2LCCA

Solution structure of rbbp1 chromobarrel domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
EDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords AT-rich interactive domain-containing protein 4A
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lccA00
4E7HA 2DIGA 2R58A 2R5MA 5KH6A 4E7KA 3H6ZA 3MEAA 4IUUA 3S3MA 4IURA 3GOXA 2RHXA 4GY5A 3P8DA 2K3YA 1MHNA 2RJDA 3QKJA 4IKFA 3NTIA 4IUTA 3NTKA 2NLUA 3OY9A 1WJRA 3DLMA 3SD4A 3KUFA 4QVZA 3OYAA 2EFIA 3OYLA 5KCHA 3L2RA 3L2WA 4BE1A 2BKDN 2RJCA 5D6YA 1WJQA 3MP8A 3ASKA 4N4HA 3S3NA 2RI3A 3LLRA 3OYBA 5FROA 4BDZA 3OYEA 3C4SA 5CIUA 2G3RA 3OA6A 3ME9A 4X34A 4C5HA 3L42A 2EQUA 5IAYA 4E7JA 4N4IA 2R57A 2O4XA 2L89A 4BDYA 3MP6A 1XNIA 4BACA 2HQXA 3OYDA 3UT1A 3CEYA 1OZ3A 5FRMA 1OYXA 2DAQA 2JZ2A 2EQMA 3OYCA 1OI1A 4N4GA 5IN1A 3MEUA 3OYHA 3L2UA 4IUQA 2EQJA 3DB3A 3OYGA 3OQ5A 3FEOA 3ZEHA 4ZTFA 1RI0A 2EQKA 2RHIA 2FHDA 3PFSA 2MWOA 3PMIA 2E6NA 4PLIA 5J26A 4B9WA 3S3OA 2X4XA 4IUPA 3UWNA 2GFAA 3OYFA 2F5KA 3OYIA 4BE2A 1SSFA 4NS5A 2B8AA 5J39A 2HQEA 5C6SA 5KE3A 4A4HA 3OMGA 3FC3A 2RHZA 5KCOA 3DB4A 3PMTA 3OYJA 4FL6A 2R5AA 3EAEA 2GFUA 2RO0A 4C5IA 2WACA 4C5GA 3LYIA 5C0MA 4QQDA 4RG2A 1N27A 4LD6A 4PLLA 4UC4A 3OYKA 1H3ZA 3MP1A 2XK0A 3QIIA 2CKKA 5KE2A 3NTHA 3OYMA 3QJ6A 4Z02A 4A4FA 1OZ2A 2RJEA 3LH0A 3META 3H8ZA 3L2QA 2VYTA 2PQWA 3OYNA 2LVMA 2QQSA 2M16A 4A4EA 4FU6A 3M9QA 2EKOA 3MEVA 2M0OA 2X4WA 2M1HA 3LGLA 4BD3A 4L59A 4BE0A 2RHYA 2X35A 2RI2A 2L3RA 4QQ6A 3S6WA 2XDPA 4OVAA 4CRIA 4EDUA 2P0KA 2LRQA 4E7LA 1WGSA 4II1A 2L8DA 1G5VA 2K3XA 2E5QA 3FLGA 3LGFA 4B9XA 2GF7A 3OS2A 5D6WA 2MWPA 3OB9A 2YRVA 4QW2A 4QQGA 3OS0A 2LDMA 3P8HA 4HCZA 3OS1A 3MEWA 2IG0A 2BUDA 2JTFA 4PL6A 3FDRA 5FRNA 4Q5WA 2QQRA 2O4XB 2RHUA 3O8VA 3OMCA 3Q1JA 3L2VA 3LX7A 5D6XA 2X4YA 4IUVA 3QBYA 4C5EA 2LCCA 4A4GA 3F70A 2RJFA 2D9TA 3BDLA 2RI5A 4E7IA 2BIVA 1KHCA 2LTOA 2DIQA 3E9GA 3E9FA 3PNWC 1WJSA 3MO8A 4ZTJA 5M9OA
chains in the Genus database with same CATH superfamily
4E7HA 2ZPGB 3OSSC 1GBRA 3QDRB 4J8OA 3LWIA 5A2QE 4M7AA 2MAMA 1MHNA 1VYTA 2K2VA 1WJRA 1QMCA 4QVZA 1C1AA 5A0DA 1I4K1 1Q95G 2RJCA 4OMOA 1M90C 2DJQA 5A0LA 3M57A 2DEUA 5I11A 2HMAA 1E7OA 4BY6C 3OA6A 3G71T 2X3XD 4EMKC 1IXDA 4E7JA 4M7DD 3CCMQ 4FW1A 5KYWB 3T9NA 1WYXA 2F2VA 2IPOB 1YI2T 4AMCA 1OQKA 1VQLA 3QSUA 1YITQ 1RAHB 4LDXA 2HDAA 4RUGA 3J7AF 4J7FA 3CXCS 1BIAA 4R56A 3CMAT 1NZ9A 2HKQB 1JU5C 4IIMA 1PCXA 2RQTA 4ZN3A 5J39A 3N5BB 2LJ3A 2LJ1A 3CCVQ 1EIFA 3PMTA 2HL3A 1UJYA 4DEYA 2RO0A 1VQMQ 1VQPA 1ZLMA 2J6FA 1VIEA 1OULA 1TUCA 2KI7A 1D3BA 3OSVA 1GCQA 2RJEA 2PUOB 3V7CA 1QKWA 3CPWS 1MGQA 2P4RA 4NL2A 4C8QF 4A54A 4M7AD 1ABOA 3CCRA 5LL6S 2O31A 3CXCA 2HSEB 4KBMB 2O01E 1WHHA 3U23A 2CT3A 1BIBA 3EG2A 3I9QA 3TSZA 2L2PA 2OAUA 4ZGJB 1UE9A 1WHKA 2E5QA 2P4TA 3RMQA 4BI4A 3CC4A 1OU8A 5GAMh 1VQOA 2C0OA 5GMKj 2KGTA 1TH7A 3P8HA 4C92C 1C0MA 2X3WD 3QDFA 4E2FB 4F17A 1KC8R 3BDUA 1VUBA 3G7ZA 1LVKA 4C92D 2RJFA 3VS2A 2XDDA 3SB2A 2LTOA 1RUWA 1SF9A 4E7KA 4XU0A 4JJBA 3CD6T 1ARKA 2QASA 3UATA 1JJ2S 2K3YA 1GCPA 3E1SA 1X2KA 1BKBA 3KUFA 3SD4A 3J81E 1K9MC 1QVFA 1MMDA 5KYYB 5GAOm 1AHJB 1YNZA 2DL3A 5LJ3j 1VQLQ 5FROA 1VOMA 5I2SA 1VQMT 2ZCFB 1OU9A 1HYOA 2CP0A 2M02A 3MJXA 3SWNA 4Y91A 3CMAQ 2QGFB 4RTXA 4M78E 3MP6A 2FPFA 1D3BB 2EBPA 2JTMA 2EQIA 1VQ7A 2EQMA 1AVZC 1SHFA 1PSFA 3GBQA 2J6OA 3GNFB 3MEUA 3TQ7P 1NEGA 2V8JA 5EC7A 3S3OA 4LDUA 3OBWA 1G2BA 4GLMA 2VUBA 4MDXA 2RHZA 1XTDA 2KRNA 3CCUT 4XTVA 1UTIA 4LE9A 1T3SA 4KGZB 1N6AA 1OZ2A 3CCEQ 4M7DC 5GAN7 1VQOQ 4J5YA 4C92F 2KT1A 1TG0A 4C8QB 5AT1B 4F7UA 5GAOp 3CBPA 2X4WA 4ME7A 3CXCP 4BD3A 4F14A 2EJ9A 3CCRT 3JCMV 5LJ5e 3X25B 3CCRQ 1ZSZB 4II1A 2OTLA 1PRLC 3I55A 4X9CA 1NLPC 3VU3C 3JCMd 4XTZA 2YRDA 2BUDA 5FRNA 4KGVB 4M78D 1M27C 1M9SA 2B86A 2X4YA 5GANh 3QBYA 1YI2A 4J83A 3ZBDA 2RI5A 2CP5A 2RQWA 1WJSA 3PNWC 1D0YA 3VUZA 2PU9B 5FU7C 4PJOB 3CCUQ 3RKXA 4PFZA 3L2RA 1Q81C 5GAMe 3L2WA 3THKA 4F7UF 4LDYA 3I55Q 3LLRA 1WXTA 4HA8A 1IRXA 2EYZA 1YCYA 1JEGA 2RMOA 4RTVA 2J06A 4GLKA 1NYFA 1K8AR 1KD1R 3EGXA 4AG1C 4L6V5 1UG1A 1BBZA 3CC7T 3PVLA 2O88A 1K4US 5LJ3g 1Q7YU 1HXDA 1W70A 3E19A 1XJWB 2KDSA 1AZGB 4F7UB 3DB3A 1MNDA 5ECAA 1M30A 2C06A 1UGQB 2LNVA 3UWNA 2L0AA 2B8AA 4M77G 2JN0A 3PTAA 2NUPB 3EGUA 2QYZA 2DD5A 1Y0MA 3URGA 5GMKh 4XU1A 3LYIA 3SDZA 1IGQA 3CC4T 3JB9I 4XTYA 4X1VA 3NTHA 5GANj 1B07A 3BW1A 1YN8A 1B34A 2M1HA 4JS4A 5KYNA 3HRTA 4PJOD 2DL4A 2C0IA 1VQ8Q 2K79A 1UDLA 2BZ8A 1K0XA 2CP2A 1QLYA 2O2OA 2QGGA 5IH2A 1FX7A 4OB2B 2IG0A 1V29B 2DXBA 2XDBA 3ER0A 2W10A 3LH5A 1KK7A 4M7DB 1IZ6A 2QA4Q 2JW4A 3QYGB 2J6KA 1B3QA 1LPLA 2BE7D 3JCMX 2DZ9A 4GY5A 5GAMg 3NTKA 5L8RE 2K5IA 2EFIA 5J3BA 1KC8C 1KHIA 1JXOA 2CUDA 2MYSA 2FPEA 4RTUA 3LW5E 4X34A 4RCCA 4N4IA 1KG1A 5D7UA 4KGXB 2ED0A 5IHIA 2OJ2A 2OX7A 1QQJA 1BK2A 2HQXA 4AFQC 2ZPBB 1MNEA 1OZ3A 1PD1A 5GAOr 2JNGA 1R8OB 5FWCA 5GJVB 1VQPQ 2HZYA 2EKHA 5CKHA 2EQKA 5J26A 4PLIA 2AZSA 2CZ0B 1GBQA 2F69A 1SG5A 1ZHIA 2VGNA 1M4ZA 2YHTA 3G1JA 1MMAA 2BZYA 1N9RA 2FVUA 4FL6A 2QA4T 2WACA 4M78A 4E7ZA 2I2LA 1RAFB 1BI2A 3EFSA 1Q81U 3M58A 2D1XA 4AG2C 2OTLT 2JM9A 3GF5A 3JCMc 5GMKm 2JM8A 2KSSA 4DBFA 3META 2LT1A 2EJGA 4X9DA 2E65A 4A4EA 2COZA 5GAN2 1I5LA 4D6WA 1YBYA 2X35A 2GTJA 4OGEA 1QKXA 4LD9K 1BCMA 2RF0A 2P0KA 1OV3A 2A28A 1G5VA 2VXEA 4FYYB 5D6WA 3TVTA 2KRSA 4QW2A 3VS5A 1D1CA 1Z9QA 2CUBA 5CQYA 4CI0C 4PK4A 2KXDA 3A5ZB 1WNLA 1JJ2P 2H3JA 2LCCA 2QTXA 2E4HA 1E6HA 5LJ3f 1SHGA 3CCJA 5GANg 2FO0A 4RTWA 3OYLA 2ZGWA 5KH6A 4ELZC 4LUDA 1VQ7Q 4IUTA 2NLUA 3DLMA 2PVGB 1NJIU 1VQ7T 4WCIA 1G3TA 3EFRA 1UGVA 2XHCA 4IIOA 1M3AA 1NPRA 3REAB 4DOWA 3G71Q 2LCSA 5CO7A 3MKDA 1W2BA 4FYXB 2ZPEB 2OAWA 3RUXA 3AT1B 1I8FA 4L5GA 3I5SA 4EMGA 1H641 3OYCA 4PKCC 2RH2A 2MF2A 4WTOB 2K4YA 2E12A 2KQWA 1VIFA 4OMFB 4FW2A 5GAMj 4LUEA 4J6WA 3OYIA 2MI6A 3KBGA 2CGHA 1K9AA 2DL5A 2L3SA 4HT9A 2FZGB 4PJLA 2GFUA 1TU0B 1X2QA 1PKSA 4LDVA 2M0YA 4XQ3A 3FRNA 4TVRA 1N9SA 2YLCA 1H3ZA 1FXXA 1BB9A 1MV3A 1WHLA 2DMOA 3QHSA 4P5NA 3CC2A 1ACMB 3OYNA 3CMEA 2FG0A 2NUTB 4C92E 1NEBA 3EG0A 1QW1A 4KRTA 2LC4A 1MMNA 1YJWA 1VQ5A 2G6FX 2QI2A 1OX8A 1VQNQ 2MWPA 2ZPFB 2MIOA 2LQKA 4EIKA 2X4JA 2DERA 3A8MB 4XK8E 2CYZB 3OMCA 1YCSB 3L2VA 5D6XA 4M7AE 3C95A 3BDLA 4E7IA 5KYUB 2LP5A 5M9OA 3VS1A 1KQSP 2R58A 3MEAA 2E64A 2V8IA 3H9NA 3M5AA 2QEXQ 1PD0A 2JS2A 4J9EA 1BI3A 3VV0A 4A63B 3MP8A 2D0NA 4M75C 4PNOA 2GCXA 4PJOA 4D8DA 2P0PA 2M9UA 2DETA 3CBMA 3H0FA 3G71A 1VYVA 3V7RA 4C0DC 1GXIE 3CEYA 1W6XA 2GQVA 3QJYA 1YWOA 2COYA 1LCKA 2QXFA 8ATCB 1E6GA 1RI0A 2E6ZA 2DXUA 1G3SA 2DNUA 4OMNA 4IUPA 4OB1B 2DTHA 1AD5A 3CQTA 3L2ZA 5KCOA 2C0TA 5KYXA 1SRMA 1YJNQ 3CD6A 3ULRB 4OF1A 2RN8A 2ZAEA 1ZX6A 2EYXA 2OI3A 2KVQG 2COWA 3LH0A 4YTLA 4KULA 5KYUA 2QQSA 2P0QA 2QG9B 4FYWB 5I22A 1VA7A 3C12A 2QEXT 1WLPB 3HP9A 6AT1B 4HT8A 2ZPIB 4MZTA 9ATCB 3OS2A 3HRUA 3O5ZA 4C8QE 3REBB 3OS1A 1NPPA 1WHGA 4JRKA 4Q5WA 1YI2Q 2JUFA 2E3HA 2EAYA 3A1PA 2DVJA 2DTIA 3EG1A 3CCVT 3OS5A 3CCJQ 3EGDB 4IURA 1KQ2A 4ESRA 2RHXA 1LOJA 1IO6A 2YUPA 3CC4Q 1WXUA 5KCHA 1U06A 3HHTB 2K9GA 2BZXA 3VS4A 4BDZA 3OYEA 5KYXB 3JB9F 4O6JA 1JRIA 2DBMA 4HVUA 4Y92A 3GLXA 2F5TX 3G6EA 2DTOA 1K73R 5HCKA 2O4XA 3JCMf 2AZVA 1KIKA 2PNIA 1K1ZA 2FB7A 3I56Q 2JTEA 1YHQT 5FRMA 4AFSC 4DOVA 1M1FA 5GMKl 1M2VB 3HRSA 3CCSQ 4M7DG 1OEBA 2FHDA 2MWOA 2E5KA 5HK0A 1Q7YR 2LQWA 1RABB 3JV3A 2D8HA 1NM7A 2P84A 3OMGA 3QWXX 1QVFP 3EAEA 5CCAA 3VJPA 1BCOA 1PKTA 1JBMA 3PE0A 1LNXA 3G4ST 2OTJQ 1N27A 1W2BP 1W1FA 4LD6A 4ANJA 1FMVA 2DKGA 4ORZA 5KE2A 1EZZB 2EGEA 2A36A 1Y07A 2BTTA 1S72T 1ABQA 2EYYA 2FZKB 2EGAA 4PFOA 4D8KA 1U1SA 2ROLA 3EGDA 3CC2Q 1YHQQ 3A98A 3GIBA 4M4ZA 3QZ5B 3I55T 5LJ5g 4M77A 3EFOA 2GF7A 4PJOF 4EMHA 5LJ5h 3VS7A 2A7YA 4JRIA 3PGGA 4BI3A 4M7DF 4J9HA 5LJ3d 1SKUB 5KYWA 2QQRA 2O4XB 3Q1JA 3V8JA 4M7DE 4XAXB 1KD1U 1YJNA 3TSWA 2KR3A 2DIQA 3E9GA 2A08A 4ZTJA 5DLQE 3VRYA 3JCMb 3UA6A 1S72A 5CKBA 3GOXA 2QA4A 1AWXA 4BE1A 4ZGDB 1U5SA 3OBYA 1YHQA 1KD1C 2CT4A 1X43A 3S3NA 1AWWA 3C4SA 1QVGA 1VQNA 3RMSA 2XICA 3L42A 1G8XA 1KQSA 3CCJT 2R57A 3R6OA 2JJ9A 3SEMA 5HKCA 1NJIC 1YJ9T 3VUBA 1RI9A 5IN1A 3VS6A 2RK2A 3BE3A 1U1TA 3L2UA 2ESWA 4LN2A 3JCMP 2RHIA 1WHJA 3VKIA 2E6NA 1TWBA 3GNGA 3EG9B 2YXYA 5FU7B 2XU8A 3OYJA 1UGRB 5GAN8 1VQLT 2Y90A 3VS0A 3QPHA 1D0XA 1ZA2B 1Y7XA 1TXQA 2OTLQ 4PLLA 3RKYA 3QJ6A 3EH1A 3KXTA 3M55A 2YUNA 2JMCA 4C0ZA 5GJWB 4DA4A 3M53A 4EPCA 3CCQA 1OOTA 4HCKA 5LJ3e 2KROA 2RA2A 2RI2A 2L3RA 1K9MU 3FB9A 3G6EQ 2HD0A 2K6DA 4M75E 5CVIA 1WA7A 4A4KA 1WQ7A 1QVFS 4RMOA 2H8HA 2FYKA 2V1QA 5FU6B 3UA7A 1J3TA 2ATCB 1OPKA 1M5Q1 2PVOB 2YUOA 1JO8A 3M56A 5KYYA 3MO8A 3RNJA 4OB0B 2KK4A 4QT7A 3JRZA 3QO3A 1DJ7B 3EH2A 2YSQA 3M4GA 4HKEA 3HSBA 4FSSA 1YJWQ 3ZFJA 3OYBA 1SSHA 4JDSA 3VRZA 1X6BA 3MHXA 5GAOq 2RK1A 4ZN1A 1ZUUA 3JB9G 5HY6A 4LNPA 5GAN5 4BACA 4JJDA 2DRKA 2SRCA 3PIOA 1AWJA 1I5OB 2MMPA 3CPWA 2V1RA 3VYGA 3ZEHA 1VQNT 5I2MA 4M7AC 2FL7A 4QKUA 4C0GA 1H92A 1ZSZA 4C5IA 5C0MA 2L3PA 2XG8D 1UECA 1WPYA 2XK0A 5EG2A 5DY9A 2VC8A 3A8HB 4CC3A 4ZNXA 2LZ6B 4C92G 1VYUA 2DBKA 2CP7A 1YP5A 4M78G 2VYTA 3L2QA 4BY6B 2MK5A 1VQ8A 3V8LA 4HCCA 2M0OA 2PVDB 2ROTA 3DKMA 4N0AA 3X24B 1HD3A 2ABLA 8AT1B 2VV5A 1Y57A 3AHUA 2LRQA 2Y4XA 1W4SA 2WSFE 1M1KU 4Y28E 2RB6A 2YLBA 3HL8A 1IHWA 1X75C 2RPNA 3FDRA 2DYBA 2RHUA 4F04B 4OMQA 3O8VA 3OW2A 1MUZA 5LJ5f 2LT4A 1Q7YC 5CR2A 2HQHA 2KNBB 1N8RU 2BIVA 2HBWA 2XMFA 1PWTA 2DIGA 1H3HA 2DPPB 2BE9B 2QQBA 1U8RA 3HPWA 1VQ9A 4M7AG 3NTIA 1M8VA 3V7SA 4PJOG 5L23A 2RI3A 2LX9A 1D1AA 3C0CA 5IHKA 4ELYC 3CCMA 1VQOT 5CIUA 5AYFA 1CKAA 5LJ5d 3FJ5A 3WXMB 1P92A 5LJ5j 1UHFA 2CSIA 3R6NA 2KAFA 1QP3A 1OYXA 2L3QA 1K73C 1ZUYA 4FSXA 1N8RR 1X6GA 1WQWA 3OQ5A 3PMIA 3M59A 2X51A 3I56T 4JRPA 1YIJT 4ATOA 2JS0A 5C6SA 3CCET 1GL5A 1K73U 1XQHA 2EJFA 1AZEA 2X9HA 1X69A 2AK5A 4CC2A 3MP1A 3JCMh 3CCVA 4PJMA 2CKKA 2MPXC 1Q82R 4PJOC 3HFOA 4AT1B 3JAME 4MMKA 4MDWA 2PQWA 4DQ2A 3M9QA 1VQ6A 1VQPT 2RM4A 3QUIA 4J6YA 3NFCA 2EYQA 1KC8U 2LQ8A 1K8AC 2CDTA 2K3XA 1ZBXA 3LGFA 4M77E 3CMEQ 1VQ9Q 3OB9A 3RERA 3NMZC 4QQGA 1VQ9T 1QVGS 4J6XA 2XKOC 4C8QD 1I81A 4M7AF 1WFWA 2GGRA 3EFOB 3F70A 1K8AU 2RD1A 2LX7A 3PIPA 2R5MA 4PJJA 3JCMW 1FWZA 3S3MA 3GP8A 5HK3A 4HVWA 4EMKA 2AKKA 1K0SA 1GRIA 1RAAB 1SPKA 2SEMA 2RQVA 2QDYB 2CREA 2XD0A 2G3RA 3CMET 2J05A 1F1BB 4C0FA 4JJNK 4FT4A 3L1AA 3JB9J 2L89A 2K5FA 1HJDA 3NHNA 1QCFA 2V26A 3SFMA 1MMGA 2DK3A 1Z9ZA 4N0AC 4ZGEB 4Z88A 4RG8A 1QCOA 5FW9A 1WHMA 1AEYA 4RKUE 4FT2A 3E2UA 5GAOl 3OYGA 1YIJQ 4B9WA 2YDLA 2PZ1A 2KYMA 1SSFA 2K2MA 4Z8AA 3CCQT 4FIBA 4JLGA 4RG2A 4UC4A 4XU2A 3JCMQ 1YWPA 3EG9A 3A8GB 3QIIA 2DILA 2QTVA 2KY9A 2DVEA 1CSKA 2KT8A 2F2WA 1PHTA 1NG2A 1UGSB 4FU6A 2EKOA 4QVDA 1G3YA 1N8RC 1R77A 3LGLA 1PRMC 1GCQC 1JB0E 2RHYA 4C8QG 4R55A 3S6WA 1H8KA 1VQ5T 4EMKB 2FZCB 2I0NA 5CK9A 4HXJA 1HK9A 5CKFA 1OPLA 3FJPA 2FPDA 3I5RA 1K76A 3CMAA 2FRYA 3CCMT 4Z89A 4HCZA 2CZ6B 1MV0B 4OMMA 2QEXA 3TCJA 4GBQA 1A0NB 3LX7A 3CCLA 2AKLA 4IUVA 4RTYA 1IHVA 4NOYA 3E9FA 1PNJA 1RADB 4BUGA 3H6ZA 2DLPA 4M78F 3CCSA 2O9SA 1TTHB 2RJDA 1YITA 5GAOn 2HNIA 2EWNA 2BKDN 4J9GA 1KFZA 4N4HA 1RACB 2EGCA 1KQ1A 1WXBA 1FMWA 2EQUA 5IAYA 3M0QA 3JCMJ 3D7SB 1VQ5Q 3EHQA 1XNIA 4FYVB 4XTUA 2VASA 2WSEE 1RAEB 3OYDA 5GAN6 1EFNA 1QVPA 2KRMA 1YJ9A 1UEBA 3BY7A 1X01A 3BFMA 2OTJT 4IUQA 3X26B 1M1KR 1JJ2A 2HSPA 2WSCE 3SWNC 1WIEA 2NWMA 4M77F 3INZA 2E70A 5KE3A 1VQKQ 1D1BA 2XI9A 4BB7A 4C5GA 3CCST 4R0KA 1QVGP 2QQ9A 3MCAB 4CC7A 2HL5C 2HAXA 3WVDB 1YJWT 1AT1B 2QDLA 2JXBA 2Y4YA 2HKNA 2DFUA 4O5VA 1RLPC 3I35A 2DO3A 1N5ZA 3PVQA 3QWYA 5GAN3 2L5QA 5CQXA 1WGSA 2NUPA 3TU4K 4OMLA 1KSWA 3HFNA 3TEEA 4OP0A 1HSQA 2VWFA 3CD6Q 1NBEB 4AFUC 2IVWA 1ZA1B 4FM4B 2DL7A 3CCLQ 1M1KC 4DBQA 7AT1B 4IUUA 3G4SA 2LCLA 4J9FA 3DLLA 1QWEA 3OYAA 2YUQA 3RESA 5GANf 1ZSZC 1V76A 2FRWA 3ME9A 4HVVA 3I56A 1NE8A 3G6ET 4BDYA 4QVCA 2CZ7B 4OMPA 1IB8A 1T3LA 4M7DA 1X6OA 2Z0WA 1WZOA 1VQ4Q 1RLQC 1PG5B 1OI1A 4DBHA 1Q86U 3OYHA 2EW3A 1GFDA 1AWOA 4M75F 1UFFA 4J7IA 2OTJA 2LJ0A 2DL8A 2DYIA 2F5KA 1QCNA 1UGPB 1K9MR 2VB6A 2E3IA 2HQEA 4A4HA 2K57A 1B7TA 3KFVA 2PTKA 1VQ6T 2YRCA 1RL2A 2DX1A 1Q82U 4QQDA 1D09B 3X28B 2HBPA 3M0RA 3CC7A 2DEQA 3X20B 3OYMA 2EIFA 2EPDA 2GBQA 3TREA 2FEIA 1YFNA 4M78B 3SHWA 1C6VX 2RQUA 4QQ6A 2LQNA 1FYNA 3EG3A 1FMKA 4B9XA 2F2XA 2JT4A 2DM1A 5DLOA 2YRVA 5GMKi 3MEWA 1W2BS 2VXFA 2CZ1B 4M7AB 3M0PA 1S72Q 3M0SA 2QAZA 2D9TA 1I0CA 2CP3A 3FLGA 2PUKB 1VQKA 1M2VA 1PC0A 2HCKA 3OW2S 2QQAA 3A8OB 3UF4A 4IKFA 3QKJA 4VUBA 4FCYA 3C94A 2AHJB 1KQSS 4F7UE 3QYHB 3OW2P 4MMLA 1SEMA 4J9BA 4JZ3A 1X27A 4M75G 1QP2A 2KYBA 2RNAA 1Q81R 4RCBA 2JOYA 4KUIA 5GMKe 4DEXA 2EYWA 4J9CA 2CS7A 3JB9H 4M77D 2JZ2A 1IREB 4N4GA 2EQJA 1G83A 3FEOA 1KJWA 3IQLA 2KMTA 1M3BA 4DBRA 4BE2A 2GFAA 1M90R 3CC7Q 3HKSA 4NS5A 1VQKT 5FLXE 2MCNA 3FC3A 4K11A 2RQRA 2HEQA 3CC2T 1EX4A 3H8ZA 4RTZA 2E41A 3CCQQ 1ZUKA 2K3BA 1M2OA 2DD4A 2M16A 4M77B 4C0DB 1IGUA 2NYSA 3V8KA 3CCEA 4LXCA 4JRQA 4CRIA 2D8JA 3CPWP 4JUVA 2CSQA 2H3EB 2QK0A 1VQ6Q 1WX6A 1S1NA 1Y71A 3OS0A 2DRMA 2LDMA 4OGCA 1O9SA 1TS9A 2GQIA 3P8BB 4LDWA 3CCUA 2JMAA 1Q82C 3VYHB 5CKEA 5GAMf 1UUEA 2NUTA 1BI0A 1KHCA 2D0QB 1JXMA 1TUDA 4AFZC 2M51A 4JPBW 1YJNT 2KEAA 2ZPHB 4KUDK 3SWNB 1Q86C 2YT6A 3JCMg 5I21A 1SRLA 5D6YA 3ASKA 5IXBA 1I1JA 1UHCA 2GTOA 4KT0E 4C5HA 1OX9A 2VGMA 2DF6A 4B6MA 1RAIB 2VVKA 2CH4A 2JVVA 3UT1A 3RR6A 2DAQA 3M0UA 3OYYA 3ZL7C 1R0CB 1M90U 5GANd 1T0HA 4C8QC 2F1LA 2X4XA 2E10A 3OYFA 4KH1B 1RAGB 3J80E 3DB4A 1ZBJA 2DXTA 2R5AA 3RBBB 2ZZDA 1NLOC 2O9VA 4C8QA 4C92A 3GPLA 3OYKA 2DZCA 1BYMA 5GANe 1PSEA 2AT1B 2D6FA 1NJIR 4V2SA 2MOXA 2V8KA 3CCLT 4E7SA 1PM3A 2LVMA 4JS5A 3CBOA 1R0BG 1TOVA 1GFCA 3MEVA 4L59A 4BE0A 1YJ9Q 3M4YA 4MZPA 2GNCA 3HTRA 3WVEB 4E6RA 3UPUA 4OVAA 2DA9A 1BI1A 4XTWA 1T0JA 4EDUA 1VQ4T 1D0ZA 2IIMA 2ED1A 1Y96A 2L8DA 3JSCA 5GAN4 2E1HA 3M0TA 1QWFA 2A37A 5DM7R 3VS3A 1G3WA 2JTFA 2J7IA 2LMJA 5IXFA 4A4GA 5CAIA 1YIJA 1ZSGA 3NPFA 4M75A 4WF2A 1LJOA 3P8DA 4BI8B 1VQ4A 3JCMe 3OY9A 2CH4W 5A0GA 1VQ8T 4JZ4A 1WJQA 3EGXB 1YITT 3A8LB 1V1CA 2NUZA 4C92B 1BU1A 1UB4A 3PT9A 1M3CA 3QG1A 3RDVA 2DXCA 3EHRA 4M78C 5GAMd 3NGPA 4M75D 2ECZA 3CPFA 2W0ZA 4ZTFA 3PFSA 3JB9D 3RIRA 3H0HA 5FU6C 4F16A 3MPUB 1TSFA 3RKWA 1VQMA 1Y96B 1I07A 2VKNA 3G4SQ 1Q86R 4PFPA 1U3OA 1WI7A 4PJOE 1AOJA 4RTTA 4NL3A 2ENMA 5IHNA 4A53A 1B34B 2A3LA 4F7UG 4XTXA 4HCBA 3QXEB 4Z02A 2DJZA 4A4FA 4XU3A 2XIDA 3H0IA 2A0FB 4JJCA 2KBTA 5CKDA 1M8MA 3FIFA 1NYGA 2DE0X 3LWHA 1O75A 4M75B 2YWWA 1ZQ1A 2K7AA 2KE9A 4CC4B 5LJ3h 5IT9E 1M1GA 2XDPA 3M54A 1JQQA 4E7LA 2AIRB 3UDCA 1WDXA 1XOVA 1UJ0A 2LNHB 5FWBA 3H41A 1TUGB 4PL6A 1CKBA 4M77C 4J9DA 4C5EA 4JLIA 2K5LA 4OB3B 3QZ9B 2EVRA 4J9IA 4MZMA 2CP6A 2KXCA 4PJNA 4E47A 4KH0B
chains in the Genus database with same CATH topology
4E7HA 5KH6A 4ELZC 2ZPGB 3JRZA 3OSSC 3QO3A 1DJ7B 4IUUA 3QDRB 4J8OA 3G4SA 3LWIA 5A2QE 2LCLA 3M4GA 4M7AA 2MAMA 1MHNA 4IUTA 2K2VA 2NLUA 4HKEA 1WJRA 2PVGB 3DLMA 4QVZA 3OYAA 3DLLA 1NJIU 5A0DA 1VQ7T 1G3TA 1I4K1 3HSBA 2RJCA 3EFRA 1M90C 2XHCA 4DOWA 3RESA 1NPRA 5A0LA 5GANf 3M57A 3ZFJA 3OYBA 5CO7A 1W2BA 4BY6C 3OA6A 3G71T 3ME9A 4JDSA 2ZPEB 4EMKC 4E7JA 4M7DD 3I56A 3MHXA 1NE8A 3RUXA 5GAOq 2RK1A 3T9NA 4ZN1A 3G6ET 3JB9G 4BDYA 4QVCA 1I8FA 2CZ7B 5HY6A 1YI2T 4L5GA 1VQLA 3QSUA 5GAN5 4BACA 4M7DA 1X6OA 3PIOA 4EMGA 4LDXA 3J7AF 1H641 3OYCA 1OI1A 2MMPA 2RH2A 4PKCC 3CPWA 1Q86U 3VYGA 4J7FA 2MF2A 3OYHA 3CXCS 1BIAA 2K4YA 4R56A 3CMAT 1NZ9A 3ZEHA 2E12A 2KQWA 4M75F 1VQNT 1VIFA 4OMFB 5I2MA 4J7IA 4M7AC 2OTJA 5GAMj 2F5KA 4J6WA 3OYIA 2FL7A 2MI6A 4ZN3A 1UGPB 5J39A 3N5BB 2HQEA 3KBGA 4A4HA 4C0GA 2CGHA 2K57A 1EIFA 3PMTA 4HT9A 1VQ6T 4C5IA 2GFUA 2RO0A 4LDVA 1RL2A 4XQ3A 1VQPA 5C0MA 1Q82U 4QQDA 3FRNA 4TVRA 1VIEA 2XG8D 3X28B 2HBPA 1N9SA 2YLCA 1WPYA 3CC7A 1FXXA 1H3ZA 2XK0A 3QHSA 5EG2A 5DY9A 4P5NA 2VC8A 2DEQA 3A8HB 3X20B 3OYMA 2EIFA 4C92G 3TREA 1D3BA 3OSVA 1KQSS 2RJEA 2PUOB 3V7CA 4M78G 2VYTA 1MGQA 4M78B 4BY6B 3L2QA 3OYNA 3CMEA 3CPWS 3CC2A 4NL2A 1VQ8A 4C8QF 4C92E 4A54A 4M7AD 3V8LA 3CCRA 5LL6S 3CXCA 2M0OA 4HCCA 1QW1A 2PVDB 4N0AA 3DKMA 2O01E 4KBMB 3X24B 4QQ6A 1BIBA 2VV5A 3AHUA 2LC4A 2LRQA 2Y4XA 1YJWA 1VQ5A 2OAUA 4ZGJB 1W4SA 2WSFE 1M1KU 2E5QA 4Y28E 2P4TA 3RMQA 4B9XA 2QI2A 4BI4A 2RB6A 2YLBA 3CC4A 5GAMh 1VQOA 2MWPA 3HL8A 2ZPFB 5DLOA 2YRVA 1X75C 5GMKj 2LQKA 3P8HA 1TH7A 4C92C 5GMKi 2X4JA 3MEWA 1W2BS 2VXFA 2CZ1B 3A8MB 3FDRA 4XK8E 2CYZB 2RHUA 3OMCA 3OW2A 3O8VA 3L2VA 3BDUA 4M7AB 5LJ5f 1VUBA 5D6XA 2LT4A 3G7ZA 1Q7YC 5CR2A 4M7AE 4C92D 2RJFA 3C95A 2XDDA 2D9TA 3BDLA 4E7IA 1N8RU 2BIVA 3SB2A 2LTOA 3FLGA 2PUKB 5M9OA 1VQKA 2DIGA 2R58A 4XU0A 4E7KA 2DPPB 3MEAA 3OW2S 2QQBA 2QQAA 3A8OB 1U8RA 2E64A 2V8IA 3HPWA 3M5AA 1JJ2S 3CD6T 2K3YA 1VQ9A 4IKFA 3QKJA 4M7AG 1BI3A 3NTIA 3E1SA 4VUBA 1M8VA 1BKBA 3KUFA 3SD4A 3VV0A 3J81E 1K9MC 3V7SA 3C94A 4PJOG 1QVFA 5GAOm 3MP8A 1AHJB 2RI3A 5LJ3j 4M75C 4PNOA 2AHJB 2GCXA 2LX9A 5FROA 4F7UE 3QYHB 4ELYC 5I2SA 5CIUA 5AYFA 3CCMA 1VQMT 2ZCFB 1VQOT 5LJ5d 2P0PA 4MMLA 3SWNA 2M9UA 3CBMA 4Y91A 3G71A 4M75G 1QP2A 3V7RA 3WXMB 4M78E 3MP6A 1P92A 4RCBA 5LJ5j 2JOYA 4KUIA 4C0DC 5GMKe 1GXIE 2CS7A 2KAFA 3JB9H 1D3BB 3CEYA 2JTMA 1QP3A 4M77D 1OYXA 1VQ7A 2JZ2A 2EQMA 2GQVA 1K73C 3QJYA 1IREB 1PSFA 4N4GA 4FSXA 3GNFB 3MEUA 1WQWA 2EQJA 2QXFA 3OQ5A 3FEOA 1RI0A 2E6ZA 2V8JA 2DXUA 3M59A 3PMIA 1G3SA 2KMTA 3S3OA 4IUPA 4BE2A 2GFAA 4LDUA 4OB1B 2DTHA 3OBWA 3I56T 4JRPA 1YIJT 3HKSA 4ATOA 4NS5A 1VQKT 5C6SA 2VUBA 3L2ZA 5FLXE 3FC3A 3CCET 2RHZA 5KCOA 4MDXA 1K73U 1XQHA 1XTDA 2EJFA 3CCUT 4XTVA 3CD6A 4OF1A 3MP1A 3JCMh 3CCVA 2CKKA 3CC2T 4PJOC 3HFOA 1N6AA 4M7DF 2KVQG 1OZ2A 3LH0A 4M7DC 3H8ZA 4YTLA 5CCAA 4J5YA 5GAN7 2E41A 4KULA 4MDWA 2PQWA 4MMKA 4C92F 3JAME 4C8QB 2QQSA 2DD4A 2M16A 2P0QA 4F7UA 4M77B 5GAOp 4DQ2A 3M9QA 4C0DB 3CBPA 1VQPT 1VQ6A 2X4WA 4ME7A 3C12A 2QEXT 4BD3A 3V8KA 2RM4A 3QUIA 2EJ9A 4J6YA 3NFCA 3CCEA 3CCRT 4JRQA 2EYQA 3HP9A 3JCMV 4CRIA 5LJ5e 1KC8U 2LQ8A 3X25B 4HT8A 2ZPIB 4JUVA 4II1A 1K8AC 2K3XA 1ZBXA 3LGFA 4M77E 4MZTA 2OTLA 3OS2A 3HRUA 3I55A 1Y71A 3OB9A 4X9CA 4C8QE 3OS0A 4QQGA 3VU3C 3RERA 2LDMA 3JCMd 3OS1A 1VQ9T 4XTZA 1NPPA 4OGCA 1QVGS 4J6XA 2BUDA 4JRKA 1O9SA 2XKOC 5FRNA 4C8QD 4Q5WA 1I81A 4M7AF 3P8BB 4LDWA 4M78D 2JUFA 1M9SA 2X4YA 5GANh 3QBYA 3CCUA 1YI2A 2EAYA 3F70A 4J83A 3ZBDA 1Q82C 3VYHB 5CKEA 1K8AU 2RI5A 5GAMf 1BI0A 1KHCA 2RD1A 2D0QB 1WJSA 2DTIA 3PNWC 3CCVT 3PIPA 3OS5A 3VUZA 2PU9B 5FU7C 4PJOB 2R5MA 3JCMW 1FWZA 1YJNT 3RKXA 3S3MA 4IURA 3GP8A 1KQ2A 2RHXA 1LOJA 2ZPHB 5HK3A 4KUDK 3SWNB 1Q86C 4EMKA 3L2RA 3JCMg 1Q81C 5GAMe 5I21A 5KCHA 3L2WA 5D6YA 4F7UF 3HHTB 4LDYA 3ASKA 3LLRA 2QDYB 4HA8A 4BDZA 2XD0A 3OYEA 2G3RA 3JB9F 3CMET 4O6JA 1YCYA 4KT0E 4C5HA 1JRIA 4C0FA 3GLXA 2F5TX 3G6EA 4JJNK 2DTOA 2VGMA 4FT4A 3L1AA 3JB9J 2O4XA 4GLKA 3JCMf 2L89A 2K5FA 2KK4A 4OB0B 4L6V5 2FB7A 3CC7T 2JVVA 3SFMA 3UT1A 2DK3A 5LJ3g 1YHQT 4N0AC 1Q7YU 4DOVA 1HXDA 2DAQA 4ZGEB 5FRMA 4RG8A 1M1FA 3E19A 5GMKl 2KDSA 3HRSA 3OYYA 4M7DG 4F7UB 3DB3A 4RKUE 4FT2A 5GAOl 3OYGA 1M90U 2FHDA 5GANd 2MWOA 2C06A 1UGQB 4B9WA 4C8QC 5HK0A 2LNVA 2X4XA 2E10A 3UWNA 3OYFA 1SSFA 2B8AA 4M77G 2JN0A 3J80E 3PTAA 3OMGA 3DB4A 2DXTA 2R5AA 2DD5A 3EAEA 3URGA 2ZZDA 4FIBA 3VJPA 1JBMA 4XU1A 1LNXA 3LYIA 4JLGA 3SDZA 4C8QA 3G4ST 4RG2A 1N27A 4LD6A 4UC4A 4XU2A 4C92A 2DKGA 3JCMQ 2DZCA 3OYKA 3GPLA 3CC4T 3JB9I 1BYMA 5GANe 4XTYA 1PSEA 3A8GB 3QIIA 5KE2A 3NTHA 2KY9A 5GANj 2D6FA 2DVEA 1Y07A 1S72T 4V2SA 2V8KA 3BW1A 3CCLT 2LVMA 1U1SA 4JS5A 3CBOA 1UGSB 4FU6A 1B34A 2EKOA 3MEVA 4QVDA 1G3YA 1N8RC 2M1HA 4JS4A 3LGLA 3HRTA 4PJOD 4L59A 1JB0E 4BE0A 2RHYA 3M4YA 4MZPA 4C8QG 4R55A 3S6WA 3WVEB 3UPUA 4OVAA 1VQ5T 4EMKB 1BI1A 4XTWA 1VQ4T 4EDUA 3GIBA 3QZ5B 5CK9A 3I55T 5LJ5g 1Y96A 1HK9A 2L8DA 5CKFA 3FJPA 4M77A 3JSCA 3CMAA 1FX7A 5GAN4 2GF7A 4OB2B 4PJOF 2E1HA 4EMHA 5LJ5h 4PJOA 3CCMT 5DM7R 2A7YA 4HCZA 4JRIA 2CZ6B 2IG0A 3PGGA 4BI3A 1G3WA 1V29B 2DXBA 2JTFA 2XDBA 5LJ3d 2QEXA 2QQRA 2O4XB 3ER0A 3Q1JA 3V8JA 4M7DE 4XAXB 3TCJA 3LX7A 1KD1U 3CCLA 4IUVA 4A4GA 5CAIA 4M7DB 1YIJA 1IZ6A 4NOYA 1YJNA 3QYGB 4ZTJA 3E9GA 2DIQA 3E9FA 5DLQE 3JCMX 2DZ9A 4M75A 4BUGA 3JCMb 3H6ZA 1S72A 4WF2A 5CKBA 3GOXA 1LJOA 3P8DA 4GY5A 4M78F 4BI8B 3CCSA 2QA4A 1VQ4A 2RJDA 3JCMe 5GAMg 3OY9A 3NTKA 5L8RE 1YITA 5A0GA 5GAOn 2K5IA 4ZGDB 4BE1A 2EFIA 3OBYA 1YHQA 1KD1C 2HNIA 2EWNA 2BKDN 5J3BA 1VQ8T 1WJQA 4N4HA 1KHIA 1YITT 1KC8C 3S3NA 3A8LB 3C4SA 1QVGA 1VQNA 3RMSA 1KQ1A 2XICA 3LW5E 4X34A 3L42A 1KQSA 3CCJT 2EQUA 5IAYA 4RCCA 4N4IA 2R57A 4C92B 1UB4A 1KG1A 3R6OA 3JCMJ 3PT9A 5HKCA 3QG1A 1NJIC 1XNIA 1YJ9T 4XTUA 3CCQT 2HQXA 2WSEE 3VUBA 5GAN6 2ZPBB 3OYDA 1QVPA 1OZ3A 2DXCA 4M78C 1YJ9A 5GAMd 1UEBA 3BY7A 5GAOr 2JNGA 4M75D 5IN1A 1X01A 2RK2A 1R8OB 3BFMA 1U1TA 3L2UA 2OTJT 4IUQA 3CPFA 3X26B 4ZTFA 5CKHA 3JCMP 2WSCE 1JJ2A 2RHIA 2EQKA 5J26A 3PFSA 4PLIA 3VKIA 2E6NA 2CZ0B 3SWNC 3JB9D 4M77F 3RIRA 3GNGA 5FU6C 2F69A 3INZA 1ZHIA 2VGNA 5FU7B 1M4ZA 2E70A 3RKWA 5KE3A 2YHTA 2XU8A 1VQMA 1Y96B 3OYJA 1UGRB 4FL6A 2XI9A 1N9RA 2FVUA 2Y90A 4BB7A 5GAN8 1VQLT 4PJOE 4C5GA 2WACA 3QPHA 4M78A 3CCST 2QA4T 2I2LA 4NL3A 1Y7XA 5GMKh 4PLLA 1BI2A 2QQ9A 3EFSA 1Q81U 3M58A 2OTLT 3MCAB 4A53A 1B34B 3RKYA 3GF5A 2A3LA 3JCMc 5GMKm 4F7UG 2HAXA 4XTXA 3WVDB 1YJWT 4HCBA 3QJ6A 3QXEB 2DJZA 2KSSA 4Z02A 4A4FA 3META 4XU3A 2LT1A 2EJGA 2XIDA 4X9DA 2Y4YA 3KXTA 2E65A 5CKDA 3M55A 3FIFA 4C0ZA 4O5VA 4DA4A 3M53A 4EPCA 4A4EA 3LWHA 2DO3A 5GAN2 1I5LA 1O75A 4D6WA 4M75B 3CCQA 1ZQ1A 1YBYA 5LJ3e 5LJ3h 5IT9E 1M1GA 2RA2A 5GAN3 2X35A 2RI2A 2L3RA 1K9MU 2L5QA 2XDPA 4OGEA 3M54A 5CQXA 4LD9K 3FB9A 2HD0A 2P0KA 4E7LA 1WGSA 3UDCA 3TU4K 4M75E 5CVIA 1XOVA 1G5VA 3HFNA 4A4KA 1WQ7A 2VXEA 3TEEA 4OP0A 5D6WA 1QVFS 4RMOA 4QW2A 2FYKA 5FU6B 5CQYA 4CI0C 4PL6A 2IVWA 4FM4B 3A5ZB 4M77C 1WNLA 2H3JA 4C5EA 4JLIA 1M5Q1 2LCCA 2K5LA 2PVOB 4OB3B 2QTXA 3QZ9B 5LJ3f 1M1KC 4MZMA 3CCJA 3M56A 5GANg 3MO8A 4E47A 3OYLA 2ZGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7H A;  2DIG A;  2R58 A;  2R5M A;  5KH6 A;  4E7K A;  3H6Z A;  3MEA A;  4IUU A;  3S3M A;  4IUR A;  3GOX A;  2RHX A;  4GY5 A;  3P8D A;  2K3Y A;  1MHN A;  2RJD A;  3QKJ A;  4IKF A;  3NTI A;  4IUT A;  3NTK A;  2NLU A;  3OY9 A;  1WJR A;  3DLM A;  3SD4 A;  3KUF A;  4QVZ A;  3OYA A;  2EFI A;  3OYL A;  5KCH A;  3L2R A;  3L2W A;  4BE1 A;  2BKD N;  2RJC A;  5D6Y A;  1WJQ A;  3MP8 A;  3ASK A;  4N4H A;  3S3N A;  2RI3 A;  3LLR A;  3OYB A;  5FRO A;  4BDZ A;  3OYE A;  3C4S A;  5CIU A;  2G3R A;  3OA6 A;  3ME9 A;  4X34 A;  4C5H A;  3L42 A;  2EQU A;  5IAY A;  4E7J A;  4N4I A;  2R57 A;  2O4X A;  2L89 A;  4BDY A;  3MP6 A;  1XNI A;  4BAC A;  2HQX A;  3OYD A;  3UT1 A;  3CEY A;  1OZ3 A;  5FRM A;  1OYX A;  2DAQ A;  2JZ2 A;  2EQM A;  3OYC A;  1OI1 A;  4N4G A;  5IN1 A;  3MEU A;  3OYH A;  3L2U A;  4IUQ A;  2EQJ A;  3DB3 A;  3OYG A;  3OQ5 A;  3FEO A;  3ZEH A;  4ZTF A;  1RI0 A;  2EQK A;  2RHI A;  2FHD A;  3PFS A;  2MWO A;  3PMI A;  2E6N A;  4PLI A;  5J26 A;  4B9W A;  3S3O A;  2X4X A;  4IUP A;  3UWN A;  2GFA A;  3OYF A;  2F5K A;  3OYI A;  4BE2 A;  1SSF A;  4NS5 A;  2B8A A;  5J39 A;  2HQE A;  5C6S A;  5KE3 A;  4A4H A;  3OMG A;  3FC3 A;  2RHZ A;  5KCO A;  3DB4 A;  3PMT A;  3OYJ A;  4FL6 A;  2R5A A;  3EAE A;  2GFU A;  2RO0 A;  4C5I A;  2WAC A;  4C5G A;  3LYI A;  5C0M A;  4QQD A;  4RG2 A;  1N27 A;  4LD6 A;  4PLL A;  4UC4 A;  3OYK A;  1H3Z A;  3MP1 A;  2XK0 A;  3QII A;  2CKK A;  5KE2 A;  3NTH A;  3OYM A;  3QJ6 A;  4Z02 A;  4A4F A;  1OZ2 A;  2RJE A;  3LH0 A;  3MET A;  3H8Z A;  3L2Q A;  2VYT A;  2PQW A;  3OYN A;  2LVM A;  2QQS A;  2M16 A;  4A4E A;  4FU6 A;  3M9Q A;  2EKO A;  3MEV A;  2M0O A;  2X4W A;  2M1H A;  3LGL A;  4BD3 A;  4L59 A;  4BE0 A;  2RHY A;  2X35 A;  2RI2 A;  2L3R A;  4QQ6 A;  3S6W A;  2XDP A;  4OVA A;  4CRI A;  4EDU A;  2P0K A;  2LRQ A;  4E7L A;  1WGS A;  4II1 A;  2L8D A;  1G5V A;  2K3X A;  2E5Q A;  3FLG A;  3LGF A;  4B9X A;  2GF7 A;  3OS2 A;  5D6W A;  2MWP A;  3OB9 A;  2YRV A;  4QW2 A;  4QQG A;  3OS0 A;  2LDM A;  3P8H A;  4HCZ A;  3OS1 A;  3MEW A;  2IG0 A;  2BUD A;  2JTF A;  4PL6 A;  3FDR A;  5FRN A;  4Q5W A;  2QQR A;  2O4X B;  2RHU A;  3O8V A;  3OMC A;  3Q1J A;  3L2V A;  3LX7 A;  5D6X A;  2X4Y A;  4IUV A;  3QBY A;  4C5E A;  2LCC A;  4A4G A;  3F70 A;  2RJF A;  2D9T A;  3BDL A;  2RI5 A;  4E7I A;  2BIV A;  1KHC A;  2LTO A;  2DIQ A;  3E9G A;  3E9F A;  3PNW C;  1WJS A;  3MO8 A;  4ZTJ A;  5M9O A; 
#chains in the Genus database with same CATH topology
 4E7H A;  2ZPG B;  3OSS C;  1GBR A;  3QDR B;  4J8O A;  3LWI A;  5A2Q E;  4M7A A;  2MAM A;  1MHN A;  1VYT A;  2K2V A;  1WJR A;  1QMC A;  4QVZ A;  1C1A A;  5A0D A;  1I4K 1;  1Q95 G;  2RJC A;  4OMO A;  1M90 C;  2DJQ A;  5A0L A;  3M57 A;  2DEU A;  5I11 A;  2HMA A;  1E7O A;  4BY6 C;  3OA6 A;  3G71 T;  2X3X D;  4EMK C;  1IXD A;  4E7J A;  4M7D D;  3CCM Q;  4FW1 A;  5KYW B;  3T9N A;  1WYX A;  2F2V A;  2IPO B;  1YI2 T;  4AMC A;  1OQK A;  1VQL A;  3QSU A;  1YIT Q;  1RAH B;  4LDX A;  2HDA A;  4RUG A;  3J7A F;  4J7F A;  3CXC S;  1BIA A;  4R56 A;  3CMA T;  1NZ9 A;  2HKQ B;  1JU5 C;  4IIM A;  1PCX A;  2RQT A;  4ZN3 A;  5J39 A;  3N5B B;  2LJ3 A;  2LJ1 A;  3CCV Q;  1EIF A;  3PMT A;  2HL3 A;  1UJY A;  4DEY A;  2RO0 A;  1VQM Q;  1VQP A;  1ZLM A;  2J6F A;  1VIE A;  1OUL A;  1TUC A;  2KI7 A;  1D3B A;  3OSV A;  1GCQ A;  2RJE A;  2PUO B;  3V7C A;  1QKW A;  3CPW S;  1MGQ A;  2P4R A;  4NL2 A;  4C8Q F;  4A54 A;  4M7A D;  1ABO A;  3CCR A;  5LL6 S;  2O31 A;  3CXC A;  2HSE B;  4KBM B;  2O01 E;  1WHH A;  3U23 A;  2CT3 A;  1BIB A;  3EG2 A;  3I9Q A;  3TSZ A;  2L2P A;  2OAU A;  4ZGJ B;  1UE9 A;  1WHK A;  2E5Q A;  2P4T A;  3RMQ A;  4BI4 A;  3CC4 A;  1OU8 A;  5GAM h;  1VQO A;  2C0O A;  5GMK j;  2KGT A;  1TH7 A;  3P8H A;  4C92 C;  1C0M A;  2X3W D;  3QDF A;  4E2F B;  4F17 A;  1KC8 R;  3BDU A;  1VUB A;  3G7Z A;  1LVK A;  4C92 D;  2RJF A;  3VS2 A;  2XDD A;  3SB2 A;  2LTO A;  1RUW A;  1SF9 A;  4E7K A;  4XU0 A;  4JJB A;  3CD6 T;  1ARK A;  2QAS A;  3UAT A;  1JJ2 S;  2K3Y A;  1GCP A;  3E1S A;  1X2K A;  1BKB A;  3KUF A;  3SD4 A;  3J81 E;  1K9M C;  1QVF A;  1MMD A;  5KYY B;  5GAO m;  1AHJ B;  1YNZ A;  2DL3 A;  5LJ3 j;  1VQL Q;  5FRO A;  1VOM A;  5I2S A;  1VQM T;  2ZCF B;  1OU9 A;  1HYO A;  2CP0 A;  2M02 A;  3MJX A;  3SWN A;  4Y91 A;  3CMA Q;  2QGF B;  4RTX A;  4M78 E;  3MP6 A;  2FPF A;  1D3B B;  2EBP A;  2JTM A;  2EQI A;  1VQ7 A;  2EQM A;  1AVZ C;  1SHF A;  1PSF A;  3GBQ A;  2J6O A;  3GNF B;  3MEU A;  3TQ7 P;  1NEG A;  2V8J A;  5EC7 A;  3S3O A;  4LDU A;  3OBW A;  1G2B A;  4GLM A;  2VUB A;  4MDX A;  2RHZ A;  1XTD A;  2KRN A;  3CCU T;  4XTV A;  1UTI A;  4LE9 A;  1T3S A;  4KGZ B;  1N6A A;  1OZ2 A;  3CCE Q;  4M7D C;  5GAN 7;  1VQO Q;  4J5Y A;  4C92 F;  2KT1 A;  1TG0 A;  4C8Q B;  5AT1 B;  4F7U A;  5GAO p;  3CBP A;  2X4W A;  4ME7 A;  3CXC P;  4BD3 A;  4F14 A;  2EJ9 A;  3CCR T;  3JCM V;  5LJ5 e;  3X25 B;  3CCR Q;  1ZSZ B;  4II1 A;  2OTL A;  1PRL C;  3I55 A;  4X9C A;  1NLP C;  3VU3 C;  3JCM d;  4XTZ A;  2YRD A;  2BUD A;  5FRN A;  4KGV B;  4M78 D;  1M27 C;  1M9S A;  2B86 A;  2X4Y A;  5GAN h;  3QBY A;  1YI2 A;  4J83 A;  3ZBD A;  2RI5 A;  2CP5 A;  2RQW A;  1WJS A;  3PNW C;  1D0Y A;  3VUZ A;  2PU9 B;  5FU7 C;  4PJO B;  3CCU Q;  3RKX A;  4PFZ A;  3L2R A;  1Q81 C;  5GAM e;  3L2W A;  3THK A;  4F7U F;  4LDY A;  3I55 Q;  3LLR A;  1WXT A;  4HA8 A;  1IRX A;  2EYZ A;  1YCY A;  1JEG A;  2RMO A;  4RTV A;  2J06 A;  4GLK A;  1NYF A;  1K8A R;  1KD1 R;  3EGX A;  4AG1 C;  4L6V 5;  1UG1 A;  1BBZ A;  3CC7 T;  3PVL A;  2O88 A;  1K4U S;  5LJ3 g;  1Q7Y U;  1HXD A;  1W70 A;  3E19 A;  1XJW B;  2KDS A;  1AZG B;  4F7U B;  3DB3 A;  1MND A;  5ECA A;  1M30 A;  2C06 A;  1UGQ B;  2LNV A;  3UWN A;  2L0A A;  2B8A A;  4M77 G;  2JN0 A;  3PTA A;  2NUP B;  3EGU A;  2QYZ A;  2DD5 A;  1Y0M A;  3URG A;  5GMK h;  4XU1 A;  3LYI A;  3SDZ A;  1IGQ A;  3CC4 T;  3JB9 I;  4XTY A;  4X1V A;  3NTH A;  5GAN j;  1B07 A;  3BW1 A;  1YN8 A;  1B34 A;  2M1H A;  4JS4 A;  5KYN A;  3HRT A;  4PJO D;  2DL4 A;  2C0I A;  1VQ8 Q;  2K79 A;  1UDL A;  2BZ8 A;  1K0X A;  2CP2 A;  1QLY A;  2O2O A;  2QGG A;  5IH2 A;  1FX7 A;  4OB2 B;  2IG0 A;  1V29 B;  2DXB A;  2XDB A;  3ER0 A;  2W10 A;  3LH5 A;  1KK7 A;  4M7D B;  1IZ6 A;  2QA4 Q;  2JW4 A;  3QYG B;  2J6K A;  1B3Q A;  1LPL A;  2BE7 D;  3JCM X;  2DZ9 A;  4GY5 A;  5GAM g;  3NTK A;  5L8R E;  2K5I A;  2EFI A;  5J3B A;  1KC8 C;  1KHI A;  1JXO A;  2CUD A;  2MYS A;  2FPE A;  4RTU A;  3LW5 E;  4X34 A;  4RCC A;  4N4I A;  1KG1 A;  5D7U A;  4KGX B;  2ED0 A;  5IHI A;  2OJ2 A;  2OX7 A;  1QQJ A;  1BK2 A;  2HQX A;  4AFQ C;  2ZPB B;  1MNE A;  1OZ3 A;  1PD1 A;  5GAO r;  2JNG A;  1R8O B;  5FWC A;  5GJV B;  1VQP Q;  2HZY A;  2EKH A;  5CKH A;  2EQK A;  5J26 A;  4PLI A;  2AZS A;  2CZ0 B;  1GBQ A;  2F69 A;  1SG5 A;  1ZHI A;  2VGN A;  1M4Z A;  2YHT A;  3G1J A;  1MMA A;  2BZY A;  1N9R A;  2FVU A;  4FL6 A;  2QA4 T;  2WAC A;  4M78 A;  4E7Z A;  2I2L A;  1RAF B;  1BI2 A;  3EFS A;  1Q81 U;  3M58 A;  2D1X A;  4AG2 C;  2OTL T;  2JM9 A;  3GF5 A;  3JCM c;  5GMK m;  2JM8 A;  2KSS A;  4DBF A;  3MET A;  2LT1 A;  2EJG A;  4X9D A;  2E65 A;  4A4E A;  2COZ A;  5GAN 2;  1I5L A;  4D6W A;  1YBY A;  2X35 A;  2GTJ A;  4OGE A;  1QKX A;  4LD9 K;  1BCM A;  2RF0 A;  2P0K A;  1OV3 A;  2A28 A;  1G5V A;  2VXE A;  4FYY B;  5D6W A;  3TVT A;  2KRS A;  4QW2 A;  3VS5 A;  1D1C A;  1Z9Q A;  2CUB A;  5CQY A;  4CI0 C;  4PK4 A;  2KXD A;  3A5Z B;  1WNL A;  1JJ2 P;  2H3J A;  2LCC A;  2QTX A;  2E4H A;  1E6H A;  5LJ3 f;  1SHG A;  3CCJ A;  5GAN g;  2FO0 A;  4RTW A;  3OYL A;  2ZGW A;  5KH6 A;  4ELZ C;  4LUD A;  1VQ7 Q;  4IUT A;  2NLU A;  3DLM A;  2PVG B;  1NJI U;  1VQ7 T;  4WCI A;  1G3T A;  3EFR A;  1UGV A;  2XHC A;  4IIO A;  1M3A A;  1NPR A;  3REA B;  4DOW A;  3G71 Q;  2LCS A;  5CO7 A;  3MKD A;  1W2B A;  4FYX B;  2ZPE B;  2OAW A;  3RUX A;  3AT1 B;  1I8F A;  4L5G A;  3I5S A;  4EMG A;  1H64 1;  3OYC A;  4PKC C;  2RH2 A;  2MF2 A;  4WTO B;  2K4Y A;  2E12 A;  2KQW A;  1VIF A;  4OMF B;  4FW2 A;  5GAM j;  4LUE A;  4J6W A;  3OYI A;  2MI6 A;  3KBG A;  2CGH A;  1K9A A;  2DL5 A;  2L3S A;  4HT9 A;  2FZG B;  4PJL A;  2GFU A;  1TU0 B;  1X2Q A;  1PKS A;  4LDV A;  2M0Y A;  4XQ3 A;  3FRN A;  4TVR A;  1N9S A;  2YLC A;  1H3Z A;  1FXX A;  1BB9 A;  1MV3 A;  1WHL A;  2DMO A;  3QHS A;  4P5N A;  3CC2 A;  1ACM B;  3OYN A;  3CME A;  2FG0 A;  2NUT B;  4C92 E;  1NEB A;  3EG0 A;  1QW1 A;  4KRT A;  2LC4 A;  1MMN A;  1YJW A;  1VQ5 A;  2G6F X;  2QI2 A;  1OX8 A;  1VQN Q;  2MWP A;  2ZPF B;  2MIO A;  2LQK A;  4EIK A;  2X4J A;  2DER A;  3A8M B;  4XK8 E;  2CYZ B;  3OMC A;  1YCS B;  3L2V A;  5D6X A;  4M7A E;  3C95 A;  3BDL A;  4E7I A;  5KYU B;  2LP5 A;  5M9O A;  3VS1 A;  1KQS P;  2R58 A;  3MEA A;  2E64 A;  2V8I A;  3H9N A;  3M5A A;  2QEX Q;  1PD0 A;  2JS2 A;  4J9E A;  1BI3 A;  3VV0 A;  4A63 B;  3MP8 A;  2D0N A;  4M75 C;  4PNO A;  2GCX A;  4PJO A;  4D8D A;  2P0P A;  2M9U A;  2DET A;  3CBM A;  3H0F A;  3G71 A;  1VYV A;  3V7R A;  4C0D C;  1GXI E;  3CEY A;  1W6X A;  2GQV A;  3QJY A;  1YWO A;  2COY A;  1LCK A;  2QXF A;  8ATC B;  1E6G A;  1RI0 A;  2E6Z A;  2DXU A;  1G3S A;  2DNU A;  4OMN A;  4IUP A;  4OB1 B;  2DTH A;  1AD5 A;  3CQT A;  3L2Z A;  5KCO A;  2C0T A;  5KYX A;  1SRM A;  1YJN Q;  3CD6 A;  3ULR B;  4OF1 A;  2RN8 A;  2ZAE A;  1ZX6 A;  2EYX A;  2OI3 A;  2KVQ G;  2COW A;  3LH0 A;  4YTL A;  4KUL A;  5KYU A;  2QQS A;  2P0Q A;  2QG9 B;  4FYW B;  5I22 A;  1VA7 A;  3C12 A;  2QEX T;  1WLP B;  3HP9 A;  6AT1 B;  4HT8 A;  2ZPI B;  4MZT A;  9ATC B;  3OS2 A;  3HRU A;  3O5Z A;  4C8Q E;  3REB B;  3OS1 A;  1NPP A;  1WHG A;  4JRK A;  4Q5W A;  1YI2 Q;  2JUF A;  2E3H A;  2EAY A;  3A1P A;  2DVJ A;  2DTI A;  3EG1 A;  3CCV T;  3OS5 A;  3CCJ Q;  3EGD B;  4IUR A;  1KQ2 A;  4ESR A;  2RHX A;  1LOJ A;  1IO6 A;  2YUP A;  3CC4 Q;  1WXU A;  5KCH A;  1U06 A;  3HHT B;  2K9G A;  2BZX A;  3VS4 A;  4BDZ A;  3OYE A;  5KYX B;  3JB9 F;  4O6J A;  1JRI A;  2DBM A;  4HVU A;  4Y92 A;  3GLX A;  2F5T X;  3G6E A;  2DTO A;  1K73 R;  5HCK A;  2O4X A;  3JCM f;  2AZV A;  1KIK A;  2PNI A;  1K1Z A;  2FB7 A;  3I56 Q;  2JTE A;  1YHQ T;  5FRM A;  4AFS C;  4DOV A;  1M1F A;  5GMK l;  1M2V B;  3HRS A;  3CCS Q;  4M7D G;  1OEB A;  2FHD A;  2MWO A;  2E5K A;  5HK0 A;  1Q7Y R;  2LQW A;  1RAB B;  3JV3 A;  2D8H A;  1NM7 A;  2P84 A;  3OMG A;  3QWX X;  1QVF P;  3EAE A;  5CCA A;  3VJP A;  1BCO A;  1PKT A;  1JBM A;  3PE0 A;  1LNX A;  3G4S T;  2OTJ Q;  1N27 A;  1W2B P;  1W1F A;  4LD6 A;  4ANJ A;  1FMV A;  2DKG A;  4ORZ A;  5KE2 A;  1EZZ B;  2EGE A;  2A36 A;  1Y07 A;  2BTT A;  1S72 T;  1ABQ A;  2EYY A;  2FZK B;  2EGA A;  4PFO A;  4D8K A;  1U1S A;  2ROL A;  3EGD A;  3CC2 Q;  1YHQ Q;  3A98 A;  3GIB A;  4M4Z A;  3QZ5 B;  3I55 T;  5LJ5 g;  4M77 A;  3EFO A;  2GF7 A;  4PJO F;  4EMH A;  5LJ5 h;  3VS7 A;  2A7Y A;  4JRI A;  3PGG A;  4BI3 A;  4M7D F;  4J9H A;  5LJ3 d;  1SKU B;  5KYW A;  2QQR A;  2O4X B;  3Q1J A;  3V8J A;  4M7D E;  4XAX B;  1KD1 U;  1YJN A;  3TSW A;  2KR3 A;  2DIQ A;  3E9G A;  2A08 A;  4ZTJ A;  5DLQ E;  3VRY A;  3JCM b;  3UA6 A;  1S72 A;  5CKB A;  3GOX A;  2QA4 A;  1AWX A;  4BE1 A;  4ZGD B;  1U5S A;  3OBY A;  1YHQ A;  1KD1 C;  2CT4 A;  1X43 A;  3S3N A;  1AWW A;  3C4S A;  1QVG A;  1VQN A;  3RMS A;  2XIC A;  3L42 A;  1G8X A;  1KQS A;  3CCJ T;  2R57 A;  3R6O A;  2JJ9 A;  3SEM A;  5HKC A;  1NJI C;  1YJ9 T;  3VUB A;  1RI9 A;  5IN1 A;  3VS6 A;  2RK2 A;  3BE3 A;  1U1T A;  3L2U A;  2ESW A;  4LN2 A;  3JCM P;  2RHI A;  1WHJ A;  3VKI A;  2E6N A;  1TWB A;  3GNG A;  3EG9 B;  2YXY A;  5FU7 B;  2XU8 A;  3OYJ A;  1UGR B;  5GAN 8;  1VQL T;  2Y90 A;  3VS0 A;  3QPH A;  1D0X A;  1ZA2 B;  1Y7X A;  1TXQ A;  2OTL Q;  4PLL A;  3RKY A;  3QJ6 A;  3EH1 A;  3KXT A;  3M55 A;  2YUN A;  2JMC A;  4C0Z A;  5GJW B;  4DA4 A;  3M53 A;  4EPC A;  3CCQ A;  1OOT A;  4HCK A;  5LJ3 e;  2KRO A;  2RA2 A;  2RI2 A;  2L3R A;  1K9M U;  3FB9 A;  3G6E Q;  2HD0 A;  2K6D A;  4M75 E;  5CVI A;  1WA7 A;  4A4K A;  1WQ7 A;  1QVF S;  4RMO A;  2H8H A;  2FYK A;  2V1Q A;  5FU6 B;  3UA7 A;  1J3T A;  2ATC B;  1OPK A;  1M5Q 1;  2PVO B;  2YUO A;  1JO8 A;  3M56 A;  5KYY A;  3MO8 A;  3RNJ A;  4OB0 B;  2KK4 A;  4QT7 A;  3JRZ A;  3QO3 A;  1DJ7 B;  3EH2 A;  2YSQ A;  3M4G A;  4HKE A;  3HSB A;  4FSS A;  1YJW Q;  3ZFJ A;  3OYB A;  1SSH A;  4JDS A;  3VRZ A;  1X6B A;  3MHX A;  5GAO q;  2RK1 A;  4ZN1 A;  1ZUU A;  3JB9 G;  5HY6 A;  4LNP A;  5GAN 5;  4BAC A;  4JJD A;  2DRK A;  2SRC A;  3PIO A;  1AWJ A;  1I5O B;  2MMP A;  3CPW A;  2V1R A;  3VYG A;  3ZEH A;  1VQN T;  5I2M A;  4M7A C;  2FL7 A;  4QKU A;  4C0G A;  1H92 A;  1ZSZ A;  4C5I A;  5C0M A;  2L3P A;  2XG8 D;  1UEC A;  1WPY A;  2XK0 A;  5EG2 A;  5DY9 A;  2VC8 A;  3A8H B;  4CC3 A;  4ZNX A;  2LZ6 B;  4C92 G;  1VYU A;  2DBK A;  2CP7 A;  1YP5 A;  4M78 G;  2VYT A;  3L2Q A;  4BY6 B;  2MK5 A;  1VQ8 A;  3V8L A;  4HCC A;  2M0O A;  2PVD B;  2ROT A;  3DKM A;  4N0A A;  3X24 B;  1HD3 A;  2ABL A;  8AT1 B;  2VV5 A;  1Y57 A;  3AHU A;  2LRQ A;  2Y4X A;  1W4S A;  2WSF E;  1M1K U;  4Y28 E;  2RB6 A;  2YLB A;  3HL8 A;  1IHW A;  1X75 C;  2RPN A;  3FDR A;  2DYB A;  2RHU A;  4F04 B;  4OMQ A;  3O8V A;  3OW2 A;  1MUZ A;  5LJ5 f;  2LT4 A;  1Q7Y C;  5CR2 A;  2HQH A;  2KNB B;  1N8R U;  2BIV A;  2HBW A;  2XMF A;  1PWT A;  2DIG A;  1H3H A;  2DPP B;  2BE9 B;  2QQB A;  1U8R A;  3HPW A;  1VQ9 A;  4M7A G;  3NTI A;  1M8V A;  3V7S A;  4PJO G;  5L23 A;  2RI3 A;  2LX9 A;  1D1A A;  3C0C A;  5IHK A;  4ELY C;  3CCM A;  1VQO T;  5CIU A;  5AYF A;  1CKA A;  5LJ5 d;  3FJ5 A;  3WXM B;  1P92 A;  5LJ5 j;  1UHF A;  2CSI A;  3R6N A;  2KAF A;  1QP3 A;  1OYX A;  2L3Q A;  1K73 C;  1ZUY A;  4FSX A;  1N8R R;  1X6G A;  1WQW A;  3OQ5 A;  3PMI A;  3M59 A;  2X51 A;  3I56 T;  4JRP A;  1YIJ T;  4ATO A;  2JS0 A;  5C6S A;  3CCE T;  1GL5 A;  1K73 U;  1XQH A;  2EJF A;  1AZE A;  2X9H A;  1X69 A;  2AK5 A;  4CC2 A;  3MP1 A;  3JCM h;  3CCV A;  4PJM A;  2CKK A;  2MPX C;  1Q82 R;  4PJO C;  3HFO A;  4AT1 B;  3JAM E;  4MMK A;  4MDW A;  2PQW A;  4DQ2 A;  3M9Q A;  1VQ6 A;  1VQP T;  2RM4 A;  3QUI A;  4J6Y A;  3NFC A;  2EYQ A;  1KC8 U;  2LQ8 A;  1K8A C;  2CDT A;  2K3X A;  1ZBX A;  3LGF A;  4M77 E;  3CME Q;  1VQ9 Q;  3OB9 A;  3RER A;  3NMZ C;  4QQG A;  1VQ9 T;  1QVG S;  4J6X A;  2XKO C;  4C8Q D;  1I81 A;  4M7A F;  1WFW A;  2GGR A;  3EFO B;  3F70 A;  1K8A U;  2RD1 A;  2LX7 A;  3PIP A;  2R5M A;  4PJJ A;  3JCM W;  1FWZ A;  3S3M A;  3GP8 A;  5HK3 A;  4HVW A;  4EMK A;  2AKK A;  1K0S A;  1GRI A;  1RAA B;  1SPK A;  2SEM A;  2RQV A;  2QDY B;  2CRE A;  2XD0 A;  2G3R A;  3CME T;  2J05 A;  1F1B B;  4C0F A;  4JJN K;  4FT4 A;  3L1A A;  3JB9 J;  2L89 A;  2K5F A;  1HJD A;  3NHN A;  1QCF A;  2V26 A;  3SFM A;  1MMG A;  2DK3 A;  1Z9Z A;  4N0A C;  4ZGE B;  4Z88 A;  4RG8 A;  1QCO A;  5FW9 A;  1WHM A;  1AEY A;  4RKU E;  4FT2 A;  3E2U A;  5GAO l;  3OYG A;  1YIJ Q;  4B9W A;  2YDL A;  2PZ1 A;  2KYM A;  1SSF A;  2K2M A;  4Z8A A;  3CCQ T;  4FIB A;  4JLG A;  4RG2 A;  4UC4 A;  4XU2 A;  3JCM Q;  1YWP A;  3EG9 A;  3A8G B;  3QII A;  2DIL A;  2QTV A;  2KY9 A;  2DVE A;  1CSK A;  2KT8 A;  2F2W A;  1PHT A;  1NG2 A;  1UGS B;  4FU6 A;  2EKO A;  4QVD A;  1G3Y A;  1N8R C;  1R77 A;  3LGL A;  1PRM C;  1GCQ C;  1JB0 E;  2RHY A;  4C8Q G;  4R55 A;  3S6W A;  1H8K A;  1VQ5 T;  4EMK B;  2FZC B;  2I0N A;  5CK9 A;  4HXJ A;  1HK9 A;  5CKF A;  1OPL A;  3FJP A;  2FPD A;  3I5R A;  1K76 A;  3CMA A;  2FRY A;  3CCM T;  4Z89 A;  4HCZ A;  2CZ6 B;  1MV0 B;  4OMM A;  2QEX A;  3TCJ A;  4GBQ A;  1A0N B;  3LX7 A;  3CCL A;  2AKL A;  4IUV A;  4RTY A;  1IHV A;  4NOY A;  3E9F A;  1PNJ A;  1RAD B;  4BUG A;  3H6Z A;  2DLP A;  4M78 F;  3CCS A;  2O9S A;  1TTH B;  2RJD A;  1YIT A;  5GAO n;  2HNI A;  2EWN A;  2BKD N;  4J9G A;  1KFZ A;  4N4H A;  1RAC B;  2EGC A;  1KQ1 A;  1WXB A;  1FMW A;  2EQU A;  5IAY A;  3M0Q A;  3JCM J;  3D7S B;  1VQ5 Q;  3EHQ A;  1XNI A;  4FYV B;  4XTU A;  2VAS A;  2WSE E;  1RAE B;  3OYD A;  5GAN 6;  1EFN A;  1QVP A;  2KRM A;  1YJ9 A;  1UEB A;  3BY7 A;  1X01 A;  3BFM A;  2OTJ T;  4IUQ A;  3X26 B;  1M1K R;  1JJ2 A;  2HSP A;  2WSC E;  3SWN C;  1WIE A;  2NWM A;  4M77 F;  3INZ A;  2E70 A;  5KE3 A;  1VQK Q;  1D1B A;  2XI9 A;  4BB7 A;  4C5G A;  3CCS T;  4R0K A;  1QVG P;  2QQ9 A;  3MCA B;  4CC7 A;  2HL5 C;  2HAX A;  3WVD B;  1YJW T;  1AT1 B;  2QDL A;  2JXB A;  2Y4Y A;  2HKN A;  2DFU A;  4O5V A;  1RLP C;  3I35 A;  2DO3 A;  1N5Z A;  3PVQ A;  3QWY A;  5GAN 3;  2L5Q A;  5CQX A;  1WGS A;  2NUP A;  3TU4 K;  4OML A;  1KSW A;  3HFN A;  3TEE A;  4OP0 A;  1HSQ A;  2VWF A;  3CD6 Q;  1NBE B;  4AFU C;  2IVW A;  1ZA1 B;  4FM4 B;  2DL7 A;  3CCL Q;  1M1K C;  4DBQ A;  7AT1 B;  4IUU A;  3G4S A;  2LCL A;  4J9F A;  3DLL A;  1QWE A;  3OYA A;  2YUQ A;  3RES A;  5GAN f;  1ZSZ C;  1V76 A;  2FRW A;  3ME9 A;  4HVV A;  3I56 A;  1NE8 A;  3G6E T;  4BDY A;  4QVC A;  2CZ7 B;  4OMP A;  1IB8 A;  1T3L A;  4M7D A;  1X6O A;  2Z0W A;  1WZO A;  1VQ4 Q;  1RLQ C;  1PG5 B;  1OI1 A;  4DBH A;  1Q86 U;  3OYH A;  2EW3 A;  1GFD A;  1AWO A;  4M75 F;  1UFF A;  4J7I A;  2OTJ A;  2LJ0 A;  2DL8 A;  2DYI A;  2F5K A;  1QCN A;  1UGP B;  1K9M R;  2VB6 A;  2E3I A;  2HQE A;  4A4H A;  2K57 A;  1B7T A;  3KFV A;  2PTK A;  1VQ6 T;  2YRC A;  1RL2 A;  2DX1 A;  1Q82 U;  4QQD A;  1D09 B;  3X28 B;  2HBP A;  3M0R A;  3CC7 A;  2DEQ A;  3X20 B;  3OYM A;  2EIF A;  2EPD A;  2GBQ A;  3TRE A;  2FEI A;  1YFN A;  4M78 B;  3SHW A;  1C6V X;  2RQU A;  4QQ6 A;  2LQN A;  1FYN A;  3EG3 A;  1FMK A;  4B9X A;  2F2X A;  2JT4 A;  2DM1 A;  5DLO A;  2YRV A;  5GMK i;  3MEW A;  1W2B S;  2VXF A;  2CZ1 B;  4M7A B;  3M0P A;  1S72 Q;  3M0S A;  2QAZ A;  2D9T A;  1I0C A;  2CP3 A;  3FLG A;  2PUK B;  1VQK A;  1M2V A;  1PC0 A;  2HCK A;  3OW2 S;  2QQA A;  3A8O B;  3UF4 A;  4IKF A;  3QKJ A;  4VUB A;  4FCY A;  3C94 A;  2AHJ B;  1KQS S;  4F7U E;  3QYH B;  3OW2 P;  4MML A;  1SEM A;  4J9B A;  4JZ3 A;  1X27 A;  4M75 G;  1QP2 A;  2KYB A;  2RNA A;  1Q81 R;  4RCB A;  2JOY A;  4KUI A;  5GMK e;  4DEX A;  2EYW A;  4J9C A;  2CS7 A;  3JB9 H;  4M77 D;  2JZ2 A;  1IRE B;  4N4G A;  2EQJ A;  1G83 A;  3FEO A;  1KJW A;  3IQL A;  2KMT A;  1M3B A;  4DBR A;  4BE2 A;  2GFA A;  1M90 R;  3CC7 Q;  3HKS A;  4NS5 A;  1VQK T;  5FLX E;  2MCN A;  3FC3 A;  4K11 A;  2RQR A;  2HEQ A;  3CC2 T;  1EX4 A;  3H8Z A;  4RTZ A;  2E41 A;  3CCQ Q;  1ZUK A;  2K3B A;  1M2O A;  2DD4 A;  2M16 A;  4M77 B;  4C0D B;  1IGU A;  2NYS A;  3V8K A;  3CCE A;  4LXC A;  4JRQ A;  4CRI A;  2D8J A;  3CPW P;  4JUV A;  2CSQ A;  2H3E B;  2QK0 A;  1VQ6 Q;  1WX6 A;  1S1N A;  1Y71 A;  3OS0 A;  2DRM A;  2LDM A;  4OGC A;  1O9S A;  1TS9 A;  2GQI A;  3P8B B;  4LDW A;  3CCU A;  2JMA A;  1Q82 C;  3VYH B;  5CKE A;  5GAM f;  1UUE A;  2NUT A;  1BI0 A;  1KHC A;  2D0Q B;  1JXM A;  1TUD A;  4AFZ C;  2M51 A;  4JPB W;  1YJN T;  2KEA A;  2ZPH B;  4KUD K;  3SWN B;  1Q86 C;  2YT6 A;  3JCM g;  5I21 A;  1SRL A;  5D6Y A;  3ASK A;  5IXB A;  1I1J A;  1UHC A;  2GTO A;  4KT0 E;  4C5H A;  1OX9 A;  2VGM A;  2DF6 A;  4B6M A;  1RAI B;  2VVK A;  2CH4 A;  2JVV A;  3UT1 A;  3RR6 A;  2DAQ A;  3M0U A;  3OYY A;  3ZL7 C;  1R0C B;  1M90 U;  5GAN d;  1T0H A;  4C8Q C;  2F1L A;  2X4X A;  2E10 A;  3OYF A;  4KH1 B;  1RAG B;  3J80 E;  3DB4 A;  1ZBJ A;  2DXT A;  2R5A A;  3RBB B;  2ZZD A;  1NLO C;  2O9V A;  4C8Q A;  4C92 A;  3GPL A;  3OYK A;  2DZC A;  1BYM A;  5GAN e;  1PSE A;  2AT1 B;  2D6F A;  1NJI R;  4V2S A;  2MOX A;  2V8K A;  3CCL T;  4E7S A;  1PM3 A;  2LVM A;  4JS5 A;  3CBO A;  1R0B G;  1TOV A;  1GFC A;  3MEV A;  4L59 A;  4BE0 A;  1YJ9 Q;  3M4Y A;  4MZP A;  2GNC A;  3HTR A;  3WVE B;  4E6R A;  3UPU A;  4OVA A;  2DA9 A;  1BI1 A;  4XTW A;  1T0J A;  4EDU A;  1VQ4 T;  1D0Z A;  2IIM A;  2ED1 A;  1Y96 A;  2L8D A;  3JSC A;  5GAN 4;  2E1H A;  3M0T A;  1QWF A;  2A37 A;  5DM7 R;  3VS3 A;  1G3W A;  2JTF A;  2J7I A;  2LMJ A;  5IXF A;  4A4G A;  5CAI A;  1YIJ A;  1ZSG A;  3NPF A;  4M75 A;  4WF2 A;  1LJO A;  3P8D A;  4BI8 B;  1VQ4 A;  3JCM e;  3OY9 A;  2CH4 W;  5A0G A;  1VQ8 T;  4JZ4 A;  1WJQ A;  3EGX B;  1YIT T;  3A8L B;  1V1C A;  2NUZ A;  4C92 B;  1BU1 A;  1UB4 A;  3PT9 A;  1M3C A;  3QG1 A;  3RDV A;  2DXC A;  3EHR A;  4M78 C;  5GAM d;  3NGP A;  4M75 D;  2ECZ A;  3CPF A;  2W0Z A;  4ZTF A;  3PFS A;  3JB9 D;  3RIR A;  3H0H A;  5FU6 C;  4F16 A;  3MPU B;  1TSF A;  3RKW A;  1VQM A;  1Y96 B;  1I07 A;  2VKN A;  3G4S Q;  1Q86 R;  4PFP A;  1U3O A;  1WI7 A;  4PJO E;  1AOJ A;  4RTT A;  4NL3 A;  2ENM A;  5IHN A;  4A53 A;  1B34 B;  2A3L A;  4F7U G;  4XTX A;  4HCB A;  3QXE B;  4Z02 A;  2DJZ A;  4A4F A;  4XU3 A;  2XID A;  3H0I A;  2A0F B;  4JJC A;  2KBT A;  5CKD A;  1M8M A;  3FIF A;  1NYG A;  2DE0 X;  3LWH A;  1O75 A;  4M75 B;  2YWW A;  1ZQ1 A;  2K7A A;  2KE9 A;  4CC4 B;  5LJ3 h;  5IT9 E;  1M1G A;  2XDP A;  3M54 A;  1JQQ A;  4E7L A;  2AIR B;  3UDC A;  1WDX A;  1XOV A;  1UJ0 A;  2LNH B;  5FWB A;  3H41 A;  1TUG B;  4PL6 A;  1CKB A;  4M77 C;  4J9D A;  4C5E A;  4JLI A;  2K5L A;  4OB3 B;  3QZ9 B;  2EVR A;  4J9I A;  4MZM A;  2CP6 A;  2KXC A;  4PJN A;  4E47 A;  4KH0 B; 
#chains in the Genus database with same CATH homology
 4E7H A;  5KH6 A;  4ELZ C;  2ZPG B;  3JRZ A;  3OSS C;  3QO3 A;  1DJ7 B;  4IUU A;  3QDR B;  4J8O A;  3G4S A;  3LWI A;  5A2Q E;  2LCL A;  3M4G A;  4M7A A;  2MAM A;  1MHN A;  4IUT A;  2K2V A;  2NLU A;  4HKE A;  1WJR A;  2PVG B;  3DLM A;  4QVZ A;  3OYA A;  3DLL A;  1NJI U;  5A0D A;  1VQ7 T;  1G3T A;  1I4K 1;  3HSB A;  2RJC A;  3EFR A;  1M90 C;  2XHC A;  4DOW A;  3RES A;  1NPR A;  5A0L A;  5GAN f;  3M57 A;  3ZFJ A;  3OYB A;  5CO7 A;  1W2B A;  4BY6 C;  3OA6 A;  3G71 T;  3ME9 A;  4JDS A;  2ZPE B;  4EMK C;  4E7J A;  4M7D D;  3I56 A;  3MHX A;  1NE8 A;  3RUX A;  5GAO q;  2RK1 A;  3T9N A;  4ZN1 A;  3G6E T;  3JB9 G;  4BDY A;  4QVC A;  1I8F A;  2CZ7 B;  5HY6 A;  1YI2 T;  4L5G A;  1VQL A;  3QSU A;  5GAN 5;  4BAC A;  4M7D A;  1X6O A;  3PIO A;  4EMG A;  4LDX A;  3J7A F;  1H64 1;  3OYC A;  1OI1 A;  2MMP A;  2RH2 A;  4PKC C;  3CPW A;  1Q86 U;  3VYG A;  4J7F A;  2MF2 A;  3OYH A;  3CXC S;  1BIA A;  2K4Y A;  4R56 A;  3CMA T;  1NZ9 A;  3ZEH A;  2E12 A;  2KQW A;  4M75 F;  1VQN T;  1VIF A;  4OMF B;  5I2M A;  4J7I A;  4M7A C;  2OTJ A;  5GAM j;  2F5K A;  4J6W A;  3OYI A;  2FL7 A;  2MI6 A;  4ZN3 A;  1UGP B;  5J39 A;  3N5B B;  2HQE A;  3KBG A;  4A4H A;  4C0G A;  2CGH A;  2K57 A;  1EIF A;  3PMT A;  4HT9 A;  1VQ6 T;  4C5I A;  2GFU A;  2RO0 A;  4LDV A;  1RL2 A;  4XQ3 A;  1VQP A;  5C0M A;  1Q82 U;  4QQD A;  3FRN A;  4TVR A;  1VIE A;  2XG8 D;  3X28 B;  2HBP A;  1N9S A;  2YLC A;  1WPY A;  3CC7 A;  1FXX A;  1H3Z A;  2XK0 A;  3QHS A;  5EG2 A;  5DY9 A;  4P5N A;  2VC8 A;  2DEQ A;  3A8H B;  3X20 B;  3OYM A;  2EIF A;  4C92 G;  3TRE A;  1D3B A;  3OSV A;  1KQS S;  2RJE A;  2PUO B;  3V7C A;  4M78 G;  2VYT A;  1MGQ A;  4M78 B;  4BY6 B;  3L2Q A;  3OYN A;  3CME A;  3CPW S;  3CC2 A;  4NL2 A;  1VQ8 A;  4C8Q F;  4C92 E;  4A54 A;  4M7A D;  3V8L A;  3CCR A;  5LL6 S;  3CXC A;  2M0O A;  4HCC A;  1QW1 A;  2PVD B;  4N0A A;  3DKM A;  2O01 E;  4KBM B;  3X24 B;  4QQ6 A;  1BIB A;  2VV5 A;  3AHU A;  2LC4 A;  2LRQ A;  2Y4X A;  1YJW A;  1VQ5 A;  2OAU A;  4ZGJ B;  1W4S A;  2WSF E;  1M1K U;  2E5Q A;  4Y28 E;  2P4T A;  3RMQ A;  4B9X A;  2QI2 A;  4BI4 A;  2RB6 A;  2YLB A;  3CC4 A;  5GAM h;  1VQO A;  2MWP A;  3HL8 A;  2ZPF B;  5DLO A;  2YRV A;  1X75 C;  5GMK j;  2LQK A;  3P8H A;  1TH7 A;  4C92 C;  5GMK i;  2X4J A;  3MEW A;  1W2B S;  2VXF A;  2CZ1 B;  3A8M B;  3FDR A;  4XK8 E;  2CYZ B;  2RHU A;  3OMC A;  3OW2 A;  3O8V A;  3L2V A;  3BDU A;  4M7A B;  5LJ5 f;  1VUB A;  5D6X A;  2LT4 A;  3G7Z A;  1Q7Y C;  5CR2 A;  4M7A E;  4C92 D;  2RJF A;  3C95 A;  2XDD A;  2D9T A;  3BDL A;  4E7I A;  1N8R U;  2BIV A;  3SB2 A;  2LTO A;  3FLG A;  2PUK B;  5M9O A;  1VQK A;  2DIG A;  2R58 A;  4XU0 A;  4E7K A;  2DPP B;  3MEA A;  3OW2 S;  2QQB A;  2QQA A;  3A8O B;  1U8R A;  2E64 A;  2V8I A;  3HPW A;  3M5A A;  1JJ2 S;  3CD6 T;  2K3Y A;  1VQ9 A;  4IKF A;  3QKJ A;  4M7A G;  1BI3 A;  3NTI A;  3E1S A;  4VUB A;  1M8V A;  1BKB A;  3KUF A;  3SD4 A;  3VV0 A;  3J81 E;  1K9M C;  3V7S A;  3C94 A;  4PJO G;  1QVF A;  5GAO m;  3MP8 A;  1AHJ B;  2RI3 A;  5LJ3 j;  4M75 C;  4PNO A;  2AHJ B;  2GCX A;  2LX9 A;  5FRO A;  4F7U E;  3QYH B;  4ELY C;  5I2S A;  5CIU A;  5AYF A;  3CCM A;  1VQM T;  2ZCF B;  1VQO T;  5LJ5 d;  2P0P A;  4MML A;  3SWN A;  2M9U A;  3CBM A;  4Y91 A;  3G71 A;  4M75 G;  1QP2 A;  3V7R A;  3WXM B;  4M78 E;  3MP6 A;  1P92 A;  4RCB A;  5LJ5 j;  2JOY A;  4KUI A;  4C0D C;  5GMK e;  1GXI E;  2CS7 A;  2KAF A;  3JB9 H;  1D3B B;  3CEY A;  2JTM A;  1QP3 A;  4M77 D;  1OYX A;  1VQ7 A;  2JZ2 A;  2EQM A;  2GQV A;  1K73 C;  3QJY A;  1IRE B;  1PSF A;  4N4G A;  4FSX A;  3GNF B;  3MEU A;  1WQW A;  2EQJ A;  2QXF A;  3OQ5 A;  3FEO A;  1RI0 A;  2E6Z A;  2V8J A;  2DXU A;  3M59 A;  3PMI A;  1G3S A;  2KMT A;  3S3O A;  4IUP A;  4BE2 A;  2GFA A;  4LDU A;  4OB1 B;  2DTH A;  3OBW A;  3I56 T;  4JRP A;  1YIJ T;  3HKS A;  4ATO A;  4NS5 A;  1VQK T;  5C6S A;  2VUB A;  3L2Z A;  5FLX E;  3FC3 A;  3CCE T;  2RHZ A;  5KCO A;  4MDX A;  1K73 U;  1XQH A;  1XTD A;  2EJF A;  3CCU T;  4XTV A;  3CD6 A;  4OF1 A;  3MP1 A;  3JCM h;  3CCV A;  2CKK A;  3CC2 T;  4PJO C;  3HFO A;  1N6A A;  4M7D F;  2KVQ G;  1OZ2 A;  3LH0 A;  4M7D C;  3H8Z A;  4YTL A;  5CCA A;  4J5Y A;  5GAN 7;  2E41 A;  4KUL A;  4MDW A;  2PQW A;  4MMK A;  4C92 F;  3JAM E;  4C8Q B;  2QQS A;  2DD4 A;  2M16 A;  2P0Q A;  4F7U A;  4M77 B;  5GAO p;  4DQ2 A;  3M9Q A;  4C0D B;  3CBP A;  1VQP T;  1VQ6 A;  2X4W A;  4ME7 A;  3C12 A;  2QEX T;  4BD3 A;  3V8K A;  2RM4 A;  3QUI A;  2EJ9 A;  4J6Y A;  3NFC A;  3CCE A;  3CCR T;  4JRQ A;  2EYQ A;  3HP9 A;  3JCM V;  4CRI A;  5LJ5 e;  1KC8 U;  2LQ8 A;  3X25 B;  4HT8 A;  2ZPI B;  4JUV A;  4II1 A;  1K8A C;  2K3X A;  1ZBX A;  3LGF A;  4M77 E;  4MZT A;  2OTL A;  3OS2 A;  3HRU A;  3I55 A;  1Y71 A;  3OB9 A;  4X9C A;  4C8Q E;  3OS0 A;  4QQG A;  3VU3 C;  3RER A;  2LDM A;  3JCM d;  3OS1 A;  1VQ9 T;  4XTZ A;  1NPP A;  4OGC A;  1QVG S;  4J6X A;  2BUD A;  4JRK A;  1O9S A;  2XKO C;  5FRN A;  4C8Q D;  4Q5W A;  1I81 A;  4M7A F;  3P8B B;  4LDW A;  4M78 D;  2JUF A;  1M9S A;  2X4Y A;  5GAN h;  3QBY A;  3CCU A;  1YI2 A;  2EAY A;  3F70 A;  4J83 A;  3ZBD A;  1Q82 C;  3VYH B;  5CKE A;  1K8A U;  2RI5 A;  5GAM f;  1BI0 A;  1KHC A;  2RD1 A;  2D0Q B;  1WJS A;  2DTI A;  3PNW C;  3CCV T;  3PIP A;  3OS5 A;  3VUZ A;  2PU9 B;  5FU7 C;  4PJO B;  2R5M A;  3JCM W;  1FWZ A;  1YJN T;  3RKX A;  3S3M A;  4IUR A;  3GP8 A;  1KQ2 A;  2RHX A;  1LOJ A;  2ZPH B;  5HK3 A;  4KUD K;  3SWN B;  1Q86 C;  4EMK A;  3L2R A;  3JCM g;  1Q81 C;  5GAM e;  5I21 A;  5KCH A;  3L2W A;  5D6Y A;  4F7U F;  3HHT B;  4LDY A;  3ASK A;  3LLR A;  2QDY B;  4HA8 A;  4BDZ A;  2XD0 A;  3OYE A;  2G3R A;  3JB9 F;  3CME T;  4O6J A;  1YCY A;  4KT0 E;  4C5H A;  1JRI A;  4C0F A;  3GLX A;  2F5T X;  3G6E A;  4JJN K;  2DTO A;  2VGM A;  4FT4 A;  3L1A A;  3JB9 J;  2O4X A;  4GLK A;  3JCM f;  2L89 A;  2K5F A;  2KK4 A;  4OB0 B;  4L6V 5;  2FB7 A;  3CC7 T;  2JVV A;  3SFM A;  3UT1 A;  2DK3 A;  5LJ3 g;  1YHQ T;  4N0A C;  1Q7Y U;  4DOV A;  1HXD A;  2DAQ A;  4ZGE B;  5FRM A;  4RG8 A;  1M1F A;  3E19 A;  5GMK l;  2KDS A;  3HRS A;  3OYY A;  4M7D G;  4F7U B;  3DB3 A;  4RKU E;  4FT2 A;  5GAO l;  3OYG A;  1M90 U;  2FHD A;  5GAN d;  2MWO A;  2C06 A;  1UGQ B;  4B9W A;  4C8Q C;  5HK0 A;  2LNV A;  2X4X A;  2E10 A;  3UWN A;  3OYF A;  1SSF A;  2B8A A;  4M77 G;  2JN0 A;  3J80 E;  3PTA A;  3OMG A;  3DB4 A;  2DXT A;  2R5A A;  2DD5 A;  3EAE A;  3URG A;  2ZZD A;  4FIB A;  3VJP A;  1JBM A;  4XU1 A;  1LNX A;  3LYI A;  4JLG A;  3SDZ A;  4C8Q A;  3G4S T;  4RG2 A;  1N27 A;  4LD6 A;  4UC4 A;  4XU2 A;  4C92 A;  2DKG A;  3JCM Q;  2DZC A;  3OYK A;  3GPL A;  3CC4 T;  3JB9 I;  1BYM A;  5GAN e;  4XTY A;  1PSE A;  3A8G B;  3QII A;  5KE2 A;  3NTH A;  2KY9 A;  5GAN j;  2D6F A;  2DVE A;  1Y07 A;  1S72 T;  4V2S A;  2V8K A;  3BW1 A;  3CCL T;  2LVM A;  1U1S A;  4JS5 A;  3CBO A;  1UGS B;  4FU6 A;  1B34 A;  2EKO A;  3MEV A;  4QVD A;  1G3Y A;  1N8R C;  2M1H A;  4JS4 A;  3LGL A;  3HRT A;  4PJO D;  4L59 A;  1JB0 E;  4BE0 A;  2RHY A;  3M4Y A;  4MZP A;  4C8Q G;  4R55 A;  3S6W A;  3WVE B;  3UPU A;  4OVA A;  1VQ5 T;  4EMK B;  1BI1 A;  4XTW A;  1VQ4 T;  4EDU A;  3GIB A;  3QZ5 B;  5CK9 A;  3I55 T;  5LJ5 g;  1Y96 A;  1HK9 A;  2L8D A;  5CKF A;  3FJP A;  4M77 A;  3JSC A;  3CMA A;  1FX7 A;  5GAN 4;  2GF7 A;  4OB2 B;  4PJO F;  2E1H A;  4EMH A;  5LJ5 h;  4PJO A;  3CCM T;  5DM7 R;  2A7Y A;  4HCZ A;  4JRI A;  2CZ6 B;  2IG0 A;  3PGG A;  4BI3 A;  1G3W A;  1V29 B;  2DXB A;  2JTF A;  2XDB A;  5LJ3 d;  2QEX A;  2QQR A;  2O4X B;  3ER0 A;  3Q1J A;  3V8J A;  4M7D E;  4XAX B;  3TCJ A;  3LX7 A;  1KD1 U;  3CCL A;  4IUV A;  4A4G A;  5CAI A;  4M7D B;  1YIJ A;  1IZ6 A;  4NOY A;  1YJN A;  3QYG B;  4ZTJ A;  3E9G A;  2DIQ A;  3E9F A;  5DLQ E;  3JCM X;  2DZ9 A;  4M75 A;  4BUG A;  3JCM b;  3H6Z A;  1S72 A;  4WF2 A;  5CKB A;  3GOX A;  1LJO A;  3P8D A;  4GY5 A;  4M78 F;  4BI8 B;  3CCS A;  2QA4 A;  1VQ4 A;  2RJD A;  3JCM e;  5GAM g;  3OY9 A;  3NTK A;  5L8R E;  1YIT A;  5A0G A;  5GAO n;  2K5I A;  4ZGD B;  4BE1 A;  2EFI A;  3OBY A;  1YHQ A;  1KD1 C;  2HNI A;  2EWN A;  2BKD N;  5J3B A;  1VQ8 T;  1WJQ A;  4N4H A;  1KHI A;  1YIT T;  1KC8 C;  3S3N A;  3A8L B;  3C4S A;  1QVG A;  1VQN A;  3RMS A;  1KQ1 A;  2XIC A;  3LW5 E;  4X34 A;  3L42 A;  1KQS A;  3CCJ T;  2EQU A;  5IAY A;  4RCC A;  4N4I A;  2R57 A;  4C92 B;  1UB4 A;  1KG1 A;  3R6O A;  3JCM J;  3PT9 A;  5HKC A;  3QG1 A;  1NJI C;  1XNI A;  1YJ9 T;  4XTU A;  3CCQ T;  2HQX A;  2WSE E;  3VUB A;  5GAN 6;  2ZPB B;  3OYD A;  1QVP A;  1OZ3 A;  2DXC A;  4M78 C;  1YJ9 A;  5GAM d;  1UEB A;  3BY7 A;  5GAO r;  2JNG A;  4M75 D;  5IN1 A;  1X01 A;  2RK2 A;  1R8O B;  3BFM A;  1U1T A;  3L2U A;  2OTJ T;  4IUQ A;  3CPF A;  3X26 B;  4ZTF A;  5CKH A;  3JCM P;  2WSC E;  1JJ2 A;  2RHI A;  2EQK A;  5J26 A;  3PFS A;  4PLI A;  3VKI A;  2E6N A;  2CZ0 B;  3SWN C;  3JB9 D;  4M77 F;  3RIR A;  3GNG A;  5FU6 C;  2F69 A;  3INZ A;  1ZHI A;  2VGN A;  5FU7 B;  1M4Z A;  2E70 A;  3RKW A;  5KE3 A;  2YHT A;  2XU8 A;  1VQM A;  1Y96 B;  3OYJ A;  1UGR B;  4FL6 A;  2XI9 A;  1N9R A;  2FVU A;  2Y90 A;  4BB7 A;  5GAN 8;  1VQL T;  4PJO E;  4C5G A;  2WAC A;  3QPH A;  4M78 A;  3CCS T;  2QA4 T;  2I2L A;  4NL3 A;  1Y7X A;  5GMK h;  4PLL A;  1BI2 A;  2QQ9 A;  3EFS A;  1Q81 U;  3M58 A;  2OTL T;  3MCA B;  4A53 A;  1B34 B;  3RKY A;  3GF5 A;  2A3L A;  3JCM c;  5GMK m;  4F7U G;  2HAX A;  4XTX A;  3WVD B;  1YJW T;  4HCB A;  3QJ6 A;  3QXE B;  2DJZ A;  2KSS A;  4Z02 A;  4A4F A;  3MET A;  4XU3 A;  2LT1 A;  2EJG A;  2XID A;  4X9D A;  2Y4Y A;  3KXT A;  2E65 A;  5CKD A;  3M55 A;  3FIF A;  4C0Z A;  4O5V A;  4DA4 A;  3M53 A;  4EPC A;  4A4E A;  3LWH A;  2DO3 A;  5GAN 2;  1I5L A;  1O75 A;  4D6W A;  4M75 B;  3CCQ A;  1ZQ1 A;  1YBY A;  5LJ3 e;  5LJ3 h;  5IT9 E;  1M1G A;  2RA2 A;  5GAN 3;  2X35 A;  2RI2 A;  2L3R A;  1K9M U;  2L5Q A;  2XDP A;  4OGE A;  3M54 A;  5CQX A;  4LD9 K;  3FB9 A;  2HD0 A;  2P0K A;  4E7L A;  1WGS A;  3UDC A;  3TU4 K;  4M75 E;  5CVI A;  1XOV A;  1G5V A;  3HFN A;  4A4K A;  1WQ7 A;  2VXE A;  3TEE A;  4OP0 A;  5D6W A;  1QVF S;  4RMO A;  4QW2 A;  2FYK A;  5FU6 B;  5CQY A;  4CI0 C;  4PL6 A;  2IVW A;  4FM4 B;  3A5Z B;  4M77 C;  1WNL A;  2H3J A;  4C5E A;  4JLI A;  1M5Q 1;  2LCC A;  2K5L A;  2PVO B;  4OB3 B;  2QTX A;  3QZ9 B;  5LJ3 f;  1M1K C;  4MZM A;  3CCJ A;  3M56 A;  5GAN g;  3MO8 A;  4E47 A;  3OYL A;  2ZGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...