2LCCA

Solution structure of rbbp1 chromobarrel domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
EDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1.
pubmed doi rcsb
molecule keywords AT-rich interactive domain-containing protein 4A
molecule tags Transcription
source organism Homo sapiens
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lccA00
3LX7A 2DIQA 3MP8A 3SD4A 2XDPA 5J39A 3UT1A 3L2VA 4OVAA 3MEVA 4BE0A 5FRNA 3KUFA 1OZ3A 4QVZA 4A4EA 3OYIA 3NTIA 3PNWC 5KE3A 3L2RA 3FDRA 3M9QA 1H3ZA 2GF7A 2JTFA 4PLIA 3E9GA 3OB9A 4N4IA 3PMIA 2EQJA 3LGLA 5J26A 2JZ2A 5M9OA 4C5HA 2B8AA 2EQKA 1G5VA 2L89A 3OYAA 3MEAA 3L2WA 2O4XA 2R5AA 3MEUA 5C6SA 4FL6A 4NS5A 5KCHA 3MO8A 4B9WA 3NTKA 4BDZA 3L2UA 4ZTFA 4Z02A 4C5EA 2D9TA 4II1A 4Q5WA 4QW2A 1OYXA 2M1HA 2E6NA 2M16A 2RI5A 2NLUA 2LCCA 3LLRA 4CRIA 2QQSA 2GFUA 4EDUA 2EKOA 2RO0A 4B9XA 2RJFA 4GY5A 3OA6A 2LDMA 3LGFA 4FU6A 2R57A 3ME9A 5KH6A 2EFIA 4N4GA 2K3XA 2RHYA 4IUVA 1OZ2A 2L3RA 2M0OA 2LRQA 2LTOA 3OYLA 3E9FA 3ZEHA 2BUDA 2RHIA 3OYNA 2LVMA 3QJ6A 3BDLA 3QBYA 2WACA 4LD6A 3MEWA 3OYEA 2HQXA 3OYJA 1WJSA 4IUQA 4E7JA 2R5MA 3DB3A 3FC3A 2P0KA 2X4WA 3OS0A 2RHXA 3OYGA 3OS2A 4BD3A 2IG0A 3OYHA 5D6XA 2EQMA 1XNIA 3GOXA 3DB4A 2G3RA 3OMCA 2MWOA 2PQWA 4BDYA 2EQUA 2GFAA 2RHUA 3F70A 2QQRA 3META 1OI1A 2R58A 1N27A 3LYIA 2X4YA 3S3OA 3H8ZA 4C5IA 2CKKA 4E7IA 2RJEA 2VYTA 3L42A 3ASKA 5FROA 3Q1JA 2X35A 2DIGA 1WJQA 2O4XB 3NTHA 3PFSA 4C5GA 3OYMA 4BACA 3OS1A 3MP6A 5CIUA 3C4SA 2E5QA 4IURA 2BKDN 2XK0A 3MP1A 5D6WA 3S6WA 3P8DA 4A4HA 2RJDA 2YRVA 5KCOA 3OYDA 1SSFA 3FLGA 4HCZA 5FRMA 2BIVA 3QIIA 4PL6A 5D6YA 1WGSA 3QKJA 4N4HA 3S3MA 2RJCA 3UWNA 3DLMA 4QQDA 2X4XA 3LH0A 4ZTJA 3PMTA 4IUPA 4QQ6A 2MWPA 2HQEA 2L8DA 3CEYA 3FEOA 4A4FA 1KHCA 3OYCA 3OYFA 1MHNA 2RI3A 5KE2A 3OQ5A 3L2QA 5IN1A 4L59A 3OY9A 5C0MA 4IUTA 1WJRA 3EAEA 4RG2A 4IKFA 3OYBA 3OYKA 2K3YA 2RI2A 3OMGA 2DAQA 4A4GA 4BE1A 2FHDA 4UC4A 2F5KA 4E7KA 4IUUA 3O8VA 4E7LA 2RHZA 4BE2A 1RI0A 4QQGA 5IAYA 3H6ZA 3P8HA 4PLLA 4X34A 4E7HA 3S3NA
chains in the Genus database with same CATH superfamily
2KROA 2AT1B 1H8KA 4ZN3A 3PNWC 3H0IA 3QZ5B 3SWNA 1VQ9T 3M55A 2QI2A 1X6OA 3HFOA 3L2WA 4LDUA 2OAWA 3CCUA 1Q86R 1U8RA 1VQ4Q 2V1QA 1JJ2A 2BTTA 1X01A 1NE8A 2O01E 2J7IA 3GF5A 5L8RE 2CREA 2DL8A 2PUKB 2R57A 1N5ZA 1E6GA 4IUVA 1WYXA 5GMKi 3OYLA 1YIJA 4PJOG 3FJ5A 3CCEQ 2L3QA 5A0GA 2DM1A 2DL3A 1UJ0A 2R5MA 2X4WA 4HCCA 2FPEA 1G3TA 2MWOA 1I5LA 3C94A 1FYNA 5KYXB 4OB0B 3GIBA 3QDRB 4D8DA 4M77F 1PNJA 4AFUC 4M77B 3PFSA 2E1HA 1U1SA 2Y90A 5I2MA 3MP1A 3S6WA 2VXEA 2NUZA 1PHTA 3CCJA 3CCMA 1PD1A 1SSFA 1OQKA 2BIVA 2M0YA 1MMGA 2QQAA 4MZPA 4JLGA 5GJVB 2FB7A 3VYHB 1KHCA 2F1LA 1VQ5A 3G4SA 1RACB 2MIOA 2LCLA 1SHGA 3EAEA 1VQLA 1VQ7T 3CD6T 1IO6A 2ABLA 4BE1A 5GMKe 4FW1A 2HEQA 1YITT 3MPUB 5CKEA 5EG2A 3SB2A 3UT1A 1QKXA 1Y71A 2X9HA 2V8JA 1ZUYA 1BIBA 4MDXA 4F16A 3IQLA 3CQTA 2DBKA 1UUEA 2EQJA 2JNGA 1H3HA 4C92F 2JXBA 1SEMA 3O5ZA 1GCQC 1VQNQ 1OULA 2KXDA 2M1HA 3CC4T 2K9GA 3H41A 4DBHA 3JCMc 4E6RA 5GAOn 1N8RR 1ZSZC 4F7UE 3EG3A 3CXCS 3VS7A 1NJIR 4J9IA 4ZGEB 2HL3A 2MMPA 1S72T 4M75G 3G6EQ 3OYHA 2KVQG 2EQMA 3DB4A 3RIRA 2CT3A 1A0NB 3EH2A 3TVTA 1OI1A 1F1BB 1VYVA 3OW2A 1JXOA 3CC7T 2CKKA 2BZXA 2DTHA 3JCMQ 1YCYA 2F2WA 4YTLA 3VS5A 3WVDB 2CZ6B 3OYMA 2HBWA 1M90R 1QVFA 1OEBA 1QVGS 3E1SA 1QLYA 2RD1A 3R6NA 2O88A 3VS6A 2ROTA 4XU2A 3OYDA 2A0FB 3QWYA 1W2BS 2FPFA 3QKJA 2DRKA 2HQHA 3EG2A 2VV5A 1GFCA 4AFSC 4OMLA 2JS0A 5C0MA 1VA7A 2NWMA 1Q7YU 2P4TA 3A8MB 4UC4A 3PIOA 1ABOA 4E7LA 4AMCA 2DKGA 1VOMA 2HBPA 4XU0A 2COZA 3EGDB 2RNAA 4QVZA 2KNBB 1YJ9T 5KE3A 2VC8A 2EGEA 5CKHA 1VQKA 1RAFB 2GF7A 3E9GA 2YRDA 2KRSA 3PMIA 4KUIA 1U3OA 1K9MR 2MCNA 4BUGA 1K73R 1T0HA 1U5SA 5HY6A 8ATCB 2OTLQ 2C06A 1ZHIA 3JRZA 2LQ8A 3VV0A 3RKYA 5LJ3d 4QW2A 5FU6B 1G8XA 5GANd 2ATCB 5HKCA 1N8RC 1VQPQ 2RM4A 2LDMA 2RA2A 2XI9A 1NJIC 2AKKA 1OZ2A 3VS4A 1SRMA 3H0FA 3JAME 3A8OB 2P0PA 3OYJA 5GMKl 4FYWB 2WSCE 3DB3A 4EPCA 4RTWA 4DBQA 3REBB 1YI2T 1B34A 2RQRA 2KDSA 2DXUA 2GFAA 5D7UA 3GP8A 2X4YA 4J9EA 5DM7R 4E7IA 4F7UA 3A8GB 2K79A 1RI9A 3VU3C 1K8AR 4ZGJB 2CP0A 1UB4A 5CIUA 2ED1A 4HKEA 3CMAA 2SEMA 4C92C 2LCSA 1M5Q1 2CYZB 1FWZA 4HCZA 3EG9B 5D6YA 3MJXA 5GAMg 2EGAA 3DLMA 2DTOA 5FU7B 3VKIA 1OPKA 1BI2A 3CCLA 2CUDA 3CEYA 2CH4A 5GAN5 3OYCA 1VIEA 1BU1A 3L2QA 4RUGA 5DLOA 1LCKA 3HTRA 2E12A 1WXTA 3OYBA 2ENMA 4M77E 2DXCA 2QA4Q 1KQSP 2QQBA 1GBQA 1HYOA 3KFVA 1KC8U 4EIKA 4EMGA 2DXTA 2XDPA 2DERA 3JCMW 3M0SA 4OVAA 3MEVA 4RMOA 3CBOA 4J6YA 1KD1C 1K9MC 5I22A 1K73C 3CCVA 5LJ3e 5LJ5e 4PLIA 1MNEA 3A5ZB 5GANe 2CGHA 2XICA 2VASA 2HKNA 4RTYA 3MEUA 4OMOA 2ZPEB 3CPWA 1B3QA 4DA4A 1OYXA 1M2VA 4L5GA 4CRIA 4FM4B 3CD6Q 2M02A 2RJFA 4JRKA 3HFNA 3VRZA 1YITQ 1QWFA 3SWNC 4N4GA 5CCAA 1W6XA 2BUDA 2EBPA 2SRCA 4JZ3A 3BDLA 1YJWQ 2AHJB 1WJSA 2EYZA 2AIRB 2GBQA 1Y57A 2PU9B 2FZCB 1XNIA 2BE7D 2PQWA 4M4ZA 1K8AC 1YWOA 4KH1B 4MMKA 5L23A 4XQ3A 5GAMd 2QDYB 2W0ZA 5GAOp 1BYMA 2KSSA 4AT1B 1TUCA 1JB0E 1WJQA 2G6FX 2P84A 2K2MA 2E5QA 4XTUA 3UATA 2XK0A 4XU3A 1CKAA 1C6VX 2HL5C 4LDVA 4P5NA 3CCLQ 3HRSA 4C0GA 1AOJA 4E2FB 1OPLA 3CCRT 2RK1A 4QQ6A 4IUPA 2EW3A 1WZOA 2COYA 3I55A 4LXCA 2VB6A 1VQMA 4HCBA 1AWXA 1VQ6Q 1S72Q 4IUTA 3PVLA 2DL7A 4C8QB 2CS7A 3QUIA 4PJMA 2DJQA 3JCMb 2RHZA 1R0CB 1VQOA 1KFZA 1YN8A 3CC7Q 2ZPGB 1TTHB 4BE0A 3JCMd 4A4EA 1Y0MA 1AEYA 1YWPA 5KYXA 5IHIA 3TSWA 1HK9A 3M59A 4ME7A 4M77A 1D1BA 2R5AA 4JS5A 3TQ7P 2XU8A 4RTVA 3CCUT 3M0TA 2JTMA 1V76A 4PNOA 3TEEA 1OV3A 4ZGDB 2M9UA 1GBRA 2YUPA 4PJLA 4KH0B 1M1KR 1Y7XA 1LOJA 4IIOA 2ZZDA 3FIFA 1NLOC 3ZEHA 2E65A 4C8QG 1YIJT 3OYNA 1BI0A 2LVMA 3QBYA 4M7DD 5IT9E 1YJ9Q 1X69A 1PCXA 1OU8A 2MI6A 1FMVA 2OAUA 3OS2A 3V8KA 1B07A 4J9GA 3VS3A 4KT0E 3A8LB 2F2VA 3GLXA 1YJNT 1VQ4A 2ED0A 2EGCA 1H641 1BKBA 2E6ZA 5AT1B 3CXCP 3UPUA 2YWWA 2HAXA 4OF1A 3ZFJA 5FROA 1KQ2A 2RQVA 2A37A 4RTXA 4ELZC 4E7SA 3PVQA 3WVEB 2KK4A 2C0IA 4C92A 2OTJQ 2RQWA 2O9VA 3NGPA 3P8DA 5KCOA 4PKCC 4Z88A 3FLGA 3CCEA 3CCMT 2PUOB 4PL6A 2HKQB 5GMKj 3LWIA 3CCJT 2EIFA 3VJPA 3MCAB 1WQWA 1SPKA 3GNFB 3I35A 1QVGP 3OY9A 4AFZC 1Z9ZA 3G4ST 2J6FA 3URGA 3VS2A 3JCMe 2LJ3A 4M7AD 1M1FA 2KE9A 3GNGA 2DAQA 4Y91A 2FHDA 2F5KA 4PJJA 5GAN3 4X34A 3MP8A 1Q81R 3V8JA 4LE9A 1WA7A 2CP5A 4PJOF 2MK5A 3CCSQ 1K1ZA 2DEUA 3G71Q 2CSQA 4RCBA 4PJOB 4DBFA 1ZUKA 4C92D 1Q86U 2EQKA 3HSBA 2VKNA 4XTVA 4DOVA 4FL6A 2EJ9A 2V8KA 1M1KC 2M16A 2EYYA 3RESA 4A4KA 1E7OA 5GMKh 4AG2C 3LGFA 3ME9A 1BIAA 1QVPA 1QMCA 4JJBA 4C0FA 2FG0A 3QHSA 3EFOB 1D0XA 3HHTB 2QGGA 2RB6A 1OU9A 2COWA 2QEXT 2JJ9A 4BI3A 3QO3A 1ZQ1A 2IG0A 1JJ2S 2O31A 4FYVB 4KGZB 3OMCA 2CZ0B 5CKDA 3EGDA 1D0YA 4HCKA 3G1JA 1M1GA 1VQNA 3F70A 1PKTA 1WXUA 2LT1A 3VS0A 4X9CA 1RLQC 5IXFA 2YXYA 1NBEB 2XDBA 4F04B 3J81E 2QG9B 4JRIA 1D1AA 3H9NA 4KULA 3G6EA 3HKSA 3TSZA 3M0UA 3PT9A 4L59A 2PVOB 1X6BA 2K5IA 3JB9F 1UGVA 4IIMA 2ZAEA 4M78F 2RQUA 1FMWA 3OYKA 2AK5A 4A4GA 4QKUA 1RAGB 4E7KA 4M78B 1Q81C 2LNHB 4CI0C 1ZA1B 3LX7A 3C12A 1WHKA 3I56T 4KGVB 2LMJA 3NTIA 4ESRA 4KUDK 2KGTA 3FDRA 4LNPA 4VUBA 1QWEA 1I0CA 1PWTA 1X2QA 2YHTA 2RN8A 1VQKT 4LN2A 3ULRB 1WHGA 4C8QE 4M75F 4OB1B 3CCRQ 4OP0A 3V8LA 4HT9A 4M75B 3V7RA 4EMHA 4X9DA 2XD0A 1I8FA 3EG9A 3LLRA 2A36A 4EDUA 1ZUUA 1M4ZA 1YP5A 4FT4A 1OX8A 4FU6A 5KH6A 4EMKB 2LNVA 3M57A 3RMQA 2LJ1A 1C0MA 1UG1A 4LD6A 2DL5A 2KXCA 1QP2A 1YBYA 2CP3A 3JB9G 4M78G 1PSEA 4M7DG 1MV0B 2OTLA 2E3HA 2PVGB 1V1CA 1I4K1 3BFMA 1SRLA 1VQ8Q 1UJYA 4C5IA 4CC7A 1M90U 4CC3A 1VQPA 2KQWA 1WNLA 2D6FA 1Y07A 5LJ3g 5ECAA 5LJ5g 4PJOC 2LQWA 4WCIA 2NUPB 1TSFA 1WLPB 4GLKA 5GANg 4AFQC 3CMAT 2QXFA 2FZGB 4J6XA 5IXBA 3OYFA 2XG8D 1ZA2B 2IPOB 3CXCA 2PTKA 1OX9A 1YJNQ 2RMOA 1UGQB 5LJ3j 2D8HA 4HVUA 4Z8AA 2FO0A 1RI0A 4M7AG 1SF9A 4KGXB 4PLLA 2HZYA 5GANj 2NYSA 1PKSA 4F17A 2X51A 1TH7A 1KJWA 1UGSB 4FSXA 4AG1C 2DVJA 1GFDA 2HNIA 1GRIA 3EGXB 1KSWA 2GCXA 3QWXX 2JVVA 5M9OA 2LX7A 4OMNA 3OS5A 2L89A 3OYAA 1I5OB 2C0TA 5KCHA 1EZZB 1UHFA 2ZPFB 1BI3A 4Z02A 4C5EA 2KRMA 4Q5WA 1W2BA 2V8IA 2QA4A 1N9RA 3M4YA 1R8OB 2EKOA 4FSSA 1QCNA 1M8VA 3QYHB 2RHYA 1KD1R 2LRQA 3PGGA 4PJOE 3VRYA 4C8QA 2GGRA 3BW1A 3JCMX 4M77C 4PFZA 3N5BB 5GAN8 5LJ3h 3OS0A 1VUBA 5LJ5d 6AT1B 5GANh 4BDYA 3E19A 1X43A 2F2XA 3JB9J 4C0DB 4MZMA 4FW2A 1RLPC 2R58A 3LYIA 2DETA 2XKOC 2LX9A 3CD6A 2DD5A 1LNXA 1B7TA 5GMKm 1VYTA 1XQHA 1YITA 3QYGB 1Q7YR 4N0AA 5D6WA 5CR2A 4M75C 4PJNA 1X6GA 1PG5B 2YRVA 1O9SA 5CO7A 1VQ9Q 1G83A 1YJWA 2D1XA 4N4HA 1LVKA 2NUTA 1M2OA 4Z89A 2L5QA 5IN1A 2QEXQ 1VQMT 4EMKC 3QZ9B 3M4GA 2FPDA 2B86A 1YHQT 2ZGWA 1PSFA 1JO8A 4E7HA 5GAMf 4D6WA 1VQOT 1K76A 5J39A 2ECZA 5CKFA 3CCQT 2ZPBB 5KYWA 4PK4A 1ZBJA 2MYSA 3E2UA 2QYZA 3OBYA 2DRMA 1VQ6A 1GCPA 4J9HA 3CC2T 2KAFA 1S72A 2D0NA 4M78E 3C95A 2J06A 3NTKA 2D9TA 2BZ8A 4JJDA 1MNDA 2LCCA 1IRXA 2PVDB 1UGRB 3GBQA 4RTTA 5GAMj 3CC7A 2K5LA 1KQ1A 2IIMA 3CMET 4JZ4A 3E9FA 4LDWA 3UA6A 3I56Q 2MAMA 2RHIA 1XJWB 3P8BB 4OGCA 4OB3B 3OYEA 1WHHA 2XMFA 4PFOA 2EPDA 2GNCA 3CPWS 5GAN6 3JCMg 4M75E 1WQ7A 3TCJA 4NL3A 2ZPHB 2DL4A 2OI3A 1HXDA 2KY9A 4LUEA 1VQ7Q 3RDVA 3S3OA 3TREA 1WFWA 3INZA 1Q7YC 3U23A 4PJOA 3X26B 4C5GA 4LUDA 1JJ2P 4MDWA 1AT1B 2BKDN 2DXBA 5DY9A 1YNZA 3V7CA 3CCET 1YJ9A 1KC8R 3SFMA 2A28A 3BY7A 2X4XA 5A2QE 4ZTJA 3QDFA 3QG1A 5KE2A 3MKDA 3RNJA 3OQ5A 5GAMh 1K4US 2AKLA 4FYYB 4JS4A 1NLPC 4IKFA 4HXJA 3NFCA 3EFOA 1BB9A 3CC4Q 1W1FA 5FU6C 1JEGA 4GLMA 2OTJA 2E70A 2YUOA 2EVRA 1I07A 1M3AA 2HSPA 3H0HA 3M9QA 2EJGA 4C8QF 2K4YA 1IGUA 3JB9H 1G5VA 4O6JA 4J9FA 5C6SA 1AVZC 2MPXC 1Q82U 5A0DA 4ZTFA 2X3WD 1TU0B 1ZBXA 1QKWA 1WHMA 1E6HA 1CSKA 4RG8A 3QSUA 1OOTA 1PC0A 3JCMh 2KMTA 1N6AA 2EWNA 2EQIA 2E5KA 1X27A 2VGMA 1QQJA 2EFIA 4JJCA 1UE9A 2FVUA 1KK7A 2K3XA 2M0OA 3RKWA 3QJ6A 3CCSA 5GJWB 3G71A 4M78A 4JRQA 2QTXA 3HRTA 5EC7A 1FMKA 3A8HB 1TWBA 1M3CA 2WSEE 2EQUA 2DO3A 2HDAA 1T3LA 4XTZA 5FU7C 3BE3A 1VQNT 1IGQA 3H8ZA 3VUBA 2RJEA 3UF4A 3EH1A 1AZGB 4XTYA 1TXQA 2O4XB 2E10A 3HL8A 3BDUA 2YSQA 1NPRA 1QW1A 2RK2A 4XK8E 4M75A 1KC8C 1NYGA 2DILA 1FX7A 2RJDA 2YRCA 1ARKA 1M9SA 4J8OA 5IHKA 1B34B 5FRMA 4J6WA 3LH0A 3PMTA 2J05A 1VYUA 3G6ET 4F7UB 2KBTA 2QTVA 4EMKA 4M77D 1D1CA 5KYYB 2OJ2A 4XAXB 4X1VA 3CBMA 4J9CA 1ZX6A 2XHCA 2RH2A 4IUUA 4QQGA 3H6ZA 4BI8B 1NM7A 3RKXA 1G3SA 1MGQA 3JCMV 4QVDA 2FEIA 2K57A 3OW2P 2YLCA 2EAYA 3EHQA 1O75A 3EG1A 2L0AA 3LGLA 1VQ5T 1JBMA 2X3XD 3LH5A 1RAHB 2NUPA 1YI2Q 1VQLT 1SKUB 4NS5A 1KHIA 1SSHA 2A7YA 5KYUB 3FRNA 2DTIA 4MMLA 2Y4XA 2QASA 1WHJA 1Y96B 1IHVA 2A08A 4GY5A 5I2SA 3A98A 1YHQQ 4F7UG 4DEXA 3NHNA 5CQXA 2L2PA 1CKBA 3EG0A 4J9DA 4TVRA 2I2LA 2OX7A 3CCQQ 2CSIA 2PZ1A 3FC3A 2P0KA 4V2SA 4JUVA 1S1NA 4J5YA 3CCRA 1KQSA 4RTZA 2KT1A 2G3RA 4A63B 2FRYA 3CC2Q 1ZSZB 3EGXA 1UEBA 2DF6A 5KYNA 5DLQE 5GAOq 3L1AA 1VQPT 4MZTA 2DIGA 2EKHA 4HVWA 1BBZA 4C8QC 2DEQA 3OS1A 2F5TX 3C4SA 3T9NA 4R55A 1TG0A 1MUZA 3CMEQ 4JDSA 4HA8A 2M51A 1D09B 4Y28E 2MWPA 2HQEA 5CAIA 1Q95G 4OMFB 2LC4A 1VQ8A 1IB8A 1QCFA 4DBRA 3OMGA 3DLLA 1IXDA 4XU1A 4N0AC 3P8HA 3UA7A 2CDTA 2ESWA 3JV3A 5CKBA 1T3SA 1OZ3A 3OYIA 1C1AA 3PIPA 5J3BA 1MMAA 5FLXE 1H3ZA 1W4SA 1HD3A 3OB9A 3UDCA 4JRPA 3RR6A 2LT4A 3QXEB 1SG5A 4M7DF 1BCOA 2DD4A 1IREB 2EJFA 2V1RA 2P0QA 1WHLA 4M7DB 1YJNA 1RABB 1TUGB 2E6NA 4PFPA 2JT4A 2QA4T 3VUZA 2GFUA 3OYYA 1AWOA 3RBBB 1M30A 1I1JA 4DQ2A 3KBGA 2DZ9A 2KI7A 1JU5C 1PM3A 2WACA 4KBMB 1XTDA 2DA9A 5D6XA 2VGNA 1RADB 2JMCA 1N8RU 3M0RA 2RPNA 5CQYA 1NZ9A 2WSFE 4J7IA 1ZSGA 3CPWP 3ASKA 1NJIU 2P4RA 3M0QA 1IZ6A 4M7AF 3MHXA 5LL6S 3X24B 2EYXA 3RMSA 3PTAA 1BK2A 2RQTA 4M7AB 4XTXA 2VVKA 4OB2B 1X2KA 2JM8A 4FIBA 1BCMA 1YJWT 1QCOA 2LQKA 3HPWA 1D3BB 3CCUQ 2K2VA 1U06A 5LJ3f 5LJ5f 1KIKA 1Q86C 2D8JA 3EGUA 4M77G 5GANf 2QQ9A 4C92B 2BZYA 2CP7A 5I21A 4HVVA 1R0BG 3X25B 3S3NA 2FRWA 2DIQA 2KYMA 3SD4A 1G3YA 3M58A 5AYFA 4R56A 2DVEA 1UGPB 1YIJQ 1VQ9A 3CCLT 3HP9A 3OW2S 2GTJA 2O2OA 2JW4A 1QVFS 1AD5A 2QEXA 1VQ6T 5LJ5j 3L2UA 3X20B 4J83A 4ELYC 3J7AF 1M8MA 5GAN2 2E64A 4D8KA 1KD1U 3SDZA 1K9MU 2CZ7B 1K73U 2O9SA 3CCVT 2L3RA 3DKMA 1YFNA 5HCKA 2KRNA 1NYFA 3CCMQ 3CCJQ 1QVGA 2DNUA 3MEWA 4JJNK 3R6OA 1WX6A 4K11A 4C92G 5IH2A 1VIFA 4E7ZA 1VQ5Q 3G4SQ 1MV3A 2RHUA 3SWNB 1VQLQ 2QQRA 1N27A 4BY6B 3M53A 2YDLA 4BACA 1IHWA 4IURA 4J7FA 4M78C 4A4HA 2QDLA 4B6MA 5LJ5h 4M7DC 3I56A 2FZKB 3QIIA 2L8DA 3FEOA 4A4FA 1AWWA 3SHWA 2GTOA 1K8AU 2HMAA 3EFRA 2YT6A 2LJ0A 1VQ7A 3RERA 2BE9B 2K3YA 2RI2A 1JQQA 4FCYA 3AHUA 4XTWA 2EYWA 2DYIA 4HT8A 3V7SA 1ACMB 1TOVA 1AHJB 4RTUA 5GAOm 5GAN7 1UECA 2AZSA 2OTJT 2JTEA 4GBQA 4ANJA 3FB9A 2QGFB 3I55T 4C8QD 5GAOl 2DX1A 4JPBW 5J26A 1Z9QA 2CP2A 3MEAA 2O4XA 4A54A 5FWBA 4M7AC 2XDDA 3M54A 2DBMA 1M3BA 1YCSB 2RI5A 3CC4A 2NLUA 4DEYA 2IVWA 1V29B 4B9XA 3OA6A 1M90C 2Y4YA 2YUQA 1RAIB 2LTOA 2H3EB 5KYYA 1I81A 3LW5E 3OBWA 5CK9A 2L3SA 2JS2A 1AWJA 3CCST 3G71T 4M7DE 5A0LA 2QAZA 3ZBDA 1GL5A 3JB9I 1BI1A 4WF2A 3SEMA 1RUWA 1AZEA 1UDLA 3Q1JA 1PRMC 3VYGA 3THKA 9ATCB 3JCMf 2MF2A 2X4JA 4LDXA 5GAOr 2RF0A 2JOYA 4RCCA 2CT4A 2E3IA 1PD0A 5KYUA 2LP5A 1WGSA 1VQKQ 3UWNA 4KRTA 1Y96A 1VQ4T 1RAAB 4BB7A 1DJ7B 3TU4K 2D0QB 4JLIA 3QJYA 2H8HA 2DYBA 2A3LA 2QK0A 1WPYA 3O8VA 4M7AE 1GCQA 2JMAA 2ZCFB 2F69A 3L2VA 1WI7A 1RAEB 3C0CA 5FRNA 2J6KA 3KUFA 3HRUA 3L2RA 1TS9A 3GPLA 1ZSZA 3WXMB 1NEGA 4DOWA 2JTFA 5FWCA 4N4IA 2DPPB 2JZ2A 4BY6C 1HSQA 3JSCA 4C92E 4WTOB 4ORZA 4BDZA 4LDYA 2C0OA 2YUNA 3PE0A 3REAB 3AT1B 2CZ1B 4LD9K 3OSVA 4C0ZA 2KR3A 4ZN1A 2RO0A 2K3BA 3A1PA 4C0DC 4PJOD 1J3TA 5HK3A 3CMAQ 2HCKA 2KT8A 3JCMP 1WXBA 4R0KA 1G2BA 3I9QA 1G3WA 3ER0A 3LWHA 2Z0WA 3EFSA 3OYGA 4BD3A 1YI2A 2CP6A 1U1TA 1M1KU 1NG2A 3FJPA 2VWFA 4L6V5 3EHRA 3META 4FYXB 1WDXA 7AT1B 1UFFA 2YLBA 4NL2A 2HD0A 4OMPA 2DJZA 1YHQA 8AT1B 2KYBA 2LQNA 1H92A 1D0ZA 1FXXA 1KG1A 2DFUA 4M7DA 3X28B 5HK0A 3CCVQ 3CCQA 1LJOA 2DK3A 4OMMA 5CVIA 1N9SA 2RJCA 2ZPIB 3D7SB 4QQDA 2XIDA 3JCMJ 1MMDA 1ZLMA 2RI3A 3ZL7C 2E41A 3CPFA 1WJRA 3CC2A 2L3PA 4RG2A 2DMOA 2PNIA 1VQ8T 4FT2A 1XOVA 1WIEA 1M27C 3M56A 2K5FA 5IAYA 2DLPA 1MMNA 1Q82R 2DE0X 5I11A 2LZ6B 1EIFA 2NUTB 2CUBA 4F7UF 2FYKA 3CMEA 3RUXA 2K7AA 4J9BA 4ATOA 4NOYA 3NPFA 4QT7A 2KEAA 4F14A 4C5HA 5FW9A 3JB9D 2B8AA 4M78D 2EYQA 3OSSC 2W10A 3L2ZA 3M5AA 3VS1A 4M7AA 5GAMe 1P92A 3MO8A 4B9WA 4OGEA 1JRIA 2JN0A 1Q81U 4RKUE 4II1A 4E47A 4O5VA 2J6OA 3CBPA 5GAN4 1HJDA 2I0NA 2QQSA 1QP3A 2H3JA 2V26A 5KYWB 5IHNA 1K9AA 2JUFA 1QVFP 1D3BA 4CC4B 1K0XA 2MOXA 1UTIA 1RL2A 2K6DA 4M75D 2VUBA 4QVCA 2HQXA 2E4HA 4IUQA 4E7JA 2RHXA 3I55Q 1JXMA 4BI4A 3GOXA 3I5RA 1K0SA 1VQMQ 1NPPA 4A53A 3G7ZA 2DZCA 1UHCA 3NMZC 1GXIE 2GQIA 3L42A 2VYTA 2X35A 3M0PA 1VQOQ 3NTHA 1W2BP 2AZVA 3MP6A 3J80E 1SHFA 2FL7A 3KXTA 1M2VB 1NEBA 1EX4A 2GQVA 1W70A 1R77A 4ZNXA 1X75C 1KQSS 1TUDA 2OTLT 2VXFA 3S3MA 2HSEB 1EFNA 1LPLA 1T0JA 1PRLC 1MHNA 2ROLA 4OMQA 3QPHA 1ABQA 2CH4W 2JM9A 3I5SA 4CC2A 1Q82C 4BE2A 4Y92A
chains in the Genus database with same CATH topology
4D6WA 1VQOT 2DIQA 3SD4A 5J39A 1G3YA 2ZPGB 3M58A 5AYFA 4R56A 4BE0A 5CKFA 3JCMd 3CCQT 2ZPBB 4A4EA 2DVEA 4ZN3A 1UGPB 3PNWC 3QZ5B 3SWNA 1VQ9A 3CCLT 1VQ9T 3HP9A 1HK9A 3M55A 3OW2S 3M59A 4ME7A 2QI2A 1X6OA 3OBYA 3HFOA 4M77A 3L2WA 2R5AA 4LDUA 4JS5A 3CC2T 3CCLA 1VQ6A 1QVFS 2KAFA 3CCUA 1S72A 2QEXA 1VQ6T 5LJ5j 4M78E 2XU8A 3C95A 3CCUT 3NTKA 1U8RA 2JTMA 3L2UA 3X20B 4PNOA 4J83A 2D9TA 3TEEA 1JJ2A 4ELYC 3J7AF 4ZGDB 1X01A 2M9UA 2LCCA 1NE8A 2PVDB 2O01E 1UGRB 5GAN2 5GAMj 2E64A 3GF5A 1Y7XA 1KD1U 3CC7A 5L8RE 3SDZA 1K9MU 2K5LA 2PUKB 1KQ1A 2CZ7B 2R57A 3CMET 1K73U 1LOJA 3CCVT 4IUVA 2L3RA 3DKMA 5GMKi 3OYLA 3E9FA 2ZZDA 3FIFA 4LDWA 4PJOG 1YIJA 3ZEHA 2E65A 2MAMA 2RHIA 4C8QG 3P8BB 3OYNA 1BI0A 2LVMA 3QBYA 4OGCA 4OB3B 5A0GA 3MEWA 3OYEA 1QVGA 4JJNK 5IT9E 4M7DD 3R6OA 3CPWS 4C92G 2MI6A 3JCMg 5GAN6 4M75E 2R5MA 1WQ7A 3TCJA 2X4WA 2OAUA 3OS2A 1VIFA 3V8KA 4HCCA 4KT0E 3A8LB 4NL3A 2ZPHB 1G3TA 3GLXA 1YJNT 2MWOA 1I5LA 1HXDA 3C94A 1VQ4A 2KY9A 2RHUA 1H641 3SWNB 1BKBA 2E6ZA 2QQRA 1N27A 4OB0B 3UPUA 3GIBA 3S3OA 2HAXA 3TREA 3QDRB 4M77F 4OF1A 3INZA 3ZFJA 4BY6B 1Q7YC 5FROA 3M53A 1KQ2A 3X26B 4PJOA 4M77B 4C5GA 4BACA 3PFSA 2E1HA 4ELZC 4MDWA 1U1SA 2Y90A 3WVEB 2KK4A 4IURA 4J7FA 4C92A 2BKDN 5I2MA 3MP1A 3S6WA 2DXBA 3P8DA 4M78C 4A4HA 2VXEA 5LJ5h 5KCOA 4PKCC 3I56A 5DY9A 1SSFA 3CCJA 3CCMA 3FLGA 3CCEA 4M7DC 2BIVA 3QIIA 2PUOB 4PL6A 3CCJT 3V7CA 5GMKj 3LWIA 3CCMT 2EIFA 1YJ9A 3CCET 3VJPA 2QQAA 3SFMA 3BY7A 2X4XA 4MZPA 5A2QE 4ZTJA 3QG1A 3MCAB 4JLGA 2FB7A 1WQWA 2L8DA 3FEOA 3VYHB 4A4FA 1KHCA 5KE2A 3OQ5A 5GAMh 1K8AU 3EFRA 3GNFB 1VQ5A 4JS4A 3OY9A 3G4SA 1VQ7A 3RERA 2LCLA 3EAEA 3G4ST 1VQLA 4IKFA 3URGA 1VQ7T 3CD6T 3JCMe 2K3YA 3NFCA 4M7AD 1M1FA 2RI2A 3GNGA 2DAQA 4Y91A 4BE1A 2FHDA 5GMKe 2F5KA 3AHUA 5GAN3 4XTWA 1YITT 4X34A 5CKEA 4HT8A 3V7SA 3MP8A 5EG2A 3SB2A 1AHJB 5FU6C 3UT1A 3V8JA 1Y71A 2V8JA 5GAOm 2E70A 5GAN7 2OTJA 1BIBA 4MDXA 2OTJT 3FB9A 3M9QA 4PJOF 3I55T 4C8QD 5GAOl 2EJGA 4C8QF 2K4YA 2EQJA 4RCBA 2JNGA 5J26A 4PJOB 3JB9H 4C92D 1Q86U 2EQKA 4C92F 3HSBA 1G5VA 3MEAA 4O6JA 4XTVA 2O4XA 4A54A 4DOVA 5C6SA 4FL6A 2EJ9A 1Q82U 4M7AC 5A0DA 4ZTFA 2XDDA 3M54A 2V8KA 1ZBXA 1M1KC 2M1HA 2M16A 2RI5A 3CC4A 4RG8A 2NLUA 2IVWA 3QSUA 3JCMh 1V29B 2KMTA 3RESA 3CC4T 1N6AA 2EWNA 4A4KA 5GMKh 4B9XA 3OA6A 2VGMA 3LGFA 3JCMc 1M90C 5GAOn 3ME9A 1BIAA 2EFIA 2Y4YA 1QVPA 2FVUA 2K3XA 4F7UE 2M0OA 2LTOA 4C0FA 3RKWA 3QHSA 1I81A 3LW5E 3OBWA 3CXCS 3HHTB 5CK9A 4ZGEB 3QJ6A 3CCSA 2RB6A 3G71A 4M78A 3CCST 3G71T 4JRQA 2MMPA 2QTXA 3HRTA 4M75G 4BI3A 3QO3A 2QEXT 1S72T 5A0LA 3A8HB 4M7DE 1ZQ1A 2IG0A 3OYHA 1JJ2S 2KVQG 2EQMA 3ZBDA 3DB4A 3JB9I 3OMCA 2CZ0B 2WSEE 3RIRA 1BI1A 4WF2A 5CKDA 2EQUA 2DO3A 1M1GA 1VQNA 3F70A 4XTZA 1OI1A 5FU7C 1VQNT 3H8ZA 3OW2A 3VUBA 3CC7T 2CKKA 2LT1A 2RJEA 2DTHA 3Q1JA 3JCMQ 1YCYA 3WVDB 4XTYA 4YTLA 3VYGA 2CZ6B 4X9CA 2O4XB 3OYMA 1QVFA 2E10A 3HL8A 3JCMf 1QVGS 3BDUA 2MF2A 2X4JA 3E1SA 4LDXA 1NPRA 1QW1A 2RK2A 2RD1A 2JOYA 4M75A 4XK8E 5GAOr 4RCCA 1KC8C 2RJDA 4XU2A 1FX7A 3OYDA 2XDBA 1M9SA 4J8OA 3J81E 1B34B 5FRMA 1W2BS 1WGSA 4J6WA 3QKJA 4JRIA 3UWNA 3LH0A 4KULA 3PMTA 3G6EA 1Y96A 1VQ4T 3HKSA 3G6ET 2VV5A 4F7UB 4BB7A 1DJ7B 4L59A 3PT9A 4M77D 4EMKA 2PVOB 5C0MA 2D0QB 2K5IA 3TU4K 4JLIA 3QJYA 4XAXB 1Q7YU 4M78F 3CBMA 3OYKA 3JB9F 2A3LA 4A4GA 1WPYA 2P4TA 3A8MB 4UC4A 2XHCA 3PIOA 4E7KA 2RH2A 4IUUA 4M78B 3O8VA 4E7LA 1Q81C 4M7AE 4QQGA 3H6ZA 4BI8B 4CI0C 2DKGA 3RKXA 3LX7A 1G3SA 1MGQA 2ZCFB 3JCMV 4QVDA 2HBPA 2F69A 3C12A 2K57A 3I56T 4XU0A 3L2VA 5FRNA 3KUFA 1VQOA 4QVZA 1YJ9T 2YLCA 3NTIA 2EAYA 3HRUA 3L2RA 5KE3A 3GPLA 2VC8A 4KUDK 3FDRA 4VUBA 5CKHA 3WXMB 1VQKA 1O75A 2GF7A 2JTFA 2YHTA 4DOWA 3E9GA 4N4IA 2DPPB 1VQKT 3PMIA 4KUIA 3LGLA 2JZ2A 4BY6C 4BUGA 1VQ5T 4C8QE 1JBMA 3JSCA 4M75F 4OB1B 5HY6A 1VQLT 4NS5A 4C92E 2C06A 1ZHIA 4OP0A 3JRZA 2LQ8A 3V8LA 4HT9A 4M75B 3V7RA 4BDZA 4LDYA 4EMHA 3VV0A 1KHIA 3RKYA 4X9DA 5LJ3d 2A7YA 4QW2A 5FU6B 2XD0A 2CZ1B 1I8FA 4LD9K 3FRNA 2DTIA 3OSVA 4MMLA 4C0ZA 1YIJT 3LLRA 2Y4XA 5GANd 5HKCA 4EDUA 4ZN1A 1N8RC 2RO0A 1Y96B 1M4ZA 2RM4A 4GY5A 5I2SA 4C0DC 2LDMA 2RA2A 2XI9A 4FU6A 4FT4A 5KH6A 4PJOD 4EMKB 2LNVA 5HK3A 1NJIC 1OZ2A 4F7UG 5CQXA 3M57A 3JCMP 3JAME 3RMQA 3A8OB 4TVRA 2I2LA 4LD6A 2P0PA 1QP2A 1YBYA 1G3WA 3ER0A 3OYJA 3LWHA 5GMKl 3JB9G 2WSCE 3DB3A 4M78G 3FC3A 2P0KA 1PSEA 3EFSA 4JUVA 3OYGA 4M7DG 4V2SA 4BD3A 1YI2A 4EPCA 4J5YA 3CCRA 2OTLA 1KQSA 1YI2T 1U1TA 2PVGB 1M1KU 1B34A 2G3RA 2KDSA 4M7AA 2DXUA 1I4K1 3BFMA 3FJPA 3JCMJ 2GFAA 4L6V5 3META 3GP8A 2X4YA 5DM7R 1UEBA 4C5IA 1M90U 2YLBA 4NL2A 3A8GB 4F7UA 2KQWA 4E7IA 1VQPA 1WNLA 5DLQE 2D6FA 5GAOq 3L1AA 3VU3C 4MZTA 1Y07A 2DIGA 1VQPT 2HD0A 5LJ3g 5LJ5g 4PJOC 2DJZA 1YHQA 4C8QC 4ZGJB 4GLKA 2DEQA 1UB4A 5CIUA 3OS1A 2F5TX 3C4SA 4HKEA 3T9NA 5GANg 4R55A 3CMAA 4C92C 1M5Q1 2CYZB 1FXXA 3CMAT 2QXFA 1KG1A 4M7DA 3X28B 5HK0A 1FWZA 4HCZA 5D6YA 5GAMg 3CCQA 1LJOA 2DK3A 5CVIA 1N9SA 2RJCA 3DLMA 2ZPIB 4JDSA 2DTOA 2XIDA 4HA8A 4QQDA 5FU7B 4Y28E 1BI2A 3VKIA 2MWPA 2HQEA 3CEYA 4J6XA 5CAIA 5GAN5 4OMFB 3OYCA 1VIEA 2RI3A 2XG8D 3OYFA 2LC4A 5DLOA 3L2QA 2E41A 3CPFA 1VQ8A 1WJRA 2E12A 3CC2A 4RG2A 3CXCA 3OYBA 1VQ8T 4FT2A 4M77E 1XOVA 2DXCA 3OMGA 3DLLA 1UGQB 5LJ3j 4XU1A 2QQBA 3M56A 1RI0A 2K5FA 5IAYA 4M7AG 4N0AC 3P8HA 4PLLA 5GANj 1KC8U 4EMGA 2DXTA 2XDPA 3JCMW 4OVAA 3MEVA 4RMOA 3CBOA 4J6YA 5CKBA 1TH7A 1EIFA 1OZ3A 1UGSB 3OYIA 4FSXA 1KD1C 1K9MC 4F7UF 3PIPA 2FYKA 2HNIA 3RUXA 5J3BA 3CMEA 5FLXE 3CCVA 1K73C 1H3ZA 1W4SA 5LJ3e 5LJ5e 4ATOA 4NOYA 4PLIA 3OB9A 3A5ZB 2GCXA 2JVVA 5M9OA 3UDCA 4JRPA 4C5HA 5GANe 2CGHA 3OS5A 3JB9D 2B8AA 2L89A 2EYQA 2LT4A 2XICA 3OSSC 4M78D 3OYAA 3L2ZA 3M5AA 3MEUA 3QXEB 4M7DF 2DD4A 5KCHA 1IREB 2EJFA 2ZPEB 3CPWA 2ZPFB 5GAMe 1P92A 1BI3A 3MO8A 2P0QA 4OGEA 1JRIA 2JN0A 4Z02A 4B9WA 4RKUE 4C5EA 4DA4A 1Q81U 4M7DB 4II1A 4Q5WA 4E47A 1OYXA 4O5VA 1YJNA 1W2BA 2V8IA 2QA4A 1N9RA 2E6NA 3CBPA 1R8OB 3M4YA 4L5GA 5GAN4 2QA4T 3VUZA 2QQSA 1QP3A 2GFUA 2H3JA 3OYYA 4FM4B 2EKOA 4CRIA 2RJFA 4JRKA 1M8VA 3HFNA 3QYHB 2JUFA 3SWNC 1D3BA 4N4GA 2RHYA 4DQ2A 2LRQA 3KBGA 3PGGA 2DZ9A 1RL2A 5CCAA 4PJOE 4C8QA 2BUDA 3BW1A 4M75D 2VUBA 3BDLA 4M77C 2WACA 4QVCA 3JCMX 2AHJB 2HQXA 3N5BB 1WJSA 4KBMB 5GAN8 4IUQA 4E7JA 5LJ3h 1XTDA 3OS0A 2PU9B 2RHXA 1VUBA 5LJ5d 5D6XA 2VGNA 1XNIA 4BI4A 5GANh 3GOXA 1NPPA 4A53A 4BDYA 2PQWA 3E19A 2DZCA 3G7ZA 3JB9J 4C0DB 1N8RU 4MZMA 5CQYA 1K8AC 1NZ9A 2R58A 3LYIA 4MMKA 1GXIE 4XQ3A 5GAMd 2XKOC 2LX9A 2QDYB 3CD6A 2DD5A 2VYTA 2WSFE 3L42A 3ASKA 4J7IA 5GAOp 1NJIU 1BYMA 1LNXA 2X35A 1IZ6A 2KSSA 1JB0E 5GMKm 4M7AF 1WJQA 3NTHA 1XQHA 1YITA 3MHXA 3QYGB 5LL6S 3X24B 3MP6A 3RMSA 3PTAA 3J80E 2E5QA 4N0AA 4M7AB 4XTUA 2XK0A 2FL7A 4XTXA 5D6WA 5CR2A 4OB2B 4XU3A 4M75C 3KXTA 2YRVA 4LDVA 1O9SA 4P5NA 2GQVA 5CO7A 3HRSA 4C0GA 1KQSS 1X75C 4FIBA 1YJWA 3CCRT 4N4HA 2VXFA 3S3MA 1YJWT 2OTLT 2RK1A 4QQ6A 4IUPA 2LQKA 3I55A 1MHNA 3HPWA 1VQMA 4HCBA 1D3BB 3QPHA 2L5QA 5IN1A 2K2VA 1VQMT 4IUTA 4EMKC 5LJ3f 5LJ5f 1Q86C 4C8QB 2CS7A 3QUIA 3QZ9B 4M77G 5GANf 2QQ9A 1Q82C 3M4GA 4C92B 1YHQT 2ZGWA 3JCMb 2RHZA 4BE2A 5I21A 1PSFA 4E7HA 3X25B 3S3NA 5GAMf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LX7 A;  2DIQ A;  3MP8 A;  3SD4 A;  2XDP A;  5J39 A;  3UT1 A;  3L2V A;  4OVA A;  3MEV A;  4BE0 A;  5FRN A;  3KUF A;  1OZ3 A;  4QVZ A;  4A4E A;  3OYI A;  3NTI A;  3PNW C;  5KE3 A;  3L2R A;  3FDR A;  3M9Q A;  1H3Z A;  2GF7 A;  2JTF A;  4PLI A;  3E9G A;  3OB9 A;  4N4I A;  3PMI A;  2EQJ A;  3LGL A;  5J26 A;  2JZ2 A;  5M9O A;  4C5H A;  2B8A A;  2EQK A;  1G5V A;  2L89 A;  3OYA A;  3MEA A;  3L2W A;  2O4X A;  2R5A A;  3MEU A;  5C6S A;  4FL6 A;  4NS5 A;  5KCH A;  3MO8 A;  4B9W A;  3NTK A;  4BDZ A;  3L2U A;  4ZTF A;  4Z02 A;  4C5E A;  2D9T A;  4II1 A;  4Q5W A;  4QW2 A;  1OYX A;  2M1H A;  2E6N A;  2M16 A;  2RI5 A;  2NLU A;  2LCC A;  3LLR A;  4CRI A;  2QQS A;  2GFU A;  4EDU A;  2EKO A;  2RO0 A;  4B9X A;  2RJF A;  4GY5 A;  3OA6 A;  2LDM A;  3LGF A;  4FU6 A;  2R57 A;  3ME9 A;  5KH6 A;  2EFI A;  4N4G A;  2K3X A;  2RHY A;  4IUV A;  1OZ2 A;  2L3R A;  2M0O A;  2LRQ A;  2LTO A;  3OYL A;  3E9F A;  3ZEH A;  2BUD A;  2RHI A;  3OYN A;  2LVM A;  3QJ6 A;  3BDL A;  3QBY A;  2WAC A;  4LD6 A;  3MEW A;  3OYE A;  2HQX A;  3OYJ A;  1WJS A;  4IUQ A;  4E7J A;  2R5M A;  3DB3 A;  3FC3 A;  2P0K A;  2X4W A;  3OS0 A;  2RHX A;  3OYG A;  3OS2 A;  4BD3 A;  2IG0 A;  3OYH A;  5D6X A;  2EQM A;  1XNI A;  3GOX A;  3DB4 A;  2G3R A;  3OMC A;  2MWO A;  2PQW A;  4BDY A;  2EQU A;  2GFA A;  2RHU A;  3F70 A;  2QQR A;  3MET A;  1OI1 A;  2R58 A;  1N27 A;  3LYI A;  2X4Y A;  3S3O A;  3H8Z A;  4C5I A;  2CKK A;  4E7I A;  2RJE A;  2VYT A;  3L42 A;  3ASK A;  5FRO A;  3Q1J A;  2X35 A;  2DIG A;  1WJQ A;  2O4X B;  3NTH A;  3PFS A;  4C5G A;  3OYM A;  4BAC A;  3OS1 A;  3MP6 A;  5CIU A;  3C4S A;  2E5Q A;  4IUR A;  2BKD N;  2XK0 A;  3MP1 A;  5D6W A;  3S6W A;  3P8D A;  4A4H A;  2RJD A;  2YRV A;  5KCO A;  3OYD A;  1SSF A;  3FLG A;  4HCZ A;  5FRM A;  2BIV A;  3QII A;  4PL6 A;  5D6Y A;  1WGS A;  3QKJ A;  4N4H A;  3S3M A;  2RJC A;  3UWN A;  3DLM A;  4QQD A;  2X4X A;  3LH0 A;  4ZTJ A;  3PMT A;  4IUP A;  4QQ6 A;  2MWP A;  2HQE A;  2L8D A;  3CEY A;  3FEO A;  4A4F A;  1KHC A;  3OYC A;  3OYF A;  1MHN A;  2RI3 A;  5KE2 A;  3OQ5 A;  3L2Q A;  5IN1 A;  4L59 A;  3OY9 A;  5C0M A;  4IUT A;  1WJR A;  3EAE A;  4RG2 A;  4IKF A;  3OYB A;  3OYK A;  2K3Y A;  2RI2 A;  3OMG A;  2DAQ A;  4A4G A;  4BE1 A;  2FHD A;  4UC4 A;  2F5K A;  4E7K A;  4IUU A;  3O8V A;  4E7L A;  2RHZ A;  4BE2 A;  1RI0 A;  4QQG A;  5IAY A;  3H6Z A;  3P8H A;  4PLL A;  4X34 A;  4E7H A;  3S3N A; 
#chains in the Genus database with same CATH topology
 2KRO A;  2AT1 B;  1H8K A;  4ZN3 A;  3PNW C;  3H0I A;  3QZ5 B;  3SWN A;  1VQ9 T;  3M55 A;  2QI2 A;  1X6O A;  3HFO A;  3L2W A;  4LDU A;  2OAW A;  3CCU A;  1Q86 R;  1U8R A;  1VQ4 Q;  2V1Q A;  1JJ2 A;  2BTT A;  1X01 A;  1NE8 A;  2O01 E;  2J7I A;  3GF5 A;  5L8R E;  2CRE A;  2DL8 A;  2PUK B;  2R57 A;  1N5Z A;  1E6G A;  4IUV A;  1WYX A;  5GMK i;  3OYL A;  1YIJ A;  4PJO G;  3FJ5 A;  3CCE Q;  2L3Q A;  5A0G A;  2DM1 A;  2DL3 A;  1UJ0 A;  2R5M A;  2X4W A;  4HCC A;  2FPE A;  1G3T A;  2MWO A;  1I5L A;  3C94 A;  1FYN A;  5KYX B;  4OB0 B;  3GIB A;  3QDR B;  4D8D A;  4M77 F;  1PNJ A;  4AFU C;  4M77 B;  3PFS A;  2E1H A;  1U1S A;  2Y90 A;  5I2M A;  3MP1 A;  3S6W A;  2VXE A;  2NUZ A;  1PHT A;  3CCJ A;  3CCM A;  1PD1 A;  1SSF A;  1OQK A;  2BIV A;  2M0Y A;  1MMG A;  2QQA A;  4MZP A;  4JLG A;  5GJV B;  2FB7 A;  3VYH B;  1KHC A;  2F1L A;  1VQ5 A;  3G4S A;  1RAC B;  2MIO A;  2LCL A;  1SHG A;  3EAE A;  1VQL A;  1VQ7 T;  3CD6 T;  1IO6 A;  2ABL A;  4BE1 A;  5GMK e;  4FW1 A;  2HEQ A;  1YIT T;  3MPU B;  5CKE A;  5EG2 A;  3SB2 A;  3UT1 A;  1QKX A;  1Y71 A;  2X9H A;  2V8J A;  1ZUY A;  1BIB A;  4MDX A;  4F16 A;  3IQL A;  3CQT A;  2DBK A;  1UUE A;  2EQJ A;  2JNG A;  1H3H A;  4C92 F;  2JXB A;  1SEM A;  3O5Z A;  1GCQ C;  1VQN Q;  1OUL A;  2KXD A;  2M1H A;  3CC4 T;  2K9G A;  3H41 A;  4DBH A;  3JCM c;  4E6R A;  5GAO n;  1N8R R;  1ZSZ C;  4F7U E;  3EG3 A;  3CXC S;  3VS7 A;  1NJI R;  4J9I A;  4ZGE B;  2HL3 A;  2MMP A;  1S72 T;  4M75 G;  3G6E Q;  3OYH A;  2KVQ G;  2EQM A;  3DB4 A;  3RIR A;  2CT3 A;  1A0N B;  3EH2 A;  3TVT A;  1OI1 A;  1F1B B;  1VYV A;  3OW2 A;  1JXO A;  3CC7 T;  2CKK A;  2BZX A;  2DTH A;  3JCM Q;  1YCY A;  2F2W A;  4YTL A;  3VS5 A;  3WVD B;  2CZ6 B;  3OYM A;  2HBW A;  1M90 R;  1QVF A;  1OEB A;  1QVG S;  3E1S A;  1QLY A;  2RD1 A;  3R6N A;  2O88 A;  3VS6 A;  2ROT A;  4XU2 A;  3OYD A;  2A0F B;  3QWY A;  1W2B S;  2FPF A;  3QKJ A;  2DRK A;  2HQH A;  3EG2 A;  2VV5 A;  1GFC A;  4AFS C;  4OML A;  2JS0 A;  5C0M A;  1VA7 A;  2NWM A;  1Q7Y U;  2P4T A;  3A8M B;  4UC4 A;  3PIO A;  1ABO A;  4E7L A;  4AMC A;  2DKG A;  1VOM A;  2HBP A;  4XU0 A;  2COZ A;  3EGD B;  2RNA A;  4QVZ A;  2KNB B;  1YJ9 T;  5KE3 A;  2VC8 A;  2EGE A;  5CKH A;  1VQK A;  1RAF B;  2GF7 A;  3E9G A;  2YRD A;  2KRS A;  3PMI A;  4KUI A;  1U3O A;  1K9M R;  2MCN A;  4BUG A;  1K73 R;  1T0H A;  1U5S A;  5HY6 A;  8ATC B;  2OTL Q;  2C06 A;  1ZHI A;  3JRZ A;  2LQ8 A;  3VV0 A;  3RKY A;  5LJ3 d;  4QW2 A;  5FU6 B;  1G8X A;  5GAN d;  2ATC B;  5HKC A;  1N8R C;  1VQP Q;  2RM4 A;  2LDM A;  2RA2 A;  2XI9 A;  1NJI C;  2AKK A;  1OZ2 A;  3VS4 A;  1SRM A;  3H0F A;  3JAM E;  3A8O B;  2P0P A;  3OYJ A;  5GMK l;  4FYW B;  2WSC E;  3DB3 A;  4EPC A;  4RTW A;  4DBQ A;  3REB B;  1YI2 T;  1B34 A;  2RQR A;  2KDS A;  2DXU A;  2GFA A;  5D7U A;  3GP8 A;  2X4Y A;  4J9E A;  5DM7 R;  4E7I A;  4F7U A;  3A8G B;  2K79 A;  1RI9 A;  3VU3 C;  1K8A R;  4ZGJ B;  2CP0 A;  1UB4 A;  5CIU A;  2ED1 A;  4HKE A;  3CMA A;  2SEM A;  4C92 C;  2LCS A;  1M5Q 1;  2CYZ B;  1FWZ A;  4HCZ A;  3EG9 B;  5D6Y A;  3MJX A;  5GAM g;  2EGA A;  3DLM A;  2DTO A;  5FU7 B;  3VKI A;  1OPK A;  1BI2 A;  3CCL A;  2CUD A;  3CEY A;  2CH4 A;  5GAN 5;  3OYC A;  1VIE A;  1BU1 A;  3L2Q A;  4RUG A;  5DLO A;  1LCK A;  3HTR A;  2E12 A;  1WXT A;  3OYB A;  2ENM A;  4M77 E;  2DXC A;  2QA4 Q;  1KQS P;  2QQB A;  1GBQ A;  1HYO A;  3KFV A;  1KC8 U;  4EIK A;  4EMG A;  2DXT A;  2XDP A;  2DER A;  3JCM W;  3M0S A;  4OVA A;  3MEV A;  4RMO A;  3CBO A;  4J6Y A;  1KD1 C;  1K9M C;  5I22 A;  1K73 C;  3CCV A;  5LJ3 e;  5LJ5 e;  4PLI A;  1MNE A;  3A5Z B;  5GAN e;  2CGH A;  2XIC A;  2VAS A;  2HKN A;  4RTY A;  3MEU A;  4OMO A;  2ZPE B;  3CPW A;  1B3Q A;  4DA4 A;  1OYX A;  1M2V A;  4L5G A;  4CRI A;  4FM4 B;  3CD6 Q;  2M02 A;  2RJF A;  4JRK A;  3HFN A;  3VRZ A;  1YIT Q;  1QWF A;  3SWN C;  4N4G A;  5CCA A;  1W6X A;  2BUD A;  2EBP A;  2SRC A;  4JZ3 A;  3BDL A;  1YJW Q;  2AHJ B;  1WJS A;  2EYZ A;  2AIR B;  2GBQ A;  1Y57 A;  2PU9 B;  2FZC B;  1XNI A;  2BE7 D;  2PQW A;  4M4Z A;  1K8A C;  1YWO A;  4KH1 B;  4MMK A;  5L23 A;  4XQ3 A;  5GAM d;  2QDY B;  2W0Z A;  5GAO p;  1BYM A;  2KSS A;  4AT1 B;  1TUC A;  1JB0 E;  1WJQ A;  2G6F X;  2P84 A;  2K2M A;  2E5Q A;  4XTU A;  3UAT A;  2XK0 A;  4XU3 A;  1CKA A;  1C6V X;  2HL5 C;  4LDV A;  4P5N A;  3CCL Q;  3HRS A;  4C0G A;  1AOJ A;  4E2F B;  1OPL A;  3CCR T;  2RK1 A;  4QQ6 A;  4IUP A;  2EW3 A;  1WZO A;  2COY A;  3I55 A;  4LXC A;  2VB6 A;  1VQM A;  4HCB A;  1AWX A;  1VQ6 Q;  1S72 Q;  4IUT A;  3PVL A;  2DL7 A;  4C8Q B;  2CS7 A;  3QUI A;  4PJM A;  2DJQ A;  3JCM b;  2RHZ A;  1R0C B;  1VQO A;  1KFZ A;  1YN8 A;  3CC7 Q;  2ZPG B;  1TTH B;  4BE0 A;  3JCM d;  4A4E A;  1Y0M A;  1AEY A;  1YWP A;  5KYX A;  5IHI A;  3TSW A;  1HK9 A;  3M59 A;  4ME7 A;  4M77 A;  1D1B A;  2R5A A;  4JS5 A;  3TQ7 P;  2XU8 A;  4RTV A;  3CCU T;  3M0T A;  2JTM A;  1V76 A;  4PNO A;  3TEE A;  1OV3 A;  4ZGD B;  2M9U A;  1GBR A;  2YUP A;  4PJL A;  4KH0 B;  1M1K R;  1Y7X A;  1LOJ A;  4IIO A;  2ZZD A;  3FIF A;  1NLO C;  3ZEH A;  2E65 A;  4C8Q G;  1YIJ T;  3OYN A;  1BI0 A;  2LVM A;  3QBY A;  4M7D D;  5IT9 E;  1YJ9 Q;  1X69 A;  1PCX A;  1OU8 A;  2MI6 A;  1FMV A;  2OAU A;  3OS2 A;  3V8K A;  1B07 A;  4J9G A;  3VS3 A;  4KT0 E;  3A8L B;  2F2V A;  3GLX A;  1YJN T;  1VQ4 A;  2ED0 A;  2EGC A;  1H64 1;  1BKB A;  2E6Z A;  5AT1 B;  3CXC P;  3UPU A;  2YWW A;  2HAX A;  4OF1 A;  3ZFJ A;  5FRO A;  1KQ2 A;  2RQV A;  2A37 A;  4RTX A;  4ELZ C;  4E7S A;  3PVQ A;  3WVE B;  2KK4 A;  2C0I A;  4C92 A;  2OTJ Q;  2RQW A;  2O9V A;  3NGP A;  3P8D A;  5KCO A;  4PKC C;  4Z88 A;  3FLG A;  3CCE A;  3CCM T;  2PUO B;  4PL6 A;  2HKQ B;  5GMK j;  3LWI A;  3CCJ T;  2EIF A;  3VJP A;  3MCA B;  1WQW A;  1SPK A;  3GNF B;  3I35 A;  1QVG P;  3OY9 A;  4AFZ C;  1Z9Z A;  3G4S T;  2J6F A;  3URG A;  3VS2 A;  3JCM e;  2LJ3 A;  4M7A D;  1M1F A;  2KE9 A;  3GNG A;  2DAQ A;  4Y91 A;  2FHD A;  2F5K A;  4PJJ A;  5GAN 3;  4X34 A;  3MP8 A;  1Q81 R;  3V8J A;  4LE9 A;  1WA7 A;  2CP5 A;  4PJO F;  2MK5 A;  3CCS Q;  1K1Z A;  2DEU A;  3G71 Q;  2CSQ A;  4RCB A;  4PJO B;  4DBF A;  1ZUK A;  4C92 D;  1Q86 U;  2EQK A;  3HSB A;  2VKN A;  4XTV A;  4DOV A;  4FL6 A;  2EJ9 A;  2V8K A;  1M1K C;  2M16 A;  2EYY A;  3RES A;  4A4K A;  1E7O A;  5GMK h;  4AG2 C;  3LGF A;  3ME9 A;  1BIA A;  1QVP A;  1QMC A;  4JJB A;  4C0F A;  2FG0 A;  3QHS A;  3EFO B;  1D0X A;  3HHT B;  2QGG A;  2RB6 A;  1OU9 A;  2COW A;  2QEX T;  2JJ9 A;  4BI3 A;  3QO3 A;  1ZQ1 A;  2IG0 A;  1JJ2 S;  2O31 A;  4FYV B;  4KGZ B;  3OMC A;  2CZ0 B;  5CKD A;  3EGD A;  1D0Y A;  4HCK A;  3G1J A;  1M1G A;  1VQN A;  3F70 A;  1PKT A;  1WXU A;  2LT1 A;  3VS0 A;  4X9C A;  1RLQ C;  5IXF A;  2YXY A;  1NBE B;  2XDB A;  4F04 B;  3J81 E;  2QG9 B;  4JRI A;  1D1A A;  3H9N A;  4KUL A;  3G6E A;  3HKS A;  3TSZ A;  3M0U A;  3PT9 A;  4L59 A;  2PVO B;  1X6B A;  2K5I A;  3JB9 F;  1UGV A;  4IIM A;  2ZAE A;  4M78 F;  2RQU A;  1FMW A;  3OYK A;  2AK5 A;  4A4G A;  4QKU A;  1RAG B;  4E7K A;  4M78 B;  1Q81 C;  2LNH B;  4CI0 C;  1ZA1 B;  3LX7 A;  3C12 A;  1WHK A;  3I56 T;  4KGV B;  2LMJ A;  3NTI A;  4ESR A;  4KUD K;  2KGT A;  3FDR A;  4LNP A;  4VUB A;  1QWE A;  1I0C A;  1PWT A;  1X2Q A;  2YHT A;  2RN8 A;  1VQK T;  4LN2 A;  3ULR B;  1WHG A;  4C8Q E;  4M75 F;  4OB1 B;  3CCR Q;  4OP0 A;  3V8L A;  4HT9 A;  4M75 B;  3V7R A;  4EMH A;  4X9D A;  2XD0 A;  1I8F A;  3EG9 A;  3LLR A;  2A36 A;  4EDU A;  1ZUU A;  1M4Z A;  1YP5 A;  4FT4 A;  1OX8 A;  4FU6 A;  5KH6 A;  4EMK B;  2LNV A;  3M57 A;  3RMQ A;  2LJ1 A;  1C0M A;  1UG1 A;  4LD6 A;  2DL5 A;  2KXC A;  1QP2 A;  1YBY A;  2CP3 A;  3JB9 G;  4M78 G;  1PSE A;  4M7D G;  1MV0 B;  2OTL A;  2E3H A;  2PVG B;  1V1C A;  1I4K 1;  3BFM A;  1SRL A;  1VQ8 Q;  1UJY A;  4C5I A;  4CC7 A;  1M90 U;  4CC3 A;  1VQP A;  2KQW A;  1WNL A;  2D6F A;  1Y07 A;  5LJ3 g;  5ECA A;  5LJ5 g;  4PJO C;  2LQW A;  4WCI A;  2NUP B;  1TSF A;  1WLP B;  4GLK A;  5GAN g;  4AFQ C;  3CMA T;  2QXF A;  2FZG B;  4J6X A;  5IXB A;  3OYF A;  2XG8 D;  1ZA2 B;  2IPO B;  3CXC A;  2PTK A;  1OX9 A;  1YJN Q;  2RMO A;  1UGQ B;  5LJ3 j;  2D8H A;  4HVU A;  4Z8A A;  2FO0 A;  1RI0 A;  4M7A G;  1SF9 A;  4KGX B;  4PLL A;  2HZY A;  5GAN j;  2NYS A;  1PKS A;  4F17 A;  2X51 A;  1TH7 A;  1KJW A;  1UGS B;  4FSX A;  4AG1 C;  2DVJ A;  1GFD A;  2HNI A;  1GRI A;  3EGX B;  1KSW A;  2GCX A;  3QWX X;  2JVV A;  5M9O A;  2LX7 A;  4OMN A;  3OS5 A;  2L89 A;  3OYA A;  1I5O B;  2C0T A;  5KCH A;  1EZZ B;  1UHF A;  2ZPF B;  1BI3 A;  4Z02 A;  4C5E A;  2KRM A;  4Q5W A;  1W2B A;  2V8I A;  2QA4 A;  1N9R A;  3M4Y A;  1R8O B;  2EKO A;  4FSS A;  1QCN A;  1M8V A;  3QYH B;  2RHY A;  1KD1 R;  2LRQ A;  3PGG A;  4PJO E;  3VRY A;  4C8Q A;  2GGR A;  3BW1 A;  3JCM X;  4M77 C;  4PFZ A;  3N5B B;  5GAN 8;  5LJ3 h;  3OS0 A;  1VUB A;  5LJ5 d;  6AT1 B;  5GAN h;  4BDY A;  3E19 A;  1X43 A;  2F2X A;  3JB9 J;  4C0D B;  4MZM A;  4FW2 A;  1RLP C;  2R58 A;  3LYI A;  2DET A;  2XKO C;  2LX9 A;  3CD6 A;  2DD5 A;  1LNX A;  1B7T A;  5GMK m;  1VYT A;  1XQH A;  1YIT A;  3QYG B;  1Q7Y R;  4N0A A;  5D6W A;  5CR2 A;  4M75 C;  4PJN A;  1X6G A;  1PG5 B;  2YRV A;  1O9S A;  5CO7 A;  1VQ9 Q;  1G83 A;  1YJW A;  2D1X A;  4N4H A;  1LVK A;  2NUT A;  1M2O A;  4Z89 A;  2L5Q A;  5IN1 A;  2QEX Q;  1VQM T;  4EMK C;  3QZ9 B;  3M4G A;  2FPD A;  2B86 A;  1YHQ T;  2ZGW A;  1PSF A;  1JO8 A;  4E7H A;  5GAM f;  4D6W A;  1VQO T;  1K76 A;  5J39 A;  2ECZ A;  5CKF A;  3CCQ T;  2ZPB B;  5KYW A;  4PK4 A;  1ZBJ A;  2MYS A;  3E2U A;  2QYZ A;  3OBY A;  2DRM A;  1VQ6 A;  1GCP A;  4J9H A;  3CC2 T;  2KAF A;  1S72 A;  2D0N A;  4M78 E;  3C95 A;  2J06 A;  3NTK A;  2D9T A;  2BZ8 A;  4JJD A;  1MND A;  2LCC A;  1IRX A;  2PVD B;  1UGR B;  3GBQ A;  4RTT A;  5GAM j;  3CC7 A;  2K5L A;  1KQ1 A;  2IIM A;  3CME T;  4JZ4 A;  3E9F A;  4LDW A;  3UA6 A;  3I56 Q;  2MAM A;  2RHI A;  1XJW B;  3P8B B;  4OGC A;  4OB3 B;  3OYE A;  1WHH A;  2XMF A;  4PFO A;  2EPD A;  2GNC A;  3CPW S;  5GAN 6;  3JCM g;  4M75 E;  1WQ7 A;  3TCJ A;  4NL3 A;  2ZPH B;  2DL4 A;  2OI3 A;  1HXD A;  2KY9 A;  4LUE A;  1VQ7 Q;  3RDV A;  3S3O A;  3TRE A;  1WFW A;  3INZ A;  1Q7Y C;  3U23 A;  4PJO A;  3X26 B;  4C5G A;  4LUD A;  1JJ2 P;  4MDW A;  1AT1 B;  2BKD N;  2DXB A;  5DY9 A;  1YNZ A;  3V7C A;  3CCE T;  1YJ9 A;  1KC8 R;  3SFM A;  2A28 A;  3BY7 A;  2X4X A;  5A2Q E;  4ZTJ A;  3QDF A;  3QG1 A;  5KE2 A;  3MKD A;  3RNJ A;  3OQ5 A;  5GAM h;  1K4U S;  2AKL A;  4FYY B;  4JS4 A;  1NLP C;  4IKF A;  4HXJ A;  3NFC A;  3EFO A;  1BB9 A;  3CC4 Q;  1W1F A;  5FU6 C;  1JEG A;  4GLM A;  2OTJ A;  2E70 A;  2YUO A;  2EVR A;  1I07 A;  1M3A A;  2HSP A;  3H0H A;  3M9Q A;  2EJG A;  4C8Q F;  2K4Y A;  1IGU A;  3JB9 H;  1G5V A;  4O6J A;  4J9F A;  5C6S A;  1AVZ C;  2MPX C;  1Q82 U;  5A0D A;  4ZTF A;  2X3W D;  1TU0 B;  1ZBX A;  1QKW A;  1WHM A;  1E6H A;  1CSK A;  4RG8 A;  3QSU A;  1OOT A;  1PC0 A;  3JCM h;  2KMT A;  1N6A A;  2EWN A;  2EQI A;  2E5K A;  1X27 A;  2VGM A;  1QQJ A;  2EFI A;  4JJC A;  1UE9 A;  2FVU A;  1KK7 A;  2K3X A;  2M0O A;  3RKW A;  3QJ6 A;  3CCS A;  5GJW B;  3G71 A;  4M78 A;  4JRQ A;  2QTX A;  3HRT A;  5EC7 A;  1FMK A;  3A8H B;  1TWB A;  1M3C A;  2WSE E;  2EQU A;  2DO3 A;  2HDA A;  1T3L A;  4XTZ A;  5FU7 C;  3BE3 A;  1VQN T;  1IGQ A;  3H8Z A;  3VUB A;  2RJE A;  3UF4 A;  3EH1 A;  1AZG B;  4XTY A;  1TXQ A;  2O4X B;  2E10 A;  3HL8 A;  3BDU A;  2YSQ A;  1NPR A;  1QW1 A;  2RK2 A;  4XK8 E;  4M75 A;  1KC8 C;  1NYG A;  2DIL A;  1FX7 A;  2RJD A;  2YRC A;  1ARK A;  1M9S A;  4J8O A;  5IHK A;  1B34 B;  5FRM A;  4J6W A;  3LH0 A;  3PMT A;  2J05 A;  1VYU A;  3G6E T;  4F7U B;  2KBT A;  2QTV A;  4EMK A;  4M77 D;  1D1C A;  5KYY B;  2OJ2 A;  4XAX B;  4X1V A;  3CBM A;  4J9C A;  1ZX6 A;  2XHC A;  2RH2 A;  4IUU A;  4QQG A;  3H6Z A;  4BI8 B;  1NM7 A;  3RKX A;  1G3S A;  1MGQ A;  3JCM V;  4QVD A;  2FEI A;  2K57 A;  3OW2 P;  2YLC A;  2EAY A;  3EHQ A;  1O75 A;  3EG1 A;  2L0A A;  3LGL A;  1VQ5 T;  1JBM A;  2X3X D;  3LH5 A;  1RAH B;  2NUP A;  1YI2 Q;  1VQL T;  1SKU B;  4NS5 A;  1KHI A;  1SSH A;  2A7Y A;  5KYU B;  3FRN A;  2DTI A;  4MML A;  2Y4X A;  2QAS A;  1WHJ A;  1Y96 B;  1IHV A;  2A08 A;  4GY5 A;  5I2S A;  3A98 A;  1YHQ Q;  4F7U G;  4DEX A;  3NHN A;  5CQX A;  2L2P A;  1CKB A;  3EG0 A;  4J9D A;  4TVR A;  2I2L A;  2OX7 A;  3CCQ Q;  2CSI A;  2PZ1 A;  3FC3 A;  2P0K A;  4V2S A;  4JUV A;  1S1N A;  4J5Y A;  3CCR A;  1KQS A;  4RTZ A;  2KT1 A;  2G3R A;  4A63 B;  2FRY A;  3CC2 Q;  1ZSZ B;  3EGX A;  1UEB A;  2DF6 A;  5KYN A;  5DLQ E;  5GAO q;  3L1A A;  1VQP T;  4MZT A;  2DIG A;  2EKH A;  4HVW A;  1BBZ A;  4C8Q C;  2DEQ A;  3OS1 A;  2F5T X;  3C4S A;  3T9N A;  4R55 A;  1TG0 A;  1MUZ A;  3CME Q;  4JDS A;  4HA8 A;  2M51 A;  1D09 B;  4Y28 E;  2MWP A;  2HQE A;  5CAI A;  1Q95 G;  4OMF B;  2LC4 A;  1VQ8 A;  1IB8 A;  1QCF A;  4DBR A;  3OMG A;  3DLL A;  1IXD A;  4XU1 A;  4N0A C;  3P8H A;  3UA7 A;  2CDT A;  2ESW A;  3JV3 A;  5CKB A;  1T3S A;  1OZ3 A;  3OYI A;  1C1A A;  3PIP A;  5J3B A;  1MMA A;  5FLX E;  1H3Z A;  1W4S A;  1HD3 A;  3OB9 A;  3UDC A;  4JRP A;  3RR6 A;  2LT4 A;  3QXE B;  1SG5 A;  4M7D F;  1BCO A;  2DD4 A;  1IRE B;  2EJF A;  2V1R A;  2P0Q A;  1WHL A;  4M7D B;  1YJN A;  1RAB B;  1TUG B;  2E6N A;  4PFP A;  2JT4 A;  2QA4 T;  3VUZ A;  2GFU A;  3OYY A;  1AWO A;  3RBB B;  1M30 A;  1I1J A;  4DQ2 A;  3KBG A;  2DZ9 A;  2KI7 A;  1JU5 C;  1PM3 A;  2WAC A;  4KBM B;  1XTD A;  2DA9 A;  5D6X A;  2VGN A;  1RAD B;  2JMC A;  1N8R U;  3M0R A;  2RPN A;  5CQY A;  1NZ9 A;  2WSF E;  4J7I A;  1ZSG A;  3CPW P;  3ASK A;  1NJI U;  2P4R A;  3M0Q A;  1IZ6 A;  4M7A F;  3MHX A;  5LL6 S;  3X24 B;  2EYX A;  3RMS A;  3PTA A;  1BK2 A;  2RQT A;  4M7A B;  4XTX A;  2VVK A;  4OB2 B;  1X2K A;  2JM8 A;  4FIB A;  1BCM A;  1YJW T;  1QCO A;  2LQK A;  3HPW A;  1D3B B;  3CCU Q;  2K2V A;  1U06 A;  5LJ3 f;  5LJ5 f;  1KIK A;  1Q86 C;  2D8J A;  3EGU A;  4M77 G;  5GAN f;  2QQ9 A;  4C92 B;  2BZY A;  2CP7 A;  5I21 A;  4HVV A;  1R0B G;  3X25 B;  3S3N A;  2FRW A;  2DIQ A;  2KYM A;  3SD4 A;  1G3Y A;  3M58 A;  5AYF A;  4R56 A;  2DVE A;  1UGP B;  1YIJ Q;  1VQ9 A;  3CCL T;  3HP9 A;  3OW2 S;  2GTJ A;  2O2O A;  2JW4 A;  1QVF S;  1AD5 A;  2QEX A;  1VQ6 T;  5LJ5 j;  3L2U A;  3X20 B;  4J83 A;  4ELY C;  3J7A F;  1M8M A;  5GAN 2;  2E64 A;  4D8K A;  1KD1 U;  3SDZ A;  1K9M U;  2CZ7 B;  1K73 U;  2O9S A;  3CCV T;  2L3R A;  3DKM A;  1YFN A;  5HCK A;  2KRN A;  1NYF A;  3CCM Q;  3CCJ Q;  1QVG A;  2DNU A;  3MEW A;  4JJN K;  3R6O A;  1WX6 A;  4K11 A;  4C92 G;  5IH2 A;  1VIF A;  4E7Z A;  1VQ5 Q;  3G4S Q;  1MV3 A;  2RHU A;  3SWN B;  1VQL Q;  2QQR A;  1N27 A;  4BY6 B;  3M53 A;  2YDL A;  4BAC A;  1IHW A;  4IUR A;  4J7F A;  4M78 C;  4A4H A;  2QDL A;  4B6M A;  5LJ5 h;  4M7D C;  3I56 A;  2FZK B;  3QII A;  2L8D A;  3FEO A;  4A4F A;  1AWW A;  3SHW A;  2GTO A;  1K8A U;  2HMA A;  3EFR A;  2YT6 A;  2LJ0 A;  1VQ7 A;  3RER A;  2BE9 B;  2K3Y A;  2RI2 A;  1JQQ A;  4FCY A;  3AHU A;  4XTW A;  2EYW A;  2DYI A;  4HT8 A;  3V7S A;  1ACM B;  1TOV A;  1AHJ B;  4RTU A;  5GAO m;  5GAN 7;  1UEC A;  2AZS A;  2OTJ T;  2JTE A;  4GBQ A;  4ANJ A;  3FB9 A;  2QGF B;  3I55 T;  4C8Q D;  5GAO l;  2DX1 A;  4JPB W;  5J26 A;  1Z9Q A;  2CP2 A;  3MEA A;  2O4X A;  4A54 A;  5FWB A;  4M7A C;  2XDD A;  3M54 A;  2DBM A;  1M3B A;  1YCS B;  2RI5 A;  3CC4 A;  2NLU A;  4DEY A;  2IVW A;  1V29 B;  4B9X A;  3OA6 A;  1M90 C;  2Y4Y A;  2YUQ A;  1RAI B;  2LTO A;  2H3E B;  5KYY A;  1I81 A;  3LW5 E;  3OBW A;  5CK9 A;  2L3S A;  2JS2 A;  1AWJ A;  3CCS T;  3G71 T;  4M7D E;  5A0L A;  2QAZ A;  3ZBD A;  1GL5 A;  3JB9 I;  1BI1 A;  4WF2 A;  3SEM A;  1RUW A;  1AZE A;  1UDL A;  3Q1J A;  1PRM C;  3VYG A;  3THK A;  9ATC B;  3JCM f;  2MF2 A;  2X4J A;  4LDX A;  5GAO r;  2RF0 A;  2JOY A;  4RCC A;  2CT4 A;  2E3I A;  1PD0 A;  5KYU A;  2LP5 A;  1WGS A;  1VQK Q;  3UWN A;  4KRT A;  1Y96 A;  1VQ4 T;  1RAA B;  4BB7 A;  1DJ7 B;  3TU4 K;  2D0Q B;  4JLI A;  3QJY A;  2H8H A;  2DYB A;  2A3L A;  2QK0 A;  1WPY A;  3O8V A;  4M7A E;  1GCQ A;  2JMA A;  2ZCF B;  2F69 A;  3L2V A;  1WI7 A;  1RAE B;  3C0C A;  5FRN A;  2J6K A;  3KUF A;  3HRU A;  3L2R A;  1TS9 A;  3GPL A;  1ZSZ A;  3WXM B;  1NEG A;  4DOW A;  2JTF A;  5FWC A;  4N4I A;  2DPP B;  2JZ2 A;  4BY6 C;  1HSQ A;  3JSC A;  4C92 E;  4WTO B;  4ORZ A;  4BDZ A;  4LDY A;  2C0O A;  2YUN A;  3PE0 A;  3REA B;  3AT1 B;  2CZ1 B;  4LD9 K;  3OSV A;  4C0Z A;  2KR3 A;  4ZN1 A;  2RO0 A;  2K3B A;  3A1P A;  4C0D C;  4PJO D;  1J3T A;  5HK3 A;  3CMA Q;  2HCK A;  2KT8 A;  3JCM P;  1WXB A;  4R0K A;  1G2B A;  3I9Q A;  1G3W A;  3ER0 A;  3LWH A;  2Z0W A;  3EFS A;  3OYG A;  4BD3 A;  1YI2 A;  2CP6 A;  1U1T A;  1M1K U;  1NG2 A;  3FJP A;  2VWF A;  4L6V 5;  3EHR A;  3MET A;  4FYX B;  1WDX A;  7AT1 B;  1UFF A;  2YLB A;  4NL2 A;  2HD0 A;  4OMP A;  2DJZ A;  1YHQ A;  8AT1 B;  2KYB A;  2LQN A;  1H92 A;  1D0Z A;  1FXX A;  1KG1 A;  2DFU A;  4M7D A;  3X28 B;  5HK0 A;  3CCV Q;  3CCQ A;  1LJO A;  2DK3 A;  4OMM A;  5CVI A;  1N9S A;  2RJC A;  2ZPI B;  3D7S B;  4QQD A;  2XID A;  3JCM J;  1MMD A;  1ZLM A;  2RI3 A;  3ZL7 C;  2E41 A;  3CPF A;  1WJR A;  3CC2 A;  2L3P A;  4RG2 A;  2DMO A;  2PNI A;  1VQ8 T;  4FT2 A;  1XOV A;  1WIE A;  1M27 C;  3M56 A;  2K5F A;  5IAY A;  2DLP A;  1MMN A;  1Q82 R;  2DE0 X;  5I11 A;  2LZ6 B;  1EIF A;  2NUT B;  2CUB A;  4F7U F;  2FYK A;  3CME A;  3RUX A;  2K7A A;  4J9B A;  4ATO A;  4NOY A;  3NPF A;  4QT7 A;  2KEA A;  4F14 A;  4C5H A;  5FW9 A;  3JB9 D;  2B8A A;  4M78 D;  2EYQ A;  3OSS C;  2W10 A;  3L2Z A;  3M5A A;  3VS1 A;  4M7A A;  5GAM e;  1P92 A;  3MO8 A;  4B9W A;  4OGE A;  1JRI A;  2JN0 A;  1Q81 U;  4RKU E;  4II1 A;  4E47 A;  4O5V A;  2J6O A;  3CBP A;  5GAN 4;  1HJD A;  2I0N A;  2QQS A;  1QP3 A;  2H3J A;  2V26 A;  5KYW B;  5IHN A;  1K9A A;  2JUF A;  1QVF P;  1D3B A;  4CC4 B;  1K0X A;  2MOX A;  1UTI A;  1RL2 A;  2K6D A;  4M75 D;  2VUB A;  4QVC A;  2HQX A;  2E4H A;  4IUQ A;  4E7J A;  2RHX A;  3I55 Q;  1JXM A;  4BI4 A;  3GOX A;  3I5R A;  1K0S A;  1VQM Q;  1NPP A;  4A53 A;  3G7Z A;  2DZC A;  1UHC A;  3NMZ C;  1GXI E;  2GQI A;  3L42 A;  2VYT A;  2X35 A;  3M0P A;  1VQO Q;  3NTH A;  1W2B P;  2AZV A;  3MP6 A;  3J80 E;  1SHF A;  2FL7 A;  3KXT A;  1M2V B;  1NEB A;  1EX4 A;  2GQV A;  1W70 A;  1R77 A;  4ZNX A;  1X75 C;  1KQS S;  1TUD A;  2OTL T;  2VXF A;  3S3M A;  2HSE B;  1EFN A;  1LPL A;  1T0J A;  1PRL C;  1MHN A;  2ROL A;  4OMQ A;  3QPH A;  1ABQ A;  2CH4 W;  2JM9 A;  3I5S A;  4CC2 A;  1Q82 C;  4BE2 A;  4Y92 A; 
#chains in the Genus database with same CATH homology
 4D6W A;  1VQO T;  2DIQ A;  3SD4 A;  5J39 A;  1G3Y A;  2ZPG B;  3M58 A;  5AYF A;  4R56 A;  4BE0 A;  5CKF A;  3JCM d;  3CCQ T;  2ZPB B;  4A4E A;  2DVE A;  4ZN3 A;  1UGP B;  3PNW C;  3QZ5 B;  3SWN A;  1VQ9 A;  3CCL T;  1VQ9 T;  3HP9 A;  1HK9 A;  3M55 A;  3OW2 S;  3M59 A;  4ME7 A;  2QI2 A;  1X6O A;  3OBY A;  3HFO A;  4M77 A;  3L2W A;  2R5A A;  4LDU A;  4JS5 A;  3CC2 T;  3CCL A;  1VQ6 A;  1QVF S;  2KAF A;  3CCU A;  1S72 A;  2QEX A;  1VQ6 T;  5LJ5 j;  4M78 E;  2XU8 A;  3C95 A;  3CCU T;  3NTK A;  1U8R A;  2JTM A;  3L2U A;  3X20 B;  4PNO A;  4J83 A;  2D9T A;  3TEE A;  1JJ2 A;  4ELY C;  3J7A F;  4ZGD B;  1X01 A;  2M9U A;  2LCC A;  1NE8 A;  2PVD B;  2O01 E;  1UGR B;  5GAN 2;  5GAM j;  2E64 A;  3GF5 A;  1Y7X A;  1KD1 U;  3CC7 A;  5L8R E;  3SDZ A;  1K9M U;  2K5L A;  2PUK B;  1KQ1 A;  2CZ7 B;  2R57 A;  3CME T;  1K73 U;  1LOJ A;  3CCV T;  4IUV A;  2L3R A;  3DKM A;  5GMK i;  3OYL A;  3E9F A;  2ZZD A;  3FIF A;  4LDW A;  4PJO G;  1YIJ A;  3ZEH A;  2E65 A;  2MAM A;  2RHI A;  4C8Q G;  3P8B B;  3OYN A;  1BI0 A;  2LVM A;  3QBY A;  4OGC A;  4OB3 B;  5A0G A;  3MEW A;  3OYE A;  1QVG A;  4JJN K;  5IT9 E;  4M7D D;  3R6O A;  3CPW S;  4C92 G;  2MI6 A;  3JCM g;  5GAN 6;  4M75 E;  2R5M A;  1WQ7 A;  3TCJ A;  2X4W A;  2OAU A;  3OS2 A;  1VIF A;  3V8K A;  4HCC A;  4KT0 E;  3A8L B;  4NL3 A;  2ZPH B;  1G3T A;  3GLX A;  1YJN T;  2MWO A;  1I5L A;  1HXD A;  3C94 A;  1VQ4 A;  2KY9 A;  2RHU A;  1H64 1;  3SWN B;  1BKB A;  2E6Z A;  2QQR A;  1N27 A;  4OB0 B;  3UPU A;  3GIB A;  3S3O A;  2HAX A;  3TRE A;  3QDR B;  4M77 F;  4OF1 A;  3INZ A;  3ZFJ A;  4BY6 B;  1Q7Y C;  5FRO A;  3M53 A;  1KQ2 A;  3X26 B;  4PJO A;  4M77 B;  4C5G A;  4BAC A;  3PFS A;  2E1H A;  4ELZ C;  4MDW A;  1U1S A;  2Y90 A;  3WVE B;  2KK4 A;  4IUR A;  4J7F A;  4C92 A;  2BKD N;  5I2M A;  3MP1 A;  3S6W A;  2DXB A;  3P8D A;  4M78 C;  4A4H A;  2VXE A;  5LJ5 h;  5KCO A;  4PKC C;  3I56 A;  5DY9 A;  1SSF A;  3CCJ A;  3CCM A;  3FLG A;  3CCE A;  4M7D C;  2BIV A;  3QII A;  2PUO B;  4PL6 A;  3CCJ T;  3V7C A;  5GMK j;  3LWI A;  3CCM T;  2EIF A;  1YJ9 A;  3CCE T;  3VJP A;  2QQA A;  3SFM A;  3BY7 A;  2X4X A;  4MZP A;  5A2Q E;  4ZTJ A;  3QG1 A;  3MCA B;  4JLG A;  2FB7 A;  1WQW A;  2L8D A;  3FEO A;  3VYH B;  4A4F A;  1KHC A;  5KE2 A;  3OQ5 A;  5GAM h;  1K8A U;  3EFR A;  3GNF B;  1VQ5 A;  4JS4 A;  3OY9 A;  3G4S A;  1VQ7 A;  3RER A;  2LCL A;  3EAE A;  3G4S T;  1VQL A;  4IKF A;  3URG A;  1VQ7 T;  3CD6 T;  3JCM e;  2K3Y A;  3NFC A;  4M7A D;  1M1F A;  2RI2 A;  3GNG A;  2DAQ A;  4Y91 A;  4BE1 A;  2FHD A;  5GMK e;  2F5K A;  3AHU A;  5GAN 3;  4XTW A;  1YIT T;  4X34 A;  5CKE A;  4HT8 A;  3V7S A;  3MP8 A;  5EG2 A;  3SB2 A;  1AHJ B;  5FU6 C;  3UT1 A;  3V8J A;  1Y71 A;  2V8J A;  5GAO m;  2E70 A;  5GAN 7;  2OTJ A;  1BIB A;  4MDX A;  2OTJ T;  3FB9 A;  3M9Q A;  4PJO F;  3I55 T;  4C8Q D;  5GAO l;  2EJG A;  4C8Q F;  2K4Y A;  2EQJ A;  4RCB A;  2JNG A;  5J26 A;  4PJO B;  3JB9 H;  4C92 D;  1Q86 U;  2EQK A;  4C92 F;  3HSB A;  1G5V A;  3MEA A;  4O6J A;  4XTV A;  2O4X A;  4A54 A;  4DOV A;  5C6S A;  4FL6 A;  2EJ9 A;  1Q82 U;  4M7A C;  5A0D A;  4ZTF A;  2XDD A;  3M54 A;  2V8K A;  1ZBX A;  1M1K C;  2M1H A;  2M16 A;  2RI5 A;  3CC4 A;  4RG8 A;  2NLU A;  2IVW A;  3QSU A;  3JCM h;  1V29 B;  2KMT A;  3RES A;  3CC4 T;  1N6A A;  2EWN A;  4A4K A;  5GMK h;  4B9X A;  3OA6 A;  2VGM A;  3LGF A;  3JCM c;  1M90 C;  5GAO n;  3ME9 A;  1BIA A;  2EFI A;  2Y4Y A;  1QVP A;  2FVU A;  2K3X A;  4F7U E;  2M0O A;  2LTO A;  4C0F A;  3RKW A;  3QHS A;  1I81 A;  3LW5 E;  3OBW A;  3CXC S;  3HHT B;  5CK9 A;  4ZGE B;  3QJ6 A;  3CCS A;  2RB6 A;  3G71 A;  4M78 A;  3CCS T;  3G71 T;  4JRQ A;  2MMP A;  2QTX A;  3HRT A;  4M75 G;  4BI3 A;  3QO3 A;  2QEX T;  1S72 T;  5A0L A;  3A8H B;  4M7D E;  1ZQ1 A;  2IG0 A;  3OYH A;  1JJ2 S;  2KVQ G;  2EQM A;  3ZBD A;  3DB4 A;  3JB9 I;  3OMC A;  2CZ0 B;  2WSE E;  3RIR A;  1BI1 A;  4WF2 A;  5CKD A;  2EQU A;  2DO3 A;  1M1G A;  1VQN A;  3F70 A;  4XTZ A;  1OI1 A;  5FU7 C;  1VQN T;  3H8Z A;  3OW2 A;  3VUB A;  3CC7 T;  2CKK A;  2LT1 A;  2RJE A;  2DTH A;  3Q1J A;  3JCM Q;  1YCY A;  3WVD B;  4XTY A;  4YTL A;  3VYG A;  2CZ6 B;  4X9C A;  2O4X B;  3OYM A;  1QVF A;  2E10 A;  3HL8 A;  3JCM f;  1QVG S;  3BDU A;  2MF2 A;  2X4J A;  3E1S A;  4LDX A;  1NPR A;  1QW1 A;  2RK2 A;  2RD1 A;  2JOY A;  4M75 A;  4XK8 E;  5GAO r;  4RCC A;  1KC8 C;  2RJD A;  4XU2 A;  1FX7 A;  3OYD A;  2XDB A;  1M9S A;  4J8O A;  3J81 E;  1B34 B;  5FRM A;  1W2B S;  1WGS A;  4J6W A;  3QKJ A;  4JRI A;  3UWN A;  3LH0 A;  4KUL A;  3PMT A;  3G6E A;  1Y96 A;  1VQ4 T;  3HKS A;  3G6E T;  2VV5 A;  4F7U B;  4BB7 A;  1DJ7 B;  4L59 A;  3PT9 A;  4M77 D;  4EMK A;  2PVO B;  5C0M A;  2D0Q B;  2K5I A;  3TU4 K;  4JLI A;  3QJY A;  4XAX B;  1Q7Y U;  4M78 F;  3CBM A;  3OYK A;  3JB9 F;  2A3L A;  4A4G A;  1WPY A;  2P4T A;  3A8M B;  4UC4 A;  2XHC A;  3PIO A;  4E7K A;  2RH2 A;  4IUU A;  4M78 B;  3O8V A;  4E7L A;  1Q81 C;  4M7A E;  4QQG A;  3H6Z A;  4BI8 B;  4CI0 C;  2DKG A;  3RKX A;  3LX7 A;  1G3S A;  1MGQ A;  2ZCF B;  3JCM V;  4QVD A;  2HBP A;  2F69 A;  3C12 A;  2K57 A;  3I56 T;  4XU0 A;  3L2V A;  5FRN A;  3KUF A;  1VQO A;  4QVZ A;  1YJ9 T;  2YLC A;  3NTI A;  2EAY A;  3HRU A;  3L2R A;  5KE3 A;  3GPL A;  2VC8 A;  4KUD K;  3FDR A;  4VUB A;  5CKH A;  3WXM B;  1VQK A;  1O75 A;  2GF7 A;  2JTF A;  2YHT A;  4DOW A;  3E9G A;  4N4I A;  2DPP B;  1VQK T;  3PMI A;  4KUI A;  3LGL A;  2JZ2 A;  4BY6 C;  4BUG A;  1VQ5 T;  4C8Q E;  1JBM A;  3JSC A;  4M75 F;  4OB1 B;  5HY6 A;  1VQL T;  4NS5 A;  4C92 E;  2C06 A;  1ZHI A;  4OP0 A;  3JRZ A;  2LQ8 A;  3V8L A;  4HT9 A;  4M75 B;  3V7R A;  4BDZ A;  4LDY A;  4EMH A;  3VV0 A;  1KHI A;  3RKY A;  4X9D A;  5LJ3 d;  2A7Y A;  4QW2 A;  5FU6 B;  2XD0 A;  2CZ1 B;  1I8F A;  4LD9 K;  3FRN A;  2DTI A;  3OSV A;  4MML A;  4C0Z A;  1YIJ T;  3LLR A;  2Y4X A;  5GAN d;  5HKC A;  4EDU A;  4ZN1 A;  1N8R C;  2RO0 A;  1Y96 B;  1M4Z A;  2RM4 A;  4GY5 A;  5I2S A;  4C0D C;  2LDM A;  2RA2 A;  2XI9 A;  4FU6 A;  4FT4 A;  5KH6 A;  4PJO D;  4EMK B;  2LNV A;  5HK3 A;  1NJI C;  1OZ2 A;  4F7U G;  5CQX A;  3M57 A;  3JCM P;  3JAM E;  3RMQ A;  3A8O B;  4TVR A;  2I2L A;  4LD6 A;  2P0P A;  1QP2 A;  1YBY A;  1G3W A;  3ER0 A;  3OYJ A;  3LWH A;  5GMK l;  3JB9 G;  2WSC E;  3DB3 A;  4M78 G;  3FC3 A;  2P0K A;  1PSE A;  3EFS A;  4JUV A;  3OYG A;  4M7D G;  4V2S A;  4BD3 A;  1YI2 A;  4EPC A;  4J5Y A;  3CCR A;  2OTL A;  1KQS A;  1YI2 T;  1U1T A;  2PVG B;  1M1K U;  1B34 A;  2G3R A;  2KDS A;  4M7A A;  2DXU A;  1I4K 1;  3BFM A;  3FJP A;  3JCM J;  2GFA A;  4L6V 5;  3MET A;  3GP8 A;  2X4Y A;  5DM7 R;  1UEB A;  4C5I A;  1M90 U;  2YLB A;  4NL2 A;  3A8G B;  4F7U A;  2KQW A;  4E7I A;  1VQP A;  1WNL A;  5DLQ E;  2D6F A;  5GAO q;  3L1A A;  3VU3 C;  4MZT A;  1Y07 A;  2DIG A;  1VQP T;  2HD0 A;  5LJ3 g;  5LJ5 g;  4PJO C;  2DJZ A;  1YHQ A;  4C8Q C;  4ZGJ B;  4GLK A;  2DEQ A;  1UB4 A;  5CIU A;  3OS1 A;  2F5T X;  3C4S A;  4HKE A;  3T9N A;  5GAN g;  4R55 A;  3CMA A;  4C92 C;  1M5Q 1;  2CYZ B;  1FXX A;  3CMA T;  2QXF A;  1KG1 A;  4M7D A;  3X28 B;  5HK0 A;  1FWZ A;  4HCZ A;  5D6Y A;  5GAM g;  3CCQ A;  1LJO A;  2DK3 A;  5CVI A;  1N9S A;  2RJC A;  3DLM A;  2ZPI B;  4JDS A;  2DTO A;  2XID A;  4HA8 A;  4QQD A;  5FU7 B;  4Y28 E;  1BI2 A;  3VKI A;  2MWP A;  2HQE A;  3CEY A;  4J6X A;  5CAI A;  5GAN 5;  4OMF B;  3OYC A;  1VIE A;  2RI3 A;  2XG8 D;  3OYF A;  2LC4 A;  5DLO A;  3L2Q A;  2E41 A;  3CPF A;  1VQ8 A;  1WJR A;  2E12 A;  3CC2 A;  4RG2 A;  3CXC A;  3OYB A;  1VQ8 T;  4FT2 A;  4M77 E;  1XOV A;  2DXC A;  3OMG A;  3DLL A;  1UGQ B;  5LJ3 j;  4XU1 A;  2QQB A;  3M56 A;  1RI0 A;  2K5F A;  5IAY A;  4M7A G;  4N0A C;  3P8H A;  4PLL A;  5GAN j;  1KC8 U;  4EMG A;  2DXT A;  2XDP A;  3JCM W;  4OVA A;  3MEV A;  4RMO A;  3CBO A;  4J6Y A;  5CKB A;  1TH7 A;  1EIF A;  1OZ3 A;  1UGS B;  3OYI A;  4FSX A;  1KD1 C;  1K9M C;  4F7U F;  3PIP A;  2FYK A;  2HNI A;  3RUX A;  5J3B A;  3CME A;  5FLX E;  3CCV A;  1K73 C;  1H3Z A;  1W4S A;  5LJ3 e;  5LJ5 e;  4ATO A;  4NOY A;  4PLI A;  3OB9 A;  3A5Z B;  2GCX A;  2JVV A;  5M9O A;  3UDC A;  4JRP A;  4C5H A;  5GAN e;  2CGH A;  3OS5 A;  3JB9 D;  2B8A A;  2L89 A;  2EYQ A;  2LT4 A;  2XIC A;  3OSS C;  4M78 D;  3OYA A;  3L2Z A;  3M5A A;  3MEU A;  3QXE B;  4M7D F;  2DD4 A;  5KCH A;  1IRE B;  2EJF A;  2ZPE B;  3CPW A;  2ZPF B;  5GAM e;  1P92 A;  1BI3 A;  3MO8 A;  2P0Q A;  4OGE A;  1JRI A;  2JN0 A;  4Z02 A;  4B9W A;  4RKU E;  4C5E A;  4DA4 A;  1Q81 U;  4M7D B;  4II1 A;  4Q5W A;  4E47 A;  1OYX A;  4O5V A;  1YJN A;  1W2B A;  2V8I A;  2QA4 A;  1N9R A;  2E6N A;  3CBP A;  1R8O B;  3M4Y A;  4L5G A;  5GAN 4;  2QA4 T;  3VUZ A;  2QQS A;  1QP3 A;  2GFU A;  2H3J A;  3OYY A;  4FM4 B;  2EKO A;  4CRI A;  2RJF A;  4JRK A;  1M8V A;  3HFN A;  3QYH B;  2JUF A;  3SWN C;  1D3B A;  4N4G A;  2RHY A;  4DQ2 A;  2LRQ A;  3KBG A;  3PGG A;  2DZ9 A;  1RL2 A;  5CCA A;  4PJO E;  4C8Q A;  2BUD A;  3BW1 A;  4M75 D;  2VUB A;  3BDL A;  4M77 C;  2WAC A;  4QVC A;  3JCM X;  2AHJ B;  2HQX A;  3N5B B;  1WJS A;  4KBM B;  5GAN 8;  4IUQ A;  4E7J A;  5LJ3 h;  1XTD A;  3OS0 A;  2PU9 B;  2RHX A;  1VUB A;  5LJ5 d;  5D6X A;  2VGN A;  1XNI A;  4BI4 A;  5GAN h;  3GOX A;  1NPP A;  4A53 A;  4BDY A;  2PQW A;  3E19 A;  2DZC A;  3G7Z A;  3JB9 J;  4C0D B;  1N8R U;  4MZM A;  5CQY A;  1K8A C;  1NZ9 A;  2R58 A;  3LYI A;  4MMK A;  1GXI E;  4XQ3 A;  5GAM d;  2XKO C;  2LX9 A;  2QDY B;  3CD6 A;  2DD5 A;  2VYT A;  2WSF E;  3L42 A;  3ASK A;  4J7I A;  5GAO p;  1NJI U;  1BYM A;  1LNX A;  2X35 A;  1IZ6 A;  2KSS A;  1JB0 E;  5GMK m;  4M7A F;  1WJQ A;  3NTH A;  1XQH A;  1YIT A;  3MHX A;  3QYG B;  5LL6 S;  3X24 B;  3MP6 A;  3RMS A;  3PTA A;  3J80 E;  2E5Q A;  4N0A A;  4M7A B;  4XTU A;  2XK0 A;  2FL7 A;  4XTX A;  5D6W A;  5CR2 A;  4OB2 B;  4XU3 A;  4M75 C;  3KXT A;  2YRV A;  4LDV A;  1O9S A;  4P5N A;  2GQV A;  5CO7 A;  3HRS A;  4C0G A;  1KQS S;  1X75 C;  4FIB A;  1YJW A;  3CCR T;  4N4H A;  2VXF A;  3S3M A;  1YJW T;  2OTL T;  2RK1 A;  4QQ6 A;  4IUP A;  2LQK A;  3I55 A;  1MHN A;  3HPW A;  1VQM A;  4HCB A;  1D3B B;  3QPH A;  2L5Q A;  5IN1 A;  2K2V A;  1VQM T;  4IUT A;  4EMK C;  5LJ3 f;  5LJ5 f;  1Q86 C;  4C8Q B;  2CS7 A;  3QUI A;  3QZ9 B;  4M77 G;  5GAN f;  2QQ9 A;  1Q82 C;  3M4G A;  4C92 B;  1YHQ T;  2ZGW A;  3JCM b;  2RHZ A;  4BE2 A;  5I21 A;  1PSF A;  4E7H A;  3X25 B;  3S3N A;  5GAM f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...