2LCCA

Solution structure of rbbp1 chromobarrel domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
EDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords AT-rich interactive domain-containing protein 4A
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lccA00
2EQMA 2M1HA 3Q1JA 4Q5WA 3OYCA 3UT1A 3E9GA 3MP8A 4HCZA 4CRIA 2IG0A 2MWPA 3OYJA 5D6WA 2MWOA 2RI2A 4PLIA 4QQDA 5CIUA 2E6NA 1OYXA 2DAQA 2X35A 3LX7A 4UC4A 5C6SA 1KHCA 2JZ2A 4RG2A 2RHYA 2K3XA 2BKDN 2RJFA 5J26A 4C5EA 4C5HA 1RI0A 2LVMA 2O4XA 5FRMA 2DIGA 3OMCA 2R58A 3OYFA 5M9OA 4IUQA 4PLLA 2LCCA 4E7KA 3QBYA 2JTFA 2RI3A 3P8HA 3L2WA 3M9QA 3MP1A 4N4GA 2X4XA 5KE3A 2BUDA 2R5MA 3H6ZA 3OS0A 3MP6A 1OZ3A 3PMTA 4IUPA 5KH6A 3OYDA 1WJSA 2XK0A 3E9FA 3O8VA 1N27A 3KUFA 5IAYA 4BE2A 3PNWC 4B9WA 4L59A 3SD4A 2YRVA 3OYIA 4ZTFA 2PQWA 2QQRA 2LDMA 2HQXA 3ZEHA 2M0OA 2O4XB 3MEVA 2D9TA 5KCOA 3PMIA 2R5AA 3OYKA 2M16A 3OYLA 3FC3A 3L2QA 1OZ2A 3MEUA 3C4SA 3OYAA 4QQGA 4IKFA 3EAEA 2L3RA 3S3NA 2B8AA 2E5QA 3FDRA 3NTIA 3PFSA 4C5IA 3DB4A 3LH0A 3OS2A 5J39A 1XNIA 5D6YA 2RI5A 4QQ6A 4E7HA 2BIVA 4A4GA 2RHZA 4GY5A 2GFAA 1SSFA 3LGLA 4IUVA 4Z02A 3S6WA 2P0KA 2RHXA 2RJCA 3ME9A 2EKOA 4QVZA 3MO8A 3OY9A 4BE0A 4ZTJA 3S3MA 3NTKA 3DB3A 3H8ZA 3MEAA 5IN1A 4N4IA 3BDLA 4E7JA 4OVAA 2F5KA 2RO0A 3OMGA 3OA6A 5FRNA 4BACA 4IURA 3QIIA 2LRQA 4BD3A 3QKJA 2X4WA 1H3ZA 3NTHA 2GF7A 3FLGA 3FEOA 2EQUA 3META 3P8DA 3QJ6A 4FU6A 4PL6A 4A4EA 2XDPA 3L2RA 3OYEA 3ASKA 4BDYA 2EFIA 2VYTA 1WJRA 3LGFA 2CKKA 2K3YA 1WJQA 2GFUA 4C5GA 1MHNA 3L42A 3F70A 2LTOA 4B9XA 3UWNA 2EQJA 5C0MA 3L2UA 5FROA 5KCHA 2DIQA 4IUUA 3LYIA 3OYBA 2HQEA 2L89A 3GOXA 4X34A 3OYNA 4EDUA 5KE2A 3OYHA 2NLUA 4BE1A 3OQ5A 4E7IA 4IUTA 2RHUA 4LD6A 4BDZA 2FHDA 2QQSA 3LLRA 5D6XA 3S3OA 1G5VA 4A4HA 2EQKA 4NS5A 1WGSA 4QW2A 2G3RA 4FL6A 2RJEA 4A4FA 4N4HA 2WACA 3OYMA 2X4YA 2RHIA 3OB9A 4II1A 3DLMA 3L2VA 3OS1A 3CEYA 3MEWA 3OYGA 2RJDA 2R57A 2L8DA 4E7LA 1OI1A
chains in the Genus database with same CATH superfamily
2JOYA 3A8MB 1M8MA 4FW1A 3QYGB 2BZ8A 4PLIA 1KQSS 5GANh 2FZCB 3OW2P 4MMKA 5C6SA 4BB7A 4JRIA 2RJFA 2L3PA 1Q95G 3I5RA 1B3QA 2OTLT 4XU2A 4XK8E 2K79A 2RI3A 1DJ7B 2JM8A 2R5MA 1WFWA 4PJJA 4E47A 3G4SQ 4OMFB 2EJFA 2LP5A 2YT6A 2QA4T 4BE2A 2PQWA 3EGXA 5I22A 5HKCA 2K5LA 1PSFA 3JB9F 4P5NA 4AFUC 1SRMA 1MNDA 1KQ2A 3JCMg 2YRCA 3V8LA 1VQPA 5D6YA 2YLBA 5L8RE 5DY9A 2K4YA 1QVGA 3QHSA 2RHXA 2O31A 3MKDA 2EYWA 4C92B 3JCMW 1WX6A 4M7DB 2RJCA 4M7DA 3QDRB 1VQ7Q 3QZ5B 5A0GA 5GAN7 1NJIC 2P84A 2CP6A 4B6MA 1VQ7A 2YUPA 4M7AB 2P0PA 4X9DA 3WXMB 2YUQA 1G83A 2X4WA 4FYYB 2EGAA 3CCVQ 1VQMT 3I55T 4VUBA 1FMWA 2KDSA 3ASKA 4OP0A 1UG1A 1ABQA 3PTAA 3QO3A 2E4HA 4C0GA 4Z89A 3CBMA 2HQHA 3M55A 5KYNA 3DLLA 1VQNA 4AFZC 4J5YA 3LYIA 3INZA 4M75A 2LT4A 2AKLA 1U06A 5I2SA 5CQXA 3V8JA 1XQHA 4PJOB 1UDLA 4PJOA 1GCPA 3CC2Q 2EAYA 4N4HA 4JRPA 2X4YA 1NYGA 2YRDA 3RDVA 5GAMg 1UFFA 1I0CA 3CPWS 2E41A 1PG5B 4LDUA 3SWNA 2IG0A 2E1HA 2L3SA 4QQDA 2E6NA 2RF0A 4QT7A 1GRIA 3MHXA 3OS5A 1D0ZA 4IUQA 1BCMA 3L2WA 1MNEA 3RMQA 2KROA 5KE3A 1X2QA 3EG9A 4JLIA 3VYGA 1K0XA 3PT9A 1JJ2S 4FYVB 1JJ2A 2LDMA 3QPHA 2GQIA 2HZYA 2HDAA 3QSUA 2E12A 3OYLA 1YWOA 3J7AF 4ZGJB 1T0HA 3CXCS 5A0DA 2OTJQ 4GLKA 2DBKA 2CUBA 1OV3A 2L3RA 3S3NA 1Y0MA 3FDRA 2RM4A 1O75A 1NM7A 1FYNA 3CD6T 1JB0E 2EGEA 3CPWP 1SSFA 1YIJQ 5EG2A 4N0AC 2D6FA 1JXMA 1YN8A 3C94A 4BI4A 4J9BA 4O5VA 2XMFA 3S3MA 4EMKC 4M77C 2KE9A 5GAN5 2QDLA 2EW3A 1S1NA 2HNIA 3CPWA 2DRKA 3QXEB 2RQRA 5IXBA 3FIFA 4J9DA 2DJZA 2CH4A 5DLQE 3G6ET 3O5ZA 4M78C 4PL6A 2V8IA 2CS7A 5CR2A 1Q82C 1E6HA 2DVEA 2J06A 4PJMA 8ATCB 1QVFP 4BI8B 5GMKh 1VQ5T 4M75F 2LJ1A 5FROA 1M2VB 1M3CA 1RAFB 5LJ3d 1VQ4Q 1I1JA 4M78F 3EH1A 3VKIA 4PJOF 3QYHB 1Y96B 3S3OA 2OAWA 4M77F 1QKXA 3HHTB 2EQKA 1BBZA 4NL3A 5GAN2 2JT4A 2ZPFB 1Q86R 3RKWA 2NUPB 1EIFA 2ZCFB 4C8QB 3L2ZA 2E5KA 1RUWA 2E65A 3MP8A 2QYZA 2VGNA 4RTVA 2K7AA 2RQWA 4AMCA 3CCJQ 3GLXA 3GP8A 4CC3A 2AKKA 3JV3A 3QBYA 4WTOB 1IXDA 2CZ1B 3CCJA 4M7AG 3PMTA 3UDCA 2BZYA 3M54A 2VV5A 4IIMA 3OYIA 4AG2C 4JJDA 2J6FA 4M77D 1JRIA 4J9EA 3CCEA 3LWHA 3CCLQ 1W70A 1FX7A 1JJ2P 4IKFA 2J6OA 4M78D 4ZN1A 1BI3A 2YHTA 1CKAA 3H0HA 1XNIA 2VB6A 1LOJA 3S6WA 3EGXB 1VQ8T 1XTDA 2EYXA 3OSSC 1M27C 2FO0A 1WHLA 4XU3A 5GAMd 3OA6A 2GF7A 2FZKB 3VS7A 1K4US 2JNGA 3PVLA 4N0AA 2I2LA 4ATOA 1EFNA 2PTKA 1GBQA 2EQJA 1VQLA 2CSQA 4PNOA 2XIDA 1JQQA 4ELZC 2FPEA 5KYYB 1WHJA 2QQ9A 1YHQT 3OQ5A 2YXYA 1M3BA 4HA8A 5DLOA 4NOYA 3CBOA 1SG5A 1KK7A 4NS5A 1V29B 3JCMb 3PGGA 2RMOA 3HRTA 4A4KA 2WACA 4II1A 3RKXA 4GBQA 4A53A 1QWFA 4LUDA 3JCMf 4QKUA 2LX9A 1QLYA 2RI2A 3TEEA 2KMTA 3CCSA 2ZAEA 2DK3A 4JLGA 3M4GA 1KD1C 2X9HA 1Q82U 2BKDN 2O4XA 1YNZA 5GANf 2E6ZA 2W0ZA 3I35A 3P8HA 2AT1B 4JZ3A 4J6YA 2ZPBB 5CKEA 1I07A 1M30A 2DEQA 3URGA 4JPBW 2JTMA 4M75E 5I11A 2MK5A 3CC2A 3MEVA 1C6VX 1YJNQ 1MUZA 2VXFA 3QJYA 3X20B 3G71Q 1GL5A 1XOVA 2MYSA 4X1VA 5LJ5f 4LUEA 2QEXT 7AT1B 3NGPA 3EFSA 5KYYA 1YJWA 2M0YA 2RH2A 2RI5A 2VXEA 3DKMA 1YJNA 2AZVA 3FRNA 2K2MA 2ESWA 4F14A 1AVZC 2VVKA 3M0RA 4ZGEB 4BI3A 3QZ9B 3HTRA 2WSFE 1U5SA 2F5KA 3J81E 1PCXA 1Q7YU 4CC7A 2K2VA 3M58A 3EH2A 3I56Q 5IHNA 2O9SA 2CYZB 4BDYA 2ATCB 2M9UA 3N5BB 2VYTA 3M57A 3M0TA 3EGDA 3I56A 1K9MR 2DD5A 1UHCA 1I8FA 3CMAT 1CSKA 1UGSB 3GOXA 4E7IA 1T0JA 3EG1A 1N8RC 2JTEA 2LQKA 5GMKl 2XU8A 4JJCA 2HCKA 1ZSGA 2DYBA 2C0IA 4RTXA 2ZPIB 2CP3A 3RR6A 2HBPA 3JB9H 3UT1A 4DEYA 1TS9A 4FW2A 2PVGB 1W2BS 1TSFA 3LW5E 5GAMe 4TVRA 2JXBA 4RUGA 3OMCA 3ER0A 3KFVA 1H92A 4XTUA 4MZMA 2F1LA 3JCMe 3MCAB 1D1BA 4LXCA 3OYDA 3O8VA 2DMOA 2HSEB 4HVUA 2QQAA 2DL3A 1QVFA 2DL7A 1VQ4T 1U3OA 2X3XD 1RAEB 2F2VA 5HCKA 4RMOA 1M1KR 3CCMT 4JRKA 2CGHA 2DLPA 1TUCA 4DBQA 2PUOB 2ZPHB 2CH4W 2OTLQ 2CP7A 2COWA 1ZA2B 2PUKB 4OB1B 4RG8A 5KYUA 1GFCA 1SRLA 2CT4A 2CT3A 3G4SA 1PRMC 1KFZA 4XTWA 3BY7A 2HAXA 1YCSB 1Q81U 3CCLT 4RTTA 1LVKA 4MDXA 1F1BB 1ACMB 2LRQA 1OOTA 4Z8AA 2DJQA 3LGFA 2J7IA 2JS0A 2EGCA 2KT1A 5EC7A 2EKHA 4QVCA 3LH5A 4ZGDB 5D7UA 2OI3A 3OYYA 2CREA 2P0QA 3CMET 4M7DE 1B7TA 5CKDA 1D1CA 1ZSZB 2QASA 2VGMA 4ESRA 2CZ0B 1W6XA 2NUTB 4C0FA 1K8AR 3HSBA 4DEXA 3L2VA 2F5TX 1AHJB 4HXJA 3VRZA 2KI7A 4E7LA 1OX8A 1NLPC 3UA7A 4MZTA 2CDTA 2E64A 2FZGB 3CC4A 2MWOA 4OMMA 1OYXA 4XQ3A 2PZ1A 2DXUA 5KYUB 3C12A 1MMDA 4CC2A 3CCUA 3AHUA 1HK9A 2LX7A 3HKSA 1WXTA 2LCCA 1IO6A 1RADB 1D0YA 1I81A 1M5Q1 4Y91A 3G7ZA 2YWWA 2QXFA 5HK0A 3H6ZA 2G6FX 5KH6A 1KC8U 2K57A 3H41A 2YRVA 4C92G 3JB9J 2QQRA 1NPPA 2M0OA 4DBRA 3PMIA 2KYMA 2LC4A 1UEBA 2SRCA 1SEMA 3CCRA 2KK4A 2DXCA 3MEUA 4C5IA 3LH0A 3OSVA 3HRUA 4DBHA 1PD0A 3M5AA 3QWYA 2ZPGB 4GLMA 1YI2T 1X75C 2NUTA 1WIEA 4D6WA 4E7SA 2DL5A 4OB3B 1AT1B 4PJNA 4J9FA 3NHNA 3SWNB 1E7OA 4RTZA 1H3ZA 1MV0B 3VUZA 3P8DA 4R0KA 3RMSA 5GAN6 4LDXA 2X4JA 1PKTA 2F2WA 1AOJA 1RACB 5CK9A 4BY6B 3L1AA 4ORZA 2LCSA 2DIQA 5KYXA 2P4TA 1VUBA 4OB2B 2EWNA 1W2BA 2RD1A 4J9GA 2NLUA 4LD6A 2FHDA 3A8OB 3EG9B 3M59A 4J9IA 5LJ3j 1G5VA 4M7AF 1QVGP 1X6GA 5IH2A 4M7DG 4XTVA 2RJEA 1W2BP 3OB9A 1X01A 2QGGA 3GNFB 4JS5A 3V7CA 2IVWA 4C92D 4PFZA 4OMOA 5KYWA 5IHKA 1VQMQ 4XTZA 2LZ6B 3LX7A 2DM1A 2BZXA 1LCKA 4C5EA 1KSWA 1NYFA 2WSCE 1TH7A 3M0QA 2BUDA 2O2OA 3AT1B 2KVQG 2NYSA 1N27A 5FWCA 1FMVA 2Y4YA 2H8HA 4HVWA 2RK1A 5CAIA 4PJOG 1PRLC 5KCOA 4M78E 4M4ZA 1QCNA 5CKBA 1I5OB 2JM9A 1BKBA 5GANg 2LJ0A 3OYAA 2DZ9A 4M77G 4LDVA 2DBMA 2QA4Q 2RHZA 2D0QB 4IUVA 1Z9ZA 4KGZB 2CZ7B 5GAOn 4PFPA 4FYXB 4Y28E 2I0NA 2KRMA 3NTKA 2QEXQ 3RBBB 2NUPA 1YJ9T 3M53A 2J05A 2LNVA 3PIOA 3CD6A 1SHFA 2EBPA 1B07A 3HFOA 3QJ6A 3JCMd 2KY9A 4M78B 1QP3A 3QDFA 4FM4B 1VYTA 1WJQA 2QGFB 1MHNA 1UE9A 1G2BA 3UWNA 4C92C 4EIKA 2Y90A 1YITT 1QKWA 1VQOT 5LJ5e 4X34A 4JRQA 2QDYB 3VJPA 2OTJT 1LJOA 3G71A 4C0DC 1U1SA 1VQ5A 2HSPA 2KXDA 1WA7A 2HKNA 3PVQA 3Q1JA 2VWFA 2YLCA 1M90U 3GIBA 2DTOA 2LMJA 1YBYA 1KD1U 1S72Q 4LNPA 1YIJA 4HCCA 5J26A 4C5HA 4HT8A 2EYQA 4ZN3A 4F17A 3CCSQ 2KRNA 2QI2A 1PSEA 1IRXA 3BFMA 4IIOA 2DO3A 3CCST 5CCAA 3M0PA 2GCXA 1NE8A 2GNCA 2LQNA 3A8HB 3ZEHA 5GAOm 3M0UA 1S72T 3ZBDA 2CZ6B 1OZ2A 3RESA 3REBB 3NTIA 3OBWA 4DBFA 4XTXA 1D3BB 2A36A 4A63B 1C1AA 4FT4A 3V7SA 3CCQT 2RQVA 2OX7A 2ROLA 3JCMV 3X28B 1VQPQ 2OAUA 2E10A 1Q86U 2MOXA 3E1SA 2YUNA 2IIMA 4MDWA 2DTHA 2QEXA 3R6OA 1RAHB 1PC0A 1Y57A 1D1AA 3FEOA 2LCLA 1GCQC 5GAOl 2HKQB 3GF5A 2DL8A 2ZPEB 2VC8A 2Y4XA 1UGRB 2JJ9A 3L2UA 5KCHA 1ZHIA 4IUUA 3BDUA 1IZ6A 1M8VA 3VS6A 1ARKA 3SDZA 1VQOQ 2J6KA 2RHUA 3KXTA 4BDZA 1I5LA 1UHFA 2K6DA 1W1FA 1UGPB 1Q82R 3VS3A 1NBEB 2MMPA 3ZL7C 2RHIA 3MEWA 4R56A 4BY6C 2MAMA 2JUFA 3OYCA 3QUIA 1Y96A 3I9QA 2QK0A 4D8DA 3EGUA 1KC8R 1TUDA 1KJWA 2QA4A 2YDLA 2DXBA 1N9SA 5GJVB 1MMAA 1X2KA 5M9OA 2HL5C 4C8QA 3EFOA 4X9CA 1LNXA 3OS0A 2D0NA 4IUPA 3E9FA 1M1KU 5IAYA 2OJ2A 2DRMA 1VQKT 2KBTA 2DF6A 3JCMX 4ZTFA 1K9MC 1G3SA 2ENMA 2HQXA 3EGDB 2R5AA 1FWZA 2OTLA 2QAZA 2XHCA 2MPXC 5I2MA 1VQLQ 1AEYA 1N5ZA 4AT1B 5GMKi 1JO8A 4KT0E 1X27A 1IHVA 1FMKA 4V2SA 2BIVA 4GY5A 1OX9A 1H3HA 1OPLA 2P0KA 2VUBA 3I55A 1ZUUA 2DX1A 5ECAA 5FU6C 4DQ2A 2EKOA 1QP2A 4EMKB 3H8ZA 3MEAA 1ABOA 2DILA 3SWNC 1M90C 4LDWA 4FU6A 4KH0B 1KD1R 4A4EA 2X3WD 1T3LA 1M90R 1VQ6T 2V1RA 3EHQA 4C0ZA 1WZOA 4ELYC 3CCEQ 1BU1A 3VU3C 2KNBB 3EFOB 5LJ5g 3NFCA 3HRSA 3JB9D 1G3WA 1K76A 1WI7A 2EYYA 4AFQC 2XG8D 1SKUB 3CC7T 1VIEA 4A54A 4C92E 3G6EA 3V7RA 1K9MU 1CKBA 1VA7A 4JDSA 1VQ9T 4M78G 4XAXB 4F16A 3X25B 1WYXA 2CP2A 1R77A 1WQWA 2DL4A 2YUOA 3E9GA 2IPOB 3CC2T 4CI0C 8AT1B 1KG1A 1BI0A 3E2UA 1G3YA 1AZEA 3X26B 2MCNA 5GAMf 2RHYA 2K5IA 4C0DB 1RI0A 1Q86C 3IQLA 4ME7A 3OYFA 5IHIA 3G1JA 1BIBA 5LJ5h 1Y7XA 2EYZA 2JN0A 2RNAA 2V8KA 3CCVT 2O4XB 1R0BG 1AWJA 2RQUA 4JZ4A 1VQ7T 5I21A 3L2QA 1IB8A 1QVGS 1BYMA 1M1GA 2F2XA 1LPLA 1WDXA 1EX4A 2FPFA 4KULA 3RIRA 3OS2A 2RK2A 5CQYA 2CSIA 2XKOC 4E7HA 2NUZA 4M7DF 1ZA1B 1NG2A 2RN8A 3A8GB 3ZFJA 3CC4Q 4OF1A 2H3JA 4F04B 3MO8A 3CCMA 1YJ9Q 4DOVA 1QCOA 4LN2A 3REAB 3SB2A 1N9RA 2MF2A 4ANJA 1D3BA 1PD1A 4PFOA 3FJPA 4FIBA 1YWPA 3VS4A 5LJ5j 2FB7A 4F7UE 4C5GA 1KQ1A 1BIAA 4XU1A 1NEGA 3CBPA 3UATA 3HFNA 1G3TA 4FCYA 2K9GA 2HEQA 2JMCA 2XICA 1UGVA 3UA6A 4JJBA 3JCMQ 1Y07A 1HJDA 5D6XA 1GCQA 3BE3A 2ED1A 2KGTA 4A4FA 1H641 4MMLA 4FT2A 3OYGA 1QVPA 1EZZB 5LJ3g 1WHKA 1RAAB 3CCMQ 1WXBA 1B34B 1YHQA 3H9NA 5CIUA 2D1XA 3HL8A 1VQPT 4J83A 2XDBA 3RNJA 2DVJA 3CMAA 5FU7B 2O01E 1IHWA 4KUIA 3VV0A 5GJWB 5FLXE 1UECA 1OZ3A 1K1ZA 1GXIE 1QQJA 4LD9K 1J3TA 1YHQQ 1WHHA 1VQ8A 1QMCA 5LJ3h 2M16A 2L0AA 4C8QE 2EJGA 3JCMP 2AIRB 1TU0B 2DFUA 4PJOD 2DYIA 4M7AE 2VASA 2DNUA 3JRZA 2E3HA 1NEBA 2FRWA 3LGLA 4KH1B 4Z02A 3CQTA 1M2OA 3OY9A 3A98A 5J3BA 1AWOA 5IN1A 2H3EB 2X51A 4EPCA 3OMGA 3CMAQ 5IT9E 5KYWB 3M56A 4J7IA 1BCOA 3FLGA 1SHGA 1TXQA 3M4YA 2PU9B 2KT8A 3OW2A 1UUEA 2K3YA 5GANj 2GFUA 5FW9A 1X69A 4EMKA 5C0MA 4M7DD 1IGQA 2D8JA 1A0NB 2BTTA 5LJ5d 4OMLA 2QG9B 2L89A 3EG2A 1RAIB 4EDUA 2E70A 1ZBJA 2L2PA 2V26A 1K8AC 2BE9B 2YSQA 3FJ5A 4C8QF 2DD4A 2EIFA 2XD0A 4WCIA 5GAN3 4FL6A 1HSQA 3PIPA 2LQ8A 2B86A 1VQMA 2O9VA 2JVVA 1UJYA 2COZA 2R57A 5GANd 1Y71A 2M1HA 4KRTA 1Q7YC 4CRIA 1U1TA 4DOWA 3EFRA 5D6WA 1AZGB 3QWXX 2DAQA 4EMGA 4F7UG 4C8QG 6AT1B 2RPNA 4PJOC 2SEMA 1HYOA 1UTIA 1X6BA 2ZZDA 1K73C 2RQTA 1V76A 1RABB 1YJWT 3KUFA 4E7ZA 4JJNK 1P92A 2A37A 4L59A 4JUVA 4E6RA 5HK3A 3EG3A 3BW1A 4M7AA 2DETA 3SFMA 4DA4A 5LJ3f 3PFSA 2FEIA 2ECZA 1V1CA 1O9SA 3THKA 3G6EQ 3CCUQ 2O88A 4BUGA 1JEGA 4M7DC 1KHIA 5FU6B 3ME9A 1FXXA 3CC7A 5GMKe 3WVEB 1E6GA 3NPFA 4OGEA 2KQWA 1VQNT 2BE7D 4IURA 2DE0X 1RI9A 3QKJA 4M75B 4OB0B 1VQKQ 1WQ7A 2XDDA 2XDPA 1KC8C 1ZSZA 5GAOp 2PNIA 2M51A 1HXDA 2NWMA 3F70A 2LTOA 4B9XA 3VYHB 2Z0WA 3VS2A 4M77A 4HKEA 3OYHA 3TREA 1PKSA 2GBQA 3JCMc 2FRYA 2E3IA 2DA9A 1MV3A 4M78A 1WGSA 4QW2A 3LWIA 4NL2A 3P8BB 2QQBA 1RLQC 2LNHB 1NPRA 2K5FA 1Q81C 2L8DA 4FSXA 2OTJA 4Q5WA 2DPPB 5AYFA 3VRYA 3OYJA 2C06A 3VS5A 1W4SA 1BI2A 4RG2A 2RB6A 4K11A 2K3XA 2KSSA 3TVTA 2LVMA 2PVOB 2ZGWA 2W10A 4E7KA 1VQ4A 1PNJA 4N4GA 2X4XA 1HD3A 1OULA 4J6WA 5DM7R 4RKUE 3TU4K 1AWWA 1TTHB 1WJSA 2XK0A 2AZSA 1M4ZA 3CXCP 3SD4A 1D09B 1VOMA 4JS4A 3OYKA 2JW4A 1WPYA 4OMQA 3C4SA 4AFSC 2DXTA 2B8AA 1GBRA 4OMNA 2FL7A 2CUDA 2MIOA 4QVZA 3DB3A 4N4IA 3BDLA 4OVAA 3TSWA 1C0MA 2JS2A 4BD3A 2AHJB 3META 3CCET 3A1PA 1N6AA 1UB4A 1WJRA 1QCFA 3JB9G 3GBQA 3H0IA 2V8JA 1OU9A 3CMEQ 1UJ0A 1YJNT 1VQNQ 1I4K1 3OYNA 1U8RA 1K9AA 2JMAA 4LE9A 2F69A 2QTVA 3OYMA 4OGCA 4HVVA 2RA2A 1IREB 1ZQ1A 3TQ7P 4OMPA 4HCKA 1WHGA 4UC4A 1IGUA 2D8HA 3ULRB 9ATCB 2JZ2A 4RCCA 2CP5A 3CPFA 2HBWA 2A08A 1M2VA 2JTFA 4KBMB 1YJWQ 4XU0A 1MMNA 3SEMA 4J9CA 5IXFA 3UPUA 2ABLA 2KEAA 3MP6A 4PJOE 4B9WA 1AD5A 4YTLA 5GMKj 2FPDA 1BB9A 1UGQB 1KQSP 3D7SB 1M9SA 3CXCA 4QQGA 3EAEA 1YCYA 2VKNA 3DB4A 1ZUKA 5J39A 1YITA 1VQ8Q 1ZBXA 2GFAA 4CC4B 1MGQA 2A0FB 2A28A 3CCVA 1ZX6A 2QTXA 1AWXA 4BE0A 4M7AC 5FRNA 3R6NA 1QWEA 1M3AA 3VUBA 5AT1B 2EVRA 2EQIA 3L2RA 2EQUA 3CMEA 2LT1A 2PVDB 3OYEA 1S72A 1JU5C 3J80E 2A3LA 5HY6A 3PE0A 5CVIA 5CKHA 1XJWB 3L42A 2LQWA 2K3BA 3JCMJ 1YIJT 1WHMA 3H0FA 1JXOA 3OYBA 2DTIA 4BE1A 2KXCA 1QW1A 2P4RA 2LJ3A 3HPWA 3SHWA 1GFDA 4M75G 4HCBA 5GAN8 5A0LA 3U23A 2FG0A 4KGXB 3E19A 5A2QE 3CD6Q 3QG1A 1OI1A 2WSEE 3EHRA 2EQMA 5GANe 4RTYA 4D8KA 2DKGA 4RTWA 2FYKA 1OPKA 1TOVA 3GNGA 1VYVA 5GMKm 2CP0A 1R8OB 3G71T 1VQ9A 2HMAA 3JCMh 1KHCA 1K0SA 1TUGB 5LL6S 3MPUB 2DIGA 1TWBA 3G4ST 1BI1A 3TCJA 3M9QA 5FWBA 4C92F 1G8XA 3KBGA 3CCLA 3EG0A 4C8QD 3JB9I 1QVFS 3C0CA 3VS1A 4M7AD 1WXUA 4EMHA 1N8RR 2GTJA 2ED0A 4RCBA 2GGRA 5GAOr 4J7FA 1YI2Q 1YJ9A 2L3QA 3NMZC 4A4GA 3CCUT 1PWTA 1X6OA 2DZCA 4ZTJA 1VQLT 1PHTA 1OQKA 1YP5A 4E7JA 3VS0A 3I56T 2RO0A 4BACA 3UF4A 4M75C 2MI6A 3QIIA 3CCQQ 4ZNXA 4FSSA 1B34A 3NTHA 2DERA 1ZSZC 1SSHA 4Y92A 2EFIA 1OU8A 3CC4T 1KQSA 1D0XA 3I5SA 4FYWB 3MJXA 2FVUA 4WF2A 5LJ3e 1NZ9A 4J9HA 3A8LB 5KE2A 2ROTA 3CCRQ 1T3SA 1NLOC 2QQSA 3LLRA 4XTYA 1VYUA 4A4HA 2HL3A 2G3RA 3JAME 4PK4A 2A7YA 4Z88A 2EJ9A 3OS1A 3CEYA 4E2FB 1VQOA 1NJIU 3OBYA 1RLPC 2DEUA 3A5ZB 5KYXB 4C8QC 4HCZA 5CKFA 2MWPA 4QVDA 1VQ6A 2X35A 4L6V5 3T9NA 1RL2A 5FU7C 1ZUYA 5FRMA 2R58A 3V8KA 2KR3A 1YI2A 4PLLA 3OW2S 2L5QA 1PM3A 3M0SA 3MP1A 1Q7YR 2KAFA 2GQVA 1NJIR 1TG0A 2KRSA 1K8AU 3PNWC 3X24B 2D9TA 5GAOq 4KUDK 3CCQA 3FC3A 4M75D 3C95A 2C0TA 3TSZA 2E5QA 3HP9A 3WVDB 5GAMh 4QQ6A 2EPDA 3I55Q 1VQ9Q 4M77E 1VQKA 5CO7A 1VIFA 1VQ6Q 4F7UA 3CCJT 4F7UB 5L23A 4PJLA 1R0CB 3CC7Q 1YFNA 1KIKA 1M1FA 4MZPA 1BK2A 5GAN4 1MMGA 3CCRT 1K73U 1ZLMA 1JBMA 2M02A 3RUXA 4F7UF 2XI9A 4AG1C 1WNLA 1M1KC 1VQ5Q 4HT9A 2CKKA 3GPLA 4O6JA 2KYBA 4PKCC 1SF9A 4LDYA 3JSCA 1Q81R 1SPKA 2C0OA 2HQEA 4RTUA 4R55A 4J6XA 4M77B 4IUTA 4L5GA 2AK5A 1N8RU 1WLPB 2GTOA 2COYA 5GAMj 3RERA 1RAGB 1K73R 3RKYA 4C92A 3FB9A 2HD0A 1H8KA 4KGVB 1YITQ 3DLMA 2V1QA 2RJDA 1OEBA 4J8OA 1Z9QA 1X43A
chains in the Genus database with same CATH topology
2JUFA 2DPPB 2HBPA 2JOYA 4Q5WA 3A8MB 3UT1A 3OYCA 3JB9H 3QUIA 5AYFA 2PVGB 3OYJA 2C06A 3QYGB 1W2BS 1Y96A 4PLIA 1KQSS 5GANh 3LW5E 1W4SA 5GAMe 1BI2A 4TVRA 2QA4A 4MMKA 2DXBA 5C6SA 4RG2A 4BB7A 2RB6A 2RJFA 2K3XA 4JRIA 1N9SA 2KSSA 2LVMA 2PVOB 3OMCA 3ER0A 4XTUA 4MZMA 5M9OA 4C8QA 2ZGWA 4XU2A 3JCMe 4X9CA 4XK8E 2RI3A 1LNXA 4E7KA 1VQ4A 2OTLT 1DJ7B 2X4XA 4N4GA 2R5MA 4J6WA 4RKUE 3MCAB 5DM7R 3OS0A 4E47A 3TU4K 4OMFB 4IUPA 3OYDA 2EJFA 1WJSA 2XK0A 3E9FA 3O8VA 2QA4T 1M1KU 5IAYA 4BE2A 1VQKT 1M4ZA 3JCMX 3SD4A 4ZTFA 1K9MC 2PQWA 1G3SA 2HQXA 4JS4A 2QQAA 5HKCA 3OYKA 2K5LA 2R5AA 1QVFA 1WPYA 1FWZA 1PSFA 1VQ4T 4P5NA 2OTLA 3JB9F 2XHCA 3OS2A 5I2MA 4RMOA 3CCMT 3C4SA 4JRKA 2DXTA 5GMKi 2CGHA 1KQ2A 2B8AA 3JCMg 2PUOB 3V8LA 4KT0E 1VQPA 2ZPHB 5D6YA 4V2SA 2YLBA 2BIVA 5L8RE 4GY5A 5DY9A 2PUKB 2K4YA 4OB1B 1QVGA 2P0KA 4RG8A 2VUBA 3QHSA 2RHXA 3I55A 2FL7A 3G4SA 3JCMW 4C92B 4M7DB 2RJCA 5FU6C 4M7DA 4DQ2A 2EKOA 4QVZA 3QDRB 4XTWA 3QZ5B 3BY7A 5A0GA 1QP2A 4EMKB 5GAN7 1Q81U 1NJIC 3DB3A 3H8ZA 3MEAA 4M7AB 3CCLT 1VQ7A 4N4IA 2P0PA 3BDLA 4OVAA 4X9DA 3WXMB 3SWNC 1M90C 4MDXA 2LRQA 4BD3A 2X4WA 4LDWA 2AHJB 1VQMT 3META 4FU6A 3CCET 3I55T 4A4EA 2KDSA 1N6AA 4VUBA 3ASKA 4OP0A 3PTAA 1UB4A 1WJRA 3QO3A 3LGFA 3JB9G 1VQ6T 4C0GA 4C0ZA 4ELYC 2V8JA 3CBMA 3M55A 3DLLA 3VU3C 1VQNA 5LJ5g 3NFCA 3HRSA 3LYIA 4J5YA 4QVCA 3JB9D 1G3WA 1I4K1 1YJNT 4ZGDB 3OYNA 3OYYA 2XG8D 3INZA 1U8RA 3CC7T 4M75A 2LT4A 2P0QA 1VIEA 4A54A 4C92E 3G6EA 3CMET 5I2SA 4M7DE 5CQXA 3V7RA 5CKDA 1K9MU 3V8JA 1XQHA 4PJOB 2HAXA 4PJOA 2VGMA 4JDSA 2EAYA 1VQ9T 2CZ0B 4C0FA 4N4HA 2F69A 3OYMA 4JRPA 2X4YA 4OGCA 4M78G 3HSBA 3L2VA 2F5TX 4XAXB 1AHJB 5GAMg 3X25B 2RA2A 1IREB 3CPWS 4E7LA 2E41A 1WQWA 4MZTA 3E9GA 4LDUA 3SWNA 3CC2T 1ZQ1A 2E64A 2IG0A 4CI0C 3CC4A 2E1HA 1KG1A 2MWOA 1BI0A 4QQDA 1G3YA 2E6NA 1OYXA 4XQ3A 3X26B 2DXUA 4UC4A 5GAMf 3C12A 3MHXA 2JZ2A 2RHYA 4RCCA 3CCUA 2K5IA 3OS5A 4C0DB 3AHUA 1HK9A 1RI0A 1Q86C 3CPFA 3HKSA 4ME7A 3OYFA 4IUQA 2LCCA 1I81A 1M5Q1 2JTFA 4KBMB 4Y91A 3L2WA 4XU0A 1BIBA 3G7ZA 3RMQA 5HK0A 2QXFA 5KE3A 3UPUA 3H6ZA 5LJ5h 3MP6A 4PJOE 5KH6A 1KC8U 2K57A 3VYGA 4JLIA 3PT9A 1Y7XA 2JN0A 4B9WA 1Q81C 2V8KA 2YRVA 1JJ2S 4C92G 4YTLA 2QQRA 5GMKj 3CCVT 2LDMA 3QPHA 3JB9J 1JJ2A 1NPPA 2M0OA 2O4XB 3PMIA 1UGQB 3QSUA 2LC4A 2E12A 1UEBA 3OYLA 3CCRA 3J7AF 2KK4A 1VQ7T 2DXCA 5I21A 3L2QA 4ZGJB 1QVGS 1BYMA 3MEUA 1M9SA 5A0DA 1M1GA 3CXCA 4GLKA 3CXCS 4QQGA 3EAEA 2L3RA 1YCYA 3S3NA 4KULA 3FDRA 3RIRA 2RK2A 1O75A 2RM4A 3DB4A 3LH0A 5CQYA 4C5IA 5J39A 3OSVA 2XKOC 1YITA 3HRUA 4E7HA 3CD6T 1JB0E 3M5AA 1ZBXA 4M7DF 2GFAA 1SSFA 1MGQA 5EG2A 2ZPGB 4N0AC 1YI2T 3CCVA 3A8GB 3ZFJA 2D6FA 2QTXA 1X75C 4OF1A 2H3JA 3C94A 3MO8A 4BI4A 4D6WA 4O5VA 4OB3B 3CCMA 4BE0A 4DOVA 3S3MA 4EMKC 4LDXA 4M7AC 4M77C 3SB2A 5GAN5 1N9RA 5FRNA 2HNIA 2MF2A 3CPWA 3QXEB 3VUBA 3SWNB 3FIFA 1H3ZA 1D3BA 3VUZA 2DJZA 5DLQE 2EQUA 3P8DA 3L2RA 3FJPA 4M78C 2LT1A 4FIBA 4PL6A 3G6ET 2PVDB 3RMSA 3OYEA 1S72A 2V8IA 2CS7A 2FB7A 2A3LA 5HY6A 5GAN6 4F7UE 2X4JA 5LJ5j 5CR2A 3J80E 3CMEA 1Q82C 4C5GA 2DVEA 1KQ1A 5CKHA 5CVIA 3L42A 1BIAA 5CK9A 4BI8B 3JCMJ 5GMKh 4BY6B 1YIJT 1VQ5T 4XU1A 3L1AA 4M75F 3CBPA 5FROA 5LJ3d 2DIQA 3HFNA 2P4TA 1VUBA 1G3TA 3OYBA 4OB2B 2EWNA 1W2BA 4M78F 2DTIA 2RD1A 3VKIA 2NLUA 4BE1A 2XICA 1QW1A 3HPWA 4PJOF 3QYHB 4LD6A 3JCMQ 2FHDA 3A8OB 1Y07A 3M59A 1Y96B 5D6XA 5LJ3j 3S3OA 4M77F 4M7AF 3HHTB 2EQKA 1G5VA 4NL3A 4M75G 4HCBA 4M7DG 4XTVA 5GAN8 5GAN2 2RJEA 4A4FA 1H641 2ZPFB 3OB9A 4J8OA 4MMLA 4FT2A 5A0LA 3E19A 3OYGA 1X01A 3GNFB 1QVPA 3RKWA 5A2QE 1EIFA 3QG1A 4JS5A 2ZCFB 2WSEE 1OI1A 2EQMA 2IVWA 3V7CA 3L2ZA 4C8QB 4C92D 5GANe 5LJ3g 2E65A 3MP8A 2DKGA 1B34B 1YHQA 5CIUA 2FYKA 3GNGA 2VGNA 3HL8A 5GMKm 4XTZA 1R8OB 3LX7A 3G71T 1VQPT 1VQ9A 4J83A 3JCMh 3GLXA 2XDBA 1KHCA 4C5EA 3GP8A 5LL6S 3CMAA 2WSCE 1TH7A 5FU7B 2O01E 2DIGA 3G4ST 4KUIA 3QBYA 1BI1A 3TCJA 3M9QA 4C92F 3VV0A 2BUDA 5FLXE 2CZ1B 3KBGA 3CCLA 3CCJA 4M7AG 1OZ3A 3PMTA 2KVQG 3UDCA 4C8QD 1GXIE 3JB9I 1QVFS 1N27A 2Y4YA 3M54A 2VV5A 5CAIA 2RK1A 4LD9K 4PJOG 3OYIA 1VQ8A 5KCOA 4M78E 5LJ3h 2M16A 4M77D 4C8QE 4M7AD 1JRIA 2EJGA 3JCMP 5CKBA 4EMHA 3CCEA 4RCBA 3LWHA 5GAOr 1BKBA 1FX7A 4PJOD 5GANg 3OYAA 4IKFA 4J7FA 2DZ9A 4M78D 4ZN1A 1YJ9A 4M7AE 1BI3A 2YHTA 4M77G 1XNIA 3JRZA 4LDVA 4A4GA 3CCUT 2RHZA 2D0QB 3LGLA 4IUVA 1X6OA 4Z02A 1LOJA 3S6WA 2DZCA 1VQ8T 1XTDA 2CZ7B 5GAOn 3OSSC 4Y28E 4ZTJA 3OY9A 1VQLT 5J3BA 3NTKA 5IN1A 1YJ9T 4E7JA 3M53A 4EPCA 4XU3A 2RO0A 3OMGA 5GAMd 3OA6A 2LNVA 3I56T 4BACA 3PIOA 4M75C 2MI6A 3QIIA 5IT9E 3CD6A 3M56A 1B34A 2GF7A 3NTHA 4J7IA 3FLGA 3HFOA 3M4YA 3QJ6A 3JCMd 2JNGA 2KY9A 2PU9B 4N0AA 2I2LA 4M78B 3OW2A 1QP3A 2EFIA 4FM4B 4ATOA 2K3YA 3CC4T 5GANj 1WJQA 1KQSA 2GFUA 1MHNA 4EMKA 3UWNA 2EQJA 2FVUA 1VQLA 4PNOA 4C92C 4WF2A 5C0MA 5LJ3e 4M7DD 2XIDA 1NZ9A 2Y90A 1YITT 5LJ5d 4ELZC 2L89A 5LJ5e 1VQOT 4X34A 3A8LB 2QDYB 2QQ9A 2E70A 3VJPA 4EDUA 3OQ5A 5KE2A 4JRQA 1YHQT 2OTJT 4HA8A 5DLOA 4NOYA 1LJOA 3CBOA 1K8AC 2QQSA 3LLRA 4XTYA 4C8QF 2DD4A 3G71A 2EIFA 4A4HA 4C0DC 2XD0A 4NS5A 1V29B 3JCMb 2G3RA 1U1SA 3PGGA 5GAN3 4FL6A 1VQ5A 3JAME 3HRTA 2LQ8A 2WACA 4A4KA 3PIPA 1VQMA 2A7YA 4II1A 2EJ9A 3RKXA 2JVVA 3CEYA 3OS1A 1VQOA 2R57A 1NJIU 3OBYA 4A53A 5GANd 3JCMf 3A5ZB 2M1HA 1Y71A 3Q1JA 4C8QC 1Q7YC 4HCZA 5CKFA 1U1TA 2YLCA 2MWPA 2LX9A 4CRIA 3EFRA 4DOWA 4QVDA 5D6WA 1M90U 1VQ6A 3GIBA 2DTOA 2RI2A 3TEEA 1YBYA 2KMTA 3CCSA 1KD1U 2DAQA 2DK3A 2X35A 3M4GA 4JLGA 4EMGA 1YIJA 1KD1C 4F7UG 4HCCA 4C8QG 4L6V5 1Q82U 2BKDN 5J26A 4C5HA 4PJOC 4HT8A 3T9NA 2EYQA 1RL2A 2O4XA 5FU7C 5FRMA 2R58A 3V8KA 5GANf 4ZN3A 4PLLA 2E6ZA 3OW2S 2L5QA 1YI2A 3P8HA 4J6YA 2ZPBB 2ZZDA 5CKEA 3MP1A 2DEQA 1K73C 2QI2A 1PSEA 2GQVA 2KAFA 3URGA 3BFMA 1YJWT 2DO3A 3KUFA 3CCST 4JJNK 5CCAA 1P92A 2JTMA 1K8AU 3PNWC 4M75E 4L59A 2GCXA 4JUVA 1NE8A 3X24B 3CC2A 3A8HB 3ZEHA 5HK3A 3MEVA 5GAOm 2D9TA 5GAOq 4KUDK 1S72T 2VXFA 3BW1A 3CCQA 3FC3A 3QJYA 3X20B 4M7AA 3ZBDA 1XOVA 4M75D 5LJ5f 2CZ6B 1OZ2A 3C95A 3SFMA 2QEXT 3EFSA 3RESA 4DA4A 2E5QA 3NTIA 5LJ3f 3PFSA 1YJWA 3OBWA 3HP9A 3WVDB 5GAMh 2RH2A 2RI5A 2VXEA 4QQ6A 4XTXA 3DKMA 1D3BB 1YJNA 1O9SA 4M77E 1VQKA 3FRNA 4FT4A 4BUGA 5CO7A 3V7SA 4M7DC 3CCQT 1VIFA 1KHIA 5FU6B 4F7UA 3CCJT 4ZGEB 3JCMV 3ME9A 3X28B 1FXXA 4BI3A 4F7UB 2OAUA 3CC7A 2E10A 3QZ9B 1Q86U 5GMKe 3WVEB 3E1SA 2WSFE 2QEXA 4MDWA 1M1FA 2DTHA 2F5KA 3R6OA 4MZPA 3J81E 4OGEA 2KQWA 5GAN4 1Q7YU 4IURA 1VQNT 2K2VA 3M58A 3QKJA 4M75B 4OB0B 3CCRT 1K73U 1WQ7A 1JBMA 2CYZB 3FEOA 2LCLA 2XDDA 4BDYA 5GAOl 2XDPA 3RUXA 5GAOp 2M9UA 2XI9A 3GF5A 4F7UF 1WNLA 3N5BB 2VYTA 1KC8C 1M1KC 4HT9A 2CKKA 3M57A 2ZPEB 3GPLA 1HXDA 4O6JA 2VC8A 3F70A 2Y4XA 1UGRB 2LTOA 4LDYA 4PKCC 4B9XA 3JSCA 3VYHB 3I56A 3L2UA 2DD5A 1I8FA 5KCHA 1ZHIA 4IUUA 3BDUA 3CMAT 1UGSB 2HQEA 4R55A 4J6XA 3GOXA 1IZ6A 4M77A 1M8VA 4HKEA 3OYHA 4M77B 3SDZA 4E7IA 4IUTA 4L5GA 2RHUA 3TREA 3KXTA 4BDZA 1N8RU 1I5LA 3JCMc 2OTJA 4M78A 5GAMj 1UGPB 1N8RC 3RERA 2LQKA 3RKYA 1WGSA 4QW2A 3LWIA 5GMKl 4C92A 2XU8A 4NL2A 3FB9A 2HD0A 2MMPA 2RHIA 3P8BB 3DLMA 2QQBA 3MEWA 2RJDA 1NPRA 2ZPIB 2K5FA 4R56A 2L8DA 4FSXA 4BY6C 2MAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQM A;  2M1H A;  3Q1J A;  4Q5W A;  3OYC A;  3UT1 A;  3E9G A;  3MP8 A;  4HCZ A;  4CRI A;  2IG0 A;  2MWP A;  3OYJ A;  5D6W A;  2MWO A;  2RI2 A;  4PLI A;  4QQD A;  5CIU A;  2E6N A;  1OYX A;  2DAQ A;  2X35 A;  3LX7 A;  4UC4 A;  5C6S A;  1KHC A;  2JZ2 A;  4RG2 A;  2RHY A;  2K3X A;  2BKD N;  2RJF A;  5J26 A;  4C5E A;  4C5H A;  1RI0 A;  2LVM A;  2O4X A;  5FRM A;  2DIG A;  3OMC A;  2R58 A;  3OYF A;  5M9O A;  4IUQ A;  4PLL A;  2LCC A;  4E7K A;  3QBY A;  2JTF A;  2RI3 A;  3P8H A;  3L2W A;  3M9Q A;  3MP1 A;  4N4G A;  2X4X A;  5KE3 A;  2BUD A;  2R5M A;  3H6Z A;  3OS0 A;  3MP6 A;  1OZ3 A;  3PMT A;  4IUP A;  5KH6 A;  3OYD A;  1WJS A;  2XK0 A;  3E9F A;  3O8V A;  1N27 A;  3KUF A;  5IAY A;  4BE2 A;  3PNW C;  4B9W A;  4L59 A;  3SD4 A;  2YRV A;  3OYI A;  4ZTF A;  2PQW A;  2QQR A;  2LDM A;  2HQX A;  3ZEH A;  2M0O A;  2O4X B;  3MEV A;  2D9T A;  5KCO A;  3PMI A;  2R5A A;  3OYK A;  2M16 A;  3OYL A;  3FC3 A;  3L2Q A;  1OZ2 A;  3MEU A;  3C4S A;  3OYA A;  4QQG A;  4IKF A;  3EAE A;  2L3R A;  3S3N A;  2B8A A;  2E5Q A;  3FDR A;  3NTI A;  3PFS A;  4C5I A;  3DB4 A;  3LH0 A;  3OS2 A;  5J39 A;  1XNI A;  5D6Y A;  2RI5 A;  4QQ6 A;  4E7H A;  2BIV A;  4A4G A;  2RHZ A;  4GY5 A;  2GFA A;  1SSF A;  3LGL A;  4IUV A;  4Z02 A;  3S6W A;  2P0K A;  2RHX A;  2RJC A;  3ME9 A;  2EKO A;  4QVZ A;  3MO8 A;  3OY9 A;  4BE0 A;  4ZTJ A;  3S3M A;  3NTK A;  3DB3 A;  3H8Z A;  3MEA A;  5IN1 A;  4N4I A;  3BDL A;  4E7J A;  4OVA A;  2F5K A;  2RO0 A;  3OMG A;  3OA6 A;  5FRN A;  4BAC A;  4IUR A;  3QII A;  2LRQ A;  4BD3 A;  3QKJ A;  2X4W A;  1H3Z A;  3NTH A;  2GF7 A;  3FLG A;  3FEO A;  2EQU A;  3MET A;  3P8D A;  3QJ6 A;  4FU6 A;  4PL6 A;  4A4E A;  2XDP A;  3L2R A;  3OYE A;  3ASK A;  4BDY A;  2EFI A;  2VYT A;  1WJR A;  3LGF A;  2CKK A;  2K3Y A;  1WJQ A;  2GFU A;  4C5G A;  1MHN A;  3L42 A;  3F70 A;  2LTO A;  4B9X A;  3UWN A;  2EQJ A;  5C0M A;  3L2U A;  5FRO A;  5KCH A;  2DIQ A;  4IUU A;  3LYI A;  3OYB A;  2HQE A;  2L89 A;  3GOX A;  4X34 A;  3OYN A;  4EDU A;  5KE2 A;  3OYH A;  2NLU A;  4BE1 A;  3OQ5 A;  4E7I A;  4IUT A;  2RHU A;  4LD6 A;  4BDZ A;  2FHD A;  2QQS A;  3LLR A;  5D6X A;  3S3O A;  1G5V A;  4A4H A;  2EQK A;  4NS5 A;  1WGS A;  4QW2 A;  2G3R A;  4FL6 A;  2RJE A;  4A4F A;  4N4H A;  2WAC A;  3OYM A;  2X4Y A;  2RHI A;  3OB9 A;  4II1 A;  3DLM A;  3L2V A;  3OS1 A;  3CEY A;  3MEW A;  3OYG A;  2RJD A;  2R57 A;  2L8D A;  4E7L A;  1OI1 A; 
#chains in the Genus database with same CATH topology
 2JOY A;  3A8M B;  1M8M A;  4FW1 A;  3QYG B;  2BZ8 A;  4PLI A;  1KQS S;  5GAN h;  2FZC B;  3OW2 P;  4MMK A;  5C6S A;  4BB7 A;  4JRI A;  2RJF A;  2L3P A;  1Q95 G;  3I5R A;  1B3Q A;  2OTL T;  4XU2 A;  4XK8 E;  2K79 A;  2RI3 A;  1DJ7 B;  2JM8 A;  2R5M A;  1WFW A;  4PJJ A;  4E47 A;  3G4S Q;  4OMF B;  2EJF A;  2LP5 A;  2YT6 A;  2QA4 T;  4BE2 A;  2PQW A;  3EGX A;  5I22 A;  5HKC A;  2K5L A;  1PSF A;  3JB9 F;  4P5N A;  4AFU C;  1SRM A;  1MND A;  1KQ2 A;  3JCM g;  2YRC A;  3V8L A;  1VQP A;  5D6Y A;  2YLB A;  5L8R E;  5DY9 A;  2K4Y A;  1QVG A;  3QHS A;  2RHX A;  2O31 A;  3MKD A;  2EYW A;  4C92 B;  3JCM W;  1WX6 A;  4M7D B;  2RJC A;  4M7D A;  3QDR B;  1VQ7 Q;  3QZ5 B;  5A0G A;  5GAN 7;  1NJI C;  2P84 A;  2CP6 A;  4B6M A;  1VQ7 A;  2YUP A;  4M7A B;  2P0P A;  4X9D A;  3WXM B;  2YUQ A;  1G83 A;  2X4W A;  4FYY B;  2EGA A;  3CCV Q;  1VQM T;  3I55 T;  4VUB A;  1FMW A;  2KDS A;  3ASK A;  4OP0 A;  1UG1 A;  1ABQ A;  3PTA A;  3QO3 A;  2E4H A;  4C0G A;  4Z89 A;  3CBM A;  2HQH A;  3M55 A;  5KYN A;  3DLL A;  1VQN A;  4AFZ C;  4J5Y A;  3LYI A;  3INZ A;  4M75 A;  2LT4 A;  2AKL A;  1U06 A;  5I2S A;  5CQX A;  3V8J A;  1XQH A;  4PJO B;  1UDL A;  4PJO A;  1GCP A;  3CC2 Q;  2EAY A;  4N4H A;  4JRP A;  2X4Y A;  1NYG A;  2YRD A;  3RDV A;  5GAM g;  1UFF A;  1I0C A;  3CPW S;  2E41 A;  1PG5 B;  4LDU A;  3SWN A;  2IG0 A;  2E1H A;  2L3S A;  4QQD A;  2E6N A;  2RF0 A;  4QT7 A;  1GRI A;  3MHX A;  3OS5 A;  1D0Z A;  4IUQ A;  1BCM A;  3L2W A;  1MNE A;  3RMQ A;  2KRO A;  5KE3 A;  1X2Q A;  3EG9 A;  4JLI A;  3VYG A;  1K0X A;  3PT9 A;  1JJ2 S;  4FYV B;  1JJ2 A;  2LDM A;  3QPH A;  2GQI A;  2HZY A;  2HDA A;  3QSU A;  2E12 A;  3OYL A;  1YWO A;  3J7A F;  4ZGJ B;  1T0H A;  3CXC S;  5A0D A;  2OTJ Q;  4GLK A;  2DBK A;  2CUB A;  1OV3 A;  2L3R A;  3S3N A;  1Y0M A;  3FDR A;  2RM4 A;  1O75 A;  1NM7 A;  1FYN A;  3CD6 T;  1JB0 E;  2EGE A;  3CPW P;  1SSF A;  1YIJ Q;  5EG2 A;  4N0A C;  2D6F A;  1JXM A;  1YN8 A;  3C94 A;  4BI4 A;  4J9B A;  4O5V A;  2XMF A;  3S3M A;  4EMK C;  4M77 C;  2KE9 A;  5GAN 5;  2QDL A;  2EW3 A;  1S1N A;  2HNI A;  3CPW A;  2DRK A;  3QXE B;  2RQR A;  5IXB A;  3FIF A;  4J9D A;  2DJZ A;  2CH4 A;  5DLQ E;  3G6E T;  3O5Z A;  4M78 C;  4PL6 A;  2V8I A;  2CS7 A;  5CR2 A;  1Q82 C;  1E6H A;  2DVE A;  2J06 A;  4PJM A;  8ATC B;  1QVF P;  4BI8 B;  5GMK h;  1VQ5 T;  4M75 F;  2LJ1 A;  5FRO A;  1M2V B;  1M3C A;  1RAF B;  5LJ3 d;  1VQ4 Q;  1I1J A;  4M78 F;  3EH1 A;  3VKI A;  4PJO F;  3QYH B;  1Y96 B;  3S3O A;  2OAW A;  4M77 F;  1QKX A;  3HHT B;  2EQK A;  1BBZ A;  4NL3 A;  5GAN 2;  2JT4 A;  2ZPF B;  1Q86 R;  3RKW A;  2NUP B;  1EIF A;  2ZCF B;  4C8Q B;  3L2Z A;  2E5K A;  1RUW A;  2E65 A;  3MP8 A;  2QYZ A;  2VGN A;  4RTV A;  2K7A A;  2RQW A;  4AMC A;  3CCJ Q;  3GLX A;  3GP8 A;  4CC3 A;  2AKK A;  3JV3 A;  3QBY A;  4WTO B;  1IXD A;  2CZ1 B;  3CCJ A;  4M7A G;  3PMT A;  3UDC A;  2BZY A;  3M54 A;  2VV5 A;  4IIM A;  3OYI A;  4AG2 C;  4JJD A;  2J6F A;  4M77 D;  1JRI A;  4J9E A;  3CCE A;  3LWH A;  3CCL Q;  1W70 A;  1FX7 A;  1JJ2 P;  4IKF A;  2J6O A;  4M78 D;  4ZN1 A;  1BI3 A;  2YHT A;  1CKA A;  3H0H A;  1XNI A;  2VB6 A;  1LOJ A;  3S6W A;  3EGX B;  1VQ8 T;  1XTD A;  2EYX A;  3OSS C;  1M27 C;  2FO0 A;  1WHL A;  4XU3 A;  5GAM d;  3OA6 A;  2GF7 A;  2FZK B;  3VS7 A;  1K4U S;  2JNG A;  3PVL A;  4N0A A;  2I2L A;  4ATO A;  1EFN A;  2PTK A;  1GBQ A;  2EQJ A;  1VQL A;  2CSQ A;  4PNO A;  2XID A;  1JQQ A;  4ELZ C;  2FPE A;  5KYY B;  1WHJ A;  2QQ9 A;  1YHQ T;  3OQ5 A;  2YXY A;  1M3B A;  4HA8 A;  5DLO A;  4NOY A;  3CBO A;  1SG5 A;  1KK7 A;  4NS5 A;  1V29 B;  3JCM b;  3PGG A;  2RMO A;  3HRT A;  4A4K A;  2WAC A;  4II1 A;  3RKX A;  4GBQ A;  4A53 A;  1QWF A;  4LUD A;  3JCM f;  4QKU A;  2LX9 A;  1QLY A;  2RI2 A;  3TEE A;  2KMT A;  3CCS A;  2ZAE A;  2DK3 A;  4JLG A;  3M4G A;  1KD1 C;  2X9H A;  1Q82 U;  2BKD N;  2O4X A;  1YNZ A;  5GAN f;  2E6Z A;  2W0Z A;  3I35 A;  3P8H A;  2AT1 B;  4JZ3 A;  4J6Y A;  2ZPB B;  5CKE A;  1I07 A;  1M30 A;  2DEQ A;  3URG A;  4JPB W;  2JTM A;  4M75 E;  5I11 A;  2MK5 A;  3CC2 A;  3MEV A;  1C6V X;  1YJN Q;  1MUZ A;  2VXF A;  3QJY A;  3X20 B;  3G71 Q;  1GL5 A;  1XOV A;  2MYS A;  4X1V A;  5LJ5 f;  4LUE A;  2QEX T;  7AT1 B;  3NGP A;  3EFS A;  5KYY A;  1YJW A;  2M0Y A;  2RH2 A;  2RI5 A;  2VXE A;  3DKM A;  1YJN A;  2AZV A;  3FRN A;  2K2M A;  2ESW A;  4F14 A;  1AVZ C;  2VVK A;  3M0R A;  4ZGE B;  4BI3 A;  3QZ9 B;  3HTR A;  2WSF E;  1U5S A;  2F5K A;  3J81 E;  1PCX A;  1Q7Y U;  4CC7 A;  2K2V A;  3M58 A;  3EH2 A;  3I56 Q;  5IHN A;  2O9S A;  2CYZ B;  4BDY A;  2ATC B;  2M9U A;  3N5B B;  2VYT A;  3M57 A;  3M0T A;  3EGD A;  3I56 A;  1K9M R;  2DD5 A;  1UHC A;  1I8F A;  3CMA T;  1CSK A;  1UGS B;  3GOX A;  4E7I A;  1T0J A;  3EG1 A;  1N8R C;  2JTE A;  2LQK A;  5GMK l;  2XU8 A;  4JJC A;  2HCK A;  1ZSG A;  2DYB A;  2C0I A;  4RTX A;  2ZPI B;  2CP3 A;  3RR6 A;  2HBP A;  3JB9 H;  3UT1 A;  4DEY A;  1TS9 A;  4FW2 A;  2PVG B;  1W2B S;  1TSF A;  3LW5 E;  5GAM e;  4TVR A;  2JXB A;  4RUG A;  3OMC A;  3ER0 A;  3KFV A;  1H92 A;  4XTU A;  4MZM A;  2F1L A;  3JCM e;  3MCA B;  1D1B A;  4LXC A;  3OYD A;  3O8V A;  2DMO A;  2HSE B;  4HVU A;  2QQA A;  2DL3 A;  1QVF A;  2DL7 A;  1VQ4 T;  1U3O A;  2X3X D;  1RAE B;  2F2V A;  5HCK A;  4RMO A;  1M1K R;  3CCM T;  4JRK A;  2CGH A;  2DLP A;  1TUC A;  4DBQ A;  2PUO B;  2ZPH B;  2CH4 W;  2OTL Q;  2CP7 A;  2COW A;  1ZA2 B;  2PUK B;  4OB1 B;  4RG8 A;  5KYU A;  1GFC A;  1SRL A;  2CT4 A;  2CT3 A;  3G4S A;  1PRM C;  1KFZ A;  4XTW A;  3BY7 A;  2HAX A;  1YCS B;  1Q81 U;  3CCL T;  4RTT A;  1LVK A;  4MDX A;  1F1B B;  1ACM B;  2LRQ A;  1OOT A;  4Z8A A;  2DJQ A;  3LGF A;  2J7I A;  2JS0 A;  2EGC A;  2KT1 A;  5EC7 A;  2EKH A;  4QVC A;  3LH5 A;  4ZGD B;  5D7U A;  2OI3 A;  3OYY A;  2CRE A;  2P0Q A;  3CME T;  4M7D E;  1B7T A;  5CKD A;  1D1C A;  1ZSZ B;  2QAS A;  2VGM A;  4ESR A;  2CZ0 B;  1W6X A;  2NUT B;  4C0F A;  1K8A R;  3HSB A;  4DEX A;  3L2V A;  2F5T X;  1AHJ B;  4HXJ A;  3VRZ A;  2KI7 A;  4E7L A;  1OX8 A;  1NLP C;  3UA7 A;  4MZT A;  2CDT A;  2E64 A;  2FZG B;  3CC4 A;  2MWO A;  4OMM A;  1OYX A;  4XQ3 A;  2PZ1 A;  2DXU A;  5KYU B;  3C12 A;  1MMD A;  4CC2 A;  3CCU A;  3AHU A;  1HK9 A;  2LX7 A;  3HKS A;  1WXT A;  2LCC A;  1IO6 A;  1RAD B;  1D0Y A;  1I81 A;  1M5Q 1;  4Y91 A;  3G7Z A;  2YWW A;  2QXF A;  5HK0 A;  3H6Z A;  2G6F X;  5KH6 A;  1KC8 U;  2K57 A;  3H41 A;  2YRV A;  4C92 G;  3JB9 J;  2QQR A;  1NPP A;  2M0O A;  4DBR A;  3PMI A;  2KYM A;  2LC4 A;  1UEB A;  2SRC A;  1SEM A;  3CCR A;  2KK4 A;  2DXC A;  3MEU A;  4C5I A;  3LH0 A;  3OSV A;  3HRU A;  4DBH A;  1PD0 A;  3M5A A;  3QWY A;  2ZPG B;  4GLM A;  1YI2 T;  1X75 C;  2NUT A;  1WIE A;  4D6W A;  4E7S A;  2DL5 A;  4OB3 B;  1AT1 B;  4PJN A;  4J9F A;  3NHN A;  3SWN B;  1E7O A;  4RTZ A;  1H3Z A;  1MV0 B;  3VUZ A;  3P8D A;  4R0K A;  3RMS A;  5GAN 6;  4LDX A;  2X4J A;  1PKT A;  2F2W A;  1AOJ A;  1RAC B;  5CK9 A;  4BY6 B;  3L1A A;  4ORZ A;  2LCS A;  2DIQ A;  5KYX A;  2P4T A;  1VUB A;  4OB2 B;  2EWN A;  1W2B A;  2RD1 A;  4J9G A;  2NLU A;  4LD6 A;  2FHD A;  3A8O B;  3EG9 B;  3M59 A;  4J9I A;  5LJ3 j;  1G5V A;  4M7A F;  1QVG P;  1X6G A;  5IH2 A;  4M7D G;  4XTV A;  2RJE A;  1W2B P;  3OB9 A;  1X01 A;  2QGG A;  3GNF B;  4JS5 A;  3V7C A;  2IVW A;  4C92 D;  4PFZ A;  4OMO A;  5KYW A;  5IHK A;  1VQM Q;  4XTZ A;  2LZ6 B;  3LX7 A;  2DM1 A;  2BZX A;  1LCK A;  4C5E A;  1KSW A;  1NYF A;  2WSC E;  1TH7 A;  3M0Q A;  2BUD A;  2O2O A;  3AT1 B;  2KVQ G;  2NYS A;  1N27 A;  5FWC A;  1FMV A;  2Y4Y A;  2H8H A;  4HVW A;  2RK1 A;  5CAI A;  4PJO G;  1PRL C;  5KCO A;  4M78 E;  4M4Z A;  1QCN A;  5CKB A;  1I5O B;  2JM9 A;  1BKB A;  5GAN g;  2LJ0 A;  3OYA A;  2DZ9 A;  4M77 G;  4LDV A;  2DBM A;  2QA4 Q;  2RHZ A;  2D0Q B;  4IUV A;  1Z9Z A;  4KGZ B;  2CZ7 B;  5GAO n;  4PFP A;  4FYX B;  4Y28 E;  2I0N A;  2KRM A;  3NTK A;  2QEX Q;  3RBB B;  2NUP A;  1YJ9 T;  3M53 A;  2J05 A;  2LNV A;  3PIO A;  3CD6 A;  1SHF A;  2EBP A;  1B07 A;  3HFO A;  3QJ6 A;  3JCM d;  2KY9 A;  4M78 B;  1QP3 A;  3QDF A;  4FM4 B;  1VYT A;  1WJQ A;  2QGF B;  1MHN A;  1UE9 A;  1G2B A;  3UWN A;  4C92 C;  4EIK A;  2Y90 A;  1YIT T;  1QKW A;  1VQO T;  5LJ5 e;  4X34 A;  4JRQ A;  2QDY B;  3VJP A;  2OTJ T;  1LJO A;  3G71 A;  4C0D C;  1U1S A;  1VQ5 A;  2HSP A;  2KXD A;  1WA7 A;  2HKN A;  3PVQ A;  3Q1J A;  2VWF A;  2YLC A;  1M90 U;  3GIB A;  2DTO A;  2LMJ A;  1YBY A;  1KD1 U;  1S72 Q;  4LNP A;  1YIJ A;  4HCC A;  5J26 A;  4C5H A;  4HT8 A;  2EYQ A;  4ZN3 A;  4F17 A;  3CCS Q;  2KRN A;  2QI2 A;  1PSE A;  1IRX A;  3BFM A;  4IIO A;  2DO3 A;  3CCS T;  5CCA A;  3M0P A;  2GCX A;  1NE8 A;  2GNC A;  2LQN A;  3A8H B;  3ZEH A;  5GAO m;  3M0U A;  1S72 T;  3ZBD A;  2CZ6 B;  1OZ2 A;  3RES A;  3REB B;  3NTI A;  3OBW A;  4DBF A;  4XTX A;  1D3B B;  2A36 A;  4A63 B;  1C1A A;  4FT4 A;  3V7S A;  3CCQ T;  2RQV A;  2OX7 A;  2ROL A;  3JCM V;  3X28 B;  1VQP Q;  2OAU A;  2E10 A;  1Q86 U;  2MOX A;  3E1S A;  2YUN A;  2IIM A;  4MDW A;  2DTH A;  2QEX A;  3R6O A;  1RAH B;  1PC0 A;  1Y57 A;  1D1A A;  3FEO A;  2LCL A;  1GCQ C;  5GAO l;  2HKQ B;  3GF5 A;  2DL8 A;  2ZPE B;  2VC8 A;  2Y4X A;  1UGR B;  2JJ9 A;  3L2U A;  5KCH A;  1ZHI A;  4IUU A;  3BDU A;  1IZ6 A;  1M8V A;  3VS6 A;  1ARK A;  3SDZ A;  1VQO Q;  2J6K A;  2RHU A;  3KXT A;  4BDZ A;  1I5L A;  1UHF A;  2K6D A;  1W1F A;  1UGP B;  1Q82 R;  3VS3 A;  1NBE B;  2MMP A;  3ZL7 C;  2RHI A;  3MEW A;  4R56 A;  4BY6 C;  2MAM A;  2JUF A;  3OYC A;  3QUI A;  1Y96 A;  3I9Q A;  2QK0 A;  4D8D A;  3EGU A;  1KC8 R;  1TUD A;  1KJW A;  2QA4 A;  2YDL A;  2DXB A;  1N9S A;  5GJV B;  1MMA A;  1X2K A;  5M9O A;  2HL5 C;  4C8Q A;  3EFO A;  4X9C A;  1LNX A;  3OS0 A;  2D0N A;  4IUP A;  3E9F A;  1M1K U;  5IAY A;  2OJ2 A;  2DRM A;  1VQK T;  2KBT A;  2DF6 A;  3JCM X;  4ZTF A;  1K9M C;  1G3S A;  2ENM A;  2HQX A;  3EGD B;  2R5A A;  1FWZ A;  2OTL A;  2QAZ A;  2XHC A;  2MPX C;  5I2M A;  1VQL Q;  1AEY A;  1N5Z A;  4AT1 B;  5GMK i;  1JO8 A;  4KT0 E;  1X27 A;  1IHV A;  1FMK A;  4V2S A;  2BIV A;  4GY5 A;  1OX9 A;  1H3H A;  1OPL A;  2P0K A;  2VUB A;  3I55 A;  1ZUU A;  2DX1 A;  5ECA A;  5FU6 C;  4DQ2 A;  2EKO A;  1QP2 A;  4EMK B;  3H8Z A;  3MEA A;  1ABO A;  2DIL A;  3SWN C;  1M90 C;  4LDW A;  4FU6 A;  4KH0 B;  1KD1 R;  4A4E A;  2X3W D;  1T3L A;  1M90 R;  1VQ6 T;  2V1R A;  3EHQ A;  4C0Z A;  1WZO A;  4ELY C;  3CCE Q;  1BU1 A;  3VU3 C;  2KNB B;  3EFO B;  5LJ5 g;  3NFC A;  3HRS A;  3JB9 D;  1G3W A;  1K76 A;  1WI7 A;  2EYY A;  4AFQ C;  2XG8 D;  1SKU B;  3CC7 T;  1VIE A;  4A54 A;  4C92 E;  3G6E A;  3V7R A;  1K9M U;  1CKB A;  1VA7 A;  4JDS A;  1VQ9 T;  4M78 G;  4XAX B;  4F16 A;  3X25 B;  1WYX A;  2CP2 A;  1R77 A;  1WQW A;  2DL4 A;  2YUO A;  3E9G A;  2IPO B;  3CC2 T;  4CI0 C;  8AT1 B;  1KG1 A;  1BI0 A;  3E2U A;  1G3Y A;  1AZE A;  3X26 B;  2MCN A;  5GAM f;  2RHY A;  2K5I A;  4C0D B;  1RI0 A;  1Q86 C;  3IQL A;  4ME7 A;  3OYF A;  5IHI A;  3G1J A;  1BIB A;  5LJ5 h;  1Y7X A;  2EYZ A;  2JN0 A;  2RNA A;  2V8K A;  3CCV T;  2O4X B;  1R0B G;  1AWJ A;  2RQU A;  4JZ4 A;  1VQ7 T;  5I21 A;  3L2Q A;  1IB8 A;  1QVG S;  1BYM A;  1M1G A;  2F2X A;  1LPL A;  1WDX A;  1EX4 A;  2FPF A;  4KUL A;  3RIR A;  3OS2 A;  2RK2 A;  5CQY A;  2CSI A;  2XKO C;  4E7H A;  2NUZ A;  4M7D F;  1ZA1 B;  1NG2 A;  2RN8 A;  3A8G B;  3ZFJ A;  3CC4 Q;  4OF1 A;  2H3J A;  4F04 B;  3MO8 A;  3CCM A;  1YJ9 Q;  4DOV A;  1QCO A;  4LN2 A;  3REA B;  3SB2 A;  1N9R A;  2MF2 A;  4ANJ A;  1D3B A;  1PD1 A;  4PFO A;  3FJP A;  4FIB A;  1YWP A;  3VS4 A;  5LJ5 j;  2FB7 A;  4F7U E;  4C5G A;  1KQ1 A;  1BIA A;  4XU1 A;  1NEG A;  3CBP A;  3UAT A;  3HFN A;  1G3T A;  4FCY A;  2K9G A;  2HEQ A;  2JMC A;  2XIC A;  1UGV A;  3UA6 A;  4JJB A;  3JCM Q;  1Y07 A;  1HJD A;  5D6X A;  1GCQ A;  3BE3 A;  2ED1 A;  2KGT A;  4A4F A;  1H64 1;  4MML A;  4FT2 A;  3OYG A;  1QVP A;  1EZZ B;  5LJ3 g;  1WHK A;  1RAA B;  3CCM Q;  1WXB A;  1B34 B;  1YHQ A;  3H9N A;  5CIU A;  2D1X A;  3HL8 A;  1VQP T;  4J83 A;  2XDB A;  3RNJ A;  2DVJ A;  3CMA A;  5FU7 B;  2O01 E;  1IHW A;  4KUI A;  3VV0 A;  5GJW B;  5FLX E;  1UEC A;  1OZ3 A;  1K1Z A;  1GXI E;  1QQJ A;  4LD9 K;  1J3T A;  1YHQ Q;  1WHH A;  1VQ8 A;  1QMC A;  5LJ3 h;  2M16 A;  2L0A A;  4C8Q E;  2EJG A;  3JCM P;  2AIR B;  1TU0 B;  2DFU A;  4PJO D;  2DYI A;  4M7A E;  2VAS A;  2DNU A;  3JRZ A;  2E3H A;  1NEB A;  2FRW A;  3LGL A;  4KH1 B;  4Z02 A;  3CQT A;  1M2O A;  3OY9 A;  3A98 A;  5J3B A;  1AWO A;  5IN1 A;  2H3E B;  2X51 A;  4EPC A;  3OMG A;  3CMA Q;  5IT9 E;  5KYW B;  3M56 A;  4J7I A;  1BCO A;  3FLG A;  1SHG A;  1TXQ A;  3M4Y A;  2PU9 B;  2KT8 A;  3OW2 A;  1UUE A;  2K3Y A;  5GAN j;  2GFU A;  5FW9 A;  1X69 A;  4EMK A;  5C0M A;  4M7D D;  1IGQ A;  2D8J A;  1A0N B;  2BTT A;  5LJ5 d;  4OML A;  2QG9 B;  2L89 A;  3EG2 A;  1RAI B;  4EDU A;  2E70 A;  1ZBJ A;  2L2P A;  2V26 A;  1K8A C;  2BE9 B;  2YSQ A;  3FJ5 A;  4C8Q F;  2DD4 A;  2EIF A;  2XD0 A;  4WCI A;  5GAN 3;  4FL6 A;  1HSQ A;  3PIP A;  2LQ8 A;  2B86 A;  1VQM A;  2O9V A;  2JVV A;  1UJY A;  2COZ A;  2R57 A;  5GAN d;  1Y71 A;  2M1H A;  4KRT A;  1Q7Y C;  4CRI A;  1U1T A;  4DOW A;  3EFR A;  5D6W A;  1AZG B;  3QWX X;  2DAQ A;  4EMG A;  4F7U G;  4C8Q G;  6AT1 B;  2RPN A;  4PJO C;  2SEM A;  1HYO A;  1UTI A;  1X6B A;  2ZZD A;  1K73 C;  2RQT A;  1V76 A;  1RAB B;  1YJW T;  3KUF A;  4E7Z A;  4JJN K;  1P92 A;  2A37 A;  4L59 A;  4JUV A;  4E6R A;  5HK3 A;  3EG3 A;  3BW1 A;  4M7A A;  2DET A;  3SFM A;  4DA4 A;  5LJ3 f;  3PFS A;  2FEI A;  2ECZ A;  1V1C A;  1O9S A;  3THK A;  3G6E Q;  3CCU Q;  2O88 A;  4BUG A;  1JEG A;  4M7D C;  1KHI A;  5FU6 B;  3ME9 A;  1FXX A;  3CC7 A;  5GMK e;  3WVE B;  1E6G A;  3NPF A;  4OGE A;  2KQW A;  1VQN T;  2BE7 D;  4IUR A;  2DE0 X;  1RI9 A;  3QKJ A;  4M75 B;  4OB0 B;  1VQK Q;  1WQ7 A;  2XDD A;  2XDP A;  1KC8 C;  1ZSZ A;  5GAO p;  2PNI A;  2M51 A;  1HXD A;  2NWM A;  3F70 A;  2LTO A;  4B9X A;  3VYH B;  2Z0W A;  3VS2 A;  4M77 A;  4HKE A;  3OYH A;  3TRE A;  1PKS A;  2GBQ A;  3JCM c;  2FRY A;  2E3I A;  2DA9 A;  1MV3 A;  4M78 A;  1WGS A;  4QW2 A;  3LWI A;  4NL2 A;  3P8B B;  2QQB A;  1RLQ C;  2LNH B;  1NPR A;  2K5F A;  1Q81 C;  2L8D A;  4FSX A;  2OTJ A;  4Q5W A;  2DPP B;  5AYF A;  3VRY A;  3OYJ A;  2C06 A;  3VS5 A;  1W4S A;  1BI2 A;  4RG2 A;  2RB6 A;  4K11 A;  2K3X A;  2KSS A;  3TVT A;  2LVM A;  2PVO B;  2ZGW A;  2W10 A;  4E7K A;  1VQ4 A;  1PNJ A;  4N4G A;  2X4X A;  1HD3 A;  1OUL A;  4J6W A;  5DM7 R;  4RKU E;  3TU4 K;  1AWW A;  1TTH B;  1WJS A;  2XK0 A;  2AZS A;  1M4Z A;  3CXC P;  3SD4 A;  1D09 B;  1VOM A;  4JS4 A;  3OYK A;  2JW4 A;  1WPY A;  4OMQ A;  3C4S A;  4AFS C;  2DXT A;  2B8A A;  1GBR A;  4OMN A;  2FL7 A;  2CUD A;  2MIO A;  4QVZ A;  3DB3 A;  4N4I A;  3BDL A;  4OVA A;  3TSW A;  1C0M A;  2JS2 A;  4BD3 A;  2AHJ B;  3MET A;  3CCE T;  3A1P A;  1N6A A;  1UB4 A;  1WJR A;  1QCF A;  3JB9 G;  3GBQ A;  3H0I A;  2V8J A;  1OU9 A;  3CME Q;  1UJ0 A;  1YJN T;  1VQN Q;  1I4K 1;  3OYN A;  1U8R A;  1K9A A;  2JMA A;  4LE9 A;  2F69 A;  2QTV A;  3OYM A;  4OGC A;  4HVV A;  2RA2 A;  1IRE B;  1ZQ1 A;  3TQ7 P;  4OMP A;  4HCK A;  1WHG A;  4UC4 A;  1IGU A;  2D8H A;  3ULR B;  9ATC B;  2JZ2 A;  4RCC A;  2CP5 A;  3CPF A;  2HBW A;  2A08 A;  1M2V A;  2JTF A;  4KBM B;  1YJW Q;  4XU0 A;  1MMN A;  3SEM A;  4J9C A;  5IXF A;  3UPU A;  2ABL A;  2KEA A;  3MP6 A;  4PJO E;  4B9W A;  1AD5 A;  4YTL A;  5GMK j;  2FPD A;  1BB9 A;  1UGQ B;  1KQS P;  3D7S B;  1M9S A;  3CXC A;  4QQG A;  3EAE A;  1YCY A;  2VKN A;  3DB4 A;  1ZUK A;  5J39 A;  1YIT A;  1VQ8 Q;  1ZBX A;  2GFA A;  4CC4 B;  1MGQ A;  2A0F B;  2A28 A;  3CCV A;  1ZX6 A;  2QTX A;  1AWX A;  4BE0 A;  4M7A C;  5FRN A;  3R6N A;  1QWE A;  1M3A A;  3VUB A;  5AT1 B;  2EVR A;  2EQI A;  3L2R A;  2EQU A;  3CME A;  2LT1 A;  2PVD B;  3OYE A;  1S72 A;  1JU5 C;  3J80 E;  2A3L A;  5HY6 A;  3PE0 A;  5CVI A;  5CKH A;  1XJW B;  3L42 A;  2LQW A;  2K3B A;  3JCM J;  1YIJ T;  1WHM A;  3H0F A;  1JXO A;  3OYB A;  2DTI A;  4BE1 A;  2KXC A;  1QW1 A;  2P4R A;  2LJ3 A;  3HPW A;  3SHW A;  1GFD A;  4M75 G;  4HCB A;  5GAN 8;  5A0L A;  3U23 A;  2FG0 A;  4KGX B;  3E19 A;  5A2Q E;  3CD6 Q;  3QG1 A;  1OI1 A;  2WSE E;  3EHR A;  2EQM A;  5GAN e;  4RTY A;  4D8K A;  2DKG A;  4RTW A;  2FYK A;  1OPK A;  1TOV A;  3GNG A;  1VYV A;  5GMK m;  2CP0 A;  1R8O B;  3G71 T;  1VQ9 A;  2HMA A;  3JCM h;  1KHC A;  1K0S A;  1TUG B;  5LL6 S;  3MPU B;  2DIG A;  1TWB A;  3G4S T;  1BI1 A;  3TCJ A;  3M9Q A;  5FWB A;  4C92 F;  1G8X A;  3KBG A;  3CCL A;  3EG0 A;  4C8Q D;  3JB9 I;  1QVF S;  3C0C A;  3VS1 A;  4M7A D;  1WXU A;  4EMH A;  1N8R R;  2GTJ A;  2ED0 A;  4RCB A;  2GGR A;  5GAO r;  4J7F A;  1YI2 Q;  1YJ9 A;  2L3Q A;  3NMZ C;  4A4G A;  3CCU T;  1PWT A;  1X6O A;  2DZC A;  4ZTJ A;  1VQL T;  1PHT A;  1OQK A;  1YP5 A;  4E7J A;  3VS0 A;  3I56 T;  2RO0 A;  4BAC A;  3UF4 A;  4M75 C;  2MI6 A;  3QII A;  3CCQ Q;  4ZNX A;  4FSS A;  1B34 A;  3NTH A;  2DER A;  1ZSZ C;  1SSH A;  4Y92 A;  2EFI A;  1OU8 A;  3CC4 T;  1KQS A;  1D0X A;  3I5S A;  4FYW B;  3MJX A;  2FVU A;  4WF2 A;  5LJ3 e;  1NZ9 A;  4J9H A;  3A8L B;  5KE2 A;  2ROT A;  3CCR Q;  1T3S A;  1NLO C;  2QQS A;  3LLR A;  4XTY A;  1VYU A;  4A4H A;  2HL3 A;  2G3R A;  3JAM E;  4PK4 A;  2A7Y A;  4Z88 A;  2EJ9 A;  3OS1 A;  3CEY A;  4E2F B;  1VQO A;  1NJI U;  3OBY A;  1RLP C;  2DEU A;  3A5Z B;  5KYX B;  4C8Q C;  4HCZ A;  5CKF A;  2MWP A;  4QVD A;  1VQ6 A;  2X35 A;  4L6V 5;  3T9N A;  1RL2 A;  5FU7 C;  1ZUY A;  5FRM A;  2R58 A;  3V8K A;  2KR3 A;  1YI2 A;  4PLL A;  3OW2 S;  2L5Q A;  1PM3 A;  3M0S A;  3MP1 A;  1Q7Y R;  2KAF A;  2GQV A;  1NJI R;  1TG0 A;  2KRS A;  1K8A U;  3PNW C;  3X24 B;  2D9T A;  5GAO q;  4KUD K;  3CCQ A;  3FC3 A;  4M75 D;  3C95 A;  2C0T A;  3TSZ A;  2E5Q A;  3HP9 A;  3WVD B;  5GAM h;  4QQ6 A;  2EPD A;  3I55 Q;  1VQ9 Q;  4M77 E;  1VQK A;  5CO7 A;  1VIF A;  1VQ6 Q;  4F7U A;  3CCJ T;  4F7U B;  5L23 A;  4PJL A;  1R0C B;  3CC7 Q;  1YFN A;  1KIK A;  1M1F A;  4MZP A;  1BK2 A;  5GAN 4;  1MMG A;  3CCR T;  1K73 U;  1ZLM A;  1JBM A;  2M02 A;  3RUX A;  4F7U F;  2XI9 A;  4AG1 C;  1WNL A;  1M1K C;  1VQ5 Q;  4HT9 A;  2CKK A;  3GPL A;  4O6J A;  2KYB A;  4PKC C;  1SF9 A;  4LDY A;  3JSC A;  1Q81 R;  1SPK A;  2C0O A;  2HQE A;  4RTU A;  4R55 A;  4J6X A;  4M77 B;  4IUT A;  4L5G A;  2AK5 A;  1N8R U;  1WLP B;  2GTO A;  2COY A;  5GAM j;  3RER A;  1RAG B;  1K73 R;  3RKY A;  4C92 A;  3FB9 A;  2HD0 A;  1H8K A;  4KGV B;  1YIT Q;  3DLM A;  2V1Q A;  2RJD A;  1OEB A;  4J8O A;  1Z9Q A;  1X43 A; 
#chains in the Genus database with same CATH homology
 2JUF A;  2DPP B;  2HBP A;  2JOY A;  4Q5W A;  3A8M B;  3UT1 A;  3OYC A;  3JB9 H;  3QUI A;  5AYF A;  2PVG B;  3OYJ A;  2C06 A;  3QYG B;  1W2B S;  1Y96 A;  4PLI A;  1KQS S;  5GAN h;  3LW5 E;  1W4S A;  5GAM e;  1BI2 A;  4TVR A;  2QA4 A;  4MMK A;  2DXB A;  5C6S A;  4RG2 A;  4BB7 A;  2RB6 A;  2RJF A;  2K3X A;  4JRI A;  1N9S A;  2KSS A;  2LVM A;  2PVO B;  3OMC A;  3ER0 A;  4XTU A;  4MZM A;  5M9O A;  4C8Q A;  2ZGW A;  4XU2 A;  3JCM e;  4X9C A;  4XK8 E;  2RI3 A;  1LNX A;  4E7K A;  1VQ4 A;  2OTL T;  1DJ7 B;  2X4X A;  4N4G A;  2R5M A;  4J6W A;  4RKU E;  3MCA B;  5DM7 R;  3OS0 A;  4E47 A;  3TU4 K;  4OMF B;  4IUP A;  3OYD A;  2EJF A;  1WJS A;  2XK0 A;  3E9F A;  3O8V A;  2QA4 T;  1M1K U;  5IAY A;  4BE2 A;  1VQK T;  1M4Z A;  3JCM X;  3SD4 A;  4ZTF A;  1K9M C;  2PQW A;  1G3S A;  2HQX A;  4JS4 A;  2QQA A;  5HKC A;  3OYK A;  2K5L A;  2R5A A;  1QVF A;  1WPY A;  1FWZ A;  1PSF A;  1VQ4 T;  4P5N A;  2OTL A;  3JB9 F;  2XHC A;  3OS2 A;  5I2M A;  4RMO A;  3CCM T;  3C4S A;  4JRK A;  2DXT A;  5GMK i;  2CGH A;  1KQ2 A;  2B8A A;  3JCM g;  2PUO B;  3V8L A;  4KT0 E;  1VQP A;  2ZPH B;  5D6Y A;  4V2S A;  2YLB A;  2BIV A;  5L8R E;  4GY5 A;  5DY9 A;  2PUK B;  2K4Y A;  4OB1 B;  1QVG A;  2P0K A;  4RG8 A;  2VUB A;  3QHS A;  2RHX A;  3I55 A;  2FL7 A;  3G4S A;  3JCM W;  4C92 B;  4M7D B;  2RJC A;  5FU6 C;  4M7D A;  4DQ2 A;  2EKO A;  4QVZ A;  3QDR B;  4XTW A;  3QZ5 B;  3BY7 A;  5A0G A;  1QP2 A;  4EMK B;  5GAN 7;  1Q81 U;  1NJI C;  3DB3 A;  3H8Z A;  3MEA A;  4M7A B;  3CCL T;  1VQ7 A;  4N4I A;  2P0P A;  3BDL A;  4OVA A;  4X9D A;  3WXM B;  3SWN C;  1M90 C;  4MDX A;  2LRQ A;  4BD3 A;  2X4W A;  4LDW A;  2AHJ B;  1VQM T;  3MET A;  4FU6 A;  3CCE T;  3I55 T;  4A4E A;  2KDS A;  1N6A A;  4VUB A;  3ASK A;  4OP0 A;  3PTA A;  1UB4 A;  1WJR A;  3QO3 A;  3LGF A;  3JB9 G;  1VQ6 T;  4C0G A;  4C0Z A;  4ELY C;  2V8J A;  3CBM A;  3M55 A;  3DLL A;  3VU3 C;  1VQN A;  5LJ5 g;  3NFC A;  3HRS A;  3LYI A;  4J5Y A;  4QVC A;  3JB9 D;  1G3W A;  1I4K 1;  1YJN T;  4ZGD B;  3OYN A;  3OYY A;  2XG8 D;  3INZ A;  1U8R A;  3CC7 T;  4M75 A;  2LT4 A;  2P0Q A;  1VIE A;  4A54 A;  4C92 E;  3G6E A;  3CME T;  5I2S A;  4M7D E;  5CQX A;  3V7R A;  5CKD A;  1K9M U;  3V8J A;  1XQH A;  4PJO B;  2HAX A;  4PJO A;  2VGM A;  4JDS A;  2EAY A;  1VQ9 T;  2CZ0 B;  4C0F A;  4N4H A;  2F69 A;  3OYM A;  4JRP A;  2X4Y A;  4OGC A;  4M78 G;  3HSB A;  3L2V A;  2F5T X;  4XAX B;  1AHJ B;  5GAM g;  3X25 B;  2RA2 A;  1IRE B;  3CPW S;  4E7L A;  2E41 A;  1WQW A;  4MZT A;  3E9G A;  4LDU A;  3SWN A;  3CC2 T;  1ZQ1 A;  2E64 A;  2IG0 A;  4CI0 C;  3CC4 A;  2E1H A;  1KG1 A;  2MWO A;  1BI0 A;  4QQD A;  1G3Y A;  2E6N A;  1OYX A;  4XQ3 A;  3X26 B;  2DXU A;  4UC4 A;  5GAM f;  3C12 A;  3MHX A;  2JZ2 A;  2RHY A;  4RCC A;  3CCU A;  2K5I A;  3OS5 A;  4C0D B;  3AHU A;  1HK9 A;  1RI0 A;  1Q86 C;  3CPF A;  3HKS A;  4ME7 A;  3OYF A;  4IUQ A;  2LCC A;  1I81 A;  1M5Q 1;  2JTF A;  4KBM B;  4Y91 A;  3L2W A;  4XU0 A;  1BIB A;  3G7Z A;  3RMQ A;  5HK0 A;  2QXF A;  5KE3 A;  3UPU A;  3H6Z A;  5LJ5 h;  3MP6 A;  4PJO E;  5KH6 A;  1KC8 U;  2K57 A;  3VYG A;  4JLI A;  3PT9 A;  1Y7X A;  2JN0 A;  4B9W A;  1Q81 C;  2V8K A;  2YRV A;  1JJ2 S;  4C92 G;  4YTL A;  2QQR A;  5GMK j;  3CCV T;  2LDM A;  3QPH A;  3JB9 J;  1JJ2 A;  1NPP A;  2M0O A;  2O4X B;  3PMI A;  1UGQ B;  3QSU A;  2LC4 A;  2E12 A;  1UEB A;  3OYL A;  3CCR A;  3J7A F;  2KK4 A;  1VQ7 T;  2DXC A;  5I21 A;  3L2Q A;  4ZGJ B;  1QVG S;  1BYM A;  3MEU A;  1M9S A;  5A0D A;  1M1G A;  3CXC A;  4GLK A;  3CXC S;  4QQG A;  3EAE A;  2L3R A;  1YCY A;  3S3N A;  4KUL A;  3FDR A;  3RIR A;  2RK2 A;  1O75 A;  2RM4 A;  3DB4 A;  3LH0 A;  5CQY A;  4C5I A;  5J39 A;  3OSV A;  2XKO C;  1YIT A;  3HRU A;  4E7H A;  3CD6 T;  1JB0 E;  3M5A A;  1ZBX A;  4M7D F;  2GFA A;  1SSF A;  1MGQ A;  5EG2 A;  2ZPG B;  4N0A C;  1YI2 T;  3CCV A;  3A8G B;  3ZFJ A;  2D6F A;  2QTX A;  1X75 C;  4OF1 A;  2H3J A;  3C94 A;  3MO8 A;  4BI4 A;  4D6W A;  4O5V A;  4OB3 B;  3CCM A;  4BE0 A;  4DOV A;  3S3M A;  4EMK C;  4LDX A;  4M7A C;  4M77 C;  3SB2 A;  5GAN 5;  1N9R A;  5FRN A;  2HNI A;  2MF2 A;  3CPW A;  3QXE B;  3VUB A;  3SWN B;  3FIF A;  1H3Z A;  1D3B A;  3VUZ A;  2DJZ A;  5DLQ E;  2EQU A;  3P8D A;  3L2R A;  3FJP A;  4M78 C;  2LT1 A;  4FIB A;  4PL6 A;  3G6E T;  2PVD B;  3RMS A;  3OYE A;  1S72 A;  2V8I A;  2CS7 A;  2FB7 A;  2A3L A;  5HY6 A;  5GAN 6;  4F7U E;  2X4J A;  5LJ5 j;  5CR2 A;  3J80 E;  3CME A;  1Q82 C;  4C5G A;  2DVE A;  1KQ1 A;  5CKH A;  5CVI A;  3L42 A;  1BIA A;  5CK9 A;  4BI8 B;  3JCM J;  5GMK h;  4BY6 B;  1YIJ T;  1VQ5 T;  4XU1 A;  3L1A A;  4M75 F;  3CBP A;  5FRO A;  5LJ3 d;  2DIQ A;  3HFN A;  2P4T A;  1VUB A;  1G3T A;  3OYB A;  4OB2 B;  2EWN A;  1W2B A;  4M78 F;  2DTI A;  2RD1 A;  3VKI A;  2NLU A;  4BE1 A;  2XIC A;  1QW1 A;  3HPW A;  4PJO F;  3QYH B;  4LD6 A;  3JCM Q;  2FHD A;  3A8O B;  1Y07 A;  3M59 A;  1Y96 B;  5D6X A;  5LJ3 j;  3S3O A;  4M77 F;  4M7A F;  3HHT B;  2EQK A;  1G5V A;  4NL3 A;  4M75 G;  4HCB A;  4M7D G;  4XTV A;  5GAN 8;  5GAN 2;  2RJE A;  4A4F A;  1H64 1;  2ZPF B;  3OB9 A;  4J8O A;  4MML A;  4FT2 A;  5A0L A;  3E19 A;  3OYG A;  1X01 A;  3GNF B;  1QVP A;  3RKW A;  5A2Q E;  1EIF A;  3QG1 A;  4JS5 A;  2ZCF B;  2WSE E;  1OI1 A;  2EQM A;  2IVW A;  3V7C A;  3L2Z A;  4C8Q B;  4C92 D;  5GAN e;  5LJ3 g;  2E65 A;  3MP8 A;  2DKG A;  1B34 B;  1YHQ A;  5CIU A;  2FYK A;  3GNG A;  2VGN A;  3HL8 A;  5GMK m;  4XTZ A;  1R8O B;  3LX7 A;  3G71 T;  1VQP T;  1VQ9 A;  4J83 A;  3JCM h;  3GLX A;  2XDB A;  1KHC A;  4C5E A;  3GP8 A;  5LL6 S;  3CMA A;  2WSC E;  1TH7 A;  5FU7 B;  2O01 E;  2DIG A;  3G4S T;  4KUI A;  3QBY A;  1BI1 A;  3TCJ A;  3M9Q A;  4C92 F;  3VV0 A;  2BUD A;  5FLX E;  2CZ1 B;  3KBG A;  3CCL A;  3CCJ A;  4M7A G;  1OZ3 A;  3PMT A;  2KVQ G;  3UDC A;  4C8Q D;  1GXI E;  3JB9 I;  1QVF S;  1N27 A;  2Y4Y A;  3M54 A;  2VV5 A;  5CAI A;  2RK1 A;  4LD9 K;  4PJO G;  3OYI A;  1VQ8 A;  5KCO A;  4M78 E;  5LJ3 h;  2M16 A;  4M77 D;  4C8Q E;  4M7A D;  1JRI A;  2EJG A;  3JCM P;  5CKB A;  4EMH A;  3CCE A;  4RCB A;  3LWH A;  5GAO r;  1BKB A;  1FX7 A;  4PJO D;  5GAN g;  3OYA A;  4IKF A;  4J7F A;  2DZ9 A;  4M78 D;  4ZN1 A;  1YJ9 A;  4M7A E;  1BI3 A;  2YHT A;  4M77 G;  1XNI A;  3JRZ A;  4LDV A;  4A4G A;  3CCU T;  2RHZ A;  2D0Q B;  3LGL A;  4IUV A;  1X6O A;  4Z02 A;  1LOJ A;  3S6W A;  2DZC A;  1VQ8 T;  1XTD A;  2CZ7 B;  5GAO n;  3OSS C;  4Y28 E;  4ZTJ A;  3OY9 A;  1VQL T;  5J3B A;  3NTK A;  5IN1 A;  1YJ9 T;  4E7J A;  3M53 A;  4EPC A;  4XU3 A;  2RO0 A;  3OMG A;  5GAM d;  3OA6 A;  2LNV A;  3I56 T;  4BAC A;  3PIO A;  4M75 C;  2MI6 A;  3QII A;  5IT9 E;  3CD6 A;  3M56 A;  1B34 A;  2GF7 A;  3NTH A;  4J7I A;  3FLG A;  3HFO A;  3M4Y A;  3QJ6 A;  3JCM d;  2JNG A;  2KY9 A;  2PU9 B;  4N0A A;  2I2L A;  4M78 B;  3OW2 A;  1QP3 A;  2EFI A;  4FM4 B;  4ATO A;  2K3Y A;  3CC4 T;  5GAN j;  1WJQ A;  1KQS A;  2GFU A;  1MHN A;  4EMK A;  3UWN A;  2EQJ A;  2FVU A;  1VQL A;  4PNO A;  4C92 C;  4WF2 A;  5C0M A;  5LJ3 e;  4M7D D;  2XID A;  1NZ9 A;  2Y90 A;  1YIT T;  5LJ5 d;  4ELZ C;  2L89 A;  5LJ5 e;  1VQO T;  4X34 A;  3A8L B;  2QDY B;  2QQ9 A;  2E70 A;  3VJP A;  4EDU A;  3OQ5 A;  5KE2 A;  4JRQ A;  1YHQ T;  2OTJ T;  4HA8 A;  5DLO A;  4NOY A;  1LJO A;  3CBO A;  1K8A C;  2QQS A;  3LLR A;  4XTY A;  4C8Q F;  2DD4 A;  3G71 A;  2EIF A;  4A4H A;  4C0D C;  2XD0 A;  4NS5 A;  1V29 B;  3JCM b;  2G3R A;  1U1S A;  3PGG A;  5GAN 3;  4FL6 A;  1VQ5 A;  3JAM E;  3HRT A;  2LQ8 A;  2WAC A;  4A4K A;  3PIP A;  1VQM A;  2A7Y A;  4II1 A;  2EJ9 A;  3RKX A;  2JVV A;  3CEY A;  3OS1 A;  1VQO A;  2R57 A;  1NJI U;  3OBY A;  4A53 A;  5GAN d;  3JCM f;  3A5Z B;  2M1H A;  1Y71 A;  3Q1J A;  4C8Q C;  1Q7Y C;  4HCZ A;  5CKF A;  1U1T A;  2YLC A;  2MWP A;  2LX9 A;  4CRI A;  3EFR A;  4DOW A;  4QVD A;  5D6W A;  1M90 U;  1VQ6 A;  3GIB A;  2DTO A;  2RI2 A;  3TEE A;  1YBY A;  2KMT A;  3CCS A;  1KD1 U;  2DAQ A;  2DK3 A;  2X35 A;  3M4G A;  4JLG A;  4EMG A;  1YIJ A;  1KD1 C;  4F7U G;  4HCC A;  4C8Q G;  4L6V 5;  1Q82 U;  2BKD N;  5J26 A;  4C5H A;  4PJO C;  4HT8 A;  3T9N A;  2EYQ A;  1RL2 A;  2O4X A;  5FU7 C;  5FRM A;  2R58 A;  3V8K A;  5GAN f;  4ZN3 A;  4PLL A;  2E6Z A;  3OW2 S;  2L5Q A;  1YI2 A;  3P8H A;  4J6Y A;  2ZPB B;  2ZZD A;  5CKE A;  3MP1 A;  2DEQ A;  1K73 C;  2QI2 A;  1PSE A;  2GQV A;  2KAF A;  3URG A;  3BFM A;  1YJW T;  2DO3 A;  3KUF A;  3CCS T;  4JJN K;  5CCA A;  1P92 A;  2JTM A;  1K8A U;  3PNW C;  4M75 E;  4L59 A;  2GCX A;  4JUV A;  1NE8 A;  3X24 B;  3CC2 A;  3A8H B;  3ZEH A;  5HK3 A;  3MEV A;  5GAO m;  2D9T A;  5GAO q;  4KUD K;  1S72 T;  2VXF A;  3BW1 A;  3CCQ A;  3FC3 A;  3QJY A;  3X20 B;  4M7A A;  3ZBD A;  1XOV A;  4M75 D;  5LJ5 f;  2CZ6 B;  1OZ2 A;  3C95 A;  3SFM A;  2QEX T;  3EFS A;  3RES A;  4DA4 A;  2E5Q A;  3NTI A;  5LJ3 f;  3PFS A;  1YJW A;  3OBW A;  3HP9 A;  3WVD B;  5GAM h;  2RH2 A;  2RI5 A;  2VXE A;  4QQ6 A;  4XTX A;  3DKM A;  1D3B B;  1YJN A;  1O9S A;  4M77 E;  1VQK A;  3FRN A;  4FT4 A;  4BUG A;  5CO7 A;  3V7S A;  4M7D C;  3CCQ T;  1VIF A;  1KHI A;  5FU6 B;  4F7U A;  3CCJ T;  4ZGE B;  3JCM V;  3ME9 A;  3X28 B;  1FXX A;  4BI3 A;  4F7U B;  2OAU A;  3CC7 A;  2E10 A;  3QZ9 B;  1Q86 U;  5GMK e;  3WVE B;  3E1S A;  2WSF E;  2QEX A;  4MDW A;  1M1F A;  2DTH A;  2F5K A;  3R6O A;  4MZP A;  3J81 E;  4OGE A;  2KQW A;  5GAN 4;  1Q7Y U;  4IUR A;  1VQN T;  2K2V A;  3M58 A;  3QKJ A;  4M75 B;  4OB0 B;  3CCR T;  1K73 U;  1WQ7 A;  1JBM A;  2CYZ B;  3FEO A;  2LCL A;  2XDD A;  4BDY A;  5GAO l;  2XDP A;  3RUX A;  5GAO p;  2M9U A;  2XI9 A;  3GF5 A;  4F7U F;  1WNL A;  3N5B B;  2VYT A;  1KC8 C;  1M1K C;  4HT9 A;  2CKK A;  3M57 A;  2ZPE B;  3GPL A;  1HXD A;  4O6J A;  2VC8 A;  3F70 A;  2Y4X A;  1UGR B;  2LTO A;  4LDY A;  4PKC C;  4B9X A;  3JSC A;  3VYH B;  3I56 A;  3L2U A;  2DD5 A;  1I8F A;  5KCH A;  1ZHI A;  4IUU A;  3BDU A;  3CMA T;  1UGS B;  2HQE A;  4R55 A;  4J6X A;  3GOX A;  1IZ6 A;  4M77 A;  1M8V A;  4HKE A;  3OYH A;  4M77 B;  3SDZ A;  4E7I A;  4IUT A;  4L5G A;  2RHU A;  3TRE A;  3KXT A;  4BDZ A;  1N8R U;  1I5L A;  3JCM c;  2OTJ A;  4M78 A;  5GAM j;  1UGP B;  1N8R C;  3RER A;  2LQK A;  3RKY A;  1WGS A;  4QW2 A;  3LWI A;  5GMK l;  4C92 A;  2XU8 A;  4NL2 A;  3FB9 A;  2HD0 A;  2MMP A;  2RHI A;  3P8B B;  3DLM A;  2QQB A;  3MEW A;  2RJD A;  1NPR A;  2ZPI B;  2K5F A;  4R56 A;  2L8D A;  4FSX A;  4BY6 C;  2MAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...