2LCCA

Solution structure of rbbp1 chromobarrel domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
b'EDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1.
pubmed doi rcsb
molecule keywords AT-rich interactive domain-containing protein 4A
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lccA00
3H6ZA 2RJCA 3FLGA 3DLMA 2EQUA 3KUFA 3MP8A 3MO8A 4LD6A 2EFIA 4QW2A 2R5MA 3DB4A 3LGFA 4B9WA 2MWOA 4BDYA 3OA6A 4C5IA 2GFUA 2YRVA 2XK0A 4FL6A 3NTIA 3NTKA 2RJFA 5C6SA 3OB9A 3OYBA 3FC3A 2M0OA 4NS5A 2LTOA 2P0KA 2HQEA 2QQRA 1OI1A 4E7LA 5FROA 4X34A 2RHYA 2GFAA 3OS2A 3L2QA 3PMTA 4RG2A 2PQWA 5KCHA 2RHIA 2XDPA 3Q1JA 4PL6A 4QQGA 4E7JA 2VYTA 2QQSA 3OS1A 3MP6A 2E6NA 3MEUA 3QIIA 2F5KA 2WACA 3LGLA 3L2VA 5J39A 5IN1A 4PLLA 4QVZA 4IUPA 3OQ5A 3OYEA 4C5HA 3EAEA 4C5EA 5KCOA 2FHDA 4E7HA 3MEWA 1KHCA 2L3RA 3E9FA 2DIGA 3PNWC 4CRIA 3S3MA 1G5VA 3OYKA 3OYLA 4IUTA 3OMCA 3MEAA 3M9QA 4N4IA 2MWPA 4IUQA 1WJQA 2LDMA 2E5QA 2RI2A 3LH0A 5IAYA 2BKDN 2RI3A 2M16A 5KE3A 2L8DA 3S6WA 2L89A 3F70A 3OYGA 3FEOA 3L2WA 5FRMA 5D6WA 4N4GA 4II1A 3LYIA 3LX7A 2LRQA 2JTFA 1H3ZA 3H8ZA 4PLIA 3NTHA 5D6YA 3L2RA 2BIVA 4BE1A 3BDLA 4IURA 4EDUA 3OYNA 3P8HA 3C4SA 2X4YA 4IKFA 5D6XA 2X35A 2GF7A 3META 3OS0A 2DAQA 2BUDA 3S3OA 4A4FA 5KE2A 2O4XB 2RHXA 4A4GA 1XNIA 5J26A 5FRNA 4QQDA 4E7KA 2X4WA 4IUUA 2LVMA 3L2UA 3OYMA 2DIQA 3LLRA 3PFSA 3OYDA 3L42A 2LCCA 4Z02A 3OYAA 5C0MA 4E7IA 2X4XA 4BACA 4ZTFA 1SSFA 3OYJA 4L59A 2R57A 2JZ2A 2EQKA 2K3XA 3ZEHA 2O4XA 4N4HA 2G3RA 3DB3A 5M9OA 2NLUA 1OYXA 4ZTJA 5KH6A 1OZ3A 2RO0A 2R5AA 3ASKA 2RI5A 4A4EA 3QBYA 3GOXA 3E9GA 3OYIA 2RHUA 3SD4A 4BD3A 4BE0A 1MHNA 5CIUA 3OYCA 2EQJA 2IG0A 3UT1A 1WJSA 1OZ2A 2M1HA 3CEYA 4UC4A 4OVAA 4Q5WA 3OMGA 1WJRA 2RHZA 2EQMA 1WGSA 3QKJA 3OYFA 3S3NA 4BE2A 2HQXA 3O8VA 4A4HA 2CKKA 3FDRA 3P8DA 4C5GA 1RI0A 3OYHA 3PMIA 3ME9A 4GY5A 4B9XA 4BDZA 2R58A 2RJEA 3OY9A 1N27A 2K3YA 2EKOA 3MP1A 2D9TA 3QJ6A 3MEVA 2B8AA 4QQ6A 4IUVA 3UWNA 4HCZA 4FU6A 2RJDA
chains in the Genus database with same CATH superfamily
3H6ZA 3A98A 1YCYA 4LDWA 2DFUA 1VQPQ 2MWOA 3V8JA 3CCUA 4CC3A 2DMOA 2KRNA 2CP0A 2YUNA 3NTKA 2ABLA 1VQKA 4M78G 2DJQA 2LTOA 2LT1A 3NGPA 2XU8A 2A0FB 1RABB 3VS3A 4M4ZA 4BB7A 1MMGA 5CKHA 4DA4A 1AWJA 3JSCA 3C95A 2E3IA 3SB2A 3L2VA 3CC4T 3CCJT 2QQAA 1VQNT 1QWFA 3H0HA 1HYOA 2RB6A 4PJOD 1B7TA 1WX6A 1VA7A 3JCMh 4IUQA 1YHQA 2XKOC 3EGXB 1NPRA 3VUBA 4KH1B 2FB7A 2FRWA 2JJ9A 4M75A 5AYFA 4J9IA 4N4GA 3REAB 1AZGB 1H3ZA 2VGNA 3QUIA 2MCNA 3VRZA 2V1RA 2EBPA 1GFCA 4LDUA 4PLIA 3GNFB 4EDUA 1JRIA 5CR2A 3C4SA 4JLGA 2XI9A 3TSWA 4IKFA 3ZL7C 1TOVA 2OJ2A 1VYUA 5CAIA 1SSHA 4M77E 1VQ8Q 3S3OA 1EZZB 2EVRA 4RTXA 4E7KA 2EYZA 2DYBA 2X4WA 5GMKe 3CCEQ 1TUGB 1KJWA 3EGUA 2PVOB 4DBFA 1NYGA 2MYSA 4LNPA 1K8AC 4Z02A 1XQHA 3UA7A 4E7IA 4M78C 1MNEA 1BBZA 4PJJA 2DJZA 2BZYA 2AHJB 2K9GA 3A1PA 3QDFA 2EQKA 1YJ9Q 5D7UA 3INZA 2MMPA 2RO0A 2RI5A 4LUDA 3JCMX 1MHNA 3MHXA 1HD3A 1VUBA 2CZ7B 3BW1A 5FLXE 2JOYA 5KYYA 4JDSA 3X28B 4F7UF 1WLPB 4AG1C 2EYXA 3SWNC 1RI0A 3CC4A 1RL2A 4X9DA 1UHCA 3I55A 3CCJA 2QA4T 2QGFB 3MP1A 3CCSQ 1SHFA 4HCZA 2JVVA 4AMCA 1VQOQ 3KUFA 2EQUA 2RM4A 2HKQB 2MPXC 4CI0C 3I56Q 2YRVA 4M7DB 3NTIA 2VC8A 2P0KA 5LJ3h 1OOTA 1QCNA 3N5BB 2DK3A 2DVEA 2PUOB 4PJOE 2QQBA 1K8AU 1MV3A 2KYBA 1BB9A 1ZA1B 2P4TA 1SRMA 1H641 2ROTA 2BZ8A 4E7JA 3MEUA 2VB6A 3VS2A 4HCKA 2AKLA 3OQ5A 4CRIA 4Z88A 5GANj 2KBTA 4IUTA 2OTLA 2V8IA 5GANg 1GCQC 1WJQA 3PGGA 4M77B 3QZ5B 4F14A 5CQXA 2L3SA 2PU9B 2QGGA 5GMKl 4YTLA 4ORZA 3L1AA 5CK9A 2K5LA 4XQ3A 3P8HA 4XU0A 4EIKA 2QG9B 4AFZC 2Z0WA 2RH2A 2GF7A 1Q7YC 3RERA 1WI7A 2RNAA 3RR6A 2KGTA 1BU1A 1T3SA 2GQVA 3QDRB 2K2VA 3JRZA 1GCPA 1ZLMA 5GAN6 1W1FA 5GANf 1VQ5Q 5GAN2 2IIMA 2KVQG 5GAN5 2M02A 3V8KA 4FIBA 2K57A 1LPLA 1FYNA 3TSZA 1KHIA 1LNXA 2CS7A 1CKAA 3OYCA 1G8XA 2EQJA 1I5LA 4UC4A 2FPFA 3CCQQ 5A0LA 3CBPA 1N8RR 3JCMg 2JT4A 3O8VA 1M2VA 1B34B 2SRCA 4PJOB 3QO3A 2ZPFB 1QCFA 3D7SB 4FYWB 1VQLT 1I1JA 1R8OB 5DLQE 3WXMB 3OYYA 3JB9D 3MCAB 1Q7YU 2K79A 1G83A 1X6BA 1IRXA 3QYHB 2DYIA 1QVFS 4FM4B 3H0IA 2NUTA 3CCMT 4JJBA 4KT0E 1VQ4Q 5FW9A 4PL6A 4C92B 1K0SA 3MP6A 3QIIA 3M56A 3JCMf 4MZPA 1C1AA 1M90R 5IHNA 3EAEA 4E7HA 1OPLA 2XD0A 1KHCA 2KEAA 2DL7A 3ZFJA 1M5Q1 4ELYC 4DOVA 2F1LA 3M9QA 1Q86C 2PVGB 2DZ9A 2MWPA 4MMLA 4D8KA 4XTVA 1PWTA 5KYXA 2KROA 1AVZC 4CC7A 5KE3A 2V8JA 2K2MA 2C0IA 3CMEQ 3LX7A 1BK2A 1NJIC 3EFSA 1YCSB 2LMJA 1YJWT 3M0TA 2DL8A 2E4HA 2AT1B 2EGEA 1KK7A 3QZ9B 5D6XA 2X35A 3J80E 3M59A 2D8HA 2QK0A 5GANe 2W0ZA 5LJ3j 3M4YA 4ZGJB 4FT4A 2CT3A 5LJ3g 1NEBA 1PD1A 1VQLA 5C0MA 2EKHA 1PRMC 4O6JA 1K1ZA 2RK1A 2A37A 3NFCA 2YUQA 3A8OB 2OI3A 5GAN8 1VQ9T 3ASKA 3GOXA 1I8FA 4EMKA 1Q86U 1GBQA 2KK4A 2VXFA 3CCMA 4BY6C 2XDDA 3GF5A 4PJLA 3CCRQ 1XJWB 2M9UA 4J6XA 5GAOn 1KG1A 1K0XA 1ZUYA 4PFZA 1NJIU 2LC4A 2EKOA 2DPPB 3OW2A 4M7AB 3MEVA 4X1VA 4C8QG 4IUVA 2HSEB 3M58A 1SRLA 1NEGA 4LD6A 2QEXT 5LJ3f 3DB4A 4B9WA 4E7ZA 1KQSA 5AT1B 1QVFP 2PTKA 2RJFA 1VQ6Q 4HA8A 4M78E 1NBEB 2M0YA 2EQIA 1IO6A 4NL2A 4F04B 3LW5E 5KCHA 4J6YA 3JCMe 2CYZB 5FU7C 1UGSB 1YN8A 1UB4A 5A0GA 3KBGA 1K76A 5IN1A 4PNOA 2DIGA 1FXXA 2L0AA 2KYMA 2OX7A 4JRIA 1AHJB 2COZA 5HK3A 1SHGA 5CKFA 2OTJT 2RI3A 2KT1A 3LWHA 2JTEA 2YLBA 3AT1B 4M77C 2C0TA 2ENMA 1VQ9A 8ATCB 1Q81C 3NTHA 4DBQA 2SEMA 3OYNA 3CCLQ 3CC7T 4FYXB 3OS0A 1JQQA 4PJNA 3M54A 1XNIA 2JS0A 2DD4A 4JRPA 1QVGS 4DEXA 2MOXA 1JEGA 2QEXA 4RTZA 2GTOA 3VU3C 4X9CA 2AIRB 3ZEHA 1D3BB 3G6EQ 1VQ7T 4N0AA 2WSEE 5FWCA 2EJFA 1C6VX 4F16A 4QVCA 2M51A 1WHGA 1KFZA 4M78B 2XHCA 1K73C 3ULRB 3ME9A 2ZAEA 2KR3A 5LJ3e 1N9SA 2EJGA 2D9TA 2RF0A 4M7DA 1Q81U 1B3QA 1DJ7B 4PJOC 1ABOA 3EFOB 3QG1A 3CD6Q 4L6V5 1Y7XA 4JJDA 4HT9A 5L8RE 5C6SA 2DXBA 3OB9A 3OYBA 2OTJA 4E7LA 2EPDA 4FSXA 3SWNB 3RNJA 1PRLC 3OS2A 5ECAA 4RG2A 2EYYA 3G4SQ 1MV0B 2HEQA 1SEMA 5A2QE 3PVLA 2VVKA 1F1BB 3CC7A 2D6FA 1BCMA 4XAXB 1ZQ1A 2OAWA 1I81A 4PK4A 1WHKA 2KT8A 5CKBA 4C0ZA 4JLIA 3SEMA 2ZPBB 4DEYA 4R0KA 1K73U 1R0BG 5D6WA 1NYFA 1YWOA 4M75G 1YJNT 3LYIA 1D0ZA 2CSIA 1VQ7A 3X24B 2EAYA 3HL8A 1G3SA 4OMPA 4C8QF 1AWXA 2DBKA 5GAOq 3CMAQ 1QVGP 3M5AA 2AKKA 2CP3A 4F7UG 2NUZA 3L2UA 3PFSA 3CC2T 1GXIE 2HSPA 2ZPGB 1WHLA 2JW4A 2EYWA 4IIMA 1M3CA 4N4HA 1JO8A 5KH6A 4A54A 2QDLA 1B34A 3RUXA 4BE0A 2RK2A 1O9SA 2GNCA 1U06A 3EHQA 2JTMA 4E47A 4J9EA 4JRQA 2PNIA 2G6FX 2XICA 4ZTJA 3V8LA 4Y91A 1WPYA 3I55Q 1OEBA 3VKIA 1V29B 1IHWA 2COYA 3M0RA 4QW2A 3H0FA 1IB8A 1BI1A 4C92A 3QPHA 4C8QD 5GJWB 4J5YA 1YJNA 1M3AA 1MGQA 1WXTA 2P0PA 5HK0A 1X27A 4OGEA 4DBHA 2GTJA 2QAZA 1EIFA 2K3BA 2LJ3A 3TVTA 5I11A 3S3MA 2JNGA 1X43A 5CQYA 5LL6S 8AT1B 2OTLQ 3CC2A 2E5QA 3S6WA 1K4US 3RMSA 3EH2A 1Y57A 3NPFA 1QP2A 2X4YA 4F17A 2LJ1A 3E1SA 2AK5A 1S72T 4C0FA 2JXBA 4OB0B 3RKYA 2DIQA 1PCXA 2E70A 2ZPHB 3PE0A 3PTAA 1W70A 1X01A 4A53A 1X2QA 2DXCA 3E2UA 2O4XA 2ROLA 3WVEB 5M9OA 2R5AA 3QWYA 4CC4B 1T0JA 1ABQA 3KFVA 5CIUA 4M7AA 1ZHIA 4ZGDB 1GL5A 2LX7A 3GLXA 2MAMA 3OYFA 1WJRA 2JUFA 1ZBXA 3G71T 3P8DA 3TCJA 3OYHA 1W2BA 4B9XA 3VUZA 3QJ6A 4C8QE 4RCCA 4IUUA 2O31A 3FLGA 1G2BA 3MO8A 4M75F 2QXFA 1VQPT 3RIRA 1QCOA 4DQ2A 5HY6A 4BY6B 2K7AA 1K9AA 3CXCA 1RI9A 4A4KA 4OB2B 5IHIA 2F2VA 1UGQB 1OI1A 2CSQA 4KGVB 5I2SA 2RQUA 1IZ6A 4J9DA 2E6NA 5GAOp 1VQNA 2WACA 2Y4YA 4IIOA 3BDUA 3QJYA 3OYEA 4C5EA 1S72A 3MEWA 3EG0A 5DM7R 3CBMA 5L23A 1YNZA 1HJDA 1SG5A 2KQWA 4J9GA 4KBMB 2E10A 2CGHA 4DOWA 1M1KR 5FU7B 1Q82C 3L2WA 4HXJA 4RG8A 1FWZA 5EG2A 2JTFA 5KYWB 2HL3A 4V2SA 1KQ2A 4WCIA 4IURA 1WZOA 1R77A 1WHHA 3PIPA 1VYTA 3G71A 4M75D 1VQ8T 3VS5A 3HSBA 2DVJA 4RTVA 5GAN7 1NG2A 1UE9A 1ZSZC 3CCET 2VASA 1UTIA 2L2PA 1IGUA 2P84A 2DL4A 2X4XA 3HP9A 3UATA 4RCBA 4NL3A 2K4YA 1VQPA 2KRMA 4C8QB 1GBRA 1YJ9T 2QASA 3RKXA 4M78A 2JMCA 3JB9I 3G7ZA 1JXMA 2GBQA 1H8KA 1WJSA 3CEYA 3H9NA 1RAAB 2RHZA 2IVWA 1G3TA 1Q82U 2QA4A 3R6OA 2FPDA 5GAMh 2GCXA 3CCVQ 2MK5A 1FMWA 3CCST 2L3PA 1VQOT 2DNUA 3SWNA 4QT7A 3E19A 1R0CB 4Z8AA 3OA6A 2ESWA 1TH7A 3I56T 2HNIA 2M0OA 4AG2C 4E2FB 4X34A 2RHYA 3UF4A 1VQMQ 1K9MR 2DILA 1BKBA 1KC8R 1UGRB 2CT4A 1HK9A 2VYTA 1UJ0A 1YWPA 2O9VA 1UHFA 1TSFA 4OB1B 5IXBA 2AZSA 2YUPA 4IUPA 4LDYA 1YI2T 1VYVA 3OSSC 2JN0A 1VQ8A 1JB0E 1OU9A 3CCEA 2DTIA 2H8HA 2LDMA 4ZGEB 1KSWA 1PKTA 4OMLA 2HCKA 3AHUA 3TREA 2V1QA 1GCQA 1YJ9A 2X9HA 2EIFA 5GAOl 4GBQA 4KUIA 1X6OA 1BYMA 3C12A 4KRTA 2F2XA 4A4FA 1H92A 2RHXA 2DKGA 4F7UE 1QW1A 1QKWA 1M8VA 3QWXX 5LJ5h 4D6WA 2A08A 1M27C 3CCSA 3SHWA 3CPFA 1VQ5T 4BACA 2ZPIB 1VQOA 3VYGA 1UUEA 1P92A 3OW2S 3I56A 1TWBA 2BZXA 2FRYA 2FZCB 3HFOA 2BE9B 2K6DA 3GIBA 2YDLA 1IREB 2DZCA 1OZ2A 3EG2A 1KQSS 2YT6A 3CCQT 2VV5A 1NLPC 2D0NA 4GY5A 3OSVA 1QP3A 2LCLA 5HCKA 3ZBDA 3UWNA 1KD1R 1YI2A 1MMDA 4M7DG 5GANd 3LGFA 4JS5A 4NOYA 4BI4A 2K5IA 1JBMA 1WDXA 1Y07A 4C0GA 4ZN3A 1A0NB 1QMCA 1GRIA 3UPUA 1AWWA 1RLQC 1YITQ 5CKDA 3P8BB 2KRSA 1VQ4T 3CPWA 2A28A 2P4RA 2KXCA 4MMKA 4FYYB 2FHDA 2DA9A 2L3RA 3E9FA 1EFNA 3C0CA 2QYZA 3OBWA 1X2KA 2CREA 3DKMA 1VIEA 4F7UB 2C0OA 5GAMj 4J7FA 1YJWA 3CMET 2YXYA 5GAMg 3M0SA 5CKEA 4GLKA 1QLYA 3EGXA 1D1AA 2EW3A 1QKXA 1AOJA 3META 4RMOA 3JCMd 2COWA 2O2OA 3CCQA 2ED1A 3A5ZB 2LQNA 2O88A 3OYDA 3VV0A 3L42A 3EFRA 3EG1A 2E1HA 3VS6A 1N8RC 3OW2P 2DM1A 3CPWP 4L59A 1KC8C 1TUCA 3EHRA 1UEBA 2G3RA 4MDXA 2NLUA 3JCMP 1JJ2A 1KQSP 4PFOA 1RAEB 1Z9QA 4C8QC 2CP6A 2RQWA 5GAMf 2FG0A 4PJMA 3EG9B 4OVAA 1T3LA 1WGSA 3HRSA 4AFSC 3CCRT 1VQ4A 5I21A 1FMKA 3FDRA 3EGDB 4BI8B 3OY9A 4C0DC 2K3YA 1J3TA 4MZTA 3RMQA 1PC0A 1S1NA 4HVWA 2F69A 2E3HA 1TXQA 2HBPA 4BDYA 2FZGB 2ED0A 4C5IA 2HD0A 1M90C 1SF9A 2E12A 1VQ6T 4C92G 2DRKA 2DX1A 1NPPA 5LJ5j 3CMEA 2XDPA 1N8RU 3CBOA 1QWEA 3RDVA 5LJ5g 3M53A 2VUBA 4PLLA 4HT8A 1TG0A 4ZNXA 1IXDA 3OYKA 1D1CA 3OMCA 5GMKi 2LQ8A 3CCUQ 4LD9K 5LJ3d 1ZX6A 5KYWA 1VQKQ 4XTUA 1U1SA 1D09B 1M9SA 2PZ1A 4AFQC 5FRMA 2W10A 1OPKA 3I35A 2ZZDA 2L5QA 3A8LB 1UJYA 1NLOC 4BE1A 3VJPA 3CQTA 2FL7A 4M77A 3CCLT 4M7DF 5LJ5f 2LCSA 1M90U 9ATCB 2B86A 3CCRA 4A4GA 1YP5A 2J6KA 1YHQQ 4JZ3A 2CUDA 1NZ9A 3OYAA 1SSFA 4JZ4A 1M1KC 5GAMe 2XG8D 1AT1B 3G6ET 1W6XA 1VQ6A 2RHUA 4FYVB 4BD3A 2E6ZA 1WQ7A 2JM8A 2EYQA 3UT1A 1K8AR 1I07A 3FRNA 1ZSZB 1LOJA 4M7AG 3S3NA 3NHNA 1IGQA 3X20B 2DXTA 2A36A 1N27A 3GPLA 3MJXA 1WXUA 3IQLA 4A63B 1TS9A 4OF1A 5GMKj 1YIJT 3CD6T 4OMQA 4ESRA 2CZ6B 3FC3A 4NS5A 4PJOA 3M0QA 2MI6A 3I9QA 2I0NA 5FROA 4K11A 4M7DD 2H3JA 1M8MA 4JPBW 2NUPB 1AD5A 3G4ST 2ECZA 3CC4Q 3REBB 2F5KA 3CCJQ 1VQNQ 1M1KU 2CZ0B 3VS7A 3CCLA 2NWMA 3QSUA 2ZGWA 4JJNK 2LX9A 1RACB 4JJCA 4M75C 2DXUA 2RMOA 5GAOm 2WSFE 3JCMb 2FEIA 4JUVA 3OBYA 1HSQA 5KYUB 5IT9E 2L8DA 1BCOA 4XTZA 4ZN1A 2L89A 4PJOF 2HQHA 4II1A 4RUGA 5LJ5e 1E6HA 3G6EA 4J9BA 2QI2A 3MPUB 2ZCFB 4QVDA 3VS4A 3CMAT 2BUDA 5KE2A 4QQDA 1IHVA 2LCCA 3U23A 4LE9A 1UGPB 2HDAA 4C92F 1M1GA 3URGA 1ZSGA 3V7SA 1WHMA 1BI0A 1YBYA 1Q7YR 1YFNA 1YIJA 1W2BS 3DB3A 3CD6A 1OYXA 1WYXA 3OYIA 2DL5A 5IH2A 1PSEA 1TUDA 1ZA2B 2CUBA 1OX9A 3QHSA 1JXOA 3OMGA 3QKJA 2CP2A 1G3WA 2OAUA 3G4SA 3CXCS 1MNDA 4XU2A 2QA4Q 3MKDA 1ACMB 2JM9A 5GJVB 3I55T 3FB9A 4M7DE 2A3LA 4E7SA 2FO0A 2PVDB 2R5MA 5CCAA 4EMHA 2GFUA 1PKSA 2XK0A 4P5NA 1LVKA 4RTTA 1ZBJA 4FW1A 1RLPC 2E41A 2O9SA 3PMTA 2PQWA 1U3OA 2RHIA 3G1JA 4BI3A 4J7IA 2DO3A 3CMAA 4C92D 4OMOA 4OMFB 3PNWC 3RBBB 2ATCB 4F7UA 1OU8A 3WVDB 2C06A 2L3QA 2OTLT 1M4ZA 2KE9A 2RI2A 3LH0A 5IAYA 1AEYA 3TEEA 4KH0B 3VYHB 4M7AF 4XTYA 2O01E 2EGCA 3FJ5A 5D6YA 3BDLA 1I0CA 1PD0A 2RQVA 2FPEA 1MUZA 1Q86R 3HRTA 3JV3A 2DETA 2VKNA 1BIBA 2KSSA 4JRKA 3A8GB 7AT1B 2J6OA 1X69A 3LLRA 1NJIR 1W2BP 2D1XA 1ZUUA 2R57A 2JZ2A 3JCMJ 3EG9A 1N9RA 4A4EA 3E9GA 4O5VA 3EGDA 2LQKA 4MDWA 3CXCP 5HKCA 1N6AA 3DLLA 4B6MA 4LDVA 2KDSA 1D3BA 4BE2A 1GFDA 3HHTB 1VQLQ 1PNJA 4FU6A 1YI2Q 3DLMA 3M55A 1KQ1A 3A8HB 4M7AD 2KY9A 2HZYA 4LN2A 4FL6A 2HQEA 3CCMQ 2LNVA 1Y71A 3V7RA 4C92E 4QKUA 3EFOA 4C0DB 3JB9F 3C94A 1NM7A 4XK8E 2NYSA 3OS1A 1QVPA 2FZKB 4XU1A 1C0MA 2YHTA 1SKUB 4FCYA 3JAME 5EC7A 2DTHA 1Y96B 4C5HA 1Z9ZA 1T0HA 2KNBB 3JCMQ 3OYLA 2CH4W 1OULA 4MZMA 4N4IA 2YSQA 1FX7A 3GBQA 3HKSA 2J05A 4OP0A 2BKDN 4M78F 3OYGA 3F70A 3FEOA 4EPCA 5FU6C 3OS5A 2LRQA 2VGMA 2RQRA 1YJWQ 4ME7A 3H8ZA 4RTYA 1BI3A 1WNLA 3L2RA 5IXFA 2LJ0A 4Y28E 3PT9A 2MIOA 3RKWA 4JS4A 5FRNA 1UGVA 3BY7A 3UA6A 3OYMA 3PIOA 2DF6A 4PKCC 4VUBA 1AWOA 1Q81R 1Y0MA 1CSKA 4OMMA 4EMKC 4M75E 2K3XA 2E65A 4WF2A 1ZSZA 1VQ9Q 1U5SA 4XTXA 5FWBA 1WIEA 2QTXA 3NMZC 5I2MA 2BTTA 1LCKA 2ZPEB 1CKBA 1U8RA 2M1HA 2F2WA 1TU0B 4CC2A 2CP5A 4LDXA 1NE8A 2EQMA 4M7AE 2CH4A 3J81E 5DLOA 4BUGA 2D0QB 1N5ZA 4BDZA 2EJ9A 2R58A 2RJEA 3JCMc 4KGZB 5J3BA 3CCVT 4M78D 2QEXQ 1H3HA 2K5FA 3EH1A 1G3YA 4J83A 3VS1A 3FIFA 4ANJA 3CPWS 2NUPA 2GQIA 2IPOB 2QQRA 1K73R 2YLCA 1RAHB 5I22A 2X4JA 2X3WD 3L2QA 1VQMT 2Y4XA 1RAFB 3JCMW 4GLMA 2HAXA 5DY9A 1V1CA 2QQSA 3ER0A 3HFNA 1UDLA 4PFPA 4KGXB 1ARKA 3QXEB 3M4GA 1PSFA 2F5TX 6AT1B 1M1FA 1WXBA 4D8DA 5KCOA 4XTWA 5KYUA 1QVFA 2OTJQ 5GAOr 5CO7A 2DE0X 2XMFA 2HMAA 1I5OB 2CP7A 2RQTA 4M75B 3CC7Q 2A7YA 3H41A 1VOMA 1RUWA 3QYGB 4M77G 3HRUA 3TQ7P 2O4XB 1D0XA 4LUEA 1SPKA 1JJ2S 4ATOA 1JU5C 1VQ5A 1MMNA 4N0AC 3CCVA 4ZTFA 3GP8A 1E6GA 2EGAA 3VRYA 2YUOA 2DEUA 1VQ7Q 4ELZC 2E5KA 1ZUKA 5GMKh 1M2OA 2XIDA 3SD4A 2P0QA 3SFMA 2HL5C 1VQMA 4OB3B 3M0UA 4M7DC 2LZ6B 1X75C 4RTWA 2E64A 4J9CA 2WSCE 3GNGA 3PMIA 3VS0A 3LH5A 2QQ9A 1D1BA 1K9MC 1RAIB 2YRDA 3MP8A 2MF2A 5KYYB 2AZVA 2DD5A 5GAN3 1RAGB 3I5SA 2X51A 1HXDA 3THKA 4PJOG 1LJOA 2LP5A 4KUDK 4QQGA 1YITT 2D8JA 2J06A 3KXTA 1M3BA 2V8KA 3T9NA 3BE3A 2PUKB 1UFFA 4TVRA 2DBMA 1E7OA 1PG5B 1OX8A 3HTRA 2X3XD 1X6GA 2KI7A 1TTHB 2FYKA 2YWWA 5KYNA 2LT4A 3L2ZA 1QQJA 1YJNQ 3EG3A 1Q95G 1UG1A 1K9MU 2VXEA 1KC8U 2DTOA 3HPWA 2LNHB 3R6NA 2BE7D 3RESA 1V76A 2Y90A 1M30A 2HKNA 1U1TA 2V26A 1JJ2P 4HVUA 4E6RA 2DAQA 2DEQA 3A8MB 3X25B 3CC2Q 1RADB 1D0YA 4XU3A 1XOVA 4AFUC 4R56A 2J6FA 1UECA 1OV3A 1YIJQ 3UDCA 4DBRA 1KD1C 4RKUE 3I5RA 1FMVA 1QVGA 3JB9H 2KAFA 1W4SA 2IG0A 4Q5WA 1YITA 2HQXA 4HVVA 4C5GA 4C8QA 4HKEA 4QQ6A 2J7IA 5CVIA 3LWIA 2B8AA 3SDZA 4KULA 2RJDA 4C92C 2RJCA 2RPNA 3V7CA 3TU4K 1OQKA 2EFIA 3O5ZA 1M2VB 5GMKm 2GGRA 5A0DA 1BIAA 1MMAA 3BFMA 4Y92A 2RA2A 4J6WA 2JS2A 1WFWA 2YRCA 2DL3A 2H3EB 4M77F 2GFAA 2KMTA 4FSSA 1EX4A 2RD1A 1Y96A 1I4K1 4OMNA 1VIFA 5GAMd 1B07A 3Q1JA 4RTUA 4OGCA 3LGLA 5J39A 4L5GA 4QVZA 2NUTB 1KD1U 1BI2A 4WTOB 3J7AF 3JB9J 1G5VA 3M0PA 3MEAA 3CCUT 2QDYB 2RN8A 4AT1B 4FT2A 2VWFA 1VQKT 2KXDA 1WQWA 2M16A 2XDBA 2DERA 2QTVA 2CDTA 1KIKA 2DLPA 1XTDA 2BIVA 5KYXB 5IHKA 2CZ1B 4HCCA 2HBWA 1O75A 1S72Q 4LXCA 1Q82R 5J26A 2LVMA 3M57A 2EWNA 2JMAA 1YHQT 4J8OA 3X26B 5FU6B 2I2LA 4EMGA 4J9FA 5GAN4 2LQWA 3OYJA 4M77D 4Z89A 3PVQA 4M7AC 4FW2A 1OZ3A 2FVUA 5GANh 3QBYA 1WA7A 1PHTA 3FJPA 4R55A 4J9HA 2DRMA 3G71Q 3JB9G 5LJ5d 4HCBA 4A4HA 1PM3A 2CKKA 4EMKB 1WHJA 3JCMV 1AZEA
chains in the Genus database with same CATH topology
3H6ZA 4M7DG 1YCYA 4PJOC 3DLMA 3M55A 4LDWA 1KQ1A 3A8HB 5GANd 3QG1A 4M7AD 3LGFA 2MWOA 3V8JA 2KY9A 3CCUA 4JS5A 4L6V5 1Y7XA 4NOYA 4BI4A 4HT9A 4FL6A 5L8RE 2K5IA 1JBMA 3NTKA 1VQKA 5C6SA 2DXBA 3OB9A 1Y07A 3OYBA 2OTJA 4C0GA 4M78G 4ZN3A 2LTOA 2LT1A 2HQEA 2XU8A 4E7LA 2LNVA 4FSXA 1Y71A 3V7RA 3SWNB 4C92E 3OS2A 3UPUA 4RG2A 4C0DB 5CKDA 3JB9F 4BB7A 3C94A 3P8BB 5CKHA 4DA4A 3JSCA 1VQ4T 5A2QE 4XK8E 3OS1A 3C95A 1QVPA 4XU1A 3SB2A 3L2VA 3CPWA 3CC4T 2YHTA 3CCJT 3CC7A 2QQAA 4MMKA 3JAME 1VQNT 2DTHA 1Y96B 2RB6A 4C5HA 2D6FA 2FHDA 4XAXB 4PJOD 3E9FA 2L3RA 1ZQ1A 3JCMQ 1I81A 3OYLA 3OBWA 3OYCA 4MZMA 4N4IA 3JCMh 1FX7A 4IUQA 1YHQA 5CKBA 2XKOC 1NPRA 3HKSA 3VUBA 4C0ZA 4JLIA 4OP0A 2ZPBB 2FB7A 2BKDN 4M78F 3DKMA 1VIEA 1K73U 4M75A 5AYFA 3OYGA 3F70A 4F7UB 3FEOA 5D6WA 4N4GA 4EPCA 4M75G 1YJNT 5GAMj 3LYIA 4J7FA 5FU6C 1YJWA 3OS5A 2LRQA 1H3ZA 2VGMA 3CMET 1VQ7A 3X24B 2VGNA 3QUIA 4ME7A 2EAYA 4GLKA 3H8ZA 4PLIA 5CKEA 1BI3A 1G3SA 1WNLA 3HL8A 3GNFB 4LDUA 4EDUA 3L2RA 4C8QF 1JRIA 5CR2A 3C4SA 4JLGA 2XI9A 4IKFA 5GAOq 3META 5CAIA 4RMOA 3JCMd 3M5AA 4M77E 4Y28E 3S3OA 3PT9A 3CCQA 3RKWA 4JS4A 5FRNA 3A5ZB 4F7UG 4E7KA 3BY7A 2X4WA 5GMKe 3L2UA 3OYMA 3PFSA 4PKCC 3PIOA 3OYDA 4VUBA 3VV0A 2PVOB 3L42A 3CC2T 3EFRA 1K8AC 4Z02A 1XQHA 1GXIE 2E1HA 4E7IA 2ZPGB 4M78C 1N8RC 4EMKC 2DJZA 4M75E 4L59A 2AHJB 1KC8C 2EQKA 2K3XA 1UEBA 4N4HA 2E65A 2G3RA 4WF2A 4M7AG 4MDXA 2NLUA 3INZA 5KH6A 2MMPA 3JCMP 2RO0A 4XTXA 4A54A 2RI5A 1JJ2A 3I55A 2QTXA 5I2MA 1B34A 4C8QC 3RUXA 4BE0A 3JCMX 2RK2A 1MHNA 1O9SA 3MHXA 1VUBA 2ZPEB 5GAMf 1U8RA 2M1HA 2JTMA 4E47A 2CZ7B 4OVAA 4LDXA 3BW1A 1NE8A 2EQMA 1WGSA 3HRSA 5FLXE 4M7AE 2JOYA 3CCRT 1VQ4A 3OW2A 4JDSA 3X28B 4F7UF 3FDRA 5I21A 3J81E 4JRQA 5DLOA 3SWNC 1RI0A 4BUGA 3CC4A 1RL2A 2D0QB 4X9DA 4BDZA 2R58A 2RJEA 2EJ9A 4BI8B 2XICA 2K3YA 3JCMc 3MP1A 4MZTA 4Y91A 3V8LA 1WPYA 4C0DC 4ZTJA 3RMQA 3VKIA 1V29B 4HCZA 2JVVA 5J3BA 4M78D 3CCVT 2K5FA 2EQUA 2F69A 3KUFA 1G3YA 4J83A 2RM4A 4QW2A 2HBPA 3FIFA 4BDYA 3CPWS 4CI0C 4C5IA 2YRVA 4M7DB 3NTIA 2HD0A 1M90C 1BI1A 4C92A 2E12A 3QPHA 2VC8A 2P0KA 2QQRA 5LJ3h 4C8QD 1VQ6T 2YLCA 4J5YA 3N5BB 4C92G 2DK3A 2DVEA 2PUOB 2X4JA 4PJOE 1YJNA 3L2QA 2QQBA 1NPPA 2Y4XA 1VQMT 1MGQA 1K8AU 5LJ5j 3CMEA 2XDPA 3JCMW 2P4TA 1N8RU 1H641 5DY9A 2P0PA 5HK0A 4E7JA 4OGEA 3CBOA 2HAXA 5LJ5g 2QQSA 3ER0A 3HFNA 3MEUA 3M53A 3QXEB 3M4GA 1PSFA 2VUBA 2F5TX 4PLLA 4HT8A 1EIFA 1M1FA 3OQ5A 5KCOA 4XTWA 4CRIA 3S3MA 3OYKA 5GANj 1QVFA 2JNGA 4IUTA 5CQYA 5LL6S 3OMCA 5GMKi 2LQ8A 2OTLA 4LD9K 2V8IA 5GANg 3CC2A 5LJ3d 1WJQA 2E5QA 5GAOr 5CO7A 4XTUA 3PGGA 4M77B 1U1SA 3QZ5B 5CQXA 3S6WA 1M9SA 5FRMA 2PU9B 5GMKl 3RMSA 2ZZDA 2L5QA 3A8LB 4YTLA 3L1AA 5CK9A 2K5LA 4BE1A 4XQ3A 3VJPA 3P8HA 1QP2A 4M75B 2X4YA 4XU0A 2FL7A 2A7YA 4M77A 3CCLT 4M7DF 5LJ5f 2RH2A 2GF7A 1M90U 1Q7YC 3E1SA 3QYGB 4M77G 1S72T 3HRUA 4C0FA 3CCRA 3RERA 4OB0B 2O4XB 4A4GA 2GQVA 3QDRB 2K2VA 1JJ2S 3JRZA 3RKYA 2DIQA 5GAN6 4ATOA 1VQ5A 2E70A 4N0AC 3CCVA 1NZ9A 3OYAA 2ZPHB 5GANf 5GAN2 3PTAA 1X01A 4A53A 2KVQG 1SSFA 5GAN5 2DXCA 4ZTFA 3GP8A 3V8KA 2O4XA 4FIBA 3WVEB 2K57A 5M9OA 1M1KC 5GAMe 4ELZC 2XG8D 1KHIA 2R5AA 1LNXA 3G6ET 5GMKh 1VQ6A 2XIDA 2CS7A 2RHUA 3SD4A 4BD3A 2P0QA 3SFMA 5CIUA 2E6ZA 1ZHIA 1WQ7A 2EQJA 2EYQA 4OB3B 3UT1A 4UC4A 4ZGDB 1VQMA 3GLXA 1I5LA 3FRNA 4M7DC 2MAMA 1LOJA 1WJRA 1X75C 3CBPA 5A0LA 3OYFA 2JUFA 1ZBXA 3S3NA 3JCMg 3G71T 3O8VA 3P8DA 3TCJA 2E64A 2WSCE 3OYHA 1B34B 3GNGA 3PMIA 3X20B 4B9XA 2DXTA 1W2BA 3VUZA 1N27A 2QQ9A 3GPLA 4PJOB 3QJ6A 3QO3A 4C8QE 4RCCA 1K9MC 2ZPFB 4IUUA 1VQLT 3FLGA 3MP8A 1R8OB 3MO8A 2MF2A 4M75F 2QXFA 5DLQE 3WXMB 3OYYA 3JB9D 4OF1A 3MCAB 1VQPT 1Q7YU 3RIRA 5GMKj 4DQ2A 1YIJT 3CD6T 5HY6A 4BY6B 2DD5A 2CZ6B 3CXCA 5GAN3 4A4KA 3QYHB 4OB2B 4NS5A 3FC3A 4PJOA 1HXDA 1UGQB 2MI6A 1OI1A 5FROA 1QVFS 4FM4B 4PJOG 4M7DD 3CCMT 2H3JA 1LJOA 4KT0E 5I2SA 4KUDK 4PL6A 4QQGA 1YITT 3G4ST 1IZ6A 4C92B 3KXTA 3MP6A 2E6NA 5GAOp 1VQNA 3QIIA 2V8KA 2F5KA 2WACA 2Y4YA 3M56A 3T9NA 3BDUA 1M1KU 2CZ0B 3QJYA 3JCMf 3CCLA 4MZPA 2PUKB 3QSUA 3OYEA 3LWIA 3EAEA 4C5EA 2ZGWA 4E7HA 4TVRA 3MEWA 1KHCA 1S72A 4JJNK 2XD0A 5DM7R 2LX9A 4M75C 2DXUA 3CBMA 3ZFJA 1M5Q1 4ELYC 4DOVA 3M9QA 2WSFE 5GAOm 2KQWA 2PVGB 2DZ9A 2MWPA 1Q86C 4KBMB 3JCMb 2E10A 2CGHA 4MMLA 4DOWA 4JUVA 3OBYA 4XTVA 2FYKA 5IT9E 2LT4A 3L2ZA 5FU7B 5KE3A 2L8DA 4XTZA 4ZN1A 1Q82C 2L89A 2V8JA 3L2WA 4PJOF 1K9MU 4RG8A 4II1A 1FWZA 5EG2A 2VXEA 3LX7A 2JTFA 1KC8U 1NJIC 5LJ5e 3EFSA 2DTOA 3G6EA 4V2SA 3HPWA 1KQ2A 2QI2A 1YJWT 4IURA 2ZCFB 3RESA 2Y90A 1U1TA 3PIPA 3QZ9B 5D6XA 2X35A 4QVDA 3J80E 3M59A 2DAQA 2BUDA 3CMAT 2DEQA 5KE2A 3G71A 3A8MB 3X25B 4M75D 1VQ8T 4QQDA 3HSBA 5GANe 5LJ3j 5GAN7 3M4YA 4ZGJB 4FT4A 3CCET 2LCCA 5LJ3g 4XU3A 1UGPB 1VQLA 4C92F 1M1GA 1XOVA 3URGA 5C0MA 4O6JA 2X4XA 3HP9A 2RK1A 3V7SA 4R56A 5GAMg 1BI0A 4RCBA 4NL3A 2K4YA 3NFCA 1VQPA 3A8OB 1YBYA 1YIJA 1W2BS 5GAN8 3DB3A 3CD6A 1OYXA 4C8QB 1VQ9T 1YJ9T 3ASKA 3UDCA 3RKXA 1KD1C 3GOXA 1I8FA 4RKUE 3OYIA 4M78A 3CCJA 4EMKA 1QVGA 3JB9I 1PSEA 3G7ZA 1Q86U 3JB9H 2KAFA 2KK4A 2VXFA 1W4SA 3CCMA 4BY6C 2IG0A 2XDDA 5GAMd 1WJSA 3CEYA 3GF5A 3QHSA 4Q5WA 3OMGA 2RHZA 3QKJA 1G3WA 2IVWA 2M9UA 2OAUA 1G3TA 2HQXA 4J6XA 3CXCS 3G4SA 1YITA 5GAOn 4C5GA 3R6OA 2QA4A 1Q82U 1KG1A 4XU2A 4C8QA 5GAMh 1NJIU 2LC4A 2EKOA 2DPPB 4HKEA 4QQ6A 3MEVA 2B8AA 2GCXA 4IUVA 5CVIA 4M7AB 3SDZA 4C8QG 4KULA 3M58A 3I55T 2RJDA 4C92C 2RJCA 3FB9A 3CCST 3V7CA 4M7DE 4LD6A 2A3LA 2QEXT 3TU4K 5LJ3f 1VQOT 2EFIA 3SWNA 2PVDB 2R5MA 3DB4A 4B9WA 5GMKm 3E19A 1KQSA 5CCAA 3OY9A 5A0DA 3OA6A 4EMHA 1BIAA 2GFUA 3BFMA 2XK0A 2RA2A 1TH7A 2RJFA 4J6WA 3I56T 2HNIA 4HA8A 2M0OA 4M78E 4P5NA 4X34A 2RHYA 4M77F 2E41A 2GFAA 2KMTA 2RD1A 4NL2A 1Y96A 3PMTA 1I4K1 2PQWA 1VIFA 3LW5E 4J6YA 2RHIA 1BKBA 5KCHA 3JCMe 4BI3A 1UGRB 2CYZB 1UGSB 3Q1JA 5FU7C 1HK9A 1UB4A 2VYTA 4J7IA 4OGCA 5A0GA 3KBGA 2DO3A 3LGLA 4OB1B 5J39A 5IN1A 4L5GA 4QVZA 4IUPA 1KD1U 3CMAA 4LDYA 1BI2A 4C92D 1YI2T 4PNOA 3J7AF 3OSSC 3PNWC 4OMFB 2JN0A 2DIGA 1FXXA 2QA4T 3JB9J 1VQ8A 1G5VA 4F7UA 1JB0E 3WVDB 3MEAA 4JRIA 1AHJB 5HK3A 3CCUT 2C06A 3CCEA 2QDYB 2OTLT 1M4ZA 2DTIA 5CKFA 2LDMA 4ZGEB 4FT2A 2RI2A 3LH0A 5IAYA 1VQKT 2OTJT 2RI3A 1WQWA 2M16A 2XDBA 3TEEA 3AHUA 3TREA 3LWHA 2YLBA 3VYHB 4M77C 4M7AF 4M7AA 4XTYA 2O01E 1YJ9A 1VQ9A 1Q81C 3NTHA 5D6YA 1XTDA 2BIVA 2EIFA 5GAOl 3BDLA 3OYNA 2CZ1B 4KUIA 1X6OA 4HCCA 1BYMA 3HRTA 3CC7T 3C12A 1O75A 1BIBA 2KSSA 4JRKA 3OS0A 3A8GB 3M54A 4A4FA 2RHXA 2DKGA 1XNIA 5J26A 2DD4A 4F7UE 4JRPA 1QW1A 2LVMA 3M57A 1M8VA 1QVGS 3LLRA 2EWNA 5LJ5h 1YHQT 4J8OA 4D6WA 3X26B 5FU6B 2I2LA 4EMGA 5GAN4 3CCSA 2QEXA 3CPFA 1VQ5T 4BACA 2ZPIB 1VQOA 3VU3C 3OYJA 4M77D 4X9CA 2R57A 2JZ2A 3VYGA 3ZEHA 3JCMJ 1D3BB 4M7AC 1P92A 1N9RA 3OW2S 1VQ7T 1OZ3A 2FVUA 2WSEE 4N0AA 3HFOA 5GANh 4A4EA 3QBYA 3I56A 3E9GA 4O5VA 2EJFA 3GIBA 1IREB 3FJPA 4R55A 2LQKA 4MDWA 5HKCA 2DZCA 1OZ2A 1N6AA 4QVCA 1KQSS 3DLLA 4LDVA 3JB9G 2KDSA 5LJ5d 1D3BA 4BE2A 4HCBA 3CCQT 4A4HA 2CKKA 4M78B 3HHTB 2VV5A 2XHCA 1K73C 4EMKB 3ME9A 4GY5A 3OSVA 1N9SA 3JCMV 1QP3A 5LJ3e 2LCLA 2EJGA 2D9TA 4M7DA 3ZBDA 3UWNA 1Q81U 1YI2A 1DJ7B 4FU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H6Z A;  2RJC A;  3FLG A;  3DLM A;  2EQU A;  3KUF A;  3MP8 A;  3MO8 A;  4LD6 A;  2EFI A;  4QW2 A;  2R5M A;  3DB4 A;  3LGF A;  4B9W A;  2MWO A;  4BDY A;  3OA6 A;  4C5I A;  2GFU A;  2YRV A;  2XK0 A;  4FL6 A;  3NTI A;  3NTK A;  2RJF A;  5C6S A;  3OB9 A;  3OYB A;  3FC3 A;  2M0O A;  4NS5 A;  2LTO A;  2P0K A;  2HQE A;  2QQR A;  1OI1 A;  4E7L A;  5FRO A;  4X34 A;  2RHY A;  2GFA A;  3OS2 A;  3L2Q A;  3PMT A;  4RG2 A;  2PQW A;  5KCH A;  2RHI A;  2XDP A;  3Q1J A;  4PL6 A;  4QQG A;  4E7J A;  2VYT A;  2QQS A;  3OS1 A;  3MP6 A;  2E6N A;  3MEU A;  3QII A;  2F5K A;  2WAC A;  3LGL A;  3L2V A;  5J39 A;  5IN1 A;  4PLL A;  4QVZ A;  4IUP A;  3OQ5 A;  3OYE A;  4C5H A;  3EAE A;  4C5E A;  5KCO A;  2FHD A;  4E7H A;  3MEW A;  1KHC A;  2L3R A;  3E9F A;  2DIG A;  3PNW C;  4CRI A;  3S3M A;  1G5V A;  3OYK A;  3OYL A;  4IUT A;  3OMC A;  3MEA A;  3M9Q A;  4N4I A;  2MWP A;  4IUQ A;  1WJQ A;  2LDM A;  2E5Q A;  2RI2 A;  3LH0 A;  5IAY A;  2BKD N;  2RI3 A;  2M16 A;  5KE3 A;  2L8D A;  3S6W A;  2L89 A;  3F70 A;  3OYG A;  3FEO A;  3L2W A;  5FRM A;  5D6W A;  4N4G A;  4II1 A;  3LYI A;  3LX7 A;  2LRQ A;  2JTF A;  1H3Z A;  3H8Z A;  4PLI A;  3NTH A;  5D6Y A;  3L2R A;  2BIV A;  4BE1 A;  3BDL A;  4IUR A;  4EDU A;  3OYN A;  3P8H A;  3C4S A;  2X4Y A;  4IKF A;  5D6X A;  2X35 A;  2GF7 A;  3MET A;  3OS0 A;  2DAQ A;  2BUD A;  3S3O A;  4A4F A;  5KE2 A;  2O4X B;  2RHX A;  4A4G A;  1XNI A;  5J26 A;  5FRN A;  4QQD A;  4E7K A;  2X4W A;  4IUU A;  2LVM A;  3L2U A;  3OYM A;  2DIQ A;  3LLR A;  3PFS A;  3OYD A;  3L42 A;  2LCC A;  4Z02 A;  3OYA A;  5C0M A;  4E7I A;  2X4X A;  4BAC A;  4ZTF A;  1SSF A;  3OYJ A;  4L59 A;  2R57 A;  2JZ2 A;  2EQK A;  2K3X A;  3ZEH A;  2O4X A;  4N4H A;  2G3R A;  3DB3 A;  5M9O A;  2NLU A;  1OYX A;  4ZTJ A;  5KH6 A;  1OZ3 A;  2RO0 A;  2R5A A;  3ASK A;  2RI5 A;  4A4E A;  3QBY A;  3GOX A;  3E9G A;  3OYI A;  2RHU A;  3SD4 A;  4BD3 A;  4BE0 A;  1MHN A;  5CIU A;  3OYC A;  2EQJ A;  2IG0 A;  3UT1 A;  1WJS A;  1OZ2 A;  2M1H A;  3CEY A;  4UC4 A;  4OVA A;  4Q5W A;  3OMG A;  1WJR A;  2RHZ A;  2EQM A;  1WGS A;  3QKJ A;  3OYF A;  3S3N A;  4BE2 A;  2HQX A;  3O8V A;  4A4H A;  2CKK A;  3FDR A;  3P8D A;  4C5G A;  1RI0 A;  3OYH A;  3PMI A;  3ME9 A;  4GY5 A;  4B9X A;  4BDZ A;  2R58 A;  2RJE A;  3OY9 A;  1N27 A;  2K3Y A;  2EKO A;  3MP1 A;  2D9T A;  3QJ6 A;  3MEV A;  2B8A A;  4QQ6 A;  4IUV A;  3UWN A;  4HCZ A;  4FU6 A;  2RJD A; 
#chains in the Genus database with same CATH topology
 3H6Z A;  3A98 A;  1YCY A;  4LDW A;  2DFU A;  1VQP Q;  2MWO A;  3V8J A;  3CCU A;  4CC3 A;  2DMO A;  2KRN A;  2CP0 A;  2YUN A;  3NTK A;  2ABL A;  1VQK A;  4M78 G;  2DJQ A;  2LTO A;  2LT1 A;  3NGP A;  2XU8 A;  2A0F B;  1RAB B;  3VS3 A;  4M4Z A;  4BB7 A;  1MMG A;  5CKH A;  4DA4 A;  1AWJ A;  3JSC A;  3C95 A;  2E3I A;  3SB2 A;  3L2V A;  3CC4 T;  3CCJ T;  2QQA A;  1VQN T;  1QWF A;  3H0H A;  1HYO A;  2RB6 A;  4PJO D;  1B7T A;  1WX6 A;  1VA7 A;  3JCM h;  4IUQ A;  1YHQ A;  2XKO C;  3EGX B;  1NPR A;  3VUB A;  4KH1 B;  2FB7 A;  2FRW A;  2JJ9 A;  4M75 A;  5AYF A;  4J9I A;  4N4G A;  3REA B;  1AZG B;  1H3Z A;  2VGN A;  3QUI A;  2MCN A;  3VRZ A;  2V1R A;  2EBP A;  1GFC A;  4LDU A;  4PLI A;  3GNF B;  4EDU A;  1JRI A;  5CR2 A;  3C4S A;  4JLG A;  2XI9 A;  3TSW A;  4IKF A;  3ZL7 C;  1TOV A;  2OJ2 A;  1VYU A;  5CAI A;  1SSH A;  4M77 E;  1VQ8 Q;  3S3O A;  1EZZ B;  2EVR A;  4RTX A;  4E7K A;  2EYZ A;  2DYB A;  2X4W A;  5GMK e;  3CCE Q;  1TUG B;  1KJW A;  3EGU A;  2PVO B;  4DBF A;  1NYG A;  2MYS A;  4LNP A;  1K8A C;  4Z02 A;  1XQH A;  3UA7 A;  4E7I A;  4M78 C;  1MNE A;  1BBZ A;  4PJJ A;  2DJZ A;  2BZY A;  2AHJ B;  2K9G A;  3A1P A;  3QDF A;  2EQK A;  1YJ9 Q;  5D7U A;  3INZ A;  2MMP A;  2RO0 A;  2RI5 A;  4LUD A;  3JCM X;  1MHN A;  3MHX A;  1HD3 A;  1VUB A;  2CZ7 B;  3BW1 A;  5FLX E;  2JOY A;  5KYY A;  4JDS A;  3X28 B;  4F7U F;  1WLP B;  4AG1 C;  2EYX A;  3SWN C;  1RI0 A;  3CC4 A;  1RL2 A;  4X9D A;  1UHC A;  3I55 A;  3CCJ A;  2QA4 T;  2QGF B;  3MP1 A;  3CCS Q;  1SHF A;  4HCZ A;  2JVV A;  4AMC A;  1VQO Q;  3KUF A;  2EQU A;  2RM4 A;  2HKQ B;  2MPX C;  4CI0 C;  3I56 Q;  2YRV A;  4M7D B;  3NTI A;  2VC8 A;  2P0K A;  5LJ3 h;  1OOT A;  1QCN A;  3N5B B;  2DK3 A;  2DVE A;  2PUO B;  4PJO E;  2QQB A;  1K8A U;  1MV3 A;  2KYB A;  1BB9 A;  1ZA1 B;  2P4T A;  1SRM A;  1H64 1;  2ROT A;  2BZ8 A;  4E7J A;  3MEU A;  2VB6 A;  3VS2 A;  4HCK A;  2AKL A;  3OQ5 A;  4CRI A;  4Z88 A;  5GAN j;  2KBT A;  4IUT A;  2OTL A;  2V8I A;  5GAN g;  1GCQ C;  1WJQ A;  3PGG A;  4M77 B;  3QZ5 B;  4F14 A;  5CQX A;  2L3S A;  2PU9 B;  2QGG A;  5GMK l;  4YTL A;  4ORZ A;  3L1A A;  5CK9 A;  2K5L A;  4XQ3 A;  3P8H A;  4XU0 A;  4EIK A;  2QG9 B;  4AFZ C;  2Z0W A;  2RH2 A;  2GF7 A;  1Q7Y C;  3RER A;  1WI7 A;  2RNA A;  3RR6 A;  2KGT A;  1BU1 A;  1T3S A;  2GQV A;  3QDR B;  2K2V A;  3JRZ A;  1GCP A;  1ZLM A;  5GAN 6;  1W1F A;  5GAN f;  1VQ5 Q;  5GAN 2;  2IIM A;  2KVQ G;  5GAN 5;  2M02 A;  3V8K A;  4FIB A;  2K57 A;  1LPL A;  1FYN A;  3TSZ A;  1KHI A;  1LNX A;  2CS7 A;  1CKA A;  3OYC A;  1G8X A;  2EQJ A;  1I5L A;  4UC4 A;  2FPF A;  3CCQ Q;  5A0L A;  3CBP A;  1N8R R;  3JCM g;  2JT4 A;  3O8V A;  1M2V A;  1B34 B;  2SRC A;  4PJO B;  3QO3 A;  2ZPF B;  1QCF A;  3D7S B;  4FYW B;  1VQL T;  1I1J A;  1R8O B;  5DLQ E;  3WXM B;  3OYY A;  3JB9 D;  3MCA B;  1Q7Y U;  2K79 A;  1G83 A;  1X6B A;  1IRX A;  3QYH B;  2DYI A;  1QVF S;  4FM4 B;  3H0I A;  2NUT A;  3CCM T;  4JJB A;  4KT0 E;  1VQ4 Q;  5FW9 A;  4PL6 A;  4C92 B;  1K0S A;  3MP6 A;  3QII A;  3M56 A;  3JCM f;  4MZP A;  1C1A A;  1M90 R;  5IHN A;  3EAE A;  4E7H A;  1OPL A;  2XD0 A;  1KHC A;  2KEA A;  2DL7 A;  3ZFJ A;  1M5Q 1;  4ELY C;  4DOV A;  2F1L A;  3M9Q A;  1Q86 C;  2PVG B;  2DZ9 A;  2MWP A;  4MML A;  4D8K A;  4XTV A;  1PWT A;  5KYX A;  2KRO A;  1AVZ C;  4CC7 A;  5KE3 A;  2V8J A;  2K2M A;  2C0I A;  3CME Q;  3LX7 A;  1BK2 A;  1NJI C;  3EFS A;  1YCS B;  2LMJ A;  1YJW T;  3M0T A;  2DL8 A;  2E4H A;  2AT1 B;  2EGE A;  1KK7 A;  3QZ9 B;  5D6X A;  2X35 A;  3J80 E;  3M59 A;  2D8H A;  2QK0 A;  5GAN e;  2W0Z A;  5LJ3 j;  3M4Y A;  4ZGJ B;  4FT4 A;  2CT3 A;  5LJ3 g;  1NEB A;  1PD1 A;  1VQL A;  5C0M A;  2EKH A;  1PRM C;  4O6J A;  1K1Z A;  2RK1 A;  2A37 A;  3NFC A;  2YUQ A;  3A8O B;  2OI3 A;  5GAN 8;  1VQ9 T;  3ASK A;  3GOX A;  1I8F A;  4EMK A;  1Q86 U;  1GBQ A;  2KK4 A;  2VXF A;  3CCM A;  4BY6 C;  2XDD A;  3GF5 A;  4PJL A;  3CCR Q;  1XJW B;  2M9U A;  4J6X A;  5GAO n;  1KG1 A;  1K0X A;  1ZUY A;  4PFZ A;  1NJI U;  2LC4 A;  2EKO A;  2DPP B;  3OW2 A;  4M7A B;  3MEV A;  4X1V A;  4C8Q G;  4IUV A;  2HSE B;  3M58 A;  1SRL A;  1NEG A;  4LD6 A;  2QEX T;  5LJ3 f;  3DB4 A;  4B9W A;  4E7Z A;  1KQS A;  5AT1 B;  1QVF P;  2PTK A;  2RJF A;  1VQ6 Q;  4HA8 A;  4M78 E;  1NBE B;  2M0Y A;  2EQI A;  1IO6 A;  4NL2 A;  4F04 B;  3LW5 E;  5KCH A;  4J6Y A;  3JCM e;  2CYZ B;  5FU7 C;  1UGS B;  1YN8 A;  1UB4 A;  5A0G A;  3KBG A;  1K76 A;  5IN1 A;  4PNO A;  2DIG A;  1FXX A;  2L0A A;  2KYM A;  2OX7 A;  4JRI A;  1AHJ B;  2COZ A;  5HK3 A;  1SHG A;  5CKF A;  2OTJ T;  2RI3 A;  2KT1 A;  3LWH A;  2JTE A;  2YLB A;  3AT1 B;  4M77 C;  2C0T A;  2ENM A;  1VQ9 A;  8ATC B;  1Q81 C;  3NTH A;  4DBQ A;  2SEM A;  3OYN A;  3CCL Q;  3CC7 T;  4FYX B;  3OS0 A;  1JQQ A;  4PJN A;  3M54 A;  1XNI A;  2JS0 A;  2DD4 A;  4JRP A;  1QVG S;  4DEX A;  2MOX A;  1JEG A;  2QEX A;  4RTZ A;  2GTO A;  3VU3 C;  4X9C A;  2AIR B;  3ZEH A;  1D3B B;  3G6E Q;  1VQ7 T;  4N0A A;  2WSE E;  5FWC A;  2EJF A;  1C6V X;  4F16 A;  4QVC A;  2M51 A;  1WHG A;  1KFZ A;  4M78 B;  2XHC A;  1K73 C;  3ULR B;  3ME9 A;  2ZAE A;  2KR3 A;  5LJ3 e;  1N9S A;  2EJG A;  2D9T A;  2RF0 A;  4M7D A;  1Q81 U;  1B3Q A;  1DJ7 B;  4PJO C;  1ABO A;  3EFO B;  3QG1 A;  3CD6 Q;  4L6V 5;  1Y7X A;  4JJD A;  4HT9 A;  5L8R E;  5C6S A;  2DXB A;  3OB9 A;  3OYB A;  2OTJ A;  4E7L A;  2EPD A;  4FSX A;  3SWN B;  3RNJ A;  1PRL C;  3OS2 A;  5ECA A;  4RG2 A;  2EYY A;  3G4S Q;  1MV0 B;  2HEQ A;  1SEM A;  5A2Q E;  3PVL A;  2VVK A;  1F1B B;  3CC7 A;  2D6F A;  1BCM A;  4XAX B;  1ZQ1 A;  2OAW A;  1I81 A;  4PK4 A;  1WHK A;  2KT8 A;  5CKB A;  4C0Z A;  4JLI A;  3SEM A;  2ZPB B;  4DEY A;  4R0K A;  1K73 U;  1R0B G;  5D6W A;  1NYF A;  1YWO A;  4M75 G;  1YJN T;  3LYI A;  1D0Z A;  2CSI A;  1VQ7 A;  3X24 B;  2EAY A;  3HL8 A;  1G3S A;  4OMP A;  4C8Q F;  1AWX A;  2DBK A;  5GAO q;  3CMA Q;  1QVG P;  3M5A A;  2AKK A;  2CP3 A;  4F7U G;  2NUZ A;  3L2U A;  3PFS A;  3CC2 T;  1GXI E;  2HSP A;  2ZPG B;  1WHL A;  2JW4 A;  2EYW A;  4IIM A;  1M3C A;  4N4H A;  1JO8 A;  5KH6 A;  4A54 A;  2QDL A;  1B34 A;  3RUX A;  4BE0 A;  2RK2 A;  1O9S A;  2GNC A;  1U06 A;  3EHQ A;  2JTM A;  4E47 A;  4J9E A;  4JRQ A;  2PNI A;  2G6F X;  2XIC A;  4ZTJ A;  3V8L A;  4Y91 A;  1WPY A;  3I55 Q;  1OEB A;  3VKI A;  1V29 B;  1IHW A;  2COY A;  3M0R A;  4QW2 A;  3H0F A;  1IB8 A;  1BI1 A;  4C92 A;  3QPH A;  4C8Q D;  5GJW B;  4J5Y A;  1YJN A;  1M3A A;  1MGQ A;  1WXT A;  2P0P A;  5HK0 A;  1X27 A;  4OGE A;  4DBH A;  2GTJ A;  2QAZ A;  1EIF A;  2K3B A;  2LJ3 A;  3TVT A;  5I11 A;  3S3M A;  2JNG A;  1X43 A;  5CQY A;  5LL6 S;  8AT1 B;  2OTL Q;  3CC2 A;  2E5Q A;  3S6W A;  1K4U S;  3RMS A;  3EH2 A;  1Y57 A;  3NPF A;  1QP2 A;  2X4Y A;  4F17 A;  2LJ1 A;  3E1S A;  2AK5 A;  1S72 T;  4C0F A;  2JXB A;  4OB0 B;  3RKY A;  2DIQ A;  1PCX A;  2E70 A;  2ZPH B;  3PE0 A;  3PTA A;  1W70 A;  1X01 A;  4A53 A;  1X2Q A;  2DXC A;  3E2U A;  2O4X A;  2ROL A;  3WVE B;  5M9O A;  2R5A A;  3QWY A;  4CC4 B;  1T0J A;  1ABQ A;  3KFV A;  5CIU A;  4M7A A;  1ZHI A;  4ZGD B;  1GL5 A;  2LX7 A;  3GLX A;  2MAM A;  3OYF A;  1WJR A;  2JUF A;  1ZBX A;  3G71 T;  3P8D A;  3TCJ A;  3OYH A;  1W2B A;  4B9X A;  3VUZ A;  3QJ6 A;  4C8Q E;  4RCC A;  4IUU A;  2O31 A;  3FLG A;  1G2B A;  3MO8 A;  4M75 F;  2QXF A;  1VQP T;  3RIR A;  1QCO A;  4DQ2 A;  5HY6 A;  4BY6 B;  2K7A A;  1K9A A;  3CXC A;  1RI9 A;  4A4K A;  4OB2 B;  5IHI A;  2F2V A;  1UGQ B;  1OI1 A;  2CSQ A;  4KGV B;  5I2S A;  2RQU A;  1IZ6 A;  4J9D A;  2E6N A;  5GAO p;  1VQN A;  2WAC A;  2Y4Y A;  4IIO A;  3BDU A;  3QJY A;  3OYE A;  4C5E A;  1S72 A;  3MEW A;  3EG0 A;  5DM7 R;  3CBM A;  5L23 A;  1YNZ A;  1HJD A;  1SG5 A;  2KQW A;  4J9G A;  4KBM B;  2E10 A;  2CGH A;  4DOW A;  1M1K R;  5FU7 B;  1Q82 C;  3L2W A;  4HXJ A;  4RG8 A;  1FWZ A;  5EG2 A;  2JTF A;  5KYW B;  2HL3 A;  4V2S A;  1KQ2 A;  4WCI A;  4IUR A;  1WZO A;  1R77 A;  1WHH A;  3PIP A;  1VYT A;  3G71 A;  4M75 D;  1VQ8 T;  3VS5 A;  3HSB A;  2DVJ A;  4RTV A;  5GAN 7;  1NG2 A;  1UE9 A;  1ZSZ C;  3CCE T;  2VAS A;  1UTI A;  2L2P A;  1IGU A;  2P84 A;  2DL4 A;  2X4X A;  3HP9 A;  3UAT A;  4RCB A;  4NL3 A;  2K4Y A;  1VQP A;  2KRM A;  4C8Q B;  1GBR A;  1YJ9 T;  2QAS A;  3RKX A;  4M78 A;  2JMC A;  3JB9 I;  3G7Z A;  1JXM A;  2GBQ A;  1H8K A;  1WJS A;  3CEY A;  3H9N A;  1RAA B;  2RHZ A;  2IVW A;  1G3T A;  1Q82 U;  2QA4 A;  3R6O A;  2FPD A;  5GAM h;  2GCX A;  3CCV Q;  2MK5 A;  1FMW A;  3CCS T;  2L3P A;  1VQO T;  2DNU A;  3SWN A;  4QT7 A;  3E19 A;  1R0C B;  4Z8A A;  3OA6 A;  2ESW A;  1TH7 A;  3I56 T;  2HNI A;  2M0O A;  4AG2 C;  4E2F B;  4X34 A;  2RHY A;  3UF4 A;  1VQM Q;  1K9M R;  2DIL A;  1BKB A;  1KC8 R;  1UGR B;  2CT4 A;  1HK9 A;  2VYT A;  1UJ0 A;  1YWP A;  2O9V A;  1UHF A;  1TSF A;  4OB1 B;  5IXB A;  2AZS A;  2YUP A;  4IUP A;  4LDY A;  1YI2 T;  1VYV A;  3OSS C;  2JN0 A;  1VQ8 A;  1JB0 E;  1OU9 A;  3CCE A;  2DTI A;  2H8H A;  2LDM A;  4ZGE B;  1KSW A;  1PKT A;  4OML A;  2HCK A;  3AHU A;  3TRE A;  2V1Q A;  1GCQ A;  1YJ9 A;  2X9H A;  2EIF A;  5GAO l;  4GBQ A;  4KUI A;  1X6O A;  1BYM A;  3C12 A;  4KRT A;  2F2X A;  4A4F A;  1H92 A;  2RHX A;  2DKG A;  4F7U E;  1QW1 A;  1QKW A;  1M8V A;  3QWX X;  5LJ5 h;  4D6W A;  2A08 A;  1M27 C;  3CCS A;  3SHW A;  3CPF A;  1VQ5 T;  4BAC A;  2ZPI B;  1VQO A;  3VYG A;  1UUE A;  1P92 A;  3OW2 S;  3I56 A;  1TWB A;  2BZX A;  2FRY A;  2FZC B;  3HFO A;  2BE9 B;  2K6D A;  3GIB A;  2YDL A;  1IRE B;  2DZC A;  1OZ2 A;  3EG2 A;  1KQS S;  2YT6 A;  3CCQ T;  2VV5 A;  1NLP C;  2D0N A;  4GY5 A;  3OSV A;  1QP3 A;  2LCL A;  5HCK A;  3ZBD A;  3UWN A;  1KD1 R;  1YI2 A;  1MMD A;  4M7D G;  5GAN d;  3LGF A;  4JS5 A;  4NOY A;  4BI4 A;  2K5I A;  1JBM A;  1WDX A;  1Y07 A;  4C0G A;  4ZN3 A;  1A0N B;  1QMC A;  1GRI A;  3UPU A;  1AWW A;  1RLQ C;  1YIT Q;  5CKD A;  3P8B B;  2KRS A;  1VQ4 T;  3CPW A;  2A28 A;  2P4R A;  2KXC A;  4MMK A;  4FYY B;  2FHD A;  2DA9 A;  2L3R A;  3E9F A;  1EFN A;  3C0C A;  2QYZ A;  3OBW A;  1X2K A;  2CRE A;  3DKM A;  1VIE A;  4F7U B;  2C0O A;  5GAM j;  4J7F A;  1YJW A;  3CME T;  2YXY A;  5GAM g;  3M0S A;  5CKE A;  4GLK A;  1QLY A;  3EGX A;  1D1A A;  2EW3 A;  1QKX A;  1AOJ A;  3MET A;  4RMO A;  3JCM d;  2COW A;  2O2O A;  3CCQ A;  2ED1 A;  3A5Z B;  2LQN A;  2O88 A;  3OYD A;  3VV0 A;  3L42 A;  3EFR A;  3EG1 A;  2E1H A;  3VS6 A;  1N8R C;  3OW2 P;  2DM1 A;  3CPW P;  4L59 A;  1KC8 C;  1TUC A;  3EHR A;  1UEB A;  2G3R A;  4MDX A;  2NLU A;  3JCM P;  1JJ2 A;  1KQS P;  4PFO A;  1RAE B;  1Z9Q A;  4C8Q C;  2CP6 A;  2RQW A;  5GAM f;  2FG0 A;  4PJM A;  3EG9 B;  4OVA A;  1T3L A;  1WGS A;  3HRS A;  4AFS C;  3CCR T;  1VQ4 A;  5I21 A;  1FMK A;  3FDR A;  3EGD B;  4BI8 B;  3OY9 A;  4C0D C;  2K3Y A;  1J3T A;  4MZT A;  3RMQ A;  1PC0 A;  1S1N A;  4HVW A;  2F69 A;  2E3H A;  1TXQ A;  2HBP A;  4BDY A;  2FZG B;  2ED0 A;  4C5I A;  2HD0 A;  1M90 C;  1SF9 A;  2E12 A;  1VQ6 T;  4C92 G;  2DRK A;  2DX1 A;  1NPP A;  5LJ5 j;  3CME A;  2XDP A;  1N8R U;  3CBO A;  1QWE A;  3RDV A;  5LJ5 g;  3M53 A;  2VUB A;  4PLL A;  4HT8 A;  1TG0 A;  4ZNX A;  1IXD A;  3OYK A;  1D1C A;  3OMC A;  5GMK i;  2LQ8 A;  3CCU Q;  4LD9 K;  5LJ3 d;  1ZX6 A;  5KYW A;  1VQK Q;  4XTU A;  1U1S A;  1D09 B;  1M9S A;  2PZ1 A;  4AFQ C;  5FRM A;  2W10 A;  1OPK A;  3I35 A;  2ZZD A;  2L5Q A;  3A8L B;  1UJY A;  1NLO C;  4BE1 A;  3VJP A;  3CQT A;  2FL7 A;  4M77 A;  3CCL T;  4M7D F;  5LJ5 f;  2LCS A;  1M90 U;  9ATC B;  2B86 A;  3CCR A;  4A4G A;  1YP5 A;  2J6K A;  1YHQ Q;  4JZ3 A;  2CUD A;  1NZ9 A;  3OYA A;  1SSF A;  4JZ4 A;  1M1K C;  5GAM e;  2XG8 D;  1AT1 B;  3G6E T;  1W6X A;  1VQ6 A;  2RHU A;  4FYV B;  4BD3 A;  2E6Z A;  1WQ7 A;  2JM8 A;  2EYQ A;  3UT1 A;  1K8A R;  1I07 A;  3FRN A;  1ZSZ B;  1LOJ A;  4M7A G;  3S3N A;  3NHN A;  1IGQ A;  3X20 B;  2DXT A;  2A36 A;  1N27 A;  3GPL A;  3MJX A;  1WXU A;  3IQL A;  4A63 B;  1TS9 A;  4OF1 A;  5GMK j;  1YIJ T;  3CD6 T;  4OMQ A;  4ESR A;  2CZ6 B;  3FC3 A;  4NS5 A;  4PJO A;  3M0Q A;  2MI6 A;  3I9Q A;  2I0N A;  5FRO A;  4K11 A;  4M7D D;  2H3J A;  1M8M A;  4JPB W;  2NUP B;  1AD5 A;  3G4S T;  2ECZ A;  3CC4 Q;  3REB B;  2F5K A;  3CCJ Q;  1VQN Q;  1M1K U;  2CZ0 B;  3VS7 A;  3CCL A;  2NWM A;  3QSU A;  2ZGW A;  4JJN K;  2LX9 A;  1RAC B;  4JJC A;  4M75 C;  2DXU A;  2RMO A;  5GAO m;  2WSF E;  3JCM b;  2FEI A;  4JUV A;  3OBY A;  1HSQ A;  5KYU B;  5IT9 E;  2L8D A;  1BCO A;  4XTZ A;  4ZN1 A;  2L89 A;  4PJO F;  2HQH A;  4II1 A;  4RUG A;  5LJ5 e;  1E6H A;  3G6E A;  4J9B A;  2QI2 A;  3MPU B;  2ZCF B;  4QVD A;  3VS4 A;  3CMA T;  2BUD A;  5KE2 A;  4QQD A;  1IHV A;  2LCC A;  3U23 A;  4LE9 A;  1UGP B;  2HDA A;  4C92 F;  1M1G A;  3URG A;  1ZSG A;  3V7S A;  1WHM A;  1BI0 A;  1YBY A;  1Q7Y R;  1YFN A;  1YIJ A;  1W2B S;  3DB3 A;  3CD6 A;  1OYX A;  1WYX A;  3OYI A;  2DL5 A;  5IH2 A;  1PSE A;  1TUD A;  1ZA2 B;  2CUB A;  1OX9 A;  3QHS A;  1JXO A;  3OMG A;  3QKJ A;  2CP2 A;  1G3W A;  2OAU A;  3G4S A;  3CXC S;  1MND A;  4XU2 A;  2QA4 Q;  3MKD A;  1ACM B;  2JM9 A;  5GJV B;  3I55 T;  3FB9 A;  4M7D E;  2A3L A;  4E7S A;  2FO0 A;  2PVD B;  2R5M A;  5CCA A;  4EMH A;  2GFU A;  1PKS A;  2XK0 A;  4P5N A;  1LVK A;  4RTT A;  1ZBJ A;  4FW1 A;  1RLP C;  2E41 A;  2O9S A;  3PMT A;  2PQW A;  1U3O A;  2RHI A;  3G1J A;  4BI3 A;  4J7I A;  2DO3 A;  3CMA A;  4C92 D;  4OMO A;  4OMF B;  3PNW C;  3RBB B;  2ATC B;  4F7U A;  1OU8 A;  3WVD B;  2C06 A;  2L3Q A;  2OTL T;  1M4Z A;  2KE9 A;  2RI2 A;  3LH0 A;  5IAY A;  1AEY A;  3TEE A;  4KH0 B;  3VYH B;  4M7A F;  4XTY A;  2O01 E;  2EGC A;  3FJ5 A;  5D6Y A;  3BDL A;  1I0C A;  1PD0 A;  2RQV A;  2FPE A;  1MUZ A;  1Q86 R;  3HRT A;  3JV3 A;  2DET A;  2VKN A;  1BIB A;  2KSS A;  4JRK A;  3A8G B;  7AT1 B;  2J6O A;  1X69 A;  3LLR A;  1NJI R;  1W2B P;  2D1X A;  1ZUU A;  2R57 A;  2JZ2 A;  3JCM J;  3EG9 A;  1N9R A;  4A4E A;  3E9G A;  4O5V A;  3EGD A;  2LQK A;  4MDW A;  3CXC P;  5HKC A;  1N6A A;  3DLL A;  4B6M A;  4LDV A;  2KDS A;  1D3B A;  4BE2 A;  1GFD A;  3HHT B;  1VQL Q;  1PNJ A;  4FU6 A;  1YI2 Q;  3DLM A;  3M55 A;  1KQ1 A;  3A8H B;  4M7A D;  2KY9 A;  2HZY A;  4LN2 A;  4FL6 A;  2HQE A;  3CCM Q;  2LNV A;  1Y71 A;  3V7R A;  4C92 E;  4QKU A;  3EFO A;  4C0D B;  3JB9 F;  3C94 A;  1NM7 A;  4XK8 E;  2NYS A;  3OS1 A;  1QVP A;  2FZK B;  4XU1 A;  1C0M A;  2YHT A;  1SKU B;  4FCY A;  3JAM E;  5EC7 A;  2DTH A;  1Y96 B;  4C5H A;  1Z9Z A;  1T0H A;  2KNB B;  3JCM Q;  3OYL A;  2CH4 W;  1OUL A;  4MZM A;  4N4I A;  2YSQ A;  1FX7 A;  3GBQ A;  3HKS A;  2J05 A;  4OP0 A;  2BKD N;  4M78 F;  3OYG A;  3F70 A;  3FEO A;  4EPC A;  5FU6 C;  3OS5 A;  2LRQ A;  2VGM A;  2RQR A;  1YJW Q;  4ME7 A;  3H8Z A;  4RTY A;  1BI3 A;  1WNL A;  3L2R A;  5IXF A;  2LJ0 A;  4Y28 E;  3PT9 A;  2MIO A;  3RKW A;  4JS4 A;  5FRN A;  1UGV A;  3BY7 A;  3UA6 A;  3OYM A;  3PIO A;  2DF6 A;  4PKC C;  4VUB A;  1AWO A;  1Q81 R;  1Y0M A;  1CSK A;  4OMM A;  4EMK C;  4M75 E;  2K3X A;  2E65 A;  4WF2 A;  1ZSZ A;  1VQ9 Q;  1U5S A;  4XTX A;  5FWB A;  1WIE A;  2QTX A;  3NMZ C;  5I2M A;  2BTT A;  1LCK A;  2ZPE B;  1CKB A;  1U8R A;  2M1H A;  2F2W A;  1TU0 B;  4CC2 A;  2CP5 A;  4LDX A;  1NE8 A;  2EQM A;  4M7A E;  2CH4 A;  3J81 E;  5DLO A;  4BUG A;  2D0Q B;  1N5Z A;  4BDZ A;  2EJ9 A;  2R58 A;  2RJE A;  3JCM c;  4KGZ B;  5J3B A;  3CCV T;  4M78 D;  2QEX Q;  1H3H A;  2K5F A;  3EH1 A;  1G3Y A;  4J83 A;  3VS1 A;  3FIF A;  4ANJ A;  3CPW S;  2NUP A;  2GQI A;  2IPO B;  2QQR A;  1K73 R;  2YLC A;  1RAH B;  5I22 A;  2X4J A;  2X3W D;  3L2Q A;  1VQM T;  2Y4X A;  1RAF B;  3JCM W;  4GLM A;  2HAX A;  5DY9 A;  1V1C A;  2QQS A;  3ER0 A;  3HFN A;  1UDL A;  4PFP A;  4KGX B;  1ARK A;  3QXE B;  3M4G A;  1PSF A;  2F5T X;  6AT1 B;  1M1F A;  1WXB A;  4D8D A;  5KCO A;  4XTW A;  5KYU A;  1QVF A;  2OTJ Q;  5GAO r;  5CO7 A;  2DE0 X;  2XMF A;  2HMA A;  1I5O B;  2CP7 A;  2RQT A;  4M75 B;  3CC7 Q;  2A7Y A;  3H41 A;  1VOM A;  1RUW A;  3QYG B;  4M77 G;  3HRU A;  3TQ7 P;  2O4X B;  1D0X A;  4LUE A;  1SPK A;  1JJ2 S;  4ATO A;  1JU5 C;  1VQ5 A;  1MMN A;  4N0A C;  3CCV A;  4ZTF A;  3GP8 A;  1E6G A;  2EGA A;  3VRY A;  2YUO A;  2DEU A;  1VQ7 Q;  4ELZ C;  2E5K A;  1ZUK A;  5GMK h;  1M2O A;  2XID A;  3SD4 A;  2P0Q A;  3SFM A;  2HL5 C;  1VQM A;  4OB3 B;  3M0U A;  4M7D C;  2LZ6 B;  1X75 C;  4RTW A;  2E64 A;  4J9C A;  2WSC E;  3GNG A;  3PMI A;  3VS0 A;  3LH5 A;  2QQ9 A;  1D1B A;  1K9M C;  1RAI B;  2YRD A;  3MP8 A;  2MF2 A;  5KYY B;  2AZV A;  2DD5 A;  5GAN 3;  1RAG B;  3I5S A;  2X51 A;  1HXD A;  3THK A;  4PJO G;  1LJO A;  2LP5 A;  4KUD K;  4QQG A;  1YIT T;  2D8J A;  2J06 A;  3KXT A;  1M3B A;  2V8K A;  3T9N A;  3BE3 A;  2PUK B;  1UFF A;  4TVR A;  2DBM A;  1E7O A;  1PG5 B;  1OX8 A;  3HTR A;  2X3X D;  1X6G A;  2KI7 A;  1TTH B;  2FYK A;  2YWW A;  5KYN A;  2LT4 A;  3L2Z A;  1QQJ A;  1YJN Q;  3EG3 A;  1Q95 G;  1UG1 A;  1K9M U;  2VXE A;  1KC8 U;  2DTO A;  3HPW A;  2LNH B;  3R6N A;  2BE7 D;  3RES A;  1V76 A;  2Y90 A;  1M30 A;  2HKN A;  1U1T A;  2V26 A;  1JJ2 P;  4HVU A;  4E6R A;  2DAQ A;  2DEQ A;  3A8M B;  3X25 B;  3CC2 Q;  1RAD B;  1D0Y A;  4XU3 A;  1XOV A;  4AFU C;  4R56 A;  2J6F A;  1UEC A;  1OV3 A;  1YIJ Q;  3UDC A;  4DBR A;  1KD1 C;  4RKU E;  3I5R A;  1FMV A;  1QVG A;  3JB9 H;  2KAF A;  1W4S A;  2IG0 A;  4Q5W A;  1YIT A;  2HQX A;  4HVV A;  4C5G A;  4C8Q A;  4HKE A;  4QQ6 A;  2J7I A;  5CVI A;  3LWI A;  2B8A A;  3SDZ A;  4KUL A;  2RJD A;  4C92 C;  2RJC A;  2RPN A;  3V7C A;  3TU4 K;  1OQK A;  2EFI A;  3O5Z A;  1M2V B;  5GMK m;  2GGR A;  5A0D A;  1BIA A;  1MMA A;  3BFM A;  4Y92 A;  2RA2 A;  4J6W A;  2JS2 A;  1WFW A;  2YRC A;  2DL3 A;  2H3E B;  4M77 F;  2GFA A;  2KMT A;  4FSS A;  1EX4 A;  2RD1 A;  1Y96 A;  1I4K 1;  4OMN A;  1VIF A;  5GAM d;  1B07 A;  3Q1J A;  4RTU A;  4OGC A;  3LGL A;  5J39 A;  4L5G A;  4QVZ A;  2NUT B;  1KD1 U;  1BI2 A;  4WTO B;  3J7A F;  3JB9 J;  1G5V A;  3M0P A;  3MEA A;  3CCU T;  2QDY B;  2RN8 A;  4AT1 B;  4FT2 A;  2VWF A;  1VQK T;  2KXD A;  1WQW A;  2M16 A;  2XDB A;  2DER A;  2QTV A;  2CDT A;  1KIK A;  2DLP A;  1XTD A;  2BIV A;  5KYX B;  5IHK A;  2CZ1 B;  4HCC A;  2HBW A;  1O75 A;  1S72 Q;  4LXC A;  1Q82 R;  5J26 A;  2LVM A;  3M57 A;  2EWN A;  2JMA A;  1YHQ T;  4J8O A;  3X26 B;  5FU6 B;  2I2L A;  4EMG A;  4J9F A;  5GAN 4;  2LQW A;  3OYJ A;  4M77 D;  4Z89 A;  3PVQ A;  4M7A C;  4FW2 A;  1OZ3 A;  2FVU A;  5GAN h;  3QBY A;  1WA7 A;  1PHT A;  3FJP A;  4R55 A;  4J9H A;  2DRM A;  3G71 Q;  3JB9 G;  5LJ5 d;  4HCB A;  4A4H A;  1PM3 A;  2CKK A;  4EMK B;  1WHJ A;  3JCM V;  1AZE A; 
#chains in the Genus database with same CATH homology
 3H6Z A;  4M7D G;  1YCY A;  4PJO C;  3DLM A;  3M55 A;  4LDW A;  1KQ1 A;  3A8H B;  5GAN d;  3QG1 A;  4M7A D;  3LGF A;  2MWO A;  3V8J A;  2KY9 A;  3CCU A;  4JS5 A;  4L6V 5;  1Y7X A;  4NOY A;  4BI4 A;  4HT9 A;  4FL6 A;  5L8R E;  2K5I A;  1JBM A;  3NTK A;  1VQK A;  5C6S A;  2DXB A;  3OB9 A;  1Y07 A;  3OYB A;  2OTJ A;  4C0G A;  4M78 G;  4ZN3 A;  2LTO A;  2LT1 A;  2HQE A;  2XU8 A;  4E7L A;  2LNV A;  4FSX A;  1Y71 A;  3V7R A;  3SWN B;  4C92 E;  3OS2 A;  3UPU A;  4RG2 A;  4C0D B;  5CKD A;  3JB9 F;  4BB7 A;  3C94 A;  3P8B B;  5CKH A;  4DA4 A;  3JSC A;  1VQ4 T;  5A2Q E;  4XK8 E;  3OS1 A;  3C95 A;  1QVP A;  4XU1 A;  3SB2 A;  3L2V A;  3CPW A;  3CC4 T;  2YHT A;  3CCJ T;  3CC7 A;  2QQA A;  4MMK A;  3JAM E;  1VQN T;  2DTH A;  1Y96 B;  2RB6 A;  4C5H A;  2D6F A;  2FHD A;  4XAX B;  4PJO D;  3E9F A;  2L3R A;  1ZQ1 A;  3JCM Q;  1I81 A;  3OYL A;  3OBW A;  3OYC A;  4MZM A;  4N4I A;  3JCM h;  1FX7 A;  4IUQ A;  1YHQ A;  5CKB A;  2XKO C;  1NPR A;  3HKS A;  3VUB A;  4C0Z A;  4JLI A;  4OP0 A;  2ZPB B;  2FB7 A;  2BKD N;  4M78 F;  3DKM A;  1VIE A;  1K73 U;  4M75 A;  5AYF A;  3OYG A;  3F70 A;  4F7U B;  3FEO A;  5D6W A;  4N4G A;  4EPC A;  4M75 G;  1YJN T;  5GAM j;  3LYI A;  4J7F A;  5FU6 C;  1YJW A;  3OS5 A;  2LRQ A;  1H3Z A;  2VGM A;  3CME T;  1VQ7 A;  3X24 B;  2VGN A;  3QUI A;  4ME7 A;  2EAY A;  4GLK A;  3H8Z A;  4PLI A;  5CKE A;  1BI3 A;  1G3S A;  1WNL A;  3HL8 A;  3GNF B;  4LDU A;  4EDU A;  3L2R A;  4C8Q F;  1JRI A;  5CR2 A;  3C4S A;  4JLG A;  2XI9 A;  4IKF A;  5GAO q;  3MET A;  5CAI A;  4RMO A;  3JCM d;  3M5A A;  4M77 E;  4Y28 E;  3S3O A;  3PT9 A;  3CCQ A;  3RKW A;  4JS4 A;  5FRN A;  3A5Z B;  4F7U G;  4E7K A;  3BY7 A;  2X4W A;  5GMK e;  3L2U A;  3OYM A;  3PFS A;  4PKC C;  3PIO A;  3OYD A;  4VUB A;  3VV0 A;  2PVO B;  3L42 A;  3CC2 T;  3EFR A;  1K8A C;  4Z02 A;  1XQH A;  1GXI E;  2E1H A;  4E7I A;  2ZPG B;  4M78 C;  1N8R C;  4EMK C;  2DJZ A;  4M75 E;  4L59 A;  2AHJ B;  1KC8 C;  2EQK A;  2K3X A;  1UEB A;  4N4H A;  2E65 A;  2G3R A;  4WF2 A;  4M7A G;  4MDX A;  2NLU A;  3INZ A;  5KH6 A;  2MMP A;  3JCM P;  2RO0 A;  4XTX A;  4A54 A;  2RI5 A;  1JJ2 A;  3I55 A;  2QTX A;  5I2M A;  1B34 A;  4C8Q C;  3RUX A;  4BE0 A;  3JCM X;  2RK2 A;  1MHN A;  1O9S A;  3MHX A;  1VUB A;  2ZPE B;  5GAM f;  1U8R A;  2M1H A;  2JTM A;  4E47 A;  2CZ7 B;  4OVA A;  4LDX A;  3BW1 A;  1NE8 A;  2EQM A;  1WGS A;  3HRS A;  5FLX E;  4M7A E;  2JOY A;  3CCR T;  1VQ4 A;  3OW2 A;  4JDS A;  3X28 B;  4F7U F;  3FDR A;  5I21 A;  3J81 E;  4JRQ A;  5DLO A;  3SWN C;  1RI0 A;  4BUG A;  3CC4 A;  1RL2 A;  2D0Q B;  4X9D A;  4BDZ A;  2R58 A;  2RJE A;  2EJ9 A;  4BI8 B;  2XIC A;  2K3Y A;  3JCM c;  3MP1 A;  4MZT A;  4Y91 A;  3V8L A;  1WPY A;  4C0D C;  4ZTJ A;  3RMQ A;  3VKI A;  1V29 B;  4HCZ A;  2JVV A;  5J3B A;  4M78 D;  3CCV T;  2K5F A;  2EQU A;  2F69 A;  3KUF A;  1G3Y A;  4J83 A;  2RM4 A;  4QW2 A;  2HBP A;  3FIF A;  4BDY A;  3CPW S;  4CI0 C;  4C5I A;  2YRV A;  4M7D B;  3NTI A;  2HD0 A;  1M90 C;  1BI1 A;  4C92 A;  2E12 A;  3QPH A;  2VC8 A;  2P0K A;  2QQR A;  5LJ3 h;  4C8Q D;  1VQ6 T;  2YLC A;  4J5Y A;  3N5B B;  4C92 G;  2DK3 A;  2DVE A;  2PUO B;  2X4J A;  4PJO E;  1YJN A;  3L2Q A;  2QQB A;  1NPP A;  2Y4X A;  1VQM T;  1MGQ A;  1K8A U;  5LJ5 j;  3CME A;  2XDP A;  3JCM W;  2P4T A;  1N8R U;  1H64 1;  5DY9 A;  2P0P A;  5HK0 A;  4E7J A;  4OGE A;  3CBO A;  2HAX A;  5LJ5 g;  2QQS A;  3ER0 A;  3HFN A;  3MEU A;  3M53 A;  3QXE B;  3M4G A;  1PSF A;  2VUB A;  2F5T X;  4PLL A;  4HT8 A;  1EIF A;  1M1F A;  3OQ5 A;  5KCO A;  4XTW A;  4CRI A;  3S3M A;  3OYK A;  5GAN j;  1QVF A;  2JNG A;  4IUT A;  5CQY A;  5LL6 S;  3OMC A;  5GMK i;  2LQ8 A;  2OTL A;  4LD9 K;  2V8I A;  5GAN g;  3CC2 A;  5LJ3 d;  1WJQ A;  2E5Q A;  5GAO r;  5CO7 A;  4XTU A;  3PGG A;  4M77 B;  1U1S A;  3QZ5 B;  5CQX A;  3S6W A;  1M9S A;  5FRM A;  2PU9 B;  5GMK l;  3RMS A;  2ZZD A;  2L5Q A;  3A8L B;  4YTL A;  3L1A A;  5CK9 A;  2K5L A;  4BE1 A;  4XQ3 A;  3VJP A;  3P8H A;  1QP2 A;  4M75 B;  2X4Y A;  4XU0 A;  2FL7 A;  2A7Y A;  4M77 A;  3CCL T;  4M7D F;  5LJ5 f;  2RH2 A;  2GF7 A;  1M90 U;  1Q7Y C;  3E1S A;  3QYG B;  4M77 G;  1S72 T;  3HRU A;  4C0F A;  3CCR A;  3RER A;  4OB0 B;  2O4X B;  4A4G A;  2GQV A;  3QDR B;  2K2V A;  1JJ2 S;  3JRZ A;  3RKY A;  2DIQ A;  5GAN 6;  4ATO A;  1VQ5 A;  2E70 A;  4N0A C;  3CCV A;  1NZ9 A;  3OYA A;  2ZPH B;  5GAN f;  5GAN 2;  3PTA A;  1X01 A;  4A53 A;  2KVQ G;  1SSF A;  5GAN 5;  2DXC A;  4ZTF A;  3GP8 A;  3V8K A;  2O4X A;  4FIB A;  3WVE B;  2K57 A;  5M9O A;  1M1K C;  5GAM e;  4ELZ C;  2XG8 D;  1KHI A;  2R5A A;  1LNX A;  3G6E T;  5GMK h;  1VQ6 A;  2XID A;  2CS7 A;  2RHU A;  3SD4 A;  4BD3 A;  2P0Q A;  3SFM A;  5CIU A;  2E6Z A;  1ZHI A;  1WQ7 A;  2EQJ A;  2EYQ A;  4OB3 B;  3UT1 A;  4UC4 A;  4ZGD B;  1VQM A;  3GLX A;  1I5L A;  3FRN A;  4M7D C;  2MAM A;  1LOJ A;  1WJR A;  1X75 C;  3CBP A;  5A0L A;  3OYF A;  2JUF A;  1ZBX A;  3S3N A;  3JCM g;  3G71 T;  3O8V A;  3P8D A;  3TCJ A;  2E64 A;  2WSC E;  3OYH A;  1B34 B;  3GNG A;  3PMI A;  3X20 B;  4B9X A;  2DXT A;  1W2B A;  3VUZ A;  1N27 A;  2QQ9 A;  3GPL A;  4PJO B;  3QJ6 A;  3QO3 A;  4C8Q E;  4RCC A;  1K9M C;  2ZPF B;  4IUU A;  1VQL T;  3FLG A;  3MP8 A;  1R8O B;  3MO8 A;  2MF2 A;  4M75 F;  2QXF A;  5DLQ E;  3WXM B;  3OYY A;  3JB9 D;  4OF1 A;  3MCA B;  1VQP T;  1Q7Y U;  3RIR A;  5GMK j;  4DQ2 A;  1YIJ T;  3CD6 T;  5HY6 A;  4BY6 B;  2DD5 A;  2CZ6 B;  3CXC A;  5GAN 3;  4A4K A;  3QYH B;  4OB2 B;  4NS5 A;  3FC3 A;  4PJO A;  1HXD A;  1UGQ B;  2MI6 A;  1OI1 A;  5FRO A;  1QVF S;  4FM4 B;  4PJO G;  4M7D D;  3CCM T;  2H3J A;  1LJO A;  4KT0 E;  5I2S A;  4KUD K;  4PL6 A;  4QQG A;  1YIT T;  3G4S T;  1IZ6 A;  4C92 B;  3KXT A;  3MP6 A;  2E6N A;  5GAO p;  1VQN A;  3QII A;  2V8K A;  2F5K A;  2WAC A;  2Y4Y A;  3M56 A;  3T9N A;  3BDU A;  1M1K U;  2CZ0 B;  3QJY A;  3JCM f;  3CCL A;  4MZP A;  2PUK B;  3QSU A;  3OYE A;  3LWI A;  3EAE A;  4C5E A;  2ZGW A;  4E7H A;  4TVR A;  3MEW A;  1KHC A;  1S72 A;  4JJN K;  2XD0 A;  5DM7 R;  2LX9 A;  4M75 C;  2DXU A;  3CBM A;  3ZFJ A;  1M5Q 1;  4ELY C;  4DOV A;  3M9Q A;  2WSF E;  5GAO m;  2KQW A;  2PVG B;  2DZ9 A;  2MWP A;  1Q86 C;  4KBM B;  3JCM b;  2E10 A;  2CGH A;  4MML A;  4DOW A;  4JUV A;  3OBY A;  4XTV A;  2FYK A;  5IT9 E;  2LT4 A;  3L2Z A;  5FU7 B;  5KE3 A;  2L8D A;  4XTZ A;  4ZN1 A;  1Q82 C;  2L89 A;  2V8J A;  3L2W A;  4PJO F;  1K9M U;  4RG8 A;  4II1 A;  1FWZ A;  5EG2 A;  2VXE A;  3LX7 A;  2JTF A;  1KC8 U;  1NJI C;  5LJ5 e;  3EFS A;  2DTO A;  3G6E A;  4V2S A;  3HPW A;  1KQ2 A;  2QI2 A;  1YJW T;  4IUR A;  2ZCF B;  3RES A;  2Y90 A;  1U1T A;  3PIP A;  3QZ9 B;  5D6X A;  2X35 A;  4QVD A;  3J80 E;  3M59 A;  2DAQ A;  2BUD A;  3CMA T;  2DEQ A;  5KE2 A;  3G71 A;  3A8M B;  3X25 B;  4M75 D;  1VQ8 T;  4QQD A;  3HSB A;  5GAN e;  5LJ3 j;  5GAN 7;  3M4Y A;  4ZGJ B;  4FT4 A;  3CCE T;  2LCC A;  5LJ3 g;  4XU3 A;  1UGP B;  1VQL A;  4C92 F;  1M1G A;  1XOV A;  3URG A;  5C0M A;  4O6J A;  2X4X A;  3HP9 A;  2RK1 A;  3V7S A;  4R56 A;  5GAM g;  1BI0 A;  4RCB A;  4NL3 A;  2K4Y A;  3NFC A;  1VQP A;  3A8O B;  1YBY A;  1YIJ A;  1W2B S;  5GAN 8;  3DB3 A;  3CD6 A;  1OYX A;  4C8Q B;  1VQ9 T;  1YJ9 T;  3ASK A;  3UDC A;  3RKX A;  1KD1 C;  3GOX A;  1I8F A;  4RKU E;  3OYI A;  4M78 A;  3CCJ A;  4EMK A;  1QVG A;  3JB9 I;  1PSE A;  3G7Z A;  1Q86 U;  3JB9 H;  2KAF A;  2KK4 A;  2VXF A;  1W4S A;  3CCM A;  4BY6 C;  2IG0 A;  2XDD A;  5GAM d;  1WJS A;  3CEY A;  3GF5 A;  3QHS A;  4Q5W A;  3OMG A;  2RHZ A;  3QKJ A;  1G3W A;  2IVW A;  2M9U A;  2OAU A;  1G3T A;  2HQX A;  4J6X A;  3CXC S;  3G4S A;  1YIT A;  5GAO n;  4C5G A;  3R6O A;  2QA4 A;  1Q82 U;  1KG1 A;  4XU2 A;  4C8Q A;  5GAM h;  1NJI U;  2LC4 A;  2EKO A;  2DPP B;  4HKE A;  4QQ6 A;  3MEV A;  2B8A A;  2GCX A;  4IUV A;  5CVI A;  4M7A B;  3SDZ A;  4C8Q G;  4KUL A;  3M58 A;  3I55 T;  2RJD A;  4C92 C;  2RJC A;  3FB9 A;  3CCS T;  3V7C A;  4M7D E;  4LD6 A;  2A3L A;  2QEX T;  3TU4 K;  5LJ3 f;  1VQO T;  2EFI A;  3SWN A;  2PVD B;  2R5M A;  3DB4 A;  4B9W A;  5GMK m;  3E19 A;  1KQS A;  5CCA A;  3OY9 A;  5A0D A;  3OA6 A;  4EMH A;  1BIA A;  2GFU A;  3BFM A;  2XK0 A;  2RA2 A;  1TH7 A;  2RJF A;  4J6W A;  3I56 T;  2HNI A;  4HA8 A;  2M0O A;  4M78 E;  4P5N A;  4X34 A;  2RHY A;  4M77 F;  2E41 A;  2GFA A;  2KMT A;  2RD1 A;  4NL2 A;  1Y96 A;  3PMT A;  1I4K 1;  2PQW A;  1VIF A;  3LW5 E;  4J6Y A;  2RHI A;  1BKB A;  5KCH A;  3JCM e;  4BI3 A;  1UGR B;  2CYZ B;  1UGS B;  3Q1J A;  5FU7 C;  1HK9 A;  1UB4 A;  2VYT A;  4J7I A;  4OGC A;  5A0G A;  3KBG A;  2DO3 A;  3LGL A;  4OB1 B;  5J39 A;  5IN1 A;  4L5G A;  4QVZ A;  4IUP A;  1KD1 U;  3CMA A;  4LDY A;  1BI2 A;  4C92 D;  1YI2 T;  4PNO A;  3J7A F;  3OSS C;  3PNW C;  4OMF B;  2JN0 A;  2DIG A;  1FXX A;  2QA4 T;  3JB9 J;  1VQ8 A;  1G5V A;  4F7U A;  1JB0 E;  3WVD B;  3MEA A;  4JRI A;  1AHJ B;  5HK3 A;  3CCU T;  2C06 A;  3CCE A;  2QDY B;  2OTL T;  1M4Z A;  2DTI A;  5CKF A;  2LDM A;  4ZGE B;  4FT2 A;  2RI2 A;  3LH0 A;  5IAY A;  1VQK T;  2OTJ T;  2RI3 A;  1WQW A;  2M16 A;  2XDB A;  3TEE A;  3AHU A;  3TRE A;  3LWH A;  2YLB A;  3VYH B;  4M77 C;  4M7A F;  4M7A A;  4XTY A;  2O01 E;  1YJ9 A;  1VQ9 A;  1Q81 C;  3NTH A;  5D6Y A;  1XTD A;  2BIV A;  2EIF A;  5GAO l;  3BDL A;  3OYN A;  2CZ1 B;  4KUI A;  1X6O A;  4HCC A;  1BYM A;  3HRT A;  3CC7 T;  3C12 A;  1O75 A;  1BIB A;  2KSS A;  4JRK A;  3OS0 A;  3A8G B;  3M54 A;  4A4F A;  2RHX A;  2DKG A;  1XNI A;  5J26 A;  2DD4 A;  4F7U E;  4JRP A;  1QW1 A;  2LVM A;  3M57 A;  1M8V A;  1QVG S;  3LLR A;  2EWN A;  5LJ5 h;  1YHQ T;  4J8O A;  4D6W A;  3X26 B;  5FU6 B;  2I2L A;  4EMG A;  5GAN 4;  3CCS A;  2QEX A;  3CPF A;  1VQ5 T;  4BAC A;  2ZPI B;  1VQO A;  3VU3 C;  3OYJ A;  4M77 D;  4X9C A;  2R57 A;  2JZ2 A;  3VYG A;  3ZEH A;  3JCM J;  1D3B B;  4M7A C;  1P92 A;  1N9R A;  3OW2 S;  1VQ7 T;  1OZ3 A;  2FVU A;  2WSE E;  4N0A A;  3HFO A;  5GAN h;  4A4E A;  3QBY A;  3I56 A;  3E9G A;  4O5V A;  2EJF A;  3GIB A;  1IRE B;  3FJP A;  4R55 A;  2LQK A;  4MDW A;  5HKC A;  2DZC A;  1OZ2 A;  1N6A A;  4QVC A;  1KQS S;  3DLL A;  4LDV A;  3JB9 G;  2KDS A;  5LJ5 d;  1D3B A;  4BE2 A;  4HCB A;  3CCQ T;  4A4H A;  2CKK A;  4M78 B;  3HHT B;  2VV5 A;  2XHC A;  1K73 C;  4EMK B;  3ME9 A;  4GY5 A;  3OSV A;  1N9S A;  3JCM V;  1QP3 A;  5LJ3 e;  2LCL A;  2EJG A;  2D9T A;  4M7D A;  3ZBD A;  3UWN A;  1Q81 U;  1YI2 A;  1DJ7 B;  4FU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...