWQ 1VA7A 2ZCFB 3H41A 1X43A 2RHUA 1PNJA 2D6FA 2CT3A 1M2VA 1WIEA 4RTZA 1PM3A 4KT0E 4JJCA 1UJ0A 1VQLA 1UTIA 2K5LA 3WVEB 2GBQA 4E7JA 2KEAA 4OB1B 2EYZA 4C8QC 3CD6Q 3CC2A 1V1CA 4BB7A 5LJ5f 4M75G 1Y71A 1BKBA 4M7DF 2VV5A 4MZPA 2P4TA 1ABOA 4J6WA 2D8HA 4FYYB 2O9SA 4O5VA 1RI0A 1PKSA 2GQIA 2AIRB 2QASA 4RCBA 3I56A 3OYJA 2R57A 3VS4A 2EQIA 4E7SA 2X35A 1I1JA 2F5KA 2X51A 4M7DB 2PVDB 1IO6A 4M75B 1JU5C 3L2ZA 4Y28E 5HK0A 2GNCA 2JN0A 1RAAB 2KNBB 4DQ2A 1OQKA 2HKNA 2C0OA 2K5IA 4ZTFA 1KJWA 2DL7A 3OYHA 4LXCA 2K9GA 2RF0A 3RMQA 1HK9A 3EAEA 3V8JA 4MZMA 3VS3A 1S72Q 5GANd 4HCCA 2NUPB 1QVPA 2CZ7B 3NFCA 5KYXB 3VS2A 5GAMd 3OYGA 2BUDA 3CCRA 4F7UB 2HBPA 3EG2A 4FW2A 4LN2A 3M0UA 4A54A 1YJ9A 3C95A 3RUXA 1QLYA 3G4SA 2QDYB 3UDCA 5GANh 4KUDK 3VS5A 2CZ6B 3OYLA 2XICA 3CCLT 4FU6A 1BYMA 3FJ5A 4PJMA 4DEYA 1W6XA 4N0AA 4X34A 3EFSA 4E47A 1WHGA 3LH0A 1ZSGA 2DLPA 2EGAA 2XI9A 1OPLA 2P0KA 3GP8A 2E70A 4ME7A 2A36A 2K3XA 3MEAA 4FYWB 1UHFA 1VQ9T 2HEQA 3EFOB 2QA4Q 1E6HA 3M5AA 2KROA 2KGTA 2FZGB 2EW3A 1OULA 2RQTA 1VQ7Q 3LW5E 3CCQQ 3M9QA 4EMKA 4J9CA 2KSSA 2KAFA 1VQNA 2YLCA 1QWEA 2P4RA 2HQEA 4LDXA 1WZOA 2DMOA 5GAN8 1G5VA 3RIRA 1IRXA 3FC3A 2HL5C 1VQ6T 2G6FX 3EG9B 1QVGP 4KH1B 2MMPA 4JUVA 5GAN5 4L6V5 4FT2A 5FRMA 1XNIA 4AMCA 1R77A 3MPUB 1AWXA 1VQMQ 4J6XA 1LPLA 2A28A 2DILA 2IG0A 5LJ3j 2RK2A 2A3LA 4XK8E 4F7UG 2ZGWA 2LTOA 4PLLA 2CP3A 1KQ2A 5CKBA 2JS0A 3M0PA 4M7DA 4M7DE 3LX7A 3RKWA 4RKUE 5GANj 2YUPA 4OB0B 5A2QE 3I5RA 1X2QA 3EH1A 5D6XA 5I21A 1Y0MA 2BTTA 2E10A 4OF1A 4HXJA 1M3BA 4X9CA 4IURA 3KFVA 1K73U 2O01E 3G4ST 4C92E 4C92A 2Y4YA 3UPUA 3M57A 2JOYA 5C6SA 5GAN7 2CSIA 2QEXQ 5CIUA 4RUGA 1YITT 2CZ1B 4PJOD 2F1LA 3VUZA 2HD0A 2DNUA 4JRKA 2QDLA 4XQ3A 4HVUA 2KQWA 5DY9A 1PD1A 4M78C 1Y96B 2MI6A 2VGMA 1YJWA 3ULRB 4F7UA 4F7UE 3PTAA 2COZA 4J9IA 1XTDA 1OU9A 5HCKA 3UA6A 5KYWB 4C8QA 4C8QE 3I55T 2VGNA 1BI2A 4FM4B 1K76A 1HSQA 3JB9D 3CC7T 1VIFA 2DEUA 3G1JA 3WVDB 1GCPA 3CCET 1PCXA 4LE9A 3L2WA 4J9DA 4EMHA 3CQTA 1XJWB 3H0IA 3PT9A 3M0QA 4KRTA 2FPEA 1NYFA 1Q86U 4RTVA 4EDUA 2MWPA 2JM9A 1IGUA 1CKAA 2CP6A 2KRSA 2LZ6B 3EG1A 3FB9A 4II1A 1OX9A 1H3ZA 4E7IA 4C5EA 3VV0A 4J9EA 2LDMA 1W1FA 1VQLT 3VS1A 4ZN3A 3JCMe 1H641 3S6WA 1K9MC 1WHJA 2QI2A 3QYHB 1K9AA 2DTIA 1M90C 1EZZB 3M4YA 3QSUA 2DEQA 2F2WA 2DXUA 3QBYA 1VQ4A 5KCOA 2DJQA 3ZFJA 4C0ZA 3ASKA 1X6BA 2DTHA 4M78G 1VQ8A 5LL6S 3M59A 3CCRQ 4ELYC 4M77B 4HA8A 1QKWA 1M30A 4OMMA 4E7KA 2EQMA 2EKHA 2DJZA 3WXMB 1GBQA 1AWJA 3CCJQ 2VXEA 1AZEA 2FO0A 3CPWS 1QCOA 3A8HB 3C12A 3CMET 3OBWA 2K6DA 1QMCA 2EJGA 1K8AC 2OTLA 3V7CA 4OB3B 4EIKA 2M51A 4O6JA 1YIJT 2GGRA 5GAMg 1RACB 4HVVA 4DOWA 2DA9A 2RK1A 3CCEQ 3BDLA 4F14A 2EPDA 1FMVA 1KD1R 3JCMQ 2NUZA 2COYA 3DKMA 2ZPHB 5KYWA 2E3HA 5J39A 1UECA 2CP2A 3MO8A 4NL3A 1KQSS 2DKGA 2YDLA 4M7DG 3THKA 1Q95G 1X6GA 3M0RA 4R56A 2DETA 1ZX6A 3CCLQ 1YI2A 2KYMA 1UG1A 2VB6A 2YT6A 3A8MB 1VQLQ 1VQKA 4M7AB 2YLBA 2HKQB 2ZPFB 3QPHA 2V8JA 3SWNA 1VQ4T 4DA4A 4KGVB 3HKSA 4IIOA 2LCSA 4EPCA 3V8KA 4M7AD 1TS9A 2E4HA 2B86A 3EGDB 1W2BS 1UGSB 4PLIA 4NOYA 4IUVA 3G6EA 3PMIA 1PD0A 4LD6A 3OYKA 2X3WD 1Z9ZA 1FMKA 1M90U 1K73R 8ATCB 3GOXA 1KD1C 1UUEA 4MMLA 5M9OA 3OYIA 1B07A 2QQ9A 2K79A 1WDXA 3NTKA 3JCMV 3HFNA 4LD9K 1WQ7A 2M1HA 4C0FA 2L5QA 2EVRA 2QK0A 4ZGJB 2AK5A 5KYNA 1VQMT 1M1FA 1WA7A 2FZCB 3I55Q 1PSEA 1T0JA 3OS2A 3QWXX 2F2XA 1NEBA 2G3RA 3M0TA 1U3OA 5GAOl 1WGSA 4M75E 4M75A 1G3TA 3VJPA 4LDUA 1IHVA 2VASA 2QQBA 2LT1A 1PRLC 5CKDA 1KD1U 4FIBA 5A0LA 3L2RA 1U8RA 1QP3A 3CMAT 2RJEA 1AWOA 1I07A 3OS5A 2EYYA 4PNOA 1WHKA 2DE0X 1JBMA 2GCXA 1BI1A 5I2SA 4N4GA 1VUBA 1O9SA 4M7AA 5KE2A 4M7AE 1W70A 2D0NA 2XK0A 4QW2A 5DLOA 5D6YA 5LJ5d 3CCUT 2HSEB 1IB8A 3TCJA 4AG1C 4N0AC 5GMKe 4IUUA 1QVFS 1YWOA 4D8DA 5GAOm 2KXDA 3X28B 1HD3A 1GBRA 4OP0A 4GLMA 4ZGDB 1D0YA 3FLGA 1SSHA 2EYXA 1Y57A 5IAYA 1H8KA 1PWTA 2J6OA 2CUDA 3G71T 2WSEE 2QAZA 3X25B 1M90R 2DZ9A 2LC4A 2LQNA 5FU7C 2LX7A 2QTXA 1WJRA 3M58A 3JCMd 2BZ8A 1I8FA 2CP5A 4NS5A 4R55A 3VS7A 2FEIA 4JRQA 4WF2A 1WJSA 1VQPT 2YWWA 2KMTA 1LVKA 3HP9A 1VYTA 5GMKh 3F70A 2L89A 1MMAA 4E2FB 2GFUA 3VKIA 4R0KA 2RQWA 4AFUC 2RNAA 3UA7A 2YRVA 3CBMA 1OYXA 4JRPA 4FYVB 4DBQA 2V8IA 4IUTA 4M77F 2PVGB 3LGFA 4CC4B 2W0ZA 1MMDA 1FX7A 3I56Q 4JJNK 2KDSA 2FYKA 5GJWB 2RMOA 2PUOB 5AYFA 2CS7A 4OMFB 3CCQA 4X9DA 3CBPA 3JB9F 2L8DA 3QDFA 2JXBA 1X2KA 2KT8A 4B9XA 1FWZA 2BKDN 3INZA 2OI3A 1NLPC 1SF9A 2JT4A 5CQYA 1TWBA 1ZBXA 2DK3A 1UE9A 2LP5A 2VWFA 1NEGA 4BACA 7AT1B 1IREB 3OYAA 1SRLA 4F7UF 1OV3A 4RG8A 3OA6A 2DFUA 1J3TA 4PFOA 4Y92A 3KBGA 2MPXC 4XAXB 4EMGA 2A37A 3ME9A 2OTJQ 4BD3A 3OYFA 1YCYA 1M9SA 5CQXA 5IHKA 1YITQ 3BW1A 2OTLT 4IUQA 2HZYA 3CMEA 2KY9A 3CCMA 3JAME 4C92F 1QWFA 3J81E 4ATOA 4AG2C 5A0DA 3P8BB 3JCMX 1HXDA 4J9FA 4AFZC 4M77D 3CC7Q 2QA4T 3CCVT 1G8XA 2ZAEA 2FB7A 3MJXA 4BI4A 2VUBA 4OGCA 1X75C 2J05A 4XTXA 3X24B 1N8RR 1BBZA 2DL3A 2C0TA 2HCKA 2W10A 2M0YA 3CCJA 1ZSZC 5J3BA 2KXCA 3OMGA 3URGA 4KULA 4QVDA 1Q81R 3OW2S 4J7IA 2ENMA 4M77A 4M77E 3LWIA 3BY7A 3PE0A 4LDWA 1V76A 3E2UA 3JRZA 5CK9A 2Y90A 4C8QF 2EFIA 3CPFA 1VQ5T 1VQ7T 1M2VB 5GAOr 4M7AG 1EFNA 3ZL7C 2RI2A 1K4US 3FIFA 2RQUA 4C92D 4UC4A 1YJNT 1JEGA 4B6MA 1YHQT 2JUFA 2DO3A 2J6FA 2GFAA 4PFZA 1RLQC 1BK2A 4A63B 2BIVA 2EQKA 3CEYA 1VQKT 4JLIA 2O31A 3CCVA 2QA4A 2QYZA 2K5FA 1D1CA 5GAN4 5CO7A 4M7DD 3J7AF 3T9NA 2FG0A 1PSFA 4PJOG 1RUWA 3CCST 3SWNC 1WHLA 1WHMA 3QUIA 1WXTA 5IXFA 1YN8A 1ZUUA 3FDRA 1IGQA 2PUKB 1SG5A 2E1HA 4JLGA 3LH5A 4GLKA 2K2VA 5CR2A 1Q81C 1KC8R 1RAEB 5EG2A 4QQGA 2YXYA 1QVFP 4C92B 4YTLA 1I0CA 2ESWA 3I9QA 4HT9A 1UDLA 2LJ3A 3EGUA 3H0FA 4Y91A 1YIJA 1YITA 3L2UA 4M75F 2EJFA 4IUPA 1WLPB 3M56A 2ED0A 2F69A 5GANf 4PJNA 4KBMB 2V26A 1D3BB 2X4YA 2K4YA 4QVZA 2C06A 4J83A 3CC4A 3EH2A 5FROA 1GFCA 2ABLA 3OMCA 2O2OA 3CCQT 5LJ3f 4JS4A 2ZPBB 2NYSA 5A0GA 1AT1B 1VQ8T 2QG9B 2DF6A 3CBOA 1A0NB 2LJ1A 5L8RE 3BDUA 2X9HA 3SD4A 2RQVA 2QQRA 3JV3A 1I5LA 1F1BB 5AT1B 2E5QA 3META 5I11A 3QDRB 2JJ9A 1E6GA 5GMKi 3EFOA 1N5ZA 2FPDA 1LNXA 2CGHA 5CVIA 3JCMg 1OX8A 4J9BA 1M4ZA 2D9TA 1K9MR 4RTWA 5LJ3g 5L23A 1KSWA 2DPPB 2DBMA 2IVWA 4IKFA 2KVQG 3N5BB 1JJ2A 2XKOC 4HCKA 3PMTA 1G83A 2EQUA 3CXCS 2DD5A 2RH2A 4PKCC 4CC7A 1D3BA 3G71A 2EJ9A 2JTMA 2C0IA 2RHYA 2RQRA 1M3CA 3CC7A 4CRIA 3J80E 3OYCA 2F5TX 4OGEA 1NE8A 1YNZA 2BE7D 5GAOq 2QGFB 2EYQA 1MV0B 2RO0A 3EHRA 3P8DA 1M2OA 2X4JA 1BIAA 1YIJQ 4BY6C 2CH4W 3CCUA 3JCMb 1IZ6A 2OTJA 1T3LA 2DIQA 4BUGA 1M3AA 3ZBDA 1NYGA 5IXBA 4XU2A 3A5ZB 2LCLA 3R6NA 5KYUA 3CMAA 1KIKA 3NHNA 1TXQA 3PVQA 3GIBA 4XU0A 2L3PA 1Z9QA 3CXCP 1NLOC 2K7AA 1X01A 3HFOA 1WQWA 2O9VA 2CP7A 4B9WA 4JJBA 2DD4A 1UGVA 8AT1B 4VUBA 3CMEQ 4RG2A 3CCSQ 1YJ9Q 3FJPA 2FVUA 3DLLA 1G3SA 3G7ZA 3QWYA 1YHQA 2H3EB 1N6AA 1WXUA 2HQXA 4JZ3A 2LNHB 3VRZA 2JZ2A 1MHNA 2V1QA 5LJ3h 1AHJB 1IHWA 3JB9J 2PZ1A 1QVGS 4LDVA 1VQ7A 2EWNA 3UWNA 1VQ5A 5LJ5j 3H0HA 2OX7A 3ER0A 4A4KA 3I56T 5GAN3 3E19A 2KBTA 1CSKA 4DEXA 5C0MA 1MNDA 1M1KC 3MEVA 2FHDA 1SSFA 3PNWC 3OYDA 1N9RA 1RAHB 3G6ET 1Q82C 4A4FA 4XU1A 3HSBA 4ZN1A 2AZVA 2IIMA 3S3MA 2A0FB 2RM4A 5KE3A 4JS5A 4Z89A 1ZLMA 3P8HA 2LNVA
chains in the Genus database with same CATH topology
4OB2B 4BI3A 3JCMd 4E47A 3PGGA 1B34A 3LH0A 4C8QG 2DXBA 1I8FA 2XI9A 4NS5A 4A4EA 4R55A 4N4HA 5GAMf 1QVFA 2LCCA 4JRQA 1M1KU 4WF2A 2P0KA 1RL2A 1WJSA 3PIPA 3GP8A 2E70A 4ME7A 4P5NA 1VQPT 2KMTA 2CKKA 3HP9A 2LQ8A 5GMKh 3F70A 4JRIA 2K3XA 3CCMT 5FU6B 4E7HA 2L89A 3MEAA 3TEEA 4DOVA 1O75A 2E65A 3MP8A 4J6YA 5CAIA 5FLXE 4A53A 1VQ9T 2GFUA 4QQDA 3VKIA 2WSFE 5D6WA 3M5AA 1U1SA 1P92A 1FXXA 1Q86C 2YRVA 3X20B 3LW5E 3CBMA 3M9QA 1OYXA 4JRPA 1KC8C 4EMKA 2V8IA 2KSSA 3OYMA 3DLMA 4IUTA 2KAFA 1VQNA 2YLCA 2E6NA 4M77F 3QIIA 3V8LA 4J8OA 2HQEA 4LDXA 2PVGB 2ZPEB 3FEOA 3LGFA 2X4XA 3V7SA 3JCMc 1FX7A 5GAN8 1UGRB 1G5VA 3RIRA 2WACA 3FC3A 4QQ6A 3LYIA 4JJNK 2KDSA 5KCHA 1VQ6T 2MAMA 2P0PA 2FYKA 2O4XA 4BDZA 2MMPA 4JUVA 5GAN5 3PIOA 2HAXA 2PUOB 4L6V5 5AYFA 2CS7A 4OMFB 3CCQA 2E6ZA 3QHSA 4J5YA 2OAUA 4NL2A 2JNGA 3CBPA 4FT2A 1XNIA 2L8DA 4X9DA 5CCAA 5FRMA 3JB9F 2EKOA 3JCMW 4B9XA 4XTYA 1FWZA 2R5AA 3S3OA 4LDYA 2BKDN 3INZA 4A4HA 3VYHB 4J6XA 3CCRT 3JCMf 1Q81U 3CCSA 2RJCA 2E41A 3OYEA 5CQYA 2IG0A 4HT8A 1N8RC 5LJ3j 3G71A 2RK2A 2A3LA 1ZBXA 2DK3A 4XK8E 1UGPB 2XU8A 4EMKC 1NZ9A 4F7UG 2ZGWA 2JVVA 2LTOA 4PLLA 4BACA 1IREB 5DLQE 1KQ2A 5CKBA 4C92G 3OYAA 2K3YA 4C8QB 3R6OA 4F7UF 1OI1A 4M7DA 4RG8A 4M7DE 3LX7A 3UT1A 3AHUA 3RKWA 3OA6A 4RKUE 5GANj 4RCCA 3SDZA 3EFRA 4OB0B 5A2QE 1Y07A 1YJNA 3KBGA 2NLUA 4XAXB 1DJ7B 1KHCA 4BI8B 2B8AA 2V8KA 5D6XA 4EMGA 5I21A 1GXIE 1Y7XA 4QVCA 2E10A 3ME9A 4OF1A 4BD3A 3C94A 1YCYA 1M9SA 2GF7A 4X9CA 4IURA 2H3JA 5CQXA 3OYFA 1K9MU 3I55A 2LT4A 3HPWA 2O01E 1K73U 3BW1A 3G4ST 4C92E 4C92A 2OTLT 4IUQA 1VQ9A 3RESA 2Y4YA 2XDPA 5GANe 2L3RA 3UPUA 3CMEA 2KY9A 4MMKA 2E12A 3CCMA 2YHTA 3JAME 4C92F 3J81E 4BE2A 1OZ2A 3M57A 1QVGA 2JOYA 4CI0C 1U1TA 2XG8D 5IN1A 5A0DA 5C6SA 4XTZA 3P8BB 5GAN7 5CIUA 3JCMX 3VUBA 1HXDA 4ELZC 1YITT 2CZ1B 4M77D 4PJOD 3A8OB 2QA4T 1M8VA 3CCVT 2FB7A 4C0DB 3VUZA 5LJ3e 1VIEA 4D6WA 4BI4A 2HD0A 2VUBA 3RKYA 4OGCA 1X75C 3OQ5A 4HKEA 4JRKA 4M75D 3M4GA 3CC2T 2MF2A 5FU7B 4XQ3A 3JSCA 2KK4A 3M53A 4XTXA 3X24B 4C0GA 3MP6A 2K57A 3OSSC 3OYBA 2KQWA 2D0QB 5CKEA 5GAOp 1XOVA 5DY9A 4BY6B 1G3YA 4BDYA 5IT9E 4M78C 1X6OA 3QZ9B 3CCJA 2XD0A 2ZPIB 5J3BA 4M75C 3S3NA 4TVRA 1Y96B 1EIFA 3OMGA 2MI6A 4KULA 3URGA 4QVDA 2VGMA 3CCEA 2CYZB 3OW2S 4J7IA 4N4IA 1YJWA 4M77A 4M77E 2RB6A 3OB9A 3LWIA 1Y96A 3BY7A 3O8VA 4LDWA 5LJ3d 4EMKB 4F7UA 4F7UE 3PTAA 1XTDA 3JRZA 5CK9A 2Y90A 4C8QF 2EFIA 1Q7YU 1B34B 3CPFA 3V7RA 4C8QA 4C8QE 3I55T 2VGNA 1VQ5T 1BI2A 1VQ7T 4FM4B 5GAOr 4M7AG 3JB9D 4C0DC 3CC7T 1TH7A 1VIFA 2VYTA 2VXFA 1S72A 2RI2A 3WVDB 3M55A 1YJWT 2O4XB 5GMKl 3CCET 3FIFA 3QJ6A 3QYGB 3SB2A 3L2WA 4EMHA 4C92D 4UC4A 1YJNT 3PT9A 5HK3A 3LWHA 1YHQT 2JUFA 1Q86U 2DO3A 5J26A 2QEXA 4E7LA 4EDUA 2MWPA 2GFAA 1Q82U 3QJYA 2PQWA 3KUFA 2XHCA 2BIVA 2EQKA 1G3WA 3CEYA 3FB9A 4II1A 4JLIA 1ZQ1A 1VQKT 1H3ZA 4HCBA 1N8RU 4E7IA 4C5EA 3CCVA 3VV0A 2RA2A 4C8QD 2QA4A 5GAN4 2K5FA 2OTJT 5CO7A 2LDMA 4M7DD 3RMSA 3J7AF 1VQLT 3T9NA 4ZN3A 5HKCA 1PSFA 4PJOG 3JCMe 1YBYA 3CCST 3SWNC 1QP2A 3L2VA 1H641 3QUIA 3S6WA 1K9MC 4M7AC 1KG1A 4MDWA 2QI2A 3QYHB 3GPLA 1WNLA 3FDRA 2LRQA 3JB9H 2DTIA 3L1AA 3CD6A 3QXEB 2PUKB 2RJDA 4OVAA 3OW2A 3HHTB 1M90C 3M4YA 3QSUA 2DEQA 2E1HA 3M54A 2DXUA 3QBYA 3NTIA 2K2VA 4GLKA 2DVEA 4GY5A 4JLGA 5CR2A 1Q81C 2XIDA 2A7YA 1VQ6A 1QW1A 1VQ4A 5EG2A 5KCOA 3ZFJA 4C0ZA 2RHZA 3ASKA 4QQGA 3PFSA 2DTHA 4M78G 3NTHA 1VQ8A 2ZPGB 3M59A 5LL6S 4PJOA 2PVOB 5GMKj 2DTOA 4PJOE 4ELYC 4M77B 1KC8U 4HA8A 4L59A 5CKHA 4C92B 5KH6A 2Y4XA 4FL6A 5CKFA 4YTLA 1NPRA 4E7KA 3VYGA 2EQMA 4PJOF 3X26B 4HT9A 3HRSA 4Y91A 1YIJA 1V29B 5I2MA 1YITA 2DJZA 3WXMB 1MGQA 3L2UA 1JRIA 3MEUA 2LQKA 2VXEA 4M75F 4Z02A 2EJFA 4IUPA 3OYNA 3M56A 3CPWS 3RERA 2F69A 3A8HB 5GANf 3C12A 3CMET 3OBWA 3GNGA 4KBMB 4BE1A 2EJGA 1D3BB 1K8AC 2JTFA 1BIBA 2ZZDA 3ZEHA 1VQPA 2OTLA 2X4YA 3V7CA 4OB3B 2RHIA 2K4YA 4QVZA 3CPWA 1NJIU 4MDXA 4O6JA 4XTUA 2C06A 4J83A 1YIJT 2PU9B 1K73C 3CC4A 4MZTA 5FROA 2DXTA 3EFSA 2QXFA 3OMCA 5GAMg 2QQSA 1KHIA 4C92C 1M5Q1 4C5IA 4DOWA 5LJ3f 3CCQT 2P0QA 2ZPBB 4JS4A 2RK1A 2LVMA 3BDLA 4C5GA 3SWNB 1Q7YC 3L42A 1ZHIA 5A0GA 3TREA 1VQ8T 3BFMA 2FL7A 2QQAA 3JCMQ 1VQNT 2XDDA 4PJOB 3CBOA 2DIGA 2VC8A 2DAQA 3DKMA 2ZPHB 3OYYA 5L8RE 3RKXA 1VQOA 1KQSA 4C5HA 3SFMA 1I4K1 5LJ5g 3A8GB 3DB4A 4JDSA 2DZCA 5J39A 3CD6T 1M1GA 3KXTA 3MO8A 4M7DC 3BDUA 4NL3A 4M7AF 1KQSS 2DKGA 4M7DG 3CC4T 1YI2T 4HCZA 3SD4A 2QQRA 1R8OB 2R58A 1I5LA 4M77C 2E5QA 4R56A 3META 3QDRB 4XTVA 5DM7R 1XQHA 5GMKi 3MHXA 1YI2A 5GMKm 1UEBA 3MCAB 1N9SA 4M77G 3QO3A 1LNXA 2CGHA 5CVIA 4A4GA 5GAMh 3A8MB 4FSXA 3JCMg 3GLXA 3C4SA 1VQKA 1M4ZA 2D9TA 4KUIA 4M7AB 4ZGEB 4RMOA 1UB4A 5LJ3g 2YLBA 3JB9I 1VQOT 1JB0E 2DPPB 4PJOC 2IVWA 4Q5WA 4IKFA 1UGQB 4PL6A 2KVQG 2EAYA 2ZPFB 5GAN6 3QKJA 2QEXT 3N5BB 2DXCA 3QPHA 2V8JA 3MEWA 3SWNA 1JJ2A 3HRTA 4XU3A 4FT4A 4DA4A 1VQ4T 2XKOC 2RI3A 3HKSA 3PMTA 4EPCA 3V8KA 4M7AD 2EQUA 2LX9A 3E1SA 3LGLA 3OBYA 3CXCS 3JCMJ 2DD5A 2RH2A 1W2BS 4PKCC 5GAMj 1UGSB 4M78B 1JJ2S 4PLIA 4NOYA 1D3BA 1LOJA 3OSVA 3PMIA 2EJ9A 2HNIA 2JTMA 4IUVA 4LD6A 5GANg 3OYKA 4M78F 1S72T 3CCLA 2RHYA 3CC7A 3E9FA 5GAMe 4CRIA 3J80E 3JCMh 3OYCA 1M90U 2F5TX 4OGEA 2M9UA 1NE8A 3Q1JA 3GOXA 5HY6A 2R5MA 2ZCFB 5GAOq 1YJ9T 2EYQA 2RO0A 1KD1C 2D6FA 2RHUA 2CZ0B 3P8DA 4MMLA 5M9OA 2X4JA 1BIAA 3QZ5B 2AHJB 4KT0E 3OYIA 3H6ZA 2QQ9A 4BY6C 1VQLA 3CCUA 3JCMb 2K5LA 1VQMA 1IZ6A 3NTKA 3WVEB 2OTJA 4E7JA 3JCMV 2E64A 4OB1B 4C8QC 1BI0A 2DIQA 3HFNA 4BUGA 3ZBDA 3CC2A 4LD9K 4XU2A 1WQ7A 3A5ZB 4BB7A 2RD1A 5LJ5f 2RHXA 4M75G 2M1HA 4M78D 1Y71A 1BKBA 4C0FA 2L5QA 2LCLA 4M7DF 1WJQA 2VV5A 4MZPA 4ZGJB 3L2QA 3JCMP 3CMAA 1VQMT 1M1FA 2P4TA 4L5GA 4M78E 4M78A 4J6WA 1N27A 1BI3A 2I2LA 4O5VA 1I81A 1PSEA 3OS2A 4BE0A 1RI0A 2EQJA 3GIBA 4XU0A 3A8LB 2G3RA 4RCBA 2GQVA 3OYJA 2R57A 3I56A 1W2BA 5GAOl 1WGSA 3TU4K 2X35A 2F5KA 4M75E 4M75A 3JB9G 4M7DB 3FRNA 3GNFB 1X01A 1G3TA 3HFOA 1WQWA 3VJPA 2PVDB 4J7FA 4LDUA 4B9WA 4ATOA 2DD4A 3HRUA 2QQBA 4M75B 1W4SA 3HL8A 2LT1A 5CKDA 3L2ZA 4Y28E 1KQ1A 1K8AU 1KD1U 5HK0A 4FIBA 4VUBA 5GAN2 5A0LA 4RG2A 3L2RA 3CCJT 2JN0A 1U8RA 1QP3A 4DQ2A 2RJEA 3CMAT 2K5IA 3OS5A 4ZTFA 3FJPA 4PNOA 2FVUA 1NJIC 5FU6C 3OYHA 3H8ZA 3DLLA 1G3SA 1JBMA 1WPYA 3G7ZA 3OS0A 2GCXA 1YHQA 2X4WA 5FRNA 1BI1A 3DB3A 3LLRA 5I2SA 1N6AA 4N4GA 3RMQA 1VUBA 2HQXA 1O9SA 1HK9A 3EAEA 3V8JA 4MZMA 5KE2A 4M7AA 4M7AE 4QW2A 2XK0A 2JZ2A 5GANd 1MHNA 5LJ3h 3OY9A 5DLOA 1AHJB 4HCCA 5D6YA 3JB9J 1QVPA 2CZ7B 5LJ5d 3CCUT 3NFCA 5GAMd 1QVGS 4LDVA 3CXCA 1VQ7A 2EWNA 3UWNA 3TCJA 3OS1A 3OYGA 1NPPA 2M0OA 5LJ5j 3MP1A 1VQ5A 2BUDA 4N0AC 4F7UB 5GMKe 2HBPA 4IUUA 3CCRA 2WSCE 3ER0A 2XDBA 3E9GA 4A4KA 3I56T 1QVFS 4A54A 5GAOm 2RJFA 3C95A 3E19A 5GAN3 1YJ9A 3VU3C 3RUXA 3X28B 5C0MA 1LJOA 3G4SA 2QDYB 3UDCA 4OP0A 5GANh 3MEVA 2M16A 1M1KC 4KUDK 2FHDA 4ZGDB 3FLGA 4XTWA 1SSFA 5IAYA 2CZ6B 3OYLA 3PNWC 3OYDA 2XICA 1N9RA 3CCLT 1OZ3A 4FU6A 2WSEE 3G6ET 3X25B 3G71T 5LJ5h 1Q82C 1BYMA 4A4FA 4XU1A 3HSBA 2MWOA 4ZN1A 2DZ9A 2EIFA 2RI5A 3QG1A 3S3MA 2RM4A 2LC4A 5LJ5e 5KE3A 5GAOn 5FU7C 3GF5A 3G6EA 4ZTJA 2QTXA 4JS5A 1WJRA 4N0AA 4X34A 3M58A 3P8HA 4V2SA 2LNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQM A;  3OYI A;  5IN1 A;  5C6S A;  3H6Z A;  3LH0 A;  5CIU A;  3NTK A;  4NS5 A;  4N4H A;  2LCC A;  3L2U A;  4E7J A;  3MEU A;  2P0K A;  1WJS A;  4Z02 A;  4IUP A;  3OYN A;  2CKK A;  2DIQ A;  3F70 A;  2K3X A;  3OQ5 A;  4E7H A;  2L89 A;  3MEA A;  3MP8 A;  2RHX A;  4BE1 A;  2M1H A;  2GFU A;  2JTF A;  3MP6 A;  4QQD A;  3ZEH A;  3OYB A;  2X4Y A;  5D6W A;  1WJQ A;  2RHI A;  4QVZ A;  3L2Q A;  4BDY A;  2YRV A;  3M9Q A;  5FRO A;  1OYX A;  3S3N A;  3OMG A;  1N27 A;  3OMC A;  2QQS A;  3OYM A;  3DLM A;  4IUT A;  4N4I A;  4C5I A;  3OS2 A;  1RI0 A;  3OB9 A;  2E6N A;  2EQJ A;  4BE0 A;  2LVM A;  3O8V A;  2G3R A;  3BDL A;  3QII A;  4C5G A;  3L42 A;  2HQE A;  3FEO A;  3LGF A;  3OYJ A;  2R57 A;  2X4X A;  2EFI A;  1WGS A;  1G5V A;  2X35 A;  2F5K A;  2WAC A;  3FC3 A;  2DIG A;  4QQ6 A;  2DAQ A;  3LYI A;  5KCH A;  4BDZ A;  2O4X A;  2VYT A;  4B9W A;  4C5H A;  2RI2 A;  3DB4 A;  2O4X B;  5J39 A;  5FRM A;  1XNI A;  2L8D A;  3QJ6 A;  3MO8 A;  2EKO A;  3L2W A;  4B9X A;  4RG2 A;  3L2R A;  4UC4 A;  2R5A A;  3S3O A;  2RJE A;  2BKD N;  4HCZ A;  3SD4 A;  4A4H A;  2QQR A;  2R58 A;  4ZTF A;  5J26 A;  4E7L A;  4EDU A;  2E5Q A;  2MWP A;  3H8Z A;  2RJC A;  3OYH A;  3OYE A;  2GFA A;  3MET A;  3OS0 A;  2IG0 A;  2PQW A;  2X4W A;  5FRN A;  3DB3 A;  3KUF A;  3LLR A;  4N4G A;  2BIV A;  2EQK A;  3CEY A;  2HQX A;  4II1 A;  1H3Z A;  3EAE A;  5KE2 A;  4A4G A;  4E7I A;  4C5E A;  4QW2 A;  2XK0 A;  3C4S A;  2LTO A;  2JZ2 A;  1MHN A;  2D9T A;  4PLL A;  4BAC A;  3OY9 A;  2LDM A;  5D6Y A;  3OYA A;  2K3Y A;  4Q5W A;  4IKF A;  4PL6 A;  1OI1 A;  3UWN A;  3OS1 A;  3LX7 A;  3OYG A;  2M0O A;  3QKJ A;  3UT1 A;  3MP1 A;  3L2V A;  2BUD A;  3OA6 A;  3MEW A;  4IUU A;  3S6W A;  3E9G A;  2RI3 A;  3PMT A;  2EQU A;  2RJF A;  3LGL A;  2NLU A;  3FDR A;  2LRQ A;  1KHC A;  5C0M A;  2B8A A;  5D6X A;  4OVA A;  2RJD A;  4PLI A;  3MEV A;  2M16 A;  4IUV A;  3PMI A;  2FHD A;  3FLG A;  4LD6 A;  3OYK A;  1SSF A;  3QBY A;  3NTI A;  5IAY A;  3OYL A;  3ME9 A;  2RHY A;  3PNW C;  4GY5 A;  3E9F A;  4BD3 A;  2GF7 A;  3OYD A;  3OYF A;  4CRI A;  4IUR A;  3OYC A;  1OZ3 A;  4FU6 A;  5KCO A;  2RHZ A;  3ASK A;  4A4F A;  3Q1J A;  4QQG A;  3PFS A;  3GOX A;  2MWO A;  2R5M A;  3NTH A;  4IUQ A;  2RI5 A;  2XDP A;  2RO0 A;  3S3M A;  2L3R A;  2RHU A;  5KE3 A;  3P8D A;  4L59 A;  5KH6 A;  5M9O A;  4ZTJ A;  4FL6 A;  1WJR A;  4X34 A;  4A4E A;  3P8H A;  4BE2 A;  4E7K A;  1OZ2 A; 
#chains in the Genus database with same CATH topology
 4OB2 B;  4HVW A;  4BI3 A;  3PGG A;  1B34 A;  4C8Q G;  2DXB A;  4N4H A;  5GAM f;  1QVF A;  2JMA A;  1GCQ C;  1RL2 A;  3PIP A;  2JW4 A;  2CKK A;  3CCM T;  5KYX A;  5FU6 B;  2E65 A;  3MP8 A;  4F17 A;  5FLX E;  4ORZ A;  1G2B A;  3D7S B;  4QQD A;  1U1S A;  1Q86 C;  1VOM A;  2PTK A;  1T0H A;  3OYM A;  2E6N A;  2SRC A;  1TSF A;  1WHH A;  3QII A;  4J8O A;  4JJD A;  2ZPE B;  5ECA A;  2HL3 A;  4ESR A;  3EG9 A;  1YI2 Q;  1YCS B;  2LJ0 A;  2WAC A;  3LYI A;  1RAB B;  5KCH A;  2MAM A;  4BDZ A;  2O4X A;  3PIO A;  1UJY A;  2HAX A;  2L2P A;  2E6Z A;  4J5Y A;  4NL2 A;  2XDB A;  1WFW A;  2JNG A;  5CCA A;  2EYW A;  1TU0 B;  2R5A A;  2DL8 A;  3S3O A;  4A4H A;  3VYH B;  1KK7 A;  3CCR T;  3JCM f;  1Q81 U;  3M0S A;  2I0N A;  3CCS A;  1C1A A;  2E41 A;  3OYE A;  1ABQ A;  1AOJ A;  4HT8 A;  1C0M A;  2QGG A;  5IHN A;  1N8R C;  2EGE A;  3REA B;  1KQS P;  1NZ9 A;  3EHQ A;  1R0B G;  1S1N A;  1QQJ A;  2K3Y A;  4C8Q B;  2OAW A;  3R6O A;  3AHU A;  2E3I A;  4RCC A;  3SDZ A;  3EFR A;  1YJN A;  2NLU A;  1DJ7 B;  2DRK A;  1FMW A;  2V8K A;  4BI8 B;  1GXI E;  1Y7X A;  6AT1 B;  4QVC A;  3CMA Q;  2VVK A;  3C94 A;  2K2M A;  1K9M U;  5KYY B;  2QTV A;  1VQK Q;  2LMJ A;  4FSS A;  2IPO B;  3EG3 A;  2XDP A;  2L3R A;  2CUB A;  1T3S A;  1MV3 A;  1RI9 A;  1QVG A;  4CI0 C;  5IN1 A;  1MMG A;  3VUB A;  1VQ4 Q;  3TSW A;  1GRI A;  1M8V A;  1RAG B;  3RKY A;  1X69 A;  2Z0W A;  2EBP A;  4M75 D;  3M4G A;  3CC2 T;  3M53 A;  2KK4 A;  4C0G A;  5CKE A;  2D0Q B;  3A98 A;  5GAO p;  4BY6 B;  4PFP A;  4BDY A;  5IT9 E;  1X6O A;  2DVJ A;  2ZPI B;  4ZNX A;  1TUC A;  1ZUY A;  3CCE A;  2CYZ B;  4N4I A;  4PK4 A;  3OB9 A;  3TVT A;  2MOX A;  5LJ3 d;  2CH4 A;  2K3B A;  1K1Z A;  3G71 Q;  3V7R A;  2L3S A;  5IHI A;  4Z8A A;  4RTX A;  4C0D C;  2VYT A;  2VXF A;  3M55 A;  1YJW T;  5GMK l;  3GBQ A;  3QJ6 A;  3QYG B;  5GJV B;  5HK3 A;  2CP0 A;  5J26 A;  2F2V A;  1PKT A;  2KT1 A;  4FYX B;  4WTO B;  1N8R U;  2RA2 A;  3BE3 A;  4C8Q D;  2OTJ T;  2GTO A;  1QP2 A;  3L2V A;  1M1K R;  1VYU A;  4M7A C;  1KG1 A;  1I5O B;  3JB9 H;  3L1A A;  3CD6 A;  3QXE B;  1D0X A;  1IXD A;  3CC4 Q;  4GY5 A;  2XID A;  1JO8 A;  4DBH A;  1QCF A;  3PFS A;  4JPB W;  2NUT B;  3NTH A;  2X3X D;  2V1R A;  4PJO A;  4PJO E;  2DTO A;  4L59 A;  4FL6 A;  4OMN A;  1AVZ C;  1TG0 A;  1Q82 R;  1OEB A;  1VQ8 Q;  3H9N A;  1JXM A;  1MGQ A;  3MEU A;  1ZBJ A;  1E7O A;  1OU8 A;  2MYS A;  1OOT A;  1BIB A;  1VQP A;  3ZEH A;  3CPW A;  2RHI A;  4MDX A;  4XTU A;  3SHW A;  2DXT A;  2QXF A;  1ZUK A;  4C92 C;  1M5Q 1;  2DRM A;  4C5I A;  2P0Q A;  2VKN A;  2LVM A;  2YUO A;  3SWN B;  3L42 A;  2AKK A;  2GTJ A;  3TRE A;  2DL5 A;  3BFM A;  3MKD A;  2FL7 A;  2QQA A;  1VQN T;  3VS6 A;  2XDD A;  4PJO B;  2VC8 A;  1KQS A;  2JMC A;  3SFM A;  1BU1 A;  3U23 A;  1I4K 1;  5LJ5 g;  3A8G B;  3DB4 A;  2A08 A;  4JDS A;  2DZC A;  1ARK A;  4M7D C;  3CC4 T;  1YI2 T;  3AT1 B;  1QKX A;  2JM8 A;  1PHT A;  4M77 C;  4XTV A;  5DM7 R;  1XQH A;  5GMK m;  1UEB A;  2ED1 A;  3MCA B;  1N9S A;  1YHQ Q;  1TUD A;  3QO3 A;  3GLX A;  3JB9 I;  1U06 A;  1UB4 A;  2EGC A;  1UGQ B;  2EAY A;  4AT1 B;  3QKJ A;  2QEX T;  2DXC A;  3EGD A;  3O5Z A;  1M8M A;  4XU3 A;  4AFQ C;  2HQH A;  2COW A;  3E1S A;  3OBY A;  1LOJ A;  3OSV A;  1X27 A;  1S72 T;  3CCL A;  4M78 F;  4OMQ A;  3E9F A;  4QT7 A;  3EGX A;  1TTH B;  1RAD B;  2M9U A;  3Q1J A;  2HBW A;  5HY6 A;  2R5M A;  3EGX B;  1YJ9 T;  4K11 A;  2RN8 A;  2CZ0 B;  1WXB A;  3QZ5 B;  2AHJ B;  3H6Z A;  4QKU A;  2DL4 A;  1VQM A;  1VQ6 Q;  2E64 A;  1NM7 A;  1GL5 A;  1BI0 A;  2RD1 A;  2RHX A;  3A1P A;  1PG5 B;  4M78 D;  1M27 C;  2FZK B;  1WJQ A;  1YP5 A;  3L2Q A;  3JCM P;  4L5G A;  1JXO A;  2KE9 A;  4M78 E;  4M78 A;  2PNI A;  1N27 A;  1BI3 A;  2I2L A;  1I81 A;  4J9G A;  4BE0 A;  2EQJ A;  5FWB A;  3A8L B;  1ACM B;  2GQV A;  2M02 A;  1K8A R;  2DYI A;  1W2B A;  3TU4 K;  3JB9 G;  3FRN A;  3GNF B;  1SKU B;  4J7F A;  3HRU A;  1W4S A;  3HL8 A;  1KQ1 A;  1K8A U;  5GAN 2;  3CCJ T;  3VS0 A;  4M4Z A;  2ROT A;  2CT4 A;  1MMN A;  1NJI C;  4KGZ B;  5FU6 C;  4CC3 A;  3H8Z A;  1WPY A;  3OS0 A;  2X4W A;  5FRN A;  3DB3 A;  3LLR A;  2HDA A;  3EG0 A;  2NUP A;  3OY9 A;  4OMP A;  4JZ4 A;  3CXC A;  2NWM A;  3OS1 A;  1NPP A;  2M0O A;  4CC2 A;  3MP1 A;  2YUN A;  2WSC E;  3G4S Q;  1D1A A;  3E9G A;  2RJF A;  2FPF A;  3VU3 C;  1LJO A;  2XMF A;  2M16 A;  4LUD A;  4XTW A;  1H3H A;  1HYO A;  1OZ3 A;  5LJ5 h;  2D1X A;  4IIM A;  2MWO A;  2EIF A;  2RI5 A;  3QG1 A;  4X1V A;  5GAO n;  5LJ5 e;  3GF5 A;  4ZTJ A;  1TUG B;  3CPW P;  4A4E A;  4V2S A;  3NGP A;  1ZSZ B;  1AZG B;  4RTT A;  5IH2 A;  2LCC A;  1M1K U;  3NMZ C;  4P5N A;  2LQ8 A;  4JRI A;  4E7H A;  2HMA A;  4DOV A;  3TEE A;  1O75 A;  5CAI A;  4J6Y A;  9ATC B;  4A53 A;  1FYN A;  2WSF E;  5D6W A;  1P92 A;  1FXX A;  2J06 A;  3X20 B;  2KRN A;  1KC8 C;  3DLM A;  1AD5 A;  4J9H A;  3V8L A;  1B7T A;  3FEO A;  2AT1 B;  2X4X A;  3V7S A;  3JCM c;  2NUT A;  1UGR B;  2L0A A;  4QQ6 A;  4KGX B;  1YFN A;  2P0P A;  2CSQ A;  5FWC A;  2HSP A;  3QHS A;  2OAU A;  1TOV A;  2KR3 A;  2EKO A;  3JCM W;  2BZY A;  4XTY A;  4LDY A;  1CKB A;  1ZA1 B;  2RJC A;  1GCQ A;  2AKL A;  2ECZ A;  4PJL A;  4RTU A;  1D0Z A;  1B3Q A;  3RR6 A;  3NPF A;  2KYB A;  1UGP B;  2XU8 A;  4EMK C;  2DYB A;  2JVV A;  5DLQ E;  2AZS A;  4C92 G;  1OI1 A;  4AFS C;  2E5K A;  1D1B A;  3UT1 A;  1SHG A;  3RDV A;  2L3Q A;  1Y07 A;  3I5S A;  1C6V X;  1OPK A;  1KHC A;  2B8A A;  4DBR A;  3TSZ A;  1RAI B;  1VQ9 Q;  2GF7 A;  2H3J A;  4Z88 A;  3I55 A;  2LT4 A;  3HPW A;  4RTY A;  4F16 A;  1VQ9 A;  3RES A;  5GAN e;  4MMK A;  2E12 A;  2YHT A;  4BE2 A;  1OZ2 A;  1U1T A;  2XG8 D;  4XTZ A;  2KRM A;  1YJN Q;  4ELZ C;  1AEY A;  3A8O B;  2D8J A;  2ATC B;  4C0D B;  5LJ3 e;  1VIE A;  4D6W A;  4HKE A;  3OQ5 A;  1PC0 A;  2MF2 A;  5FU7 B;  1VQP Q;  3JSC A;  2LQW A;  2MIO A;  2BZX A;  3MP6 A;  2K57 A;  3OSS C;  2SEM A;  3OYB A;  1NG2 A;  1XOV A;  1G3Y A;  3QZ9 B;  2XD0 A;  3SEM A;  4M75 C;  3S3N A;  4TVR A;  1EIF A;  1SPK A;  2RB6 A;  2OJ2 A;  1Y96 A;  3O8V A;  1QCN A;  4EMK B;  3VRY A;  2H8H A;  1VYV A;  5FW9 A;  1WI7 A;  3G6E Q;  1B34 B;  1PRM C;  2FRW A;  1SEM A;  1WYX A;  1TH7 A;  2JS2 A;  1UHC A;  2ROL A;  1S72 A;  3OW2 P;  2O4X B;  4GBQ A;  1W2B P;  1VQ5 Q;  3SB2 A;  1K0X A;  3LWH A;  2YUQ A;  1LCK A;  1EX4 A;  2QEX A;  4E7L A;  4E7Z A;  3I35 A;  1Q82 U;  3QJY A;  2PQW A;  3KUF A;  3HTR A;  2XHC A;  5KYU B;  1G3W A;  1ZQ1 A;  2KI7 A;  4HCB A;  4FW1 A;  2YRC A;  3C0C A;  3RMS A;  2P84 A;  4OMO A;  5HKC A;  4D8K A;  1YBY A;  1NBE B;  1Q7Y R;  4LNP A;  1VQN Q;  4MDW A;  2DBK A;  3GPL A;  3RNJ A;  1WNL A;  2YSQ A;  2LRQ A;  4F04 B;  2CDT A;  2BE9 B;  2CRE A;  2RJD A;  4OVA A;  4FCY A;  3OW2 A;  3HHT B;  3M54 A;  1R0C B;  3NTI A;  4LUE A;  2DVE A;  5KYY A;  2YRD A;  2A7Y A;  1VQ6 A;  1QW1 A;  4WCI A;  2J7I A;  2RHZ A;  5D7U A;  3TQ7 P;  1SRM A;  2ZPG B;  1RLP C;  2PVO B;  5GMK j;  1KC8 U;  2MK5 A;  3PVL A;  5CKH A;  5KH6 A;  2Y4X A;  5CKF A;  1NPR A;  3VYG A;  4PJO F;  3X26 B;  1VQO Q;  2DM1 A;  1BCM A;  3HRS A;  1Q86 R;  4OML A;  1V29 B;  5I2M A;  1JQQ A;  1ZA2 B;  3UF4 A;  4PJJ A;  1D09 B;  1JRI A;  2LQK A;  4Z02 A;  1HJD A;  1WX6 A;  3OYN A;  3RER A;  3GNG A;  2RPN A;  4BE1 A;  2O88 A;  2JTF A;  2ZZD A;  1NJI U;  1RAF B;  1K73 C;  2PU9 B;  1SHF A;  4MZT A;  4E6R A;  2QQS A;  1KHI A;  1H92 A;  1YWP A;  3CC2 Q;  1GFD A;  4C5G A;  1Q7Y C;  1ZHI A;  1MUZ A;  1NJI R;  4DBF A;  2DIG A;  2DAQ A;  3OYY A;  1AWW A;  1K0S A;  1VQO A;  3RKX A;  3RBB B;  4C5H A;  1KFZ A;  1JJ2 P;  3UAT A;  3CD6 T;  1M1G A;  3KXT A;  4M7A F;  1ZSZ A;  5EC7 A;  4HCZ A;  1MNE A;  1R8O B;  2R58 A;  1UFF A;  3REB B;  2DX1 A;  3MHX A;  4ANJ A;  4M77 G;  4A4G A;  5GAM h;  4FSX A;  1BCO A;  2DER A;  3C4S A;  2MCN A;  2FRY A;  4KUI A;  4ZGE B;  4RMO A;  3CCV Q;  1VQO T;  1JB0 E;  4PJO C;  4Q5W A;  4PL6 A;  3CCM Q;  5GAN 6;  3IQL A;  3MEW A;  1BB9 A;  3HRT A;  4FT4 A;  2RI3 A;  3CCU Q;  2LX9 A;  3LGL A;  3JCM J;  5GAM j;  4M78 B;  1JJ2 S;  1Q7Y U;  5GAN g;  2HNI A;  2J6K A;  2JTE A;  4KH0 B;  1U5S A;  5I22 A;  5GAM e;  2OTL Q;  3JCM h;  1YJW Q;  1VA7 A;  2ZCF B;  3H41 A;  1X43 A;  2RHU A;  1PNJ A;  2D6F A;  2CT3 A;  1M2V A;  1WIE A;  4RTZ A;  1PM3 A;  4KT0 E;  4JJC A;  1UJ0 A;  1VQL A;  1UTI A;  2K5L A;  3WVE B;  2GBQ A;  4E7J A;  2KEA A;  4OB1 B;  2EYZ A;  4C8Q C;  3CD6 Q;  3CC2 A;  1V1C A;  4BB7 A;  5LJ5 f;  4M75 G;  1Y71 A;  1BKB A;  4M7D F;  2VV5 A;  4MZP A;  2P4T A;  1ABO A;  4J6W A;  2D8H A;  4FYY B;  2O9S A;  4O5V A;  1RI0 A;  1PKS A;  2GQI A;  2AIR B;  2QAS A;  4RCB A;  3I56 A;  3OYJ A;  2R57 A;  3VS4 A;  2EQI A;  4E7S A;  2X35 A;  1I1J A;  2F5K A;  2X51 A;  4M7D B;  2PVD B;  1IO6 A;  4M75 B;  1JU5 C;  3L2Z A;  4Y28 E;  5HK0 A;  2GNC A;  2JN0 A;  1RAA B;  2KNB B;  4DQ2 A;  1OQK A;  2HKN A;  2C0O A;  2K5I A;  4ZTF A;  1KJW A;  2DL7 A;  3OYH A;  4LXC A;  2K9G A;  2RF0 A;  3RMQ A;  1HK9 A;  3EAE A;  3V8J A;  4MZM A;  3VS3 A;  1S72 Q;  5GAN d;  4HCC A;  2NUP B;  1QVP A;  2CZ7 B;  3NFC A;  5KYX B;  3VS2 A;  5GAM d;  3OYG A;  2BUD A;  3CCR A;  4F7U B;  2HBP A;  3EG2 A;  4FW2 A;  4LN2 A;  3M0U A;  4A54 A;  1YJ9 A;  3C95 A;  3RUX A;  1QLY A;  3G4S A;  2QDY B;  3UDC A;  5GAN h;  4KUD K;  3VS5 A;  2CZ6 B;  3OYL A;  2XIC A;  3CCL T;  4FU6 A;  1BYM A;  3FJ5 A;  4PJM A;  4DEY A;  1W6X A;  4N0A A;  4X34 A;  3EFS A;  4E47 A;  1WHG A;  3LH0 A;  1ZSG A;  2DLP A;  2EGA A;  2XI9 A;  1OPL A;  2P0K A;  3GP8 A;  2E70 A;  4ME7 A;  2A36 A;  2K3X A;  3MEA A;  4FYW B;  1UHF A;  1VQ9 T;  2HEQ A;  3EFO B;  2QA4 Q;  1E6H A;  3M5A A;  2KRO A;  2KGT A;  2FZG B;  2EW3 A;  1OUL A;  2RQT A;  1VQ7 Q;  3LW5 E;  3CCQ Q;  3M9Q A;  4EMK A;  4J9C A;  2KSS A;  2KAF A;  1VQN A;  2YLC A;  1QWE A;  2P4R A;  2HQE A;  4LDX A;  1WZO A;  2DMO A;  5GAN 8;  1G5V A;  3RIR A;  1IRX A;  3FC3 A;  2HL5 C;  1VQ6 T;  2G6F X;  3EG9 B;  1QVG P;  4KH1 B;  2MMP A;  4JUV A;  5GAN 5;  4L6V 5;  4FT2 A;  5FRM A;  1XNI A;  4AMC A;  1R77 A;  3MPU B;  1AWX A;  1VQM Q;  4J6X A;  1LPL A;  2A28 A;  2DIL A;  2IG0 A;  5LJ3 j;  2RK2 A;  2A3L A;  4XK8 E;  4F7U G;  2ZGW A;  2LTO A;  4PLL A;  2CP3 A;  1KQ2 A;  5CKB A;  2JS0 A;  3M0P A;  4M7D A;  4M7D E;  3LX7 A;  3RKW A;  4RKU E;  5GAN j;  2YUP A;  4OB0 B;  5A2Q E;  3I5R A;  1X2Q A;  3EH1 A;  5D6X A;  5I21 A;  1Y0M A;  2BTT A;  2E10 A;  4OF1 A;  4HXJ A;  1M3B A;  4X9C A;  4IUR A;  3KFV A;  1K73 U;  2O01 E;  3G4S T;  4C92 E;  4C92 A;  2Y4Y A;  3UPU A;  3M57 A;  2JOY A;  5C6S A;  5GAN 7;  2CSI A;  2QEX Q;  5CIU A;  4RUG A;  1YIT T;  2CZ1 B;  4PJO D;  2F1L A;  3VUZ A;  2HD0 A;  2DNU A;  4JRK A;  2QDL A;  4XQ3 A;  4HVU A;  2KQW A;  5DY9 A;  1PD1 A;  4M78 C;  1Y96 B;  2MI6 A;  2VGM A;  1YJW A;  3ULR B;  4F7U A;  4F7U E;  3PTA A;  2COZ A;  4J9I A;  1XTD A;  1OU9 A;  5HCK A;  3UA6 A;  5KYW B;  4C8Q A;  4C8Q E;  3I55 T;  2VGN A;  1BI2 A;  4FM4 B;  1K76 A;  1HSQ A;  3JB9 D;  3CC7 T;  1VIF A;  2DEU A;  3G1J A;  3WVD B;  1GCP A;  3CCE T;  1PCX A;  4LE9 A;  3L2W A;  4J9D A;  4EMH A;  3CQT A;  1XJW B;  3H0I A;  3PT9 A;  3M0Q A;  4KRT A;  2FPE A;  1NYF A;  1Q86 U;  4RTV A;  4EDU A;  2MWP A;  2JM9 A;  1IGU A;  1CKA A;  2CP6 A;  2KRS A;  2LZ6 B;  3EG1 A;  3FB9 A;  4II1 A;  1OX9 A;  1H3Z A;  4E7I A;  4C5E A;  3VV0 A;  4J9E A;  2LDM A;  1W1F A;  1VQL T;  3VS1 A;  4ZN3 A;  3JCM e;  1H64 1;  3S6W A;  1K9M C;  1WHJ A;  2QI2 A;  3QYH B;  1K9A A;  2DTI A;  1M90 C;  1EZZ B;  3M4Y A;  3QSU A;  2DEQ A;  2F2W A;  2DXU A;  3QBY A;  1VQ4 A;  5KCO A;  2DJQ A;  3ZFJ A;  4C0Z A;  3ASK A;  1X6B A;  2DTH A;  4M78 G;  1VQ8 A;  5LL6 S;  3M59 A;  3CCR Q;  4ELY C;  4M77 B;  4HA8 A;  1QKW A;  1M30 A;  4OMM A;  4E7K A;  2EQM A;  2EKH A;  2DJZ A;  3WXM B;  1GBQ A;  1AWJ A;  3CCJ Q;  2VXE A;  1AZE A;  2FO0 A;  3CPW S;  1QCO A;  3A8H B;  3C12 A;  3CME T;  3OBW A;  2K6D A;  1QMC A;  2EJG A;  1K8A C;  2OTL A;  3V7C A;  4OB3 B;  4EIK A;  2M51 A;  4O6J A;  1YIJ T;  2GGR A;  5GAM g;  1RAC B;  4HVV A;  4DOW A;  2DA9 A;  2RK1 A;  3CCE Q;  3BDL A;  4F14 A;  2EPD A;  1FMV A;  1KD1 R;  3JCM Q;  2NUZ A;  2COY A;  3DKM A;  2ZPH B;  5KYW A;  2E3H A;  5J39 A;  1UEC A;  2CP2 A;  3MO8 A;  4NL3 A;  1KQS S;  2DKG A;  2YDL A;  4M7D G;  3THK A;  1Q95 G;  1X6G A;  3M0R A;  4R56 A;  2DET A;  1ZX6 A;  3CCL Q;  1YI2 A;  2KYM A;  1UG1 A;  2VB6 A;  2YT6 A;  3A8M B;  1VQL Q;  1VQK A;  4M7A B;  2YLB A;  2HKQ B;  2ZPF B;  3QPH A;  2V8J A;  3SWN A;  1VQ4 T;  4DA4 A;  4KGV B;  3HKS A;  4IIO A;  2LCS A;  4EPC A;  3V8K A;  4M7A D;  1TS9 A;  2E4H A;  2B86 A;  3EGD B;  1W2B S;  1UGS B;  4PLI A;  4NOY A;  4IUV A;  3G6E A;  3PMI A;  1PD0 A;  4LD6 A;  3OYK A;  2X3W D;  1Z9Z A;  1FMK A;  1M90 U;  1K73 R;  8ATC B;  3GOX A;  1KD1 C;  1UUE A;  4MML A;  5M9O A;  3OYI A;  1B07 A;  2QQ9 A;  2K79 A;  1WDX A;  3NTK A;  3JCM V;  3HFN A;  4LD9 K;  1WQ7 A;  2M1H A;  4C0F A;  2L5Q A;  2EVR A;  2QK0 A;  4ZGJ B;  2AK5 A;  5KYN A;  1VQM T;  1M1F A;  1WA7 A;  2FZC B;  3I55 Q;  1PSE A;  1T0J A;  3OS2 A;  3QWX X;  2F2X A;  1NEB A;  2G3R A;  3M0T A;  1U3O A;  5GAO l;  1WGS A;  4M75 E;  4M75 A;  1G3T A;  3VJP A;  4LDU A;  1IHV A;  2VAS A;  2QQB A;  2LT1 A;  1PRL C;  5CKD A;  1KD1 U;  4FIB A;  5A0L A;  3L2R A;  1U8R A;  1QP3 A;  3CMA T;  2RJE A;  1AWO A;  1I07 A;  3OS5 A;  2EYY A;  4PNO A;  1WHK A;  2DE0 X;  1JBM A;  2GCX A;  1BI1 A;  5I2S A;  4N4G A;  1VUB A;  1O9S A;  4M7A A;  5KE2 A;  4M7A E;  1W70 A;  2D0N A;  2XK0 A;  4QW2 A;  5DLO A;  5D6Y A;  5LJ5 d;  3CCU T;  2HSE B;  1IB8 A;  3TCJ A;  4AG1 C;  4N0A C;  5GMK e;  4IUU A;  1QVF S;  1YWO A;  4D8D A;  5GAO m;  2KXD A;  3X28 B;  1HD3 A;  1GBR A;  4OP0 A;  4GLM A;  4ZGD B;  1D0Y A;  3FLG A;  1SSH A;  2EYX A;  1Y57 A;  5IAY A;  1H8K A;  1PWT A;  2J6O A;  2CUD A;  3G71 T;  2WSE E;  2QAZ A;  3X25 B;  1M90 R;  2DZ9 A;  2LC4 A;  2LQN A;  5FU7 C;  2LX7 A;  2QTX A;  1WJR A;  3M58 A;  3JCM d;  2BZ8 A;  1I8F A;  2CP5 A;  4NS5 A;  4R55 A;  3VS7 A;  2FEI A;  4JRQ A;  4WF2 A;  1WJS A;  1VQP T;  2YWW A;  2KMT A;  1LVK A;  3HP9 A;  1VYT A;  5GMK h;  3F70 A;  2L89 A;  1MMA A;  4E2F B;  2GFU A;  3VKI A;  4R0K A;  2RQW A;  4AFU C;  2RNA A;  3UA7 A;  2YRV A;  3CBM A;  1OYX A;  4JRP A;  4FYV B;  4DBQ A;  2V8I A;  4IUT A;  4M77 F;  2PVG B;  3LGF A;  4CC4 B;  2W0Z A;  1MMD A;  1FX7 A;  3I56 Q;  4JJN K;  2KDS A;  2FYK A;  5GJW B;  2RMO A;  2PUO B;  5AYF A;  2CS7 A;  4OMF B;  3CCQ A;  4X9D A;  3CBP A;  3JB9 F;  2L8D A;  3QDF A;  2JXB A;  1X2K A;  2KT8 A;  4B9X A;  1FWZ A;  2BKD N;  3INZ A;  2OI3 A;  1NLP C;  1SF9 A;  2JT4 A;  5CQY A;  1TWB A;  1ZBX A;  2DK3 A;  1UE9 A;  2LP5 A;  2VWF A;  1NEG A;  4BAC A;  7AT1 B;  1IRE B;  3OYA A;  1SRL A;  4F7U F;  1OV3 A;  4RG8 A;  3OA6 A;  2DFU A;  1J3T A;  4PFO A;  4Y92 A;  3KBG A;  2MPX C;  4XAX B;  4EMG A;  2A37 A;  3ME9 A;  2OTJ Q;  4BD3 A;  3OYF A;  1YCY A;  1M9S A;  5CQX A;  5IHK A;  1YIT Q;  3BW1 A;  2OTL T;  4IUQ A;  2HZY A;  3CME A;  2KY9 A;  3CCM A;  3JAM E;  4C92 F;  1QWF A;  3J81 E;  4ATO A;  4AG2 C;  5A0D A;  3P8B B;  3JCM X;  1HXD A;  4J9F A;  4AFZ C;  4M77 D;  3CC7 Q;  2QA4 T;  3CCV T;  1G8X A;  2ZAE A;  2FB7 A;  3MJX A;  4BI4 A;  2VUB A;  4OGC A;  1X75 C;  2J05 A;  4XTX A;  3X24 B;  1N8R R;  1BBZ A;  2DL3 A;  2C0T A;  2HCK A;  2W10 A;  2M0Y A;  3CCJ A;  1ZSZ C;  5J3B A;  2KXC A;  3OMG A;  3URG A;  4KUL A;  4QVD A;  1Q81 R;  3OW2 S;  4J7I A;  2ENM A;  4M77 A;  4M77 E;  3LWI A;  3BY7 A;  3PE0 A;  4LDW A;  1V76 A;  3E2U A;  3JRZ A;  5CK9 A;  2Y90 A;  4C8Q F;  2EFI A;  3CPF A;  1VQ5 T;  1VQ7 T;  1M2V B;  5GAO r;  4M7A G;  1EFN A;  3ZL7 C;  2RI2 A;  1K4U S;  3FIF A;  2RQU A;  4C92 D;  4UC4 A;  1YJN T;  1JEG A;  4B6M A;  1YHQ T;  2JUF A;  2DO3 A;  2J6F A;  2GFA A;  4PFZ A;  1RLQ C;  1BK2 A;  4A63 B;  2BIV A;  2EQK A;  3CEY A;  1VQK T;  4JLI A;  2O31 A;  3CCV A;  2QA4 A;  2QYZ A;  2K5F A;  1D1C A;  5GAN 4;  5CO7 A;  4M7D D;  3J7A F;  3T9N A;  2FG0 A;  1PSF A;  4PJO G;  1RUW A;  3CCS T;  3SWN C;  1WHL A;  1WHM A;  3QUI A;  1WXT A;  5IXF A;  1YN8 A;  1ZUU A;  3FDR A;  1IGQ A;  2PUK B;  1SG5 A;  2E1H A;  4JLG A;  3LH5 A;  4GLK A;  2K2V A;  5CR2 A;  1Q81 C;  1KC8 R;  1RAE B;  5EG2 A;  4QQG A;  2YXY A;  1QVF P;  4C92 B;  4YTL A;  1I0C A;  2ESW A;  3I9Q A;  4HT9 A;  1UDL A;  2LJ3 A;  3EGU A;  3H0F A;  4Y91 A;  1YIJ A;  1YIT A;  3L2U A;  4M75 F;  2EJF A;  4IUP A;  1WLP B;  3M56 A;  2ED0 A;  2F69 A;  5GAN f;  4PJN A;  4KBM B;  2V26 A;  1D3B B;  2X4Y A;  2K4Y A;  4QVZ A;  2C06 A;  4J83 A;  3CC4 A;  3EH2 A;  5FRO A;  1GFC A;  2ABL A;  3OMC A;  2O2O A;  3CCQ T;  5LJ3 f;  4JS4 A;  2ZPB B;  2NYS A;  5A0G A;  1AT1 B;  1VQ8 T;  2QG9 B;  2DF6 A;  3CBO A;  1A0N B;  2LJ1 A;  5L8R E;  3BDU A;  2X9H A;  3SD4 A;  2RQV A;  2QQR A;  3JV3 A;  1I5L A;  1F1B B;  5AT1 B;  2E5Q A;  3MET A;  5I11 A;  3QDR B;  2JJ9 A;  1E6G A;  5GMK i;  3EFO A;  1N5Z A;  2FPD A;  1LNX A;  2CGH A;  5CVI A;  3JCM g;  1OX8 A;  4J9B A;  1M4Z A;  2D9T A;  1K9M R;  4RTW A;  5LJ3 g;  5L23 A;  1KSW A;  2DPP B;  2DBM A;  2IVW A;  4IKF A;  2KVQ G;  3N5B B;  1JJ2 A;  2XKO C;  4HCK A;  3PMT A;  1G83 A;  2EQU A;  3CXC S;  2DD5 A;  2RH2 A;  4PKC C;  4CC7 A;  1D3B A;  3G71 A;  2EJ9 A;  2JTM A;  2C0I A;  2RHY A;  2RQR A;  1M3C A;  3CC7 A;  4CRI A;  3J80 E;  3OYC A;  2F5T X;  4OGE A;  1NE8 A;  1YNZ A;  2BE7 D;  5GAO q;  2QGF B;  2EYQ A;  1MV0 B;  2RO0 A;  3EHR A;  3P8D A;  1M2O A;  2X4J A;  1BIA A;  1YIJ Q;  4BY6 C;  2CH4 W;  3CCU A;  3JCM b;  1IZ6 A;  2OTJ A;  1T3L A;  2DIQ A;  4BUG A;  1M3A A;  3ZBD A;  1NYG A;  5IXB A;  4XU2 A;  3A5Z B;  2LCL A;  3R6N A;  5KYU A;  3CMA A;  1KIK A;  3NHN A;  1TXQ A;  3PVQ A;  3GIB A;  4XU0 A;  2L3P A;  1Z9Q A;  3CXC P;  1NLO C;  2K7A A;  1X01 A;  3HFO A;  1WQW A;  2O9V A;  2CP7 A;  4B9W A;  4JJB A;  2DD4 A;  1UGV A;  8AT1 B;  4VUB A;  3CME Q;  4RG2 A;  3CCS Q;  1YJ9 Q;  3FJP A;  2FVU A;  3DLL A;  1G3S A;  3G7Z A;  3QWY A;  1YHQ A;  2H3E B;  1N6A A;  1WXU A;  2HQX A;  4JZ3 A;  2LNH B;  3VRZ A;  2JZ2 A;  1MHN A;  2V1Q A;  5LJ3 h;  1AHJ B;  1IHW A;  3JB9 J;  2PZ1 A;  1QVG S;  4LDV A;  1VQ7 A;  2EWN A;  3UWN A;  1VQ5 A;  5LJ5 j;  3H0H A;  2OX7 A;  3ER0 A;  4A4K A;  3I56 T;  5GAN 3;  3E19 A;  2KBT A;  1CSK A;  4DEX A;  5C0M A;  1MND A;  1M1K C;  3MEV A;  2FHD A;  1SSF A;  3PNW C;  3OYD A;  1N9R A;  1RAH B;  3G6E T;  1Q82 C;  4A4F A;  4XU1 A;  3HSB A;  4ZN1 A;  2AZV A;  2IIM A;  3S3M A;  2A0F B;  2RM4 A;  5KE3 A;  4JS5 A;  4Z89 A;  1ZLM A;  3P8H A;  2LNV A; 
#chains in the Genus database with same CATH homology
 4OB2 B;  4BI3 A;  3JCM d;  4E47 A;  3PGG A;  1B34 A;  3LH0 A;  4C8Q G;  2DXB A;  1I8F A;  2XI9 A;  4NS5 A;  4A4E A;  4R55 A;  4N4H A;  5GAM f;  1QVF A;  2LCC A;  4JRQ A;  1M1K U;  4WF2 A;  2P0K A;  1RL2 A;  1WJS A;  3PIP A;  3GP8 A;  2E70 A;  4ME7 A;  4P5N A;  1VQP T;  2KMT A;  2CKK A;  3HP9 A;  2LQ8 A;  5GMK h;  3F70 A;  4JRI A;  2K3X A;  3CCM T;  5FU6 B;  4E7H A;  2L89 A;  3MEA A;  3TEE A;  4DOV A;  1O75 A;  2E65 A;  3MP8 A;  4J6Y A;  5CAI A;  5FLX E;  4A53 A;  1VQ9 T;  2GFU A;  4QQD A;  3VKI A;  2WSF E;  5D6W A;  3M5A A;  1U1S A;  1P92 A;  1FXX A;  1Q86 C;  2YRV A;  3X20 B;  3LW5 E;  3CBM A;  3M9Q A;  1OYX A;  4JRP A;  1KC8 C;  4EMK A;  2V8I A;  2KSS A;  3OYM A;  3DLM A;  4IUT A;  2KAF A;  1VQN A;  2YLC A;  2E6N A;  4M77 F;  3QII A;  3V8L A;  4J8O A;  2HQE A;  4LDX A;  2PVG B;  2ZPE B;  3FEO A;  3LGF A;  2X4X A;  3V7S A;  3JCM c;  1FX7 A;  5GAN 8;  1UGR B;  1G5V A;  3RIR A;  2WAC A;  3FC3 A;  4QQ6 A;  3LYI A;  4JJN K;  2KDS A;  5KCH A;  1VQ6 T;  2MAM A;  2P0P A;  2FYK A;  2O4X A;  4BDZ A;  2MMP A;  4JUV A;  5GAN 5;  3PIO A;  2HAX A;  2PUO B;  4L6V 5;  5AYF A;  2CS7 A;  4OMF B;  3CCQ A;  2E6Z A;  3QHS A;  4J5Y A;  2OAU A;  4NL2 A;  2JNG A;  3CBP A;  4FT2 A;  1XNI A;  2L8D A;  4X9D A;  5CCA A;  5FRM A;  3JB9 F;  2EKO A;  3JCM W;  4B9X A;  4XTY A;  1FWZ A;  2R5A A;  3S3O A;  4LDY A;  2BKD N;  3INZ A;  4A4H A;  3VYH B;  4J6X A;  3CCR T;  3JCM f;  1Q81 U;  3CCS A;  2RJC A;  2E41 A;  3OYE A;  5CQY A;  2IG0 A;  4HT8 A;  1N8R C;  5LJ3 j;  3G71 A;  2RK2 A;  2A3L A;  1ZBX A;  2DK3 A;  4XK8 E;  1UGP B;  2XU8 A;  4EMK C;  1NZ9 A;  4F7U G;  2ZGW A;  2JVV A;  2LTO A;  4PLL A;  4BAC A;  1IRE B;  5DLQ E;  1KQ2 A;  5CKB A;  4C92 G;  3OYA A;  2K3Y A;  4C8Q B;  3R6O A;  4F7U F;  1OI1 A;  4M7D A;  4RG8 A;  4M7D E;  3LX7 A;  3UT1 A;  3AHU A;  3RKW A;  3OA6 A;  4RKU E;  5GAN j;  4RCC A;  3SDZ A;  3EFR A;  4OB0 B;  5A2Q E;  1Y07 A;  1YJN A;  3KBG A;  2NLU A;  4XAX B;  1DJ7 B;  1KHC A;  4BI8 B;  2B8A A;  2V8K A;  5D6X A;  4EMG A;  5I21 A;  1GXI E;  1Y7X A;  4QVC A;  2E10 A;  3ME9 A;  4OF1 A;  4BD3 A;  3C94 A;  1YCY A;  1M9S A;  2GF7 A;  4X9C A;  4IUR A;  2H3J A;  5CQX A;  3OYF A;  1K9M U;  3I55 A;  2LT4 A;  3HPW A;  2O01 E;  1K73 U;  3BW1 A;  3G4S T;  4C92 E;  4C92 A;  2OTL T;  4IUQ A;  1VQ9 A;  3RES A;  2Y4Y A;  2XDP A;  5GAN e;  2L3R A;  3UPU A;  3CME A;  2KY9 A;  4MMK A;  2E12 A;  3CCM A;  2YHT A;  3JAM E;  4C92 F;  3J81 E;  4BE2 A;  1OZ2 A;  3M57 A;  1QVG A;  2JOY A;  4CI0 C;  1U1T A;  2XG8 D;  5IN1 A;  5A0D A;  5C6S A;  4XTZ A;  3P8B B;  5GAN 7;  5CIU A;  3JCM X;  3VUB A;  1HXD A;  4ELZ C;  1YIT T;  2CZ1 B;  4M77 D;  4PJO D;  3A8O B;  2QA4 T;  1M8V A;  3CCV T;  2FB7 A;  4C0D B;  3VUZ A;  5LJ3 e;  1VIE A;  4D6W A;  4BI4 A;  2HD0 A;  2VUB A;  3RKY A;  4OGC A;  1X75 C;  3OQ5 A;  4HKE A;  4JRK A;  4M75 D;  3M4G A;  3CC2 T;  2MF2 A;  5FU7 B;  4XQ3 A;  3JSC A;  2KK4 A;  3M53 A;  4XTX A;  3X24 B;  4C0G A;  3MP6 A;  2K57 A;  3OSS C;  3OYB A;  2KQW A;  2D0Q B;  5CKE A;  5GAO p;  1XOV A;  5DY9 A;  4BY6 B;  1G3Y A;  4BDY A;  5IT9 E;  4M78 C;  1X6O A;  3QZ9 B;  3CCJ A;  2XD0 A;  2ZPI B;  5J3B A;  4M75 C;  3S3N A;  4TVR A;  1Y96 B;  1EIF A;  3OMG A;  2MI6 A;  4KUL A;  3URG A;  4QVD A;  2VGM A;  3CCE A;  2CYZ B;  3OW2 S;  4J7I A;  4N4I A;  1YJW A;  4M77 A;  4M77 E;  2RB6 A;  3OB9 A;  3LWI A;  1Y96 A;  3BY7 A;  3O8V A;  4LDW A;  5LJ3 d;  4EMK B;  4F7U A;  4F7U E;  3PTA A;  1XTD A;  3JRZ A;  5CK9 A;  2Y90 A;  4C8Q F;  2EFI A;  1Q7Y U;  1B34 B;  3CPF A;  3V7R A;  4C8Q A;  4C8Q E;  3I55 T;  2VGN A;  1VQ5 T;  1BI2 A;  1VQ7 T;  4FM4 B;  5GAO r;  4M7A G;  3JB9 D;  4C0D C;  3CC7 T;  1TH7 A;  1VIF A;  2VYT A;  2VXF A;  1S72 A;  2RI2 A;  3WVD B;  3M55 A;  1YJW T;  2O4X B;  5GMK l;  3CCE T;  3FIF A;  3QJ6 A;  3QYG B;  3SB2 A;  3L2W A;  4EMH A;  4C92 D;  4UC4 A;  1YJN T;  3PT9 A;  5HK3 A;  3LWH A;  1YHQ T;  2JUF A;  1Q86 U;  2DO3 A;  5J26 A;  2QEX A;  4E7L A;  4EDU A;  2MWP A;  2GFA A;  1Q82 U;  3QJY A;  2PQW A;  3KUF A;  2XHC A;  2BIV A;  2EQK A;  1G3W A;  3CEY A;  3FB9 A;  4II1 A;  4JLI A;  1ZQ1 A;  1VQK T;  1H3Z A;  4HCB A;  1N8R U;  4E7I A;  4C5E A;  3CCV A;  3VV0 A;  2RA2 A;  4C8Q D;  2QA4 A;  5GAN 4;  2K5F A;  2OTJ T;  5CO7 A;  2LDM A;  4M7D D;  3RMS A;  3J7A F;  1VQL T;  3T9N A;  4ZN3 A;  5HKC A;  1PSF A;  4PJO G;  3JCM e;  1YBY A;  3CCS T;  3SWN C;  1QP2 A;  3L2V A;  1H64 1;  3QUI A;  3S6W A;  1K9M C;  4M7A C;  1KG1 A;  4MDW A;  2QI2 A;  3QYH B;  3GPL A;  1WNL A;  3FDR A;  2LRQ A;  3JB9 H;  2DTI A;  3L1A A;  3CD6 A;  3QXE B;  2PUK B;  2RJD A;  4OVA A;  3OW2 A;  3HHT B;  1M90 C;  3M4Y A;  3QSU A;  2DEQ A;  2E1H A;  3M54 A;  2DXU A;  3QBY A;  3NTI A;  2K2V A;  4GLK A;  2DVE A;  4GY5 A;  4JLG A;  5CR2 A;  1Q81 C;  2XID A;  2A7Y A;  1VQ6 A;  1QW1 A;  1VQ4 A;  5EG2 A;  5KCO A;  3ZFJ A;  4C0Z A;  2RHZ A;  3ASK A;  4QQG A;  3PFS A;  2DTH A;  4M78 G;  3NTH A;  1VQ8 A;  2ZPG B;  3M59 A;  5LL6 S;  4PJO A;  2PVO B;  5GMK j;  2DTO A;  4PJO E;  4ELY C;  4M77 B;  1KC8 U;  4HA8 A;  4L59 A;  5CKH A;  4C92 B;  5KH6 A;  2Y4X A;  4FL6 A;  5CKF A;  4YTL A;  1NPR A;  4E7K A;  3VYG A;  2EQM A;  4PJO F;  3X26 B;  4HT9 A;  3HRS A;  4Y91 A;  1YIJ A;  1V29 B;  5I2M A;  1YIT A;  2DJZ A;  3WXM B;  1MGQ A;  3L2U A;  1JRI A;  3MEU A;  2LQK A;  2VXE A;  4M75 F;  4Z02 A;  2EJF A;  4IUP A;  3OYN A;  3M56 A;  3CPW S;  3RER A;  2F69 A;  3A8H B;  5GAN f;  3C12 A;  3CME T;  3OBW A;  3GNG A;  4KBM B;  4BE1 A;  2EJG A;  1D3B B;  1K8A C;  2JTF A;  1BIB A;  2ZZD A;  3ZEH A;  1VQP A;  2OTL A;  2X4Y A;  3V7C A;  4OB3 B;  2RHI A;  2K4Y A;  4QVZ A;  3CPW A;  1NJI U;  4MDX A;  4O6J A;  4XTU A;  2C06 A;  4J83 A;  1YIJ T;  2PU9 B;  1K73 C;  3CC4 A;  4MZT A;  5FRO A;  2DXT A;  3EFS A;  2QXF A;  3OMC A;  5GAM g;  2QQS A;  1KHI A;  4C92 C;  1M5Q 1;  4C5I A;  4DOW A;  5LJ3 f;  3CCQ T;  2P0Q A;  2ZPB B;  4JS4 A;  2RK1 A;  2LVM A;  3BDL A;  4C5G A;  3SWN B;  1Q7Y C;  3L42 A;  1ZHI A;  5A0G A;  3TRE A;  1VQ8 T;  3BFM A;  2FL7 A;  2QQA A;  3JCM Q;  1VQN T;  2XDD A;  4PJO B;  3CBO A;  2DIG A;  2VC8 A;  2DAQ A;  3DKM A;  2ZPH B;  3OYY A;  5L8R E;  3RKX A;  1VQO A;  1KQS A;  4C5H A;  3SFM A;  1I4K 1;  5LJ5 g;  3A8G B;  3DB4 A;  4JDS A;  2DZC A;  5J39 A;  3CD6 T;  1M1G A;  3KXT A;  3MO8 A;  4M7D C;  3BDU A;  4NL3 A;  4M7A F;  1KQS S;  2DKG A;  4M7D G;  3CC4 T;  1YI2 T;  4HCZ A;  3SD4 A;  2QQR A;  1R8O B;  2R58 A;  1I5L A;  4M77 C;  2E5Q A;  4R56 A;  3MET A;  3QDR B;  4XTV A;  5DM7 R;  1XQH A;  5GMK i;  3MHX A;  1YI2 A;  5GMK m;  1UEB A;  3MCA B;  1N9S A;  4M77 G;  3QO3 A;  1LNX A;  2CGH A;  5CVI A;  4A4G A;  5GAM h;  3A8M B;  4FSX A;  3JCM g;  3GLX A;  3C4S A;  1VQK A;  1M4Z A;  2D9T A;  4KUI A;  4M7A B;  4ZGE B;  4RMO A;  1UB4 A;  5LJ3 g;  2YLB A;  3JB9 I;  1VQO T;  1JB0 E;  2DPP B;  4PJO C;  2IVW A;  4Q5W A;  4IKF A;  1UGQ B;  4PL6 A;  2KVQ G;  2EAY A;  2ZPF B;  5GAN 6;  3QKJ A;  2QEX T;  3N5B B;  2DXC A;  3QPH A;  2V8J A;  3MEW A;  3SWN A;  1JJ2 A;  3HRT A;  4XU3 A;  4FT4 A;  4DA4 A;  1VQ4 T;  2XKO C;  2RI3 A;  3HKS A;  3PMT A;  4EPC A;  3V8K A;  4M7A D;  2EQU A;  2LX9 A;  3E1S A;  3LGL A;  3OBY A;  3CXC S;  3JCM J;  2DD5 A;  2RH2 A;  1W2B S;  4PKC C;  5GAM j;  1UGS B;  4M78 B;  1JJ2 S;  4PLI A;  4NOY A;  1D3B A;  1LOJ A;  3OSV A;  3PMI A;  2EJ9 A;  2HNI A;  2JTM A;  4IUV A;  4LD6 A;  5GAN g;  3OYK A;  4M78 F;  1S72 T;  3CCL A;  2RHY A;  3CC7 A;  3E9F A;  5GAM e;  4CRI A;  3J80 E;  3JCM h;  3OYC A;  1M90 U;  2F5T X;  4OGE A;  2M9U A;  1NE8 A;  3Q1J A;  3GOX A;  5HY6 A;  2R5M A;  2ZCF B;  5GAO q;  1YJ9 T;  2EYQ A;  2RO0 A;  1KD1 C;  2D6F A;  2RHU A;  2CZ0 B;  3P8D A;  4MML A;  5M9O A;  2X4J A;  1BIA A;  3QZ5 B;  2AHJ B;  4KT0 E;  3OYI A;  3H6Z A;  2QQ9 A;  4BY6 C;  1VQL A;  3CCU A;  3JCM b;  2K5L A;  1VQM A;  1IZ6 A;  3NTK A;  3WVE B;  2OTJ A;  4E7J A;  3JCM V;  2E64 A;  4OB1 B;  4C8Q C;  1BI0 A;  2DIQ A;  3HFN A;  4BUG A;  3ZBD A;  3CC2 A;  4LD9 K;  4XU2 A;  1WQ7 A;  3A5Z B;  4BB7 A;  2RD1 A;  5LJ5 f;  2RHX A;  4M75 G;  2M1H A;  4M78 D;  1Y71 A;  1BKB A;  4C0F A;  2L5Q A;  2LCL A;  4M7D F;  1WJQ A;  2VV5 A;  4MZP A;  4ZGJ B;  3L2Q A;  3JCM P;  3CMA A;  1VQM T;  1M1F A;  2P4T A;  4L5G A;  4M78 E;  4M78 A;  4J6W A;  1N27 A;  1BI3 A;  2I2L A;  4O5V A;  1I81 A;  1PSE A;  3OS2 A;  4BE0 A;  1RI0 A;  2EQJ A;  3GIB A;  4XU0 A;  3A8L B;  2G3R A;  4RCB A;  2GQV A;  3OYJ A;  2R57 A;  3I56 A;  1W2B A;  5GAO l;  1WGS A;  3TU4 K;  2X35 A;  2F5K A;  4M75 E;  4M75 A;  3JB9 G;  4M7D B;  3FRN A;  3GNF B;  1X01 A;  1G3T A;  3HFO A;  1WQW A;  3VJP A;  2PVD B;  4J7F A;  4LDU A;  4B9W A;  4ATO A;  2DD4 A;  3HRU A;  2QQB A;  4M75 B;  1W4S A;  3HL8 A;  2LT1 A;  5CKD A;  3L2Z A;  4Y28 E;  1KQ1 A;  1K8A U;  1KD1 U;  5HK0 A;  4FIB A;  4VUB A;  5GAN 2;  5A0L A;  4RG2 A;  3L2R A;  3CCJ T;  2JN0 A;  1U8R A;  1QP3 A;  4DQ2 A;  2RJE A;  3CMA T;  2K5I A;  3OS5 A;  4ZTF A;  3FJP A;  4PNO A;  2FVU A;  1NJI C;  5FU6 C;  3OYH A;  3H8Z A;  3DLL A;  1G3S A;  1JBM A;  1WPY A;  3G7Z A;  3OS0 A;  2GCX A;  1YHQ A;  2X4W A;  5FRN A;  1BI1 A;  3DB3 A;  3LLR A;  5I2S A;  1N6A A;  4N4G A;  3RMQ A;  1VUB A;  2HQX A;  1O9S A;  1HK9 A;  3EAE A;  3V8J A;  4MZM A;  5KE2 A;  4M7A A;  4M7A E;  4QW2 A;  2XK0 A;  2JZ2 A;  5GAN d;  1MHN A;  5LJ3 h;  3OY9 A;  5DLO A;  1AHJ B;  4HCC A;  5D6Y A;  3JB9 J;  1QVP A;  2CZ7 B;  5LJ5 d;  3CCU T;  3NFC A;  5GAM d;  1QVG S;  4LDV A;  3CXC A;  1VQ7 A;  2EWN A;  3UWN A;  3TCJ A;  3OS1 A;  3OYG A;  1NPP A;  2M0O A;  5LJ5 j;  3MP1 A;  1VQ5 A;  2BUD A;  4N0A C;  4F7U B;  5GMK e;  2HBP A;  4IUU A;  3CCR A;  2WSC E;  3ER0 A;  2XDB A;  3E9G A;  4A4K A;  3I56 T;  1QVF S;  4A54 A;  5GAO m;  2RJF A;  3C95 A;  3E19 A;  5GAN 3;  1YJ9 A;  3VU3 C;  3RUX A;  3X28 B;  5C0M A;  1LJO A;  3G4S A;  2QDY B;  3UDC A;  4OP0 A;  5GAN h;  3MEV A;  2M16 A;  1M1K C;  4KUD K;  2FHD A;  4ZGD B;  3FLG A;  4XTW A;  1SSF A;  5IAY A;  2CZ6 B;  3OYL A;  3PNW C;  3OYD A;  2XIC A;  1N9R A;  3CCL T;  1OZ3 A;  4FU6 A;  2WSE E;  3G6E T;  3X25 B;  3G71 T;  5LJ5 h;  1Q82 C;  1BYM A;  4A4F A;  4XU1 A;  3HSB A;  2MWO A;  4ZN1 A;  2DZ9 A;  2EIF A;  2RI5 A;  3QG1 A;  3S3M A;  2RM4 A;  2LC4 A;  5LJ5 e;  5KE3 A;  5GAO n;  5FU7 C;  3GF5 A;  3G6E A;  4ZTJ A;  2QTX A;  4JS5 A;  1WJR A;  4N0A A;  4X34 A;  3M58 A;  3P8H A;  4V2S A;  2LNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...