2LCCA

Solution structure of rbbp1 chromobarrel domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
b'EDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT-rich interactive domain-containing protein 4A
publication title Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lccA00
3MP1A 3NTIA 1OZ3A 2QQSA 3MEWA 3L2VA 5KE2A 2WACA 2L89A 3OA6A 1RI0A 3Q1JA 3P8HA 3LLRA 3SD4A 2M1HA 4IUQA 4PL6A 4E7LA 3ZEHA 4C5HA 2LRQA 4BE1A 2FHDA 3FLGA 4PLIA 4IUVA 3L42A 4X34A 3OS2A 2K3XA 3MO8A 3E9FA 1N27A 4CRIA 3O8VA 2L8DA 2E6NA 1OI1A 2EQKA 3QIIA 1MHNA 3S6WA 4NS5A 1H3ZA 2M16A 3META 3PMTA 4PLLA 3L2RA 5FRNA 3FEOA 4A4GA 3OYBA 3MEUA 2D9TA 1G5VA 4N4GA 4Q5WA 3LYIA 3KUFA 3S3MA 2G3RA 2X4XA 2YRVA 3FC3A 3BDLA 3QBYA 3QKJA 2RJDA 4RG2A 3OYHA 3S3NA 5D6XA 4BE2A 2DAQA 2EQUA 2LDMA 4BDZA 3MEAA 2RO0A 3P8DA 2LTOA 4A4HA 4E7HA 2XK0A 3ASKA 3M9QA 4OVAA 3OQ5A 2QQRA 2LVMA 2R57A 4E7JA 2M0OA 4HCZA 5D6YA 4C5EA 2R58A 2RJEA 4ZTJA 2RJFA 4UC4A 1KHCA 2GFAA 3L2UA 1OZ2A 4A4FA 3ME9A 3OYAA 4GY5A 2CKKA 2JTFA 4E7KA 3S3OA 2RI3A 2RHUA 2X35A 2RJCA 2BKDN 4QVZA 3DB3A 1WJQA 2RHIA 2O4XA 5D6WA 3EAEA 3OY9A 4BDYA 3OMCA 4N4HA 5J39A 2EKOA 3H8ZA 3OYLA 3OMGA 4IUUA 4QQDA 2RI5A 1XNIA 5C6SA 4ZTFA 4C5IA 2GFUA 2RHYA 2P0KA 2X4WA 3OYGA 4IUPA 5IN1A 2VYTA 3MP6A 2K3YA 4LD6A 4E7IA 2EQMA 2DIGA 2R5MA 3H6ZA 2L3RA 4II1A 4QQGA 4C5GA 4EDUA 4FL6A 3OYNA 3OYEA 3OYIA 2F5KA 4IURA 5KE3A 2X4YA 3NTHA 4FU6A 3PFSA 3LGLA 3NTKA 2LCCA 4IKFA 3LX7A 4BE0A 1OYXA 3FDRA 2B8AA 3DLMA 2IG0A 2RHXA 5FROA 3OYDA 4BACA 3E9GA 3CEYA 3UWNA 2BUDA 2HQEA 3GOXA 2RI2A 4Z02A 2O4XB 5IAYA 3OYCA 3PMIA 3LGFA 2JZ2A 4QW2A 5J26A 1WJRA 4B9XA 2HQXA 4B9WA 3OS1A 5KH6A 4BD3A 4A4EA 3QJ6A 3DB4A 5KCHA 5M9OA 3OB9A 2E5QA 3PNWC 2R5AA 2GF7A 5C0MA 2BIVA 3OYFA 3L2WA 4QQ6A 3MEVA 1WGSA 2XDPA 3OYJA 5KCOA 3C4SA 3LH0A 3OYMA 3UT1A 4L59A 3F70A 2NLUA 3MP8A 2PQWA 2RHZA 5FRMA 2DIQA 3OS0A 5CIUA 2EQJA 2MWPA 2EFIA 3OYKA 4N4IA 4IUTA 3L2QA 1WJSA 1SSFA 2MWOA
chains in the Genus database with same CATH superfamily
4J6WA 3GNFB 3SD4A 2J7IA 3ZEHA 2CGHA 4OMFB 2BE9B 3L42A 1U8RA 2X3XD 4M77B 4QVCA 3J7AF 2L8DA 3VUBA 1RABB 2M9UA 3RR6A 3CCEA 1OOTA 3L2RA 2JM9A 1IRXA 4OB2B 1QWFA 3WXMB 1T0JA 5CCAA 2F2XA 3S3MA 3FC3A 3BDLA 1NYFA 1PNJA 3NMZC 4BE2A 4AFSC 1YNZA 2RO0A 1M1KR 4R56A 1G3SA 1Q86U 1AT1B 1I0CA 4C0FA 1T3SA 4C5EA 1K8AC 1HK9A 4ZTJA 1VIFA 3L1AA 3ME9A 3RIRA 5CQXA 3QZ5B 4HCKA 1VYUA 4PJOE 1TSFA 1PRLC 1WLPB 2YUNA 5I21A 1S72Q 4QQDA 3VJPA 2P0PA 4ME7A 2YHTA 1UE9A 1WXTA 4O6JA 4LDYA 5CQYA 2PVDB 3VS5A 2DYBA 5KYYA 5GAOn 4Z8AA 3CD6A 4Z88A 3TSZA 3V7CA 1EX4A 1WHLA 1VQNT 1I8FA 1M90C 1RACB 1I4K1 3JB9I 3NHNA 3EH2A 4J9DA 4N0AA 1I1JA 3JCMW 2HQEA 2CP5A 3I56A 5GAN2 1VQKA 1T0HA 1QVGA 5LJ5h 5KH6A 2O01E 4BD3A 2ATCB 4BY6B 2J05A 4FT4A 1GFDA 4M7AF 2PUOB 2XDBA 1AHJB 1JB0E 5D7UA 2BIVA 2DL5A 4C8QD 2WSCE 3CCVT 1W2BS 3H0HA 1N8RR 1JO8A 1G3WA 1QLYA 2HKNA 2QASA 3RKXA 1M1KU 2DF6A 4KGZB 1OX8A 4LE9A 4IUTA 4FM4B 4KH0B 4P5NA 1NEBA 1LJOA 2P84A 1Z9QA 2EYWA 1YJWT 1YITA 2K9GA 4OMOA 3SB2A 4DOVA 3JCMQ 3EFOA 2DJZA 1AWJA 1LOJA 2FHDA 3A98A 4JDSA 1VQOA 4J83A 5GANh 2PNIA 4A4KA 5I22A 2DFUA 5LL6S 3C12A 4X9DA 4M75F 2QQAA 1M2VB 2O9VA 1SHFA 2K5FA 3CC4Q 3M4GA 1LPLA 2KRMA 1WXUA 3TSWA 2LJ1A 4CC3A 3CPFA 5GJWB 1K4US 4A4HA 2LX7A 2M51A 3I5RA 5GMKe 2R58A 3G4SQ 2ZZDA 2OX7A 2EGEA 2QTVA 2KDSA 1GBQA 3QG1A 1PD1A 1YJ9A 1ARKA 2RD1A 2P0KA 4CC7A 1N8RU 2RK1A 1IB8A 4FT2A 1W2BP 4J9CA 1QMCA 2YSQA 2F5KA 3CC7Q 5KE3A 1X2KA 1D09B 2A0FB 5L8RE 3G6EQ 1V1CA 2VC8A 2PVOB 3CCJT 4JZ4A 4C0DC 5J26A 4B9XA 1VQ4Q 2DEQA 2OTLQ 1N9RA 1SKUB 1VQ8Q 4MDWA 4DBFA 3G7ZA 2ED0A 2JM8A 4PJJA 3PTAA 5KYYB 2K5LA 4KULA 1OX9A 5CIUA 4XU2A 1VQPT 1JJ2P 2HEQA 3L2ZA 3A8HB 4M77D 1UFFA 5CO7A 2WACA 2I2LA 4F7UG 3H41A 4E7LA 5GMKj 3G71T 5KYNA 3BE3A 1S72A 1VQ6Q 1OI1A 3S6WA 4NS5A 1H3ZA 1FXXA 5FRNA 4A4GA 2LC4A 1G5VA 2L3SA 2XDDA 3CCQA 5DLOA 3OYHA 2QDYB 2FRYA 1RAEB 3NFCA 2QI2A 1R0BG 5IH2A 3C0CA 4OB0B 4GBQA 4X1VA 5FU7B 3HRUA 3M53A 1TG0A 1Q82R 1M8MA 1RAGB 4DEXA 4A4FA 2VASA 2HQHA 5FWBA 3S3OA 3EFRA 1UB4A 1WJQA 3JCMc 3EG3A 3FJPA 3H8ZA 3CC2Q 2CZ0B 1XNIA 3QO3A 8AT1B 2EGCA 3CCSA 4YTLA 2PU9B 1O75A 4XU1A 4JS4A 4XU3A 1K73C 1RI9A 3RKYA 3NTKA 1VQMT 4IKFA 2EQIA 2OAUA 3CCMQ 3GOXA 1KD1R 5IAYA 2NUPA 1UECA 3UATA 3VYGA 1WJRA 2FO0A 4OGCA 4DBRA 4FYVB 2KXDA 3CCUQ 2D0NA 5KYWB 2CZ7B 2YRDA 3OB9A 3M58A 4RTWA 3DKMA 2DL8A 4MMKA 5GAMg 3CC4A 3HPWA 2ZPBB 1B3QA 1UDLA 4N4IA 2E3IA 1IZ6A 3SWNA 1AZGB 1KIKA 3HFNA 4OF1A 1Q82U 3G4SA 2LQKA 3V8LA 3FLGA 2JXBA 2M02A 2E41A 1NLOC 3CPWA 1YWOA 2K3XA 4C8QG 2VV5A 3O8VA 4BB7A 3PMTA 3CCLQ 3OBWA 3PVQA 1LVKA 2NYSA 2SEMA 3INZA 1Z9ZA 3S3NA 2KSSA 1OPLA 4LUDA 3CC7A 4FW1A 1IHVA 1SRLA 4F17A 4OVAA 3A8GB 3I55Q 4B6MA 1VQLQ 2HL3A 3GLXA 2P4TA 2QXFA 1KD1U 2QGFB 3D7SB 2RJFA 3L2UA 1KHCA 1TU0B 5GAMd 1A0NB 1FYNA 5CKDA 4C92G 2V26A 1VQ4A 1B34A 1QVFP 3EGXA 2GQVA 3R6NA 2P4RA 2E64A 3DB3A 4F7UF 1ZSGA 3EAEA 3OMGA 4NL3A 2DJQA 2FB7A 2YUPA 1VQ8A 2X4WA 2KYMA 1D0YA 3VS2A 3CMAQ 2XI9A 3JCMg 3IQLA 2RF0A 2L3RA 3SHWA 2DX1A 4IURA 2G6FX 2EYZA 2FZCB 4M7DB 3VV0A 2QK0A 1UGPB 4FYWB 4LDWA 3RBBB 3R6OA 4M78A 3QXEB 4WF2A 2PTKA 3HRTA 4MZMA 1MV3A 1GCQA 4PFOA 2LQ8A 1VQ6A 2LMJA 3E19A 4RG8A 4A4EA 2YRCA 2DM1A 4OB1B 4PFZA 3J81E 1E6HA 2E5KA 3O5ZA 1BB9A 2Z0WA 1AWWA 1NZ9A 3MP1A 4R0KA 2BE7D 3MEWA 1I5OB 1CSKA 2NUPB 3QWXX 3P8HA 1AVZC 4PL6A 1D1CA 2OJ2A 1BI1A 2KAFA 1XJWB 2DTOA 3JCMd 2AK5A 1ZSZC 2B86A 4X34A 1XTDA 3CC2A 3M0PA 3GIBA 2M16A 4PLLA 1K0XA 2CP0A 1MUZA 1W6XA 1GFCA 4PK4A 4M77G 1W70A 2K2VA 3CXCS 2DD5A 1D1AA 1OPKA 1NJIU 2DILA 3I56Q 3CCMA 4DOWA 1NG2A 4LUEA 1VQKQ 3HSBA 2F1LA 2D0QB 3FIFA 1TS9A 2NUTB 4BDYA 2DMOA 3ER0A 1FMKA 2MOXA 3VS0A 4TVRA 3CCRA 4C8QF 5C6SA 2LQNA 3EG9B 1RAHB 2V8KA 5FW9A 4C92B 4E7IA 4JUVA 2EW3A 2HKQB 2OTJQ 1U1TA 2EIFA 3OYEA 5FWCA 1R8OB 1ZLMA 3VS7A 1VQ5Q 2YT6A 2YLCA 4MZTA 1K9MR 1JQQA 2RI2A 4J9HA 1VQOQ 1YP5A 3CCJA 2K79A 4B9WA 4M7AA 1YI2Q 2CDTA 3CCLA 3GPLA 4QKUA 2L3PA 5KCOA 2WSFE 4RKUE 2Y90A 1N6AA 5GAOr 2HDAA 5GANf 5HY6A 3URGA 1VQLA 3NTIA 5CKFA 1HJDA 4M78B 3SEMA 2YDLA 4PLIA 1X6GA 3OW2P 3JCMe 1RUWA 2M0YA 4LN2A 3E9FA 5GAMj 1C6VX 1YJ9Q 4M75C 4M75A 1EIFA 3QIIA 1YBYA 2QEXT 2LNVA 2DK3A 4RTVA 3CMAA 4PJOA 1PRMC 2K2MA 2CT4A 3UF4A 1S1NA 3QKJA 1RLPC 3M59A 2DZ9A 4M7AE 2QQ9A 2AKLA 2YWWA 1K9MU 2O2OA 3LWIA 3VS6A 1DJ7B 5ECAA 3X26B 4J9IA 3A8LB 1YFNA 2V1QA 1VOMA 2XKOC 4IIMA 5GMKh 1KQSA 2VGMA 2FRWA 1XQHA 3RMQA 2FZGB 4M7DD 2CSQA 1TWBA 3TVTA 4NL2A 2GQIA 1PD0A 1PWTA 3OYIA 5KYUB 4M77F 1VYTA 4M75E 4PJLA 2PUKB 2CH4A 2KEAA 1FMVA 2ED1A 2DETA 3UWNA 3WVDB 3PMIA 1C0MA 2L5QA 1QVGS 3TEEA 4XTWA 2CREA 3G6ET 5GAN3 1FWZA 3KFVA 3SDZA 3CCQQ 2R5AA 1WI7A 5LJ5g 1HD3A 3VUZA 1NJIC 3CMET 2EQJA 3L2QA 4AT1B 3TCJA 1WHHA 4VUBA 1F1BB 1X43A 4EMKB 1RI0A 2BZ8A 4QVDA 5A0DA 4C5HA 1VQ7Q 4IUVA 2E3HA 3EGDA 3ZL7C 1K1ZA 3OS2A 4KUIA 4JJBA 2W10A 3CCSQ 2XD0A 1X75C 1R0CB 3EG0A 3LYIA 2JVVA 2OTJA 1JXMA 2C0TA 2RJDA 3VYHB 2DVEA 1ZQ1A 1ZUUA 2L3QA 4A53A 1P92A 1BU1A 2P0QA 1VQ5A 1M1FA 3VS4A 2E12A 2VUBA 1YHQT 1U06A 3X20B 3QDRB 2ZPIB 2HBPA 2RJEA 3TQ7P 4AG2C 1OZ2A 1MNEA 1G2BA 2J6KA 5GMKi 2HBWA 4C92D 1YI2A 5A0LA 1PG5B 2RHIA 1Y96B 5D6WA 3OY9A 5IHIA 1VIEA 5J39A 4PJOB 5LJ3g 1V29B 4IUUA 2Y4XA 4E6RA 1WZOA 1WPYA 3G1JA 4C5GA 2C0IA 2FVUA 2DXBA 1WX6A 4FU6A 1TTHB 1QP3A 2FYKA 5GJVB 1OYXA 2CP2A 2FL7A 2DL7A 2RQWA 3HTRA 2NWMA 2DXUA 4Z02A 3OYCA 2DZCA 3QHSA 1T3LA 3PE0A 4MZPA 4DQ2A 1KHIA 5I2SA 1K9MC 3MEVA 3M54A 4M78D 3GBQA 2COWA 3HP9A 1K9AA 2JMCA 2DIQA 3RDVA 1M5Q1 2EFIA 4J8OA 1HSQA 2XU8A 1LNXA 1YCSB 2COYA 1NPPA 1JJ2A 5LJ3d 2DXCA 1BKBA 2QQBA 1WQ7A 1TH7A 2C0OA 3DLLA 4IUQA 2XHCA 2D8HA 2JW4A 3RNJA 2QA4T 2HMAA 1BI3A 2FPFA 2E6NA 2EGAA 1YIJT 1MHNA 1Q86C 4RTUA 3MKDA 2LZ6B 1ABOA 3QZ9B 2X3WD 2K57A 3UDCA 4Q5WA 1ZX6A 2FPEA 3KUFA 5IHNA 2H3JA 2VXFA 5EC7A 2DAQA 2O31A 3HRSA 4JJCA 4XQ3A 2EBPA 2IPOB 3UPUA 2LVMA 2R57A 2M0OA 3EGDB 2GFAA 4F7UA 4E7KA 3PVLA 3JRZA 4HVUA 4N4HA 2A7YA 3CCVQ 3OYGA 4R55A 4IUPA 5IN1A 4XU0A 3EG2A 3H6ZA 2LCSA 3EFOB 1KC8R 1PHTA 1GL5A 2LCLA 1PSEA 1OU8A 4BE0A 2HNIA 1RL2A 4BACA 4L5GA 1EZZB 1VQ7A 2CS7A 4E7ZA 1M1KC 2ROTA 1KFZA 4M7DG 1D0XA 3LWHA 4ZGDB 5HKCA 5KCHA 1Y71A 3LW5E 1SRMA 2JS0A 4M7DC 3OYFA 3OYJA 1BBZA 1RLQC 1QKXA 2XICA 3CCET 1QCNA 4F7UE 1ABQA 2DRKA 2MAMA 2MWPA 5GAOm 5GAOl 3JB9D 3V8JA 1N5ZA 1SSFA 1HYOA 2DKGA 3T9NA 2L89A 3OA6A 3RKWA 2LP5A 5CKHA 4KT0E 4F04B 2IIMA 3CPWS 2D8JA 4Y28E 2F2VA 3UA6A 3OSSC 1H92A 5HK3A 3CCRQ 4DBHA 2EJFA 4D8KA 4F14A 1KC8U 4J9GA 1HXDA 4RG2A 4J5YA 1IGQA 1M3CA 2BZYA 3MEAA 4ZN1A 2ZPGB 2QQRA 4PJOD 1N8RC 3JCMP 2A36A 3CCJQ 1FX7A 4BI3A 4UC4A 4Y92A 3CD6T 2ABLA 2DL4A 2AT1B 4D8DA 4EPCA 3GNGA 1N9SA 2L2PA 4OMPA 3M5AA 4C8QC 2IVWA 1MMAA 1QVFA 5GAMh 1VQKT 1SHGA 2GFUA 2CP6A 3LH5A 1GBRA 1VQPQ 2R5MA 2DIGA 4II1A 1C1AA 3AHUA 4HXJA 3PIPA 4NOYA 4V2SA 4EIKA 5FU6B 2ZPEB 2COZA 1E6GA 4RTXA 1VQ9T 2LQWA 1Q81R 1YJNT 3G71Q 1H3HA 1MNDA 5LJ3j 3TREA 4C92C 1YITT 2HQXA 3M0SA 1NEGA 3CPWP 1K76A 2X4JA 2XIDA 2VWFA 1OULA 1UEBA 1VQOT 1X6BA 3QPHA 1D0ZA 1MMGA 1SSHA 1WHGA 3QYHB 1VQNA 1K8AR 3OS0A 3OYKA 2CH4W 4C8QE 1TUDA 2KI7A 2E65A 1H641 1Q7YR 2KT1A 1M9SA 2KK4A 1NE8A 2RB6A 3QDFA 3EFSA 1N27A 4M78G 3MCAB 2ZGWA 3CCVA 2K4YA 4M7DF 4XTZA 2J06A 4M4ZA 3JCMh 3JCMJ 3TU4K 1M90R 4XK8E 1I81A 1I5LA 4PNOA 4C92E 1YJWA 4FIBA 1VQMQ 2ESWA 2PZ1A 2YUQA 2YUOA 1UUEA 1WHMA 1Q81U 3ASKA 4E7JA 1WQWA 1ZSZA 4KGVB 1AD5A 3J80E 1PM3A 3OYAA 2CKKA 3HKSA 2JTFA 4JJDA 4KRTA 2LJ3A 1M4ZA 5GMKm 5GMKl 1G3YA 2DD4A 4BUGA 4J9FA 2DXTA 4AFUC 1JU5C 3SWNB 1AZEA 1RAFB 5AT1B 1TUCA 1K8AU 1BCOA 4M77C 1JBMA 3EG1A 2EQMA 3EHQA 4OMQA 4MDXA 1NBEB 1VA7A 3X28B 2KE9A 1IO6A 3OYYA 4HVVA 4GLKA 1Q7YU 5GAMe 2DERA 2VB6A 2B8AA 1UHFA 1E7OA 4HCBA 4ZNXA 1XOVA 1WXBA 2AHJB 1U3OA 2KBTA 2QYZA 2BTTA 4WCIA 3QJ6A 1RAAB 1NM7A 2O9SA 1Q82C 2E5QA 3V7RA 4XTXA 4RTTA 1S72T 1AWOA 3LH0A 2MYSA 3UT1A 3CQTA 3F70A 2DBKA 2NLUA 2PQWA 2HSPA 3CCQT 1KK7A 1B34B 4O5VA 2FEIA 1QKWA 3EGXB 4QT7A 5I11A 2DRMA 4ATOA 3BDUA 4EMHA 1BK2A 1MMDA 2ROLA 1QCOA 4M77E 4C92F 6AT1B 2DLPA 1D3BA 2LJ0A 2AIRB 4Y91A 3OW2A 1UTIA 1KD1C 3OYBA 4N4GA 1X27A 3JB9G 1VQPA 2EYXA 5IXBA 2GGRA 1OV3A 4BY6C 2MK5A 2OI3A 5I2MA 2EYQA 3ZBDA 3CXCP 4JJNK 3CCST 4A63B 3V7SA 1WFWA 2A3LA 4RCBA 3A5ZB 1GXIE 4FSXA 2EPDA 5A0GA 3G71A 1M3BA 2EKHA 2DO3A 2KRSA 3KXTA 2AKKA 4XTVA 3HFOA 2FZKB 3JAME 1J3TA 4QVZA 3VU3C 3MHXA 3MPUB 1KQSS 3OMCA 3M0UA 2KRNA 4M78F 4ZTFA 2RHYA 4X9CA 1UJ0A 2HD0A 2AZVA 3HHTB 4JRIA 4EDUA 2JUFA 4PJOG 3OYNA 3CC4T 2KMTA 2RM4A 2X4YA 3CBPA 3I35A 3LGLA 3FDRA 3OYDA 3AT1B 3G4ST 3LGFA 4DEYA 5DLQE 1AWXA 1U5SA 4IIOA 4FCYA 2GF7A 1Q81C 1WGSA 3ULRB 1PKSA 3CBOA 1SEMA 2MI6A 1VQMA 5FRMA 2ZCFB 3M55A 1OZ3A 3CC7T 1OU9A 3RESA 5GAN7 2K7AA 1KQ2A 1GRIA 2D6FA 1QW1A 1Y0MA 5IXFA 2F2WA 4RMOA 1KQSP 2RH2A 3FEOA 2GTOA 1VQ4T 2D9TA 2ENMA 1IXDA 1Q7YC 3JSCA 1K73R 3OS5A 1VUBA 1I07A 2G3RA 2OTLT 2D1XA 2MPXC 1VQ8T 3X24B 1QQJA 2XK0A 4M7AB 2JT4A 3JB9J 1X6OA 1D3BB 2YLBA 4ELZC 3EH1A 1RADB 2DE0X 2ZPHB 4JLIA 1JEGA 5L23A 4N0AC 2BKDN 4K11A 3OYLA 4DA4A 1NLPC 5GANg 3FJ5A 1VQ6T 4LD6A 1WIEA 2E4HA 4FW2A 3JB9F 3MJXA 1OQKA 2RQRA 3E2UA 4HCCA 4AMCA 3JCMb 5LJ5d 1Q95G 4M75B 4E7SA 1VQ9A 3RUXA 1TXQA 2IG0A 4C0GA 1YJNA 3VKIA 3EGUA 1QVGP 2YXYA 1WDXA 2K6DA 2GCXA 2KNBB 2V1RA 4JRQA 4JLGA 3OS1A 2QEXQ 5FU7C 2LT4A 1K73U 3M0RA 1IGUA 4XAXB 4JZ3A 3CC2T 1ZHIA 1QWEA 4J9BA 2CUBA 2J6FA 2AZSA 1W2BA 3MP8A 2JOYA 5FLXE 2V8IA 1G8XA 4JRPA 3M9QA 4PJOF 1PC0A 1JJ2S 3JCMV 1D1BA 5CKBA 5KE2A 3PT9A 5GANd 3M56A 4BE1A 2A37A 1JXOA 3CCMT 2FPDA 3MO8A 5LJ3h 4WTOB 4Z89A 4AFZC 3JB9H 1ZA1B 4F16A 3CCUT 1IREB 4FYYB 2A08A 2XMFA 2RA2A 3CCRT 1AOJA 2DTHA 3M0TA 1MGQA 2Y4YA 2EQUA 5KYWA 2JN0A 2A28A 9ATCB 5GAOp 5GAMf 2FG0A 4HCZA 5D6YA 1Y57A 4JRKA 1KQ1A 2RI3A 2I0NA 3WVEB 1YWPA 2CZ6B 1PCXA 2O4XA 1IHWA 4EMGA 1KSWA 2DVJA 3REBB 4C5IA 1G83A 1VQNQ 3CMEQ 4LNPA 3MP6A 3U23A 4AFQC 2KT8A 5A2QE 4OMLA 1NYGA 3SFMA 3CCLT 4J7FA 3BY7A 4PJNA 2KR3A 4HT8A 2RQTA 4LXCA 3RMSA 5LJ5e 3E9GA 3A8OB 3I55T 1VQLT 4ZGEB 2MF2A 4HKEA 5HK0A 2CYZB 2W0ZA 5FU6C 3H0IA 4OGEA 2DEUA 2KROA 2XDPA 1M27C 2ZPFB 3ZFJA 3QYGB 4JPBW 1BIAA 5CR2A 1YJWQ 1M1GA 2RHZA 3VS3A 3CMAT 1YHQQ 1QCFA 2MWOA 3QUIA 3JCMf 1WHKA 5GANe 3M0QA 2M1HA 4ZN3A 3H0FA 2LRQA 3A8MB 5CAIA 3NPFA 4M7DA 2EWNA 1UGSB 4ESRA 2VGNA 1G3TA 1U1SA 4M7AD 2QAZA 3C95A 4BI4A 2X4XA 2YRVA 3QBYA 1UGVA 2JMAA 4RTZA 7AT1B 2KXCA 5LJ3e 4KGXB 3E1SA 1ACMB 3EHRA 1WA7A 1UGRB 3P8DA 3I9QA 3OQ5A 4PFPA 4PJMA 4XTYA 5LJ5j 3FRNA 2HAXA 4OP0A 2QEXA 1Y07A 1QVFS 1AEYA 2BZXA 1UJYA 2RI5A 3QSUA 1M2OA 2JS2A 4M75D 4C0DB 2VKNA 4CC2A 2RPNA 2CT3A 4KH1B 3JCMX 3NTHA 4M7DE 2GTJA 2E6ZA 3PFSA 5KYXA 1JRIA 2LCCA 3JV3A 4RCCA 3SWNC 2GNCA 5FROA 2L0AA 2KQWA 3CEYA 1ZUYA 5J3BA 2QA4Q 4C8QA 2KY9A 3I56T 2O4XB 5GANj 2JZ2A 2E10A 1YIJQ 2GBQA 2LT1A 1LCKA 1PSFA 2X51A 3OBYA 4FSSA 3L2WA 4ELYC 3A1PA 3M4YA 4L59A 2NUTA 1BCMA 2ECZA 3HL8A 1KG1A 1BIBA 2PVGB 4F7UB 2OTJT 4E47A 1WJSA 2HL5C 3EG9A 5DY9A 2QQSA 3L2VA 4C92A 1VQ5T 1MMNA 4L6V5 4RUGA 3G6EA 3H9NA 2MMPA 4CRIA 2EVRA 5IT9E 5DM7R 2EQKA 3RERA 1WYXA 3META 2EAYA 1YI2T 2CUDA 3NGPA 3CMEA 1K0SA 2OTLA 1TUGB 1ZUKA 2VXEA 2QTXA 3GF5A 5D6XA 5HCKA 4HVWA 2E1HA 4FYXB 4BDZA 4E7HA 3THKA 2LX9A 3BW1A 4OB3B 5CVIA 3PIOA 1Y7XA 1V76A 4E2FB 3I5SA 1ZA2B 1WNLA 2RQVA 4GY5A 1BI0A 4KUDK 3M57A 2RHUA 2X35A 2X9HA 2RJCA 4M78C 1NJIR 1O9SA 1GCQC 1YJ9T 2HSEB 2SRCA 4XTUA 4AG1C 2JTEA 3CCEQ 5IHKA 2RMOA 2VYTA 3P8BB 1H8KA 2MCNA 1B07A 1UHCA 2QDLA 1YHQA 2VVKA 1UGQB 1VYVA 1OEBA 4D6WA 2H8HA 2DPPB 4J6XA 1BYMA 3LX7A 1CKAA 2RHXA 4GLMA 1TOVA 5CKEA 3C94A 4A54A 3CBMA 1MV0B 1X2QA 3X25B 3DB4A 3VRYA 2HCKA 1B7TA 4M77A 1M8VA 4RTYA 3PNWC 4OMNA 5C0MA 2DTIA 1ZBXA 2EJGA 2RQUA 4QQ6A 2ZAEA 3V8KA 5EG2A 2JTMA 4CI0C 4BI8B 3KBGA 2E70A 5KYXB 1W1FA 2JNGA 4M78E 4HA8A 2DBMA 2C06A 1QP2A 2XG8D 2J6OA 4C8QB 3CD6Q 1KC8C 8ATCB 3Q1JA 1SPKA 2EYYA 3LLRA 1QVPA 4OMMA 2H3EB 4C0ZA 2MIOA 5KYUA 1UG1A 4LDVA 5CK9A 1ZBJA 1BI2A 1M90U 1YN8A 1SF9A 2NUZA 3OW2S 2O88A 1X69A 2CP3A 2HZYA 3BFMA 3MEUA 3CCUA 3VS1A 2DL3A 1M30A 2JJ9A 3PGGA 5AYFA 1RAIB 3UA7A 1X01A 1PKTA 2LNHB 1GCPA 1NPRA 4KBMB 2F69A 2K3BA 2K5IA 4HT9A 2LDMA 1VQ9Q 2LTOA 4J7IA 5GAN8 3CXCA 5LJ5f 1YJNQ 4J9EA 2F5TX 1W4SA 2RN8A 2CSIA 1CKBA 2CP7A 5GAOq 2QA4A 1YITQ 1WHJA 5GAN4 1YIJA 2WSEE 2DYIA 5GAN6 4M7AG 4LDXA 1VQ7T 4EMKC 2EKOA 4ORZA 4EMKA 2DNUA 4M7AC 4ANJA 1YCYA 4CC4B 2DA9A 2QGGA 2EJ9A 2K3YA 2V8JA 4QQGA 3GP8A 4FL6A 1R77A 2KGTA 1SG5A 4MMLA 2QG9B 4PKCC 3N5BB 2RK2A 3DLMA 3QWYA 1Q86R 3I55A 2BUDA 2KYBA 2RNAA 4LD9K 4QW2A 1KJWA 4M75G 1EFNA 4ZGJB 3REAB 5M9OA 4LDUA 5GAN5 2KVQG 2CZ1B 3FB9A 4J6YA 1M3AA 3QJYA 3OSVA 3C4SA 3OYMA 1Y96A 5LJ3f 1ZSZB 4PJOC 3VRZA 1M2VA 1FMWA 2OAWA 4DBQA 4JS5A
chains in the Genus database with same CATH topology
3MP1A 4PJOF 1JJ2S 3JCMV 2DKGA 5CKBA 3MEWA 3T9NA 5KE2A 2L89A 3OA6A 3RKWA 3PT9A 5GANd 5CKHA 3P8HA 4J6WA 3GNFB 3SD4A 4PL6A 3M56A 3ZEHA 4BE1A 2CGHA 4OMFB 1BI1A 2KAFA 4KT0E 2DTOA 3CPWS 3L42A 3JCMd 3CCMT 4X34A 4Y28E 1U8RA 3MO8A 5LJ3h 4M77B 4QVCA 1XTDA 3J7AF 3OSSC 5HK3A 3CC2A 2L8DA 3VUBA 3GIBA 2EJFA 3JB9H 2M9UA 2M16A 4PLLA 3CCEA 3L2RA 4OB2B 3WXMB 3CCUT 1IREB 5CCAA 3S3MA 1KC8U 4M77G 2RA2A 1HXDA 3BDLA 3FC3A 4RG2A 3CCRT 2DTHA 1MGQA 2Y4YA 2EQUA 4J5YA 4BE2A 2JN0A 2K2VA 3MEAA 2RO0A 4ZN1A 5GAOp 5GAMf 3CXCS 2DD5A 2ZPGB 4R56A 1G3SA 1Q86U 2QQRA 4PJOD 4C0FA 4HCZA 5D6YA 4C5EA 3CCMA 3JCMP 4DOWA 1N8RC 1NJIU 1FX7A 1HK9A 4BI3A 4UC4A 4ZTJA 1VIFA 1K8AC 3CD6T 3HSBA 4JRKA 3L1AA 3ME9A 3RIRA 4EPCA 1KQ1A 3GNGA 1N9SA 2RI3A 3QZ5B 5CQXA 2D0QB 4PJOE 3WVEB 2CZ6B 3FIFA 3M5AA 4C8QC 2O4XA 2IVWA 4BDYA 3ER0A 4EMGA 1QVFA 5I21A 4TVRA 4QQDA 3VJPA 5GAMh 2P0PA 3CCRA 1VQKT 4ME7A 4C8QF 5C6SA 2YHTA 4C5IA 2GFUA 2V8KA 3MP6A 4C92B 4O6JA 5A2QE 4LDYA 4JUVA 2R5MA 2DIGA 3SFMA 4II1A 4E7IA 1U1TA 3CCLT 4J7FA 2EIFA 3OYEA 3PIPA 3AHUA 5CQYA 2PVDB 3BY7A 4NOYA 4V2SA 1R8OB 5FU6B 2ZPEB 5GAOn 3CD6A 3V7CA 1VQNT 4HT8A 1I8FA 2YLCA 3RMSA 1I4K1 4MZTA 5LJ5e 3JB9I 1M90C 1VQ9T 1YJNT 3E9GA 3A8OB 4N0AA 3I55T 3JCMW 1VQLT 2HQEA 4ZGEB 2MF2A 2RI2A 5LJ3j 3I56A 1Q81C 3CCJA 5GAN2 3TREA 4C92C 1YITT 4HKEA 1VQKA 2HQXA 4B9WA 1QVGA 5LJ5h 5KH6A 4M7AA 5HK0A 2O01E 4BD3A 2CYZB 4BY6B 2X4JA 2XIDA 4FT4A 5FU6C 4OGEA 1VQ9A 4M7AF 2PUOB 2XDBA 1AHJB 1UEBA 1VQOT 3CCLA 1JB0E 2BIVA 3GPLA 4C8QD 3QPHA 2XDPA 2WSCE 2WSFE 2ZPFB 4RKUE 3ZFJA 5KCOA 3CCVT 2Y90A 3QYGB 5CR2A 1BIAA 1W2BS 1M1GA 1N6AA 3QYHB 5GAOr 1G3WA 2RHZA 3RKXA 1VQNA 3CMAT 1M1KU 3OS0A 5GANf 3OYKA 4IUTA 4C8QE 5HY6A 3URGA 4FM4B 1VQLA 2MWOA 4P5NA 3NTIA 3QUIA 2E65A 1LJOA 5CKFA 4M78B 3JCMf 1H641 1YJWT 1YITA 5GANe 3SB2A 4DOVA 3JCMQ 2M1HA 2DJZA 4ZN3A 1LOJA 1M9SA 2KK4A 2LRQA 3A8MB 1NE8A 2FHDA 5CAIA 2RB6A 4PLIA 3EFSA 3JCMe 4JDSA 1VQOA 3E9FA 5GAMj 1N27A 4M78G 4M75C 4J83A 4M7DA 5GANh 2EWNA 3MCAB 1EIFA 2ZGWA 3QIIA 4M75A 4A4KA 3CCVA 1UGSB 2K4YA 1YBYA 2VGNA 3C12A 4X9DA 2LNVA 2DK3A 1G3TA 5LL6S 4XTZA 1U1SA 4M7DF 4M75F 4M7AD 4BI4A 3C95A 2QQAA 3JCMh 3CMAA 4PJOA 3JCMJ 2X4XA 3TU4K 2YRVA 3QKJA 3QBYA 4XK8E 2K5FA 1I81A 1I5LA 4PNOA 3M4GA 4C92E 5LJ3e 3M59A 2DZ9A 4FIBA 2QQ9A 1YJWA 4M7AE 3E1SA 3CPFA 1UGRB 3P8DA 4A4HA 1Q81U 1K9MU 3ASKA 3OQ5A 3LWIA 4E7JA 1DJ7B 1WQWA 5GMKe 2R58A 3X26B 4XTYA 3J80E 2ZZDA 5LJ5j 3OYAA 3A8LB 2CKKA 3FRNA 2JTFA 3HKSA 2HAXA 4OP0A 2QEXA 1Y07A 2KDSA 1M4ZA 5GMKm 5GMKl 2XKOC 1G3YA 5GMKh 2DD4A 3QG1A 4BUGA 1QVFS 1KQSA 1YJ9A 2DXTA 2VGMA 2RI5A 1XQHA 3SWNB 2RD1A 3QSUA 3RMQA 2P0KA 4M7DD 1N8RU 4M75D 2RK1A 1K8AU 4M77C 1JBMA 4C0DB 4NL2A 2EQMA 4FT2A 4MDXA 3OYIA 3X28B 2F5KA 4M77F 3OYYA 3JCMX 4GLKA 3NTHA 5KE3A 4M7DE 2E6ZA 4M75E 2PUKB 3PFSA 1Q7YU 5GAMe 1JRIA 2LCCA 4RCCA 5L8RE 2B8AA 3SWNC 5FROA 2KQWA 3CEYA 3UWNA 1XOVA 3WVDB 4HCBA 5J3BA 2VC8A 4C8QA 2KY9A 2PVOB 3I56T 2AHJB 2O4XB 3CCJT 3PMIA 4C0DC 5GANj 2JZ2A 2L5QA 2E10A 5J26A 3TEEA 4B9XA 1QVGS 2LT1A 3QJ6A 4XTWA 1PSFA 2DEQA 3G6ET 1Q82C 3OBYA 1FWZA 5GAN3 2E5QA 3SDZA 3V7RA 1N9RA 2R5AA 4XTXA 3L2WA 1S72T 4ELYC 4MDWA 5LJ5g 3G7ZA 3LH0A 3M4YA 3PTAA 3UT1A 3VUZA 4L59A 3F70A 1NJIC 2NLUA 2PQWA 3CMET 3HL8A 1KG1A 2K5LA 1BIBA 4KULA 2EQJA 2PVGB 5CIUA 4XU2A 4F7UB 1VQPT 3L2ZA 3L2QA 2OTJT 4E47A 3CCQT 1WJSA 3TCJA 1B34B 3A8HB 4M77D 4O5VA 4VUBA 5DY9A 2QQSA 5CO7A 3L2VA 4ATOA 2WACA 4C92A 4EMKB 1RI0A 2I2LA 3BDUA 1VQ5T 4EMHA 4QVDA 5A0DA 4L6V5 4F7UG 4C5HA 4E7LA 4M77E 4C92F 3G6EA 1D3BA 4IUVA 5GMKj 3G71T 1K9MC 3OS2A 4KUIA 2MMPA 4CRIA 5IT9E 5DM7R 1S72A 4Y91A 1OI1A 2EQKA 3S6WA 3OW2A 3RERA 4NS5A 1H3ZA 1FXXA 3META 2EAYA 5FRNA 1KD1C 4A4GA 3OYBA 1YI2T 2LC4A 3JB9J 2XD0A 1X75C 1G5VA 4N4GA 3CMEA 3LYIA 3JB9G 1VQPA 2JVVA 2XDDA 2OTLA 3CCQA 2OTJA 5DLOA 3OYHA 2RJDA 2QDYB 4BY6C 2VXEA 2DVEA 2QTXA 3GF5A 5D6XA 5I2MA 3VYHB 1ZQ1A 2EYQA 3NFCA 2QI2A 3ZBDA 4A53A 4JJNK 1P92A 4OB0B 3CCST 2P0QA 2E1HA 1VQ5A 4BDZA 1M1FA 3V7SA 2A3LA 4RCBA 2E12A 2VUBA 4E7HA 3A5ZB 2LX9A 3BW1A 4OB3B 1GXIE 5CVIA 1YHQT 4FSXA 3X20B 3QDRB 5FU7B 5A0GA 3PIOA 3G71A 2ZPIB 2RJEA 1Y7XA 2HBPA 3HRUA 2DO3A 3M53A 1OZ2A 3KXTA 4A4FA 4XTVA 1WNLA 4GY5A 1BI0A 3HFOA 5GMKi 3M57A 3JAME 3S3OA 4KUDK 3EFRA 4C92D 1YI2A 1UB4A 2RHUA 2X35A 2RJCA 5A0LA 4QVZA 3VU3C 4M78C 1WJQA 1Y96B 2RHIA 3MHXA 5D6WA 3JCMc 3OY9A 1KQSS 1VIEA 3OMCA 3FJPA 1O9SA 5J39A 3H8ZA 5LJ3g 4PJOB 1V29B 2CZ0B 1YJ9T 4IUUA 2Y4XA 4XTUA 1XNIA 4M78F 4ZTFA 3QO3A 1WPYA 2RHYA 4X9CA 2HD0A 2QEXT 3CCSA 2VYTA 3P8BB 4YTLA 3HHTB 4JRIA 4C5GA 2PU9B 4EDUA 2JUFA 4PJOG 3OYNA 1O75A 1YHQA 4XU1A 3CC4T 2KMTA 2FVUA 2RM4A 2DXBA 2X4YA 1UGQB 4JS4A 4FU6A 4XU3A 1K73C 3CBPA 4D6WA 3LGLA 3RKYA 3NTKA 1VQMT 1QP3A 2DPPB 2FYKA 3LX7A 4J6XA 4IKFA 1OYXA 1BYMA 3FDRA 2FL7A 2OAUA 2RHXA 3OYDA 2DXUA 5CKEA 3GOXA 3C94A 4A54A 3CBMA 4Z02A 5IAYA 3OYCA 3G4ST 3VYGA 3LGFA 1WJRA 2DZCA 4OGCA 3X25B 5DLQE 3QHSA 2CZ7B 3DB4A 3OB9A 3M58A 4M77A 1M8VA 4MZPA 3PNWC 3DKMA 4DQ2A 5C0MA 2GF7A 1KHIA 2DTIA 1ZBXA 2EJGA 4MMKA 4QQ6A 3MEVA 1WGSA 3M54A 4M78D 5I2SA 5GAMg 3HPWA 3V8KA 3CC4A 3CBOA 3HP9A 5EG2A 2JTMA 4CI0C 4BI8B 3KBGA 2MI6A 2E70A 2ZPBB 1VQMA 2DIQA 5FRMA 1M5Q1 2EFIA 2JNGA 4J8OA 4N4IA 3SWNA 1IZ6A 4M78E 4HA8A 2ZCFB 2XU8A 3HFNA 1LNXA 2C06A 1QP2A 3M55A 4OF1A 1OZ3A 1NPPA 2XG8D 1JJ2A 4C8QB 3G4SA 1Q82U 5LJ3d 2DXCA 3CC7T 1BKBA 1KC8C 2QQBA 3Q1JA 1WQ7A 1TH7A 2LQKA 3LLRA 1QVPA 3DLLA 4IUQA 2XHCA 4C0ZA 3V8LA 3FLGA 3RESA 5GAN7 1KQ2A 4LDVA 5CK9A 2QA4T 2E41A 3CPWA 2K3XA 1BI3A 1BI2A 4C8QG 1M90U 2D6FA 2VV5A 3O8VA 3OW2S 1QW1A 2E6NA 1YIJT 1MHNA 4BB7A 1Q86C 3PMTA 4RMOA 2RH2A 3FEOA 1VQ4T 3BFMA 3MEUA 3QZ9B 3UDCA 2D9TA 2K57A 3PGGA 4Q5WA 5AYFA 3CCUA 1Q7YC 3JSCA 3KUFA 1VUBA 3OS5A 2G3RA 1X01A 2H3JA 3OBWA 2OTLT 2VXFA 3INZA 1NPRA 4KBMB 3S3NA 2F69A 2KSSA 2K5IA 1VQ8T 3CC7A 2DAQA 3HRSA 4HT9A 2LDMA 4XQ3A 3X24B 2LTOA 4J7IA 5GAN8 2XK0A 4M7AB 5LJ5f 3CXCA 3M9QA 3UPUA 4OVAA 2F5TX 3A8GB 1W4SA 2LVMA 2R57A 2M0OA 2P4TA 2QXFA 1X6OA 1D3BB 2YLBA 3GLXA 4ELZC 5GAOq 2QA4A 1KD1U 2RJFA 3L2UA 1KHCA 2GFAA 5GAN4 5GAMd 1YIJA 4F7UA 5CKDA 4E7KA 2ZPHB 4JLIA 4C92G 2WSEE 5GAN6 1VQ4A 1B34A 4N0AC 4LDXA 4M7AG 2GQVA 2BKDN 2E64A 3DB3A 3JRZA 4F7UF 1VQ7T 3EAEA 4EMKC 4N4HA 3OYLA 4DA4A 2EKOA 4EMKA 3OMGA 2A7YA 4NL3A 2FB7A 5GANg 4M7AC 1VQ8A 1VQ6T 1YCYA 3OYGA 2X4WA 4R55A 4IUPA 5IN1A 4XU0A 2EJ9A 2XI9A 2K3YA 4LD6A 2V8JA 3JCMg 3H6ZA 4QQGA 3GP8A 2L3RA 4FL6A 3JB9F 2LCLA 4IURA 1PSEA 4HCCA 3JCMb 4MMLA 4BE0A 4M7DB 5LJ5d 4M75B 3VV0A 4PKCC 3N5BB 2HNIA 2RK2A 3DLMA 1RL2A 1UGPB 2IG0A 3RUXA 3VKIA 4LDWA 4C0GA 4L5GA 4BACA 1YJNA 3I55A 2BUDA 3R6OA 1VQ7A 2CS7A 3QXEB 4M78A 4WF2A 2GCXA 1M1KC 4LD9K 3HRTA 4MZMA 4QW2A 4JRQA 2LQ8A 1VQ6A 4JLGA 3E19A 3OS1A 4RG8A 4M7DG 4M75G 5FU7C 4A4EA 3LWHA 4ZGDB 4ZGJB 5HKCA 5KCHA 1Y71A 2LT4A 3LW5E 5M9OA 1K73U 4LDUA 5GAN5 4M7DC 4XAXB 2KVQG 2CZ1B 3FB9A 4J6YA 4OB1B 3OYFA 3OYJA 3CC2T 3QJYA 3OSVA 3C4SA 1ZHIA 2XICA 3CCET 3OYMA 4F7UE 3J81E 1W2BA 2MAMA 1Y96A 3MP8A 5LJ3f 2JOYA 5FLXE 4PJOC 2V8IA 2MWPA 5GAOm 5GAOl 3JB9D 3V8JA 4JS5A 1NZ9A 4JRPA 1SSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP1 A;  3NTI A;  1OZ3 A;  2QQS A;  3MEW A;  3L2V A;  5KE2 A;  2WAC A;  2L89 A;  3OA6 A;  1RI0 A;  3Q1J A;  3P8H A;  3LLR A;  3SD4 A;  2M1H A;  4IUQ A;  4PL6 A;  4E7L A;  3ZEH A;  4C5H A;  2LRQ A;  4BE1 A;  2FHD A;  3FLG A;  4PLI A;  4IUV A;  3L42 A;  4X34 A;  3OS2 A;  2K3X A;  3MO8 A;  3E9F A;  1N27 A;  4CRI A;  3O8V A;  2L8D A;  2E6N A;  1OI1 A;  2EQK A;  3QII A;  1MHN A;  3S6W A;  4NS5 A;  1H3Z A;  2M16 A;  3MET A;  3PMT A;  4PLL A;  3L2R A;  5FRN A;  3FEO A;  4A4G A;  3OYB A;  3MEU A;  2D9T A;  1G5V A;  4N4G A;  4Q5W A;  3LYI A;  3KUF A;  3S3M A;  2G3R A;  2X4X A;  2YRV A;  3FC3 A;  3BDL A;  3QBY A;  3QKJ A;  2RJD A;  4RG2 A;  3OYH A;  3S3N A;  5D6X A;  4BE2 A;  2DAQ A;  2EQU A;  2LDM A;  4BDZ A;  3MEA A;  2RO0 A;  3P8D A;  2LTO A;  4A4H A;  4E7H A;  2XK0 A;  3ASK A;  3M9Q A;  4OVA A;  3OQ5 A;  2QQR A;  2LVM A;  2R57 A;  4E7J A;  2M0O A;  4HCZ A;  5D6Y A;  4C5E A;  2R58 A;  2RJE A;  4ZTJ A;  2RJF A;  4UC4 A;  1KHC A;  2GFA A;  3L2U A;  1OZ2 A;  4A4F A;  3ME9 A;  3OYA A;  4GY5 A;  2CKK A;  2JTF A;  4E7K A;  3S3O A;  2RI3 A;  2RHU A;  2X35 A;  2RJC A;  2BKD N;  4QVZ A;  3DB3 A;  1WJQ A;  2RHI A;  2O4X A;  5D6W A;  3EAE A;  3OY9 A;  4BDY A;  3OMC A;  4N4H A;  5J39 A;  2EKO A;  3H8Z A;  3OYL A;  3OMG A;  4IUU A;  4QQD A;  2RI5 A;  1XNI A;  5C6S A;  4ZTF A;  4C5I A;  2GFU A;  2RHY A;  2P0K A;  2X4W A;  3OYG A;  4IUP A;  5IN1 A;  2VYT A;  3MP6 A;  2K3Y A;  4LD6 A;  4E7I A;  2EQM A;  2DIG A;  2R5M A;  3H6Z A;  2L3R A;  4II1 A;  4QQG A;  4C5G A;  4EDU A;  4FL6 A;  3OYN A;  3OYE A;  3OYI A;  2F5K A;  4IUR A;  5KE3 A;  2X4Y A;  3NTH A;  4FU6 A;  3PFS A;  3LGL A;  3NTK A;  2LCC A;  4IKF A;  3LX7 A;  4BE0 A;  1OYX A;  3FDR A;  2B8A A;  3DLM A;  2IG0 A;  2RHX A;  5FRO A;  3OYD A;  4BAC A;  3E9G A;  3CEY A;  3UWN A;  2BUD A;  2HQE A;  3GOX A;  2RI2 A;  4Z02 A;  2O4X B;  5IAY A;  3OYC A;  3PMI A;  3LGF A;  2JZ2 A;  4QW2 A;  5J26 A;  1WJR A;  4B9X A;  2HQX A;  4B9W A;  3OS1 A;  5KH6 A;  4BD3 A;  4A4E A;  3QJ6 A;  3DB4 A;  5KCH A;  5M9O A;  3OB9 A;  2E5Q A;  3PNW C;  2R5A A;  2GF7 A;  5C0M A;  2BIV A;  3OYF A;  3L2W A;  4QQ6 A;  3MEV A;  1WGS A;  2XDP A;  3OYJ A;  5KCO A;  3C4S A;  3LH0 A;  3OYM A;  3UT1 A;  4L59 A;  3F70 A;  2NLU A;  3MP8 A;  2PQW A;  2RHZ A;  5FRM A;  2DIQ A;  3OS0 A;  5CIU A;  2EQJ A;  2MWP A;  2EFI A;  3OYK A;  4N4I A;  4IUT A;  3L2Q A;  1WJS A;  1SSF A;  2MWO A; 
#chains in the Genus database with same CATH topology
 4J6W A;  3GNF B;  3SD4 A;  2J7I A;  3ZEH A;  2CGH A;  4OMF B;  2BE9 B;  3L42 A;  1U8R A;  2X3X D;  4M77 B;  4QVC A;  3J7A F;  2L8D A;  3VUB A;  1RAB B;  2M9U A;  3RR6 A;  3CCE A;  1OOT A;  3L2R A;  2JM9 A;  1IRX A;  4OB2 B;  1QWF A;  3WXM B;  1T0J A;  5CCA A;  2F2X A;  3S3M A;  3FC3 A;  3BDL A;  1NYF A;  1PNJ A;  3NMZ C;  4BE2 A;  4AFS C;  1YNZ A;  2RO0 A;  1M1K R;  4R56 A;  1G3S A;  1Q86 U;  1AT1 B;  1I0C A;  4C0F A;  1T3S A;  4C5E A;  1K8A C;  1HK9 A;  4ZTJ A;  1VIF A;  3L1A A;  3ME9 A;  3RIR A;  5CQX A;  3QZ5 B;  4HCK A;  1VYU A;  4PJO E;  1TSF A;  1PRL C;  1WLP B;  2YUN A;  5I21 A;  1S72 Q;  4QQD A;  3VJP A;  2P0P A;  4ME7 A;  2YHT A;  1UE9 A;  1WXT A;  4O6J A;  4LDY A;  5CQY A;  2PVD B;  3VS5 A;  2DYB A;  5KYY A;  5GAO n;  4Z8A A;  3CD6 A;  4Z88 A;  3TSZ A;  3V7C A;  1EX4 A;  1WHL A;  1VQN T;  1I8F A;  1M90 C;  1RAC B;  1I4K 1;  3JB9 I;  3NHN A;  3EH2 A;  4J9D A;  4N0A A;  1I1J A;  3JCM W;  2HQE A;  2CP5 A;  3I56 A;  5GAN 2;  1VQK A;  1T0H A;  1QVG A;  5LJ5 h;  5KH6 A;  2O01 E;  4BD3 A;  2ATC B;  4BY6 B;  2J05 A;  4FT4 A;  1GFD A;  4M7A F;  2PUO B;  2XDB A;  1AHJ B;  1JB0 E;  5D7U A;  2BIV A;  2DL5 A;  4C8Q D;  2WSC E;  3CCV T;  1W2B S;  3H0H A;  1N8R R;  1JO8 A;  1G3W A;  1QLY A;  2HKN A;  2QAS A;  3RKX A;  1M1K U;  2DF6 A;  4KGZ B;  1OX8 A;  4LE9 A;  4IUT A;  4FM4 B;  4KH0 B;  4P5N A;  1NEB A;  1LJO A;  2P84 A;  1Z9Q A;  2EYW A;  1YJW T;  1YIT A;  2K9G A;  4OMO A;  3SB2 A;  4DOV A;  3JCM Q;  3EFO A;  2DJZ A;  1AWJ A;  1LOJ A;  2FHD A;  3A98 A;  4JDS A;  1VQO A;  4J83 A;  5GAN h;  2PNI A;  4A4K A;  5I22 A;  2DFU A;  5LL6 S;  3C12 A;  4X9D A;  4M75 F;  2QQA A;  1M2V B;  2O9V A;  1SHF A;  2K5F A;  3CC4 Q;  3M4G A;  1LPL A;  2KRM A;  1WXU A;  3TSW A;  2LJ1 A;  4CC3 A;  3CPF A;  5GJW B;  1K4U S;  4A4H A;  2LX7 A;  2M51 A;  3I5R A;  5GMK e;  2R58 A;  3G4S Q;  2ZZD A;  2OX7 A;  2EGE A;  2QTV A;  2KDS A;  1GBQ A;  3QG1 A;  1PD1 A;  1YJ9 A;  1ARK A;  2RD1 A;  2P0K A;  4CC7 A;  1N8R U;  2RK1 A;  1IB8 A;  4FT2 A;  1W2B P;  4J9C A;  1QMC A;  2YSQ A;  2F5K A;  3CC7 Q;  5KE3 A;  1X2K A;  1D09 B;  2A0F B;  5L8R E;  3G6E Q;  1V1C A;  2VC8 A;  2PVO B;  3CCJ T;  4JZ4 A;  4C0D C;  5J26 A;  4B9X A;  1VQ4 Q;  2DEQ A;  2OTL Q;  1N9R A;  1SKU B;  1VQ8 Q;  4MDW A;  4DBF A;  3G7Z A;  2ED0 A;  2JM8 A;  4PJJ A;  3PTA A;  5KYY B;  2K5L A;  4KUL A;  1OX9 A;  5CIU A;  4XU2 A;  1VQP T;  1JJ2 P;  2HEQ A;  3L2Z A;  3A8H B;  4M77 D;  1UFF A;  5CO7 A;  2WAC A;  2I2L A;  4F7U G;  3H41 A;  4E7L A;  5GMK j;  3G71 T;  5KYN A;  3BE3 A;  1S72 A;  1VQ6 Q;  1OI1 A;  3S6W A;  4NS5 A;  1H3Z A;  1FXX A;  5FRN A;  4A4G A;  2LC4 A;  1G5V A;  2L3S A;  2XDD A;  3CCQ A;  5DLO A;  3OYH A;  2QDY B;  2FRY A;  1RAE B;  3NFC A;  2QI2 A;  1R0B G;  5IH2 A;  3C0C A;  4OB0 B;  4GBQ A;  4X1V A;  5FU7 B;  3HRU A;  3M53 A;  1TG0 A;  1Q82 R;  1M8M A;  1RAG B;  4DEX A;  4A4F A;  2VAS A;  2HQH A;  5FWB A;  3S3O A;  3EFR A;  1UB4 A;  1WJQ A;  3JCM c;  3EG3 A;  3FJP A;  3H8Z A;  3CC2 Q;  2CZ0 B;  1XNI A;  3QO3 A;  8AT1 B;  2EGC A;  3CCS A;  4YTL A;  2PU9 B;  1O75 A;  4XU1 A;  4JS4 A;  4XU3 A;  1K73 C;  1RI9 A;  3RKY A;  3NTK A;  1VQM T;  4IKF A;  2EQI A;  2OAU A;  3CCM Q;  3GOX A;  1KD1 R;  5IAY A;  2NUP A;  1UEC A;  3UAT A;  3VYG A;  1WJR A;  2FO0 A;  4OGC A;  4DBR A;  4FYV B;  2KXD A;  3CCU Q;  2D0N A;  5KYW B;  2CZ7 B;  2YRD A;  3OB9 A;  3M58 A;  4RTW A;  3DKM A;  2DL8 A;  4MMK A;  5GAM g;  3CC4 A;  3HPW A;  2ZPB B;  1B3Q A;  1UDL A;  4N4I A;  2E3I A;  1IZ6 A;  3SWN A;  1AZG B;  1KIK A;  3HFN A;  4OF1 A;  1Q82 U;  3G4S A;  2LQK A;  3V8L A;  3FLG A;  2JXB A;  2M02 A;  2E41 A;  1NLO C;  3CPW A;  1YWO A;  2K3X A;  4C8Q G;  2VV5 A;  3O8V A;  4BB7 A;  3PMT A;  3CCL Q;  3OBW A;  3PVQ A;  1LVK A;  2NYS A;  2SEM A;  3INZ A;  1Z9Z A;  3S3N A;  2KSS A;  1OPL A;  4LUD A;  3CC7 A;  4FW1 A;  1IHV A;  1SRL A;  4F17 A;  4OVA A;  3A8G B;  3I55 Q;  4B6M A;  1VQL Q;  2HL3 A;  3GLX A;  2P4T A;  2QXF A;  1KD1 U;  2QGF B;  3D7S B;  2RJF A;  3L2U A;  1KHC A;  1TU0 B;  5GAM d;  1A0N B;  1FYN A;  5CKD A;  4C92 G;  2V26 A;  1VQ4 A;  1B34 A;  1QVF P;  3EGX A;  2GQV A;  3R6N A;  2P4R A;  2E64 A;  3DB3 A;  4F7U F;  1ZSG A;  3EAE A;  3OMG A;  4NL3 A;  2DJQ A;  2FB7 A;  2YUP A;  1VQ8 A;  2X4W A;  2KYM A;  1D0Y A;  3VS2 A;  3CMA Q;  2XI9 A;  3JCM g;  3IQL A;  2RF0 A;  2L3R A;  3SHW A;  2DX1 A;  4IUR A;  2G6F X;  2EYZ A;  2FZC B;  4M7D B;  3VV0 A;  2QK0 A;  1UGP B;  4FYW B;  4LDW A;  3RBB B;  3R6O A;  4M78 A;  3QXE B;  4WF2 A;  2PTK A;  3HRT A;  4MZM A;  1MV3 A;  1GCQ A;  4PFO A;  2LQ8 A;  1VQ6 A;  2LMJ A;  3E19 A;  4RG8 A;  4A4E A;  2YRC A;  2DM1 A;  4OB1 B;  4PFZ A;  3J81 E;  1E6H A;  2E5K A;  3O5Z A;  1BB9 A;  2Z0W A;  1AWW A;  1NZ9 A;  3MP1 A;  4R0K A;  2BE7 D;  3MEW A;  1I5O B;  1CSK A;  2NUP B;  3QWX X;  3P8H A;  1AVZ C;  4PL6 A;  1D1C A;  2OJ2 A;  1BI1 A;  2KAF A;  1XJW B;  2DTO A;  3JCM d;  2AK5 A;  1ZSZ C;  2B86 A;  4X34 A;  1XTD A;  3CC2 A;  3M0P A;  3GIB A;  2M16 A;  4PLL A;  1K0X A;  2CP0 A;  1MUZ A;  1W6X A;  1GFC A;  4PK4 A;  4M77 G;  1W70 A;  2K2V A;  3CXC S;  2DD5 A;  1D1A A;  1OPK A;  1NJI U;  2DIL A;  3I56 Q;  3CCM A;  4DOW A;  1NG2 A;  4LUE A;  1VQK Q;  3HSB A;  2F1L A;  2D0Q B;  3FIF A;  1TS9 A;  2NUT B;  4BDY A;  2DMO A;  3ER0 A;  1FMK A;  2MOX A;  3VS0 A;  4TVR A;  3CCR A;  4C8Q F;  5C6S A;  2LQN A;  3EG9 B;  1RAH B;  2V8K A;  5FW9 A;  4C92 B;  4E7I A;  4JUV A;  2EW3 A;  2HKQ B;  2OTJ Q;  1U1T A;  2EIF A;  3OYE A;  5FWC A;  1R8O B;  1ZLM A;  3VS7 A;  1VQ5 Q;  2YT6 A;  2YLC A;  4MZT A;  1K9M R;  1JQQ A;  2RI2 A;  4J9H A;  1VQO Q;  1YP5 A;  3CCJ A;  2K79 A;  4B9W A;  4M7A A;  1YI2 Q;  2CDT A;  3CCL A;  3GPL A;  4QKU A;  2L3P A;  5KCO A;  2WSF E;  4RKU E;  2Y90 A;  1N6A A;  5GAO r;  2HDA A;  5GAN f;  5HY6 A;  3URG A;  1VQL A;  3NTI A;  5CKF A;  1HJD A;  4M78 B;  3SEM A;  2YDL A;  4PLI A;  1X6G A;  3OW2 P;  3JCM e;  1RUW A;  2M0Y A;  4LN2 A;  3E9F A;  5GAM j;  1C6V X;  1YJ9 Q;  4M75 C;  4M75 A;  1EIF A;  3QII A;  1YBY A;  2QEX T;  2LNV A;  2DK3 A;  4RTV A;  3CMA A;  4PJO A;  1PRM C;  2K2M A;  2CT4 A;  3UF4 A;  1S1N A;  3QKJ A;  1RLP C;  3M59 A;  2DZ9 A;  4M7A E;  2QQ9 A;  2AKL A;  2YWW A;  1K9M U;  2O2O A;  3LWI A;  3VS6 A;  1DJ7 B;  5ECA A;  3X26 B;  4J9I A;  3A8L B;  1YFN A;  2V1Q A;  1VOM A;  2XKO C;  4IIM A;  5GMK h;  1KQS A;  2VGM A;  2FRW A;  1XQH A;  3RMQ A;  2FZG B;  4M7D D;  2CSQ A;  1TWB A;  3TVT A;  4NL2 A;  2GQI A;  1PD0 A;  1PWT A;  3OYI A;  5KYU B;  4M77 F;  1VYT A;  4M75 E;  4PJL A;  2PUK B;  2CH4 A;  2KEA A;  1FMV A;  2ED1 A;  2DET A;  3UWN A;  3WVD B;  3PMI A;  1C0M A;  2L5Q A;  1QVG S;  3TEE A;  4XTW A;  2CRE A;  3G6E T;  5GAN 3;  1FWZ A;  3KFV A;  3SDZ A;  3CCQ Q;  2R5A A;  1WI7 A;  5LJ5 g;  1HD3 A;  3VUZ A;  1NJI C;  3CME T;  2EQJ A;  3L2Q A;  4AT1 B;  3TCJ A;  1WHH A;  4VUB A;  1F1B B;  1X43 A;  4EMK B;  1RI0 A;  2BZ8 A;  4QVD A;  5A0D A;  4C5H A;  1VQ7 Q;  4IUV A;  2E3H A;  3EGD A;  3ZL7 C;  1K1Z A;  3OS2 A;  4KUI A;  4JJB A;  2W10 A;  3CCS Q;  2XD0 A;  1X75 C;  1R0C B;  3EG0 A;  3LYI A;  2JVV A;  2OTJ A;  1JXM A;  2C0T A;  2RJD A;  3VYH B;  2DVE A;  1ZQ1 A;  1ZUU A;  2L3Q A;  4A53 A;  1P92 A;  1BU1 A;  2P0Q A;  1VQ5 A;  1M1F A;  3VS4 A;  2E12 A;  2VUB A;  1YHQ T;  1U06 A;  3X20 B;  3QDR B;  2ZPI B;  2HBP A;  2RJE A;  3TQ7 P;  4AG2 C;  1OZ2 A;  1MNE A;  1G2B A;  2J6K A;  5GMK i;  2HBW A;  4C92 D;  1YI2 A;  5A0L A;  1PG5 B;  2RHI A;  1Y96 B;  5D6W A;  3OY9 A;  5IHI A;  1VIE A;  5J39 A;  4PJO B;  5LJ3 g;  1V29 B;  4IUU A;  2Y4X A;  4E6R A;  1WZO A;  1WPY A;  3G1J A;  4C5G A;  2C0I A;  2FVU A;  2DXB A;  1WX6 A;  4FU6 A;  1TTH B;  1QP3 A;  2FYK A;  5GJV B;  1OYX A;  2CP2 A;  2FL7 A;  2DL7 A;  2RQW A;  3HTR A;  2NWM A;  2DXU A;  4Z02 A;  3OYC A;  2DZC A;  3QHS A;  1T3L A;  3PE0 A;  4MZP A;  4DQ2 A;  1KHI A;  5I2S A;  1K9M C;  3MEV A;  3M54 A;  4M78 D;  3GBQ A;  2COW A;  3HP9 A;  1K9A A;  2JMC A;  2DIQ A;  3RDV A;  1M5Q 1;  2EFI A;  4J8O A;  1HSQ A;  2XU8 A;  1LNX A;  1YCS B;  2COY A;  1NPP A;  1JJ2 A;  5LJ3 d;  2DXC A;  1BKB A;  2QQB A;  1WQ7 A;  1TH7 A;  2C0O A;  3DLL A;  4IUQ A;  2XHC A;  2D8H A;  2JW4 A;  3RNJ A;  2QA4 T;  2HMA A;  1BI3 A;  2FPF A;  2E6N A;  2EGA A;  1YIJ T;  1MHN A;  1Q86 C;  4RTU A;  3MKD A;  2LZ6 B;  1ABO A;  3QZ9 B;  2X3W D;  2K57 A;  3UDC A;  4Q5W A;  1ZX6 A;  2FPE A;  3KUF A;  5IHN A;  2H3J A;  2VXF A;  5EC7 A;  2DAQ A;  2O31 A;  3HRS A;  4JJC A;  4XQ3 A;  2EBP A;  2IPO B;  3UPU A;  2LVM A;  2R57 A;  2M0O A;  3EGD B;  2GFA A;  4F7U A;  4E7K A;  3PVL A;  3JRZ A;  4HVU A;  4N4H A;  2A7Y A;  3CCV Q;  3OYG A;  4R55 A;  4IUP A;  5IN1 A;  4XU0 A;  3EG2 A;  3H6Z A;  2LCS A;  3EFO B;  1KC8 R;  1PHT A;  1GL5 A;  2LCL A;  1PSE A;  1OU8 A;  4BE0 A;  2HNI A;  1RL2 A;  4BAC A;  4L5G A;  1EZZ B;  1VQ7 A;  2CS7 A;  4E7Z A;  1M1K C;  2ROT A;  1KFZ A;  4M7D G;  1D0X A;  3LWH A;  4ZGD B;  5HKC A;  5KCH A;  1Y71 A;  3LW5 E;  1SRM A;  2JS0 A;  4M7D C;  3OYF A;  3OYJ A;  1BBZ A;  1RLQ C;  1QKX A;  2XIC A;  3CCE T;  1QCN A;  4F7U E;  1ABQ A;  2DRK A;  2MAM A;  2MWP A;  5GAO m;  5GAO l;  3JB9 D;  3V8J A;  1N5Z A;  1SSF A;  1HYO A;  2DKG A;  3T9N A;  2L89 A;  3OA6 A;  3RKW A;  2LP5 A;  5CKH A;  4KT0 E;  4F04 B;  2IIM A;  3CPW S;  2D8J A;  4Y28 E;  2F2V A;  3UA6 A;  3OSS C;  1H92 A;  5HK3 A;  3CCR Q;  4DBH A;  2EJF A;  4D8K A;  4F14 A;  1KC8 U;  4J9G A;  1HXD A;  4RG2 A;  4J5Y A;  1IGQ A;  1M3C A;  2BZY A;  3MEA A;  4ZN1 A;  2ZPG B;  2QQR A;  4PJO D;  1N8R C;  3JCM P;  2A36 A;  3CCJ Q;  1FX7 A;  4BI3 A;  4UC4 A;  4Y92 A;  3CD6 T;  2ABL A;  2DL4 A;  2AT1 B;  4D8D A;  4EPC A;  3GNG A;  1N9S A;  2L2P A;  4OMP A;  3M5A A;  4C8Q C;  2IVW A;  1MMA A;  1QVF A;  5GAM h;  1VQK T;  1SHG A;  2GFU A;  2CP6 A;  3LH5 A;  1GBR A;  1VQP Q;  2R5M A;  2DIG A;  4II1 A;  1C1A A;  3AHU A;  4HXJ A;  3PIP A;  4NOY A;  4V2S A;  4EIK A;  5FU6 B;  2ZPE B;  2COZ A;  1E6G A;  4RTX A;  1VQ9 T;  2LQW A;  1Q81 R;  1YJN T;  3G71 Q;  1H3H A;  1MND A;  5LJ3 j;  3TRE A;  4C92 C;  1YIT T;  2HQX A;  3M0S A;  1NEG A;  3CPW P;  1K76 A;  2X4J A;  2XID A;  2VWF A;  1OUL A;  1UEB A;  1VQO T;  1X6B A;  3QPH A;  1D0Z A;  1MMG A;  1SSH A;  1WHG A;  3QYH B;  1VQN A;  1K8A R;  3OS0 A;  3OYK A;  2CH4 W;  4C8Q E;  1TUD A;  2KI7 A;  2E65 A;  1H64 1;  1Q7Y R;  2KT1 A;  1M9S A;  2KK4 A;  1NE8 A;  2RB6 A;  3QDF A;  3EFS A;  1N27 A;  4M78 G;  3MCA B;  2ZGW A;  3CCV A;  2K4Y A;  4M7D F;  4XTZ A;  2J06 A;  4M4Z A;  3JCM h;  3JCM J;  3TU4 K;  1M90 R;  4XK8 E;  1I81 A;  1I5L A;  4PNO A;  4C92 E;  1YJW A;  4FIB A;  1VQM Q;  2ESW A;  2PZ1 A;  2YUQ A;  2YUO A;  1UUE A;  1WHM A;  1Q81 U;  3ASK A;  4E7J A;  1WQW A;  1ZSZ A;  4KGV B;  1AD5 A;  3J80 E;  1PM3 A;  3OYA A;  2CKK A;  3HKS A;  2JTF A;  4JJD A;  4KRT A;  2LJ3 A;  1M4Z A;  5GMK m;  5GMK l;  1G3Y A;  2DD4 A;  4BUG A;  4J9F A;  2DXT A;  4AFU C;  1JU5 C;  3SWN B;  1AZE A;  1RAF B;  5AT1 B;  1TUC A;  1K8A U;  1BCO A;  4M77 C;  1JBM A;  3EG1 A;  2EQM A;  3EHQ A;  4OMQ A;  4MDX A;  1NBE B;  1VA7 A;  3X28 B;  2KE9 A;  1IO6 A;  3OYY A;  4HVV A;  4GLK A;  1Q7Y U;  5GAM e;  2DER A;  2VB6 A;  2B8A A;  1UHF A;  1E7O A;  4HCB A;  4ZNX A;  1XOV A;  1WXB A;  2AHJ B;  1U3O A;  2KBT A;  2QYZ A;  2BTT A;  4WCI A;  3QJ6 A;  1RAA B;  1NM7 A;  2O9S A;  1Q82 C;  2E5Q A;  3V7R A;  4XTX A;  4RTT A;  1S72 T;  1AWO A;  3LH0 A;  2MYS A;  3UT1 A;  3CQT A;  3F70 A;  2DBK A;  2NLU A;  2PQW A;  2HSP A;  3CCQ T;  1KK7 A;  1B34 B;  4O5V A;  2FEI A;  1QKW A;  3EGX B;  4QT7 A;  5I11 A;  2DRM A;  4ATO A;  3BDU A;  4EMH A;  1BK2 A;  1MMD A;  2ROL A;  1QCO A;  4M77 E;  4C92 F;  6AT1 B;  2DLP A;  1D3B A;  2LJ0 A;  2AIR B;  4Y91 A;  3OW2 A;  1UTI A;  1KD1 C;  3OYB A;  4N4G A;  1X27 A;  3JB9 G;  1VQP A;  2EYX A;  5IXB A;  2GGR A;  1OV3 A;  4BY6 C;  2MK5 A;  2OI3 A;  5I2M A;  2EYQ A;  3ZBD A;  3CXC P;  4JJN K;  3CCS T;  4A63 B;  3V7S A;  1WFW A;  2A3L A;  4RCB A;  3A5Z B;  1GXI E;  4FSX A;  2EPD A;  5A0G A;  3G71 A;  1M3B A;  2EKH A;  2DO3 A;  2KRS A;  3KXT A;  2AKK A;  4XTV A;  3HFO A;  2FZK B;  3JAM E;  1J3T A;  4QVZ A;  3VU3 C;  3MHX A;  3MPU B;  1KQS S;  3OMC A;  3M0U A;  2KRN A;  4M78 F;  4ZTF A;  2RHY A;  4X9C A;  1UJ0 A;  2HD0 A;  2AZV A;  3HHT B;  4JRI A;  4EDU A;  2JUF A;  4PJO G;  3OYN A;  3CC4 T;  2KMT A;  2RM4 A;  2X4Y A;  3CBP A;  3I35 A;  3LGL A;  3FDR A;  3OYD A;  3AT1 B;  3G4S T;  3LGF A;  4DEY A;  5DLQ E;  1AWX A;  1U5S A;  4IIO A;  4FCY A;  2GF7 A;  1Q81 C;  1WGS A;  3ULR B;  1PKS A;  3CBO A;  1SEM A;  2MI6 A;  1VQM A;  5FRM A;  2ZCF B;  3M55 A;  1OZ3 A;  3CC7 T;  1OU9 A;  3RES A;  5GAN 7;  2K7A A;  1KQ2 A;  1GRI A;  2D6F A;  1QW1 A;  1Y0M A;  5IXF A;  2F2W A;  4RMO A;  1KQS P;  2RH2 A;  3FEO A;  2GTO A;  1VQ4 T;  2D9T A;  2ENM A;  1IXD A;  1Q7Y C;  3JSC A;  1K73 R;  3OS5 A;  1VUB A;  1I07 A;  2G3R A;  2OTL T;  2D1X A;  2MPX C;  1VQ8 T;  3X24 B;  1QQJ A;  2XK0 A;  4M7A B;  2JT4 A;  3JB9 J;  1X6O A;  1D3B B;  2YLB A;  4ELZ C;  3EH1 A;  1RAD B;  2DE0 X;  2ZPH B;  4JLI A;  1JEG A;  5L23 A;  4N0A C;  2BKD N;  4K11 A;  3OYL A;  4DA4 A;  1NLP C;  5GAN g;  3FJ5 A;  1VQ6 T;  4LD6 A;  1WIE A;  2E4H A;  4FW2 A;  3JB9 F;  3MJX A;  1OQK A;  2RQR A;  3E2U A;  4HCC A;  4AMC A;  3JCM b;  5LJ5 d;  1Q95 G;  4M75 B;  4E7S A;  1VQ9 A;  3RUX A;  1TXQ A;  2IG0 A;  4C0G A;  1YJN A;  3VKI A;  3EGU A;  1QVG P;  2YXY A;  1WDX A;  2K6D A;  2GCX A;  2KNB B;  2V1R A;  4JRQ A;  4JLG A;  3OS1 A;  2QEX Q;  5FU7 C;  2LT4 A;  1K73 U;  3M0R A;  1IGU A;  4XAX B;  4JZ3 A;  3CC2 T;  1ZHI A;  1QWE A;  4J9B A;  2CUB A;  2J6F A;  2AZS A;  1W2B A;  3MP8 A;  2JOY A;  5FLX E;  2V8I A;  1G8X A;  4JRP A;  3M9Q A;  4PJO F;  1PC0 A;  1JJ2 S;  3JCM V;  1D1B A;  5CKB A;  5KE2 A;  3PT9 A;  5GAN d;  3M56 A;  4BE1 A;  2A37 A;  1JXO A;  3CCM T;  2FPD A;  3MO8 A;  5LJ3 h;  4WTO B;  4Z89 A;  4AFZ C;  3JB9 H;  1ZA1 B;  4F16 A;  3CCU T;  1IRE B;  4FYY B;  2A08 A;  2XMF A;  2RA2 A;  3CCR T;  1AOJ A;  2DTH A;  3M0T A;  1MGQ A;  2Y4Y A;  2EQU A;  5KYW A;  2JN0 A;  2A28 A;  9ATC B;  5GAO p;  5GAM f;  2FG0 A;  4HCZ A;  5D6Y A;  1Y57 A;  4JRK A;  1KQ1 A;  2RI3 A;  2I0N A;  3WVE B;  1YWP A;  2CZ6 B;  1PCX A;  2O4X A;  1IHW A;  4EMG A;  1KSW A;  2DVJ A;  3REB B;  4C5I A;  1G83 A;  1VQN Q;  3CME Q;  4LNP A;  3MP6 A;  3U23 A;  4AFQ C;  2KT8 A;  5A2Q E;  4OML A;  1NYG A;  3SFM A;  3CCL T;  4J7F A;  3BY7 A;  4PJN A;  2KR3 A;  4HT8 A;  2RQT A;  4LXC A;  3RMS A;  5LJ5 e;  3E9G A;  3A8O B;  3I55 T;  1VQL T;  4ZGE B;  2MF2 A;  4HKE A;  5HK0 A;  2CYZ B;  2W0Z A;  5FU6 C;  3H0I A;  4OGE A;  2DEU A;  2KRO A;  2XDP A;  1M27 C;  2ZPF B;  3ZFJ A;  3QYG B;  4JPB W;  1BIA A;  5CR2 A;  1YJW Q;  1M1G A;  2RHZ A;  3VS3 A;  3CMA T;  1YHQ Q;  1QCF A;  2MWO A;  3QUI A;  3JCM f;  1WHK A;  5GAN e;  3M0Q A;  2M1H A;  4ZN3 A;  3H0F A;  2LRQ A;  3A8M B;  5CAI A;  3NPF A;  4M7D A;  2EWN A;  1UGS B;  4ESR A;  2VGN A;  1G3T A;  1U1S A;  4M7A D;  2QAZ A;  3C95 A;  4BI4 A;  2X4X A;  2YRV A;  3QBY A;  1UGV A;  2JMA A;  4RTZ A;  7AT1 B;  2KXC A;  5LJ3 e;  4KGX B;  3E1S A;  1ACM B;  3EHR A;  1WA7 A;  1UGR B;  3P8D A;  3I9Q A;  3OQ5 A;  4PFP A;  4PJM A;  4XTY A;  5LJ5 j;  3FRN A;  2HAX A;  4OP0 A;  2QEX A;  1Y07 A;  1QVF S;  1AEY A;  2BZX A;  1UJY A;  2RI5 A;  3QSU A;  1M2O A;  2JS2 A;  4M75 D;  4C0D B;  2VKN A;  4CC2 A;  2RPN A;  2CT3 A;  4KH1 B;  3JCM X;  3NTH A;  4M7D E;  2GTJ A;  2E6Z A;  3PFS A;  5KYX A;  1JRI A;  2LCC A;  3JV3 A;  4RCC A;  3SWN C;  2GNC A;  5FRO A;  2L0A A;  2KQW A;  3CEY A;  1ZUY A;  5J3B A;  2QA4 Q;  4C8Q A;  2KY9 A;  3I56 T;  2O4X B;  5GAN j;  2JZ2 A;  2E10 A;  1YIJ Q;  2GBQ A;  2LT1 A;  1LCK A;  1PSF A;  2X51 A;  3OBY A;  4FSS A;  3L2W A;  4ELY C;  3A1P A;  3M4Y A;  4L59 A;  2NUT A;  1BCM A;  2ECZ A;  3HL8 A;  1KG1 A;  1BIB A;  2PVG B;  4F7U B;  2OTJ T;  4E47 A;  1WJS A;  2HL5 C;  3EG9 A;  5DY9 A;  2QQS A;  3L2V A;  4C92 A;  1VQ5 T;  1MMN A;  4L6V 5;  4RUG A;  3G6E A;  3H9N A;  2MMP A;  4CRI A;  2EVR A;  5IT9 E;  5DM7 R;  2EQK A;  3RER A;  1WYX A;  3MET A;  2EAY A;  1YI2 T;  2CUD A;  3NGP A;  3CME A;  1K0S A;  2OTL A;  1TUG B;  1ZUK A;  2VXE A;  2QTX A;  3GF5 A;  5D6X A;  5HCK A;  4HVW A;  2E1H A;  4FYX B;  4BDZ A;  4E7H A;  3THK A;  2LX9 A;  3BW1 A;  4OB3 B;  5CVI A;  3PIO A;  1Y7X A;  1V76 A;  4E2F B;  3I5S A;  1ZA2 B;  1WNL A;  2RQV A;  4GY5 A;  1BI0 A;  4KUD K;  3M57 A;  2RHU A;  2X35 A;  2X9H A;  2RJC A;  4M78 C;  1NJI R;  1O9S A;  1GCQ C;  1YJ9 T;  2HSE B;  2SRC A;  4XTU A;  4AG1 C;  2JTE A;  3CCE Q;  5IHK A;  2RMO A;  2VYT A;  3P8B B;  1H8K A;  2MCN A;  1B07 A;  1UHC A;  2QDL A;  1YHQ A;  2VVK A;  1UGQ B;  1VYV A;  1OEB A;  4D6W A;  2H8H A;  2DPP B;  4J6X A;  1BYM A;  3LX7 A;  1CKA A;  2RHX A;  4GLM A;  1TOV A;  5CKE A;  3C94 A;  4A54 A;  3CBM A;  1MV0 B;  1X2Q A;  3X25 B;  3DB4 A;  3VRY A;  2HCK A;  1B7T A;  4M77 A;  1M8V A;  4RTY A;  3PNW C;  4OMN A;  5C0M A;  2DTI A;  1ZBX A;  2EJG A;  2RQU A;  4QQ6 A;  2ZAE A;  3V8K A;  5EG2 A;  2JTM A;  4CI0 C;  4BI8 B;  3KBG A;  2E70 A;  5KYX B;  1W1F A;  2JNG A;  4M78 E;  4HA8 A;  2DBM A;  2C06 A;  1QP2 A;  2XG8 D;  2J6O A;  4C8Q B;  3CD6 Q;  1KC8 C;  8ATC B;  3Q1J A;  1SPK A;  2EYY A;  3LLR A;  1QVP A;  4OMM A;  2H3E B;  4C0Z A;  2MIO A;  5KYU A;  1UG1 A;  4LDV A;  5CK9 A;  1ZBJ A;  1BI2 A;  1M90 U;  1YN8 A;  1SF9 A;  2NUZ A;  3OW2 S;  2O88 A;  1X69 A;  2CP3 A;  2HZY A;  3BFM A;  3MEU A;  3CCU A;  3VS1 A;  2DL3 A;  1M30 A;  2JJ9 A;  3PGG A;  5AYF A;  1RAI B;  3UA7 A;  1X01 A;  1PKT A;  2LNH B;  1GCP A;  1NPR A;  4KBM B;  2F69 A;  2K3B A;  2K5I A;  4HT9 A;  2LDM A;  1VQ9 Q;  2LTO A;  4J7I A;  5GAN 8;  3CXC A;  5LJ5 f;  1YJN Q;  4J9E A;  2F5T X;  1W4S A;  2RN8 A;  2CSI A;  1CKB A;  2CP7 A;  5GAO q;  2QA4 A;  1YIT Q;  1WHJ A;  5GAN 4;  1YIJ A;  2WSE E;  2DYI A;  5GAN 6;  4M7A G;  4LDX A;  1VQ7 T;  4EMK C;  2EKO A;  4ORZ A;  4EMK A;  2DNU A;  4M7A C;  4ANJ A;  1YCY A;  4CC4 B;  2DA9 A;  2QGG A;  2EJ9 A;  2K3Y A;  2V8J A;  4QQG A;  3GP8 A;  4FL6 A;  1R77 A;  2KGT A;  1SG5 A;  4MML A;  2QG9 B;  4PKC C;  3N5B B;  2RK2 A;  3DLM A;  3QWY A;  1Q86 R;  3I55 A;  2BUD A;  2KYB A;  2RNA A;  4LD9 K;  4QW2 A;  1KJW A;  4M75 G;  1EFN A;  4ZGJ B;  3REA B;  5M9O A;  4LDU A;  5GAN 5;  2KVQ G;  2CZ1 B;  3FB9 A;  4J6Y A;  1M3A A;  3QJY A;  3OSV A;  3C4S A;  3OYM A;  1Y96 A;  5LJ3 f;  1ZSZ B;  4PJO C;  3VRZ A;  1M2V A;  1FMW A;  2OAW A;  4DBQ A;  4JS5 A; 
#chains in the Genus database with same CATH homology
 3MP1 A;  4PJO F;  1JJ2 S;  3JCM V;  2DKG A;  5CKB A;  3MEW A;  3T9N A;  5KE2 A;  2L89 A;  3OA6 A;  3RKW A;  3PT9 A;  5GAN d;  5CKH A;  3P8H A;  4J6W A;  3GNF B;  3SD4 A;  4PL6 A;  3M56 A;  3ZEH A;  4BE1 A;  2CGH A;  4OMF B;  1BI1 A;  2KAF A;  4KT0 E;  2DTO A;  3CPW S;  3L42 A;  3JCM d;  3CCM T;  4X34 A;  4Y28 E;  1U8R A;  3MO8 A;  5LJ3 h;  4M77 B;  4QVC A;  1XTD A;  3J7A F;  3OSS C;  5HK3 A;  3CC2 A;  2L8D A;  3VUB A;  3GIB A;  2EJF A;  3JB9 H;  2M9U A;  2M16 A;  4PLL A;  3CCE A;  3L2R A;  4OB2 B;  3WXM B;  3CCU T;  1IRE B;  5CCA A;  3S3M A;  1KC8 U;  4M77 G;  2RA2 A;  1HXD A;  3BDL A;  3FC3 A;  4RG2 A;  3CCR T;  2DTH A;  1MGQ A;  2Y4Y A;  2EQU A;  4J5Y A;  4BE2 A;  2JN0 A;  2K2V A;  3MEA A;  2RO0 A;  4ZN1 A;  5GAO p;  5GAM f;  3CXC S;  2DD5 A;  2ZPG B;  4R56 A;  1G3S A;  1Q86 U;  2QQR A;  4PJO D;  4C0F A;  4HCZ A;  5D6Y A;  4C5E A;  3CCM A;  3JCM P;  4DOW A;  1N8R C;  1NJI U;  1FX7 A;  1HK9 A;  4BI3 A;  4UC4 A;  4ZTJ A;  1VIF A;  1K8A C;  3CD6 T;  3HSB A;  4JRK A;  3L1A A;  3ME9 A;  3RIR A;  4EPC A;  1KQ1 A;  3GNG A;  1N9S A;  2RI3 A;  3QZ5 B;  5CQX A;  2D0Q B;  4PJO E;  3WVE B;  2CZ6 B;  3FIF A;  3M5A A;  4C8Q C;  2O4X A;  2IVW A;  4BDY A;  3ER0 A;  4EMG A;  1QVF A;  5I21 A;  4TVR A;  4QQD A;  3VJP A;  5GAM h;  2P0P A;  3CCR A;  1VQK T;  4ME7 A;  4C8Q F;  5C6S A;  2YHT A;  4C5I A;  2GFU A;  2V8K A;  3MP6 A;  4C92 B;  4O6J A;  5A2Q E;  4LDY A;  4JUV A;  2R5M A;  2DIG A;  3SFM A;  4II1 A;  4E7I A;  1U1T A;  3CCL T;  4J7F A;  2EIF A;  3OYE A;  3PIP A;  3AHU A;  5CQY A;  2PVD B;  3BY7 A;  4NOY A;  4V2S A;  1R8O B;  5FU6 B;  2ZPE B;  5GAO n;  3CD6 A;  3V7C A;  1VQN T;  4HT8 A;  1I8F A;  2YLC A;  3RMS A;  1I4K 1;  4MZT A;  5LJ5 e;  3JB9 I;  1M90 C;  1VQ9 T;  1YJN T;  3E9G A;  3A8O B;  4N0A A;  3I55 T;  3JCM W;  1VQL T;  2HQE A;  4ZGE B;  2MF2 A;  2RI2 A;  5LJ3 j;  3I56 A;  1Q81 C;  3CCJ A;  5GAN 2;  3TRE A;  4C92 C;  1YIT T;  4HKE A;  1VQK A;  2HQX A;  4B9W A;  1QVG A;  5LJ5 h;  5KH6 A;  4M7A A;  5HK0 A;  2O01 E;  4BD3 A;  2CYZ B;  4BY6 B;  2X4J A;  2XID A;  4FT4 A;  5FU6 C;  4OGE A;  1VQ9 A;  4M7A F;  2PUO B;  2XDB A;  1AHJ B;  1UEB A;  1VQO T;  3CCL A;  1JB0 E;  2BIV A;  3GPL A;  4C8Q D;  3QPH A;  2XDP A;  2WSC E;  2WSF E;  2ZPF B;  4RKU E;  3ZFJ A;  5KCO A;  3CCV T;  2Y90 A;  3QYG B;  5CR2 A;  1BIA A;  1W2B S;  1M1G A;  1N6A A;  3QYH B;  5GAO r;  1G3W A;  2RHZ A;  3RKX A;  1VQN A;  3CMA T;  1M1K U;  3OS0 A;  5GAN f;  3OYK A;  4IUT A;  4C8Q E;  5HY6 A;  3URG A;  4FM4 B;  1VQL A;  2MWO A;  4P5N A;  3NTI A;  3QUI A;  2E65 A;  1LJO A;  5CKF A;  4M78 B;  3JCM f;  1H64 1;  1YJW T;  1YIT A;  5GAN e;  3SB2 A;  4DOV A;  3JCM Q;  2M1H A;  2DJZ A;  4ZN3 A;  1LOJ A;  1M9S A;  2KK4 A;  2LRQ A;  3A8M B;  1NE8 A;  2FHD A;  5CAI A;  2RB6 A;  4PLI A;  3EFS A;  3JCM e;  4JDS A;  1VQO A;  3E9F A;  5GAM j;  1N27 A;  4M78 G;  4M75 C;  4J83 A;  4M7D A;  5GAN h;  2EWN A;  3MCA B;  1EIF A;  2ZGW A;  3QII A;  4M75 A;  4A4K A;  3CCV A;  1UGS B;  2K4Y A;  1YBY A;  2VGN A;  3C12 A;  4X9D A;  2LNV A;  2DK3 A;  1G3T A;  5LL6 S;  4XTZ A;  1U1S A;  4M7D F;  4M75 F;  4M7A D;  4BI4 A;  3C95 A;  2QQA A;  3JCM h;  3CMA A;  4PJO A;  3JCM J;  2X4X A;  3TU4 K;  2YRV A;  3QKJ A;  3QBY A;  4XK8 E;  2K5F A;  1I81 A;  1I5L A;  4PNO A;  3M4G A;  4C92 E;  5LJ3 e;  3M59 A;  2DZ9 A;  4FIB A;  2QQ9 A;  1YJW A;  4M7A E;  3E1S A;  3CPF A;  1UGR B;  3P8D A;  4A4H A;  1Q81 U;  1K9M U;  3ASK A;  3OQ5 A;  3LWI A;  4E7J A;  1DJ7 B;  1WQW A;  5GMK e;  2R58 A;  3X26 B;  4XTY A;  3J80 E;  2ZZD A;  5LJ5 j;  3OYA A;  3A8L B;  2CKK A;  3FRN A;  2JTF A;  3HKS A;  2HAX A;  4OP0 A;  2QEX A;  1Y07 A;  2KDS A;  1M4Z A;  5GMK m;  5GMK l;  2XKO C;  1G3Y A;  5GMK h;  2DD4 A;  3QG1 A;  4BUG A;  1QVF S;  1KQS A;  1YJ9 A;  2DXT A;  2VGM A;  2RI5 A;  1XQH A;  3SWN B;  2RD1 A;  3QSU A;  3RMQ A;  2P0K A;  4M7D D;  1N8R U;  4M75 D;  2RK1 A;  1K8A U;  4M77 C;  1JBM A;  4C0D B;  4NL2 A;  2EQM A;  4FT2 A;  4MDX A;  3OYI A;  3X28 B;  2F5K A;  4M77 F;  3OYY A;  3JCM X;  4GLK A;  3NTH A;  5KE3 A;  4M7D E;  2E6Z A;  4M75 E;  2PUK B;  3PFS A;  1Q7Y U;  5GAM e;  1JRI A;  2LCC A;  4RCC A;  5L8R E;  2B8A A;  3SWN C;  5FRO A;  2KQW A;  3CEY A;  3UWN A;  1XOV A;  3WVD B;  4HCB A;  5J3B A;  2VC8 A;  4C8Q A;  2KY9 A;  2PVO B;  3I56 T;  2AHJ B;  2O4X B;  3CCJ T;  3PMI A;  4C0D C;  5GAN j;  2JZ2 A;  2L5Q A;  2E10 A;  5J26 A;  3TEE A;  4B9X A;  1QVG S;  2LT1 A;  3QJ6 A;  4XTW A;  1PSF A;  2DEQ A;  3G6E T;  1Q82 C;  3OBY A;  1FWZ A;  5GAN 3;  2E5Q A;  3SDZ A;  3V7R A;  1N9R A;  2R5A A;  4XTX A;  3L2W A;  1S72 T;  4ELY C;  4MDW A;  5LJ5 g;  3G7Z A;  3LH0 A;  3M4Y A;  3PTA A;  3UT1 A;  3VUZ A;  4L59 A;  3F70 A;  1NJI C;  2NLU A;  2PQW A;  3CME T;  3HL8 A;  1KG1 A;  2K5L A;  1BIB A;  4KUL A;  2EQJ A;  2PVG B;  5CIU A;  4XU2 A;  4F7U B;  1VQP T;  3L2Z A;  3L2Q A;  2OTJ T;  4E47 A;  3CCQ T;  1WJS A;  3TCJ A;  1B34 B;  3A8H B;  4M77 D;  4O5V A;  4VUB A;  5DY9 A;  2QQS A;  5CO7 A;  3L2V A;  4ATO A;  2WAC A;  4C92 A;  4EMK B;  1RI0 A;  2I2L A;  3BDU A;  1VQ5 T;  4EMH A;  4QVD A;  5A0D A;  4L6V 5;  4F7U G;  4C5H A;  4E7L A;  4M77 E;  4C92 F;  3G6E A;  1D3B A;  4IUV A;  5GMK j;  3G71 T;  1K9M C;  3OS2 A;  4KUI A;  2MMP A;  4CRI A;  5IT9 E;  5DM7 R;  1S72 A;  4Y91 A;  1OI1 A;  2EQK A;  3S6W A;  3OW2 A;  3RER A;  4NS5 A;  1H3Z A;  1FXX A;  3MET A;  2EAY A;  5FRN A;  1KD1 C;  4A4G A;  3OYB A;  1YI2 T;  2LC4 A;  3JB9 J;  2XD0 A;  1X75 C;  1G5V A;  4N4G A;  3CME A;  3LYI A;  3JB9 G;  1VQP A;  2JVV A;  2XDD A;  2OTL A;  3CCQ A;  2OTJ A;  5DLO A;  3OYH A;  2RJD A;  2QDY B;  4BY6 C;  2VXE A;  2DVE A;  2QTX A;  3GF5 A;  5D6X A;  5I2M A;  3VYH B;  1ZQ1 A;  2EYQ A;  3NFC A;  2QI2 A;  3ZBD A;  4A53 A;  4JJN K;  1P92 A;  4OB0 B;  3CCS T;  2P0Q A;  2E1H A;  1VQ5 A;  4BDZ A;  1M1F A;  3V7S A;  2A3L A;  4RCB A;  2E12 A;  2VUB A;  4E7H A;  3A5Z B;  2LX9 A;  3BW1 A;  4OB3 B;  1GXI E;  5CVI A;  1YHQ T;  4FSX A;  3X20 B;  3QDR B;  5FU7 B;  5A0G A;  3PIO A;  3G71 A;  2ZPI B;  2RJE A;  1Y7X A;  2HBP A;  3HRU A;  2DO3 A;  3M53 A;  1OZ2 A;  3KXT A;  4A4F A;  4XTV A;  1WNL A;  4GY5 A;  1BI0 A;  3HFO A;  5GMK i;  3M57 A;  3JAM E;  3S3O A;  4KUD K;  3EFR A;  4C92 D;  1YI2 A;  1UB4 A;  2RHU A;  2X35 A;  2RJC A;  5A0L A;  4QVZ A;  3VU3 C;  4M78 C;  1WJQ A;  1Y96 B;  2RHI A;  3MHX A;  5D6W A;  3JCM c;  3OY9 A;  1KQS S;  1VIE A;  3OMC A;  3FJP A;  1O9S A;  5J39 A;  3H8Z A;  5LJ3 g;  4PJO B;  1V29 B;  2CZ0 B;  1YJ9 T;  4IUU A;  2Y4X A;  4XTU A;  1XNI A;  4M78 F;  4ZTF A;  3QO3 A;  1WPY A;  2RHY A;  4X9C A;  2HD0 A;  2QEX T;  3CCS A;  2VYT A;  3P8B B;  4YTL A;  3HHT B;  4JRI A;  4C5G A;  2PU9 B;  4EDU A;  2JUF A;  4PJO G;  3OYN A;  1O75 A;  1YHQ A;  4XU1 A;  3CC4 T;  2KMT A;  2FVU A;  2RM4 A;  2DXB A;  2X4Y A;  1UGQ B;  4JS4 A;  4FU6 A;  4XU3 A;  1K73 C;  3CBP A;  4D6W A;  3LGL A;  3RKY A;  3NTK A;  1VQM T;  1QP3 A;  2DPP B;  2FYK A;  3LX7 A;  4J6X A;  4IKF A;  1OYX A;  1BYM A;  3FDR A;  2FL7 A;  2OAU A;  2RHX A;  3OYD A;  2DXU A;  5CKE A;  3GOX A;  3C94 A;  4A54 A;  3CBM A;  4Z02 A;  5IAY A;  3OYC A;  3G4S T;  3VYG A;  3LGF A;  1WJR A;  2DZC A;  4OGC A;  3X25 B;  5DLQ E;  3QHS A;  2CZ7 B;  3DB4 A;  3OB9 A;  3M58 A;  4M77 A;  1M8V A;  4MZP A;  3PNW C;  3DKM A;  4DQ2 A;  5C0M A;  2GF7 A;  1KHI A;  2DTI A;  1ZBX A;  2EJG A;  4MMK A;  4QQ6 A;  3MEV A;  1WGS A;  3M54 A;  4M78 D;  5I2S A;  5GAM g;  3HPW A;  3V8K A;  3CC4 A;  3CBO A;  3HP9 A;  5EG2 A;  2JTM A;  4CI0 C;  4BI8 B;  3KBG A;  2MI6 A;  2E70 A;  2ZPB B;  1VQM A;  2DIQ A;  5FRM A;  1M5Q 1;  2EFI A;  2JNG A;  4J8O A;  4N4I A;  3SWN A;  1IZ6 A;  4M78 E;  4HA8 A;  2ZCF B;  2XU8 A;  3HFN A;  1LNX A;  2C06 A;  1QP2 A;  3M55 A;  4OF1 A;  1OZ3 A;  1NPP A;  2XG8 D;  1JJ2 A;  4C8Q B;  3G4S A;  1Q82 U;  5LJ3 d;  2DXC A;  3CC7 T;  1BKB A;  1KC8 C;  2QQB A;  3Q1J A;  1WQ7 A;  1TH7 A;  2LQK A;  3LLR A;  1QVP A;  3DLL A;  4IUQ A;  2XHC A;  4C0Z A;  3V8L A;  3FLG A;  3RES A;  5GAN 7;  1KQ2 A;  4LDV A;  5CK9 A;  2QA4 T;  2E41 A;  3CPW A;  2K3X A;  1BI3 A;  1BI2 A;  4C8Q G;  1M90 U;  2D6F A;  2VV5 A;  3O8V A;  3OW2 S;  1QW1 A;  2E6N A;  1YIJ T;  1MHN A;  4BB7 A;  1Q86 C;  3PMT A;  4RMO A;  2RH2 A;  3FEO A;  1VQ4 T;  3BFM A;  3MEU A;  3QZ9 B;  3UDC A;  2D9T A;  2K57 A;  3PGG A;  4Q5W A;  5AYF A;  3CCU A;  1Q7Y C;  3JSC A;  3KUF A;  1VUB A;  3OS5 A;  2G3R A;  1X01 A;  2H3J A;  3OBW A;  2OTL T;  2VXF A;  3INZ A;  1NPR A;  4KBM B;  3S3N A;  2F69 A;  2KSS A;  2K5I A;  1VQ8 T;  3CC7 A;  2DAQ A;  3HRS A;  4HT9 A;  2LDM A;  4XQ3 A;  3X24 B;  2LTO A;  4J7I A;  5GAN 8;  2XK0 A;  4M7A B;  5LJ5 f;  3CXC A;  3M9Q A;  3UPU A;  4OVA A;  2F5T X;  3A8G B;  1W4S A;  2LVM A;  2R57 A;  2M0O A;  2P4T A;  2QXF A;  1X6O A;  1D3B B;  2YLB A;  3GLX A;  4ELZ C;  5GAO q;  2QA4 A;  1KD1 U;  2RJF A;  3L2U A;  1KHC A;  2GFA A;  5GAN 4;  5GAM d;  1YIJ A;  4F7U A;  5CKD A;  4E7K A;  2ZPH B;  4JLI A;  4C92 G;  2WSE E;  5GAN 6;  1VQ4 A;  1B34 A;  4N0A C;  4LDX A;  4M7A G;  2GQV A;  2BKD N;  2E64 A;  3DB3 A;  3JRZ A;  4F7U F;  1VQ7 T;  3EAE A;  4EMK C;  4N4H A;  3OYL A;  4DA4 A;  2EKO A;  4EMK A;  3OMG A;  2A7Y A;  4NL3 A;  2FB7 A;  5GAN g;  4M7A C;  1VQ8 A;  1VQ6 T;  1YCY A;  3OYG A;  2X4W A;  4R55 A;  4IUP A;  5IN1 A;  4XU0 A;  2EJ9 A;  2XI9 A;  2K3Y A;  4LD6 A;  2V8J A;  3JCM g;  3H6Z A;  4QQG A;  3GP8 A;  2L3R A;  4FL6 A;  3JB9 F;  2LCL A;  4IUR A;  1PSE A;  4HCC A;  3JCM b;  4MML A;  4BE0 A;  4M7D B;  5LJ5 d;  4M75 B;  3VV0 A;  4PKC C;  3N5B B;  2HNI A;  2RK2 A;  3DLM A;  1RL2 A;  1UGP B;  2IG0 A;  3RUX A;  3VKI A;  4LDW A;  4C0G A;  4L5G A;  4BAC A;  1YJN A;  3I55 A;  2BUD A;  3R6O A;  1VQ7 A;  2CS7 A;  3QXE B;  4M78 A;  4WF2 A;  2GCX A;  1M1K C;  4LD9 K;  3HRT A;  4MZM A;  4QW2 A;  4JRQ A;  2LQ8 A;  1VQ6 A;  4JLG A;  3E19 A;  3OS1 A;  4RG8 A;  4M7D G;  4M75 G;  5FU7 C;  4A4E A;  3LWH A;  4ZGD B;  4ZGJ B;  5HKC A;  5KCH A;  1Y71 A;  2LT4 A;  3LW5 E;  5M9O A;  1K73 U;  4LDU A;  5GAN 5;  4M7D C;  4XAX B;  2KVQ G;  2CZ1 B;  3FB9 A;  4J6Y A;  4OB1 B;  3OYF A;  3OYJ A;  3CC2 T;  3QJY A;  3OSV A;  3C4S A;  1ZHI A;  2XIC A;  3CCE T;  3OYM A;  4F7U E;  3J81 E;  1W2B A;  2MAM A;  1Y96 A;  3MP8 A;  5LJ3 f;  2JOY A;  5FLX E;  4PJO C;  2V8I A;  2MWP A;  5GAO m;  5GAO l;  3JB9 D;  3V8J A;  4JS5 A;  1NZ9 A;  4JRP A;  1SSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...