2LCCA

Solution structure of rbbp1 chromobarrel domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
EDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT-rich interactive domain-containing protein 4A
publication title Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lccA00
2L89A 2RJFA 3S3MA 2DIQA 3OYIA 2M16A 3L2VA 2X4YA 3MO8A 3UT1A 1H3ZA 2L3RA 4NS5A 3L2WA 2E6NA 3LH0A 3NTHA 2EQMA 1WJRA 3SD4A 3DB3A 2RI5A 2YRVA 3QKJA 2X4XA 2R5MA 5KCHA 4C5HA 2RI3A 2PQWA 3FEOA 3PFSA 4IUVA 4ZTFA 4N4IA 3LLRA 4IUQA 2X4WA 2RHUA 3NTIA 3QIIA 4FL6A 5FRNA 2NLUA 4QQDA 4A4GA 2G3RA 1WJQA 2RJDA 3FDRA 4C5IA 3OYLA 3H8ZA 3P8DA 1N27A 5J26A 4BE0A 3OYAA 2E5QA 3META 4II1A 4B9WA 2R58A 2F5KA 4Z02A 5M9OA 3DLMA 3S6WA 4N4HA 3OYNA 4PLIA 3LYIA 4ZTJA 2HQEA 4C5GA 3LGFA 3OYMA 3LGLA 3MP6A 3OYCA 4LD6A 2VYTA 2IG0A 2K3XA 3OMCA 3L2RA 3FC3A 2RJCA 2GF7A 4X34A 4BDZA 4QQ6A 3Q1JA 2LVMA 3EAEA 2QQRA 1WJSA 3OYBA 3KUFA 3UWNA 3H6ZA 5FROA 3MP8A 2LTOA 2BUDA 2RI2A 4E7HA 2DAQA 3OA6A 2EQUA 1WGSA 3ME9A 4PLLA 3OY9A 3FLGA 1SSFA 3QJ6A 2RJEA 2O4XB 3ZEHA 3OYFA 1OZ3A 3MEVA 4OVAA 2XK0A 3OYKA 2RO0A 2L8DA 3C4SA 3M9QA 4QVZA 5D6WA 3DB4A 4IUPA 5D6YA 5C6SA 3E9FA 4UC4A 5IN1A 4C5EA 2P0KA 3OYDA 3E9GA 3P8HA 1KHCA 3OYEA 2FHDA 2MWPA 3L2UA 5KCOA 3MEAA 4GY5A 3F70A 2M1HA 4HCZA 4QQGA 1OYXA 2RHYA 2JTFA 1RI0A 2RHIA 2LDMA 4BE2A 3PMIA 4FU6A 3OYHA 2RHZA 3MEUA 4BE1A 3QBYA 2QQSA 4A4EA 2EFIA 3OS1A 5FRMA 2GFAA 4BACA 1G5VA 3O8VA 5KH6A 3OS0A 4E7JA 2WACA 3L42A 3ASKA 2K3YA 2X35A 3OYJA 5J39A 3GOXA 3L2QA 3CEYA 1OZ2A 2MWOA 4A4HA 3PMTA 4RG2A 4E7KA 4A4FA 2JZ2A 4B9XA 4EDUA 3S3OA 5CIUA 3OB9A 4E7LA 3S3NA 3MEWA 4N4GA 2O4XA 4IKFA 4Q5WA 4BD3A 2LRQA 2GFUA 5KE2A 2BKDN 2DIGA 2R5AA 2HQXA 5KE3A 3OMGA 3MP1A 1XNIA 1OI1A 2CKKA 3LX7A 4QW2A 4IURA 1MHNA 5C0MA 2EQJA 5D6XA 3BDLA 2B8AA 2LCCA 3OYGA 4L59A 4BDYA 3OQ5A 3NTKA 2BIVA 3PNWC 2RHXA 4CRIA 2M0OA 2EQKA 4IUUA 4IUTA 3OS2A 2R57A 2EKOA 2XDPA 2D9TA 4E7IA 5IAYA 4PL6A
chains in the Genus database with same CATH superfamily
1ZA1B 1X75C 2V8IA 2JM9A 4MMLA 1G3TA 1ZUKA 3X20B 1VQ4A 1K9MC 1QKXA 2NWMA 1E6HA 1WHKA 2RM4A 2DFUA 1M90C 1K8AC 3NMZC 5L8RE 4D6WA 2PUKB 1YIJA 2P84A 2KXDA 3CCJA 5GAMg 2QA4A 1VQ7A 2A36A 2EYXA 4F7UE 3OYMA 2LNVA 3LGLA 2FEIA 2JW4A 1RI9A 2I0NA 5HK3A 3FC3A 1JJ2S 5A0DA 1D0YA 2DXBA 3EAEA 5CAIA 1TWBA 2RI2A 2YWWA 3CD6T 3EFOA 1QCNA 2O4XB 5GANe 3M0RA 1M3BA 3M4GA 1VQPQ 3RIRA 1LOJA 2DM1A 1G2BA 1SHGA 5DLQE 2AKLA 4XQ3A 5FW9A 1QVFS 3G6EQ 3CCQT 4M78B 2ZPFB 1G3YA 4M77C 2BZYA 5CCAA 2QYZA 2ZPBB 4M75E 4E7ZA 3VJPA 5LJ3e 1K9MU 2KROA 2E70A 4M78D 1M90U 4ORZA 3G71T 1OZ2A 4A4HA 2ED0A 1K8AU 5KYUB 1K73C 3EFOB 4E7LA 4F17A 4RTTA 2LRQA 1W2BP 1D0ZA 1Z9ZA 2DIGA 3MP1A 1UUEA 2LJ1A 3HRTA 3MHXA 1X27A 3CCUA 4L59A 3CBMA 2KSSA 1BK2A 2DO3A 4C92B 2RHXA 1OU8A 2D6FA 1KC8C 2XG8D 4X1VA 4M7DG 1KQSA 3PT9A 3M57A 3RESA 4E7IA 2CP6A 3URGA 3SFMA 4C92D 4J9FA 1U1SA 2HMAA 3T9NA 4EPCA 2LZ6B 2NYSA 4IIMA 3M54A 3TCJA 2DK3A 4C8QE 3GIBA 2YSQA 1YWOA 5LJ5d 2NLUA 4QQDA 3GNGA 3JCMQ 3CC7Q 4QVDA 1LCKA 3OYAA 4FYXB 2X51A 1AZGB 3QYHB 1VQLQ 5KYNA 1UE9A 1GCQC 1M8MA 2KXCA 2GF7A 3OBWA 1K73U 3REAB 3E1SA 4QQ6A 1FX7A 1NEGA 2LQ8A 4PJNA 2OTLA 2BUDA 1UB4A 4PLLA 1OX9A 3OYFA 1SSFA 1FYNA 1X6BA 3S3OA 2YT6A 1KD1C 1MV3A 1VQ8Q 4AFSC 1KC8U 3JCMb 3E9GA 2VB6A 3X28B 1JB0E 1GRIA 2XD0A 5D7UA 2ZPHB 8AT1B 2RHYA 1VQ4T 3G4SA 4BE1A 1RLPC 4A4EA 3EG9A 3OS0A 3JB9F 2WACA 1BYMA 4HCKA 3RUXA 2IVWA 1YIJT 3CCJT 5EG2A 3PVLA 2ZPGB 5GAOm 1VQ7T 3M59A 3CMAA 4EDUA 1LPLA 1RADB 2JUFA 1Y57A 1Q82R 2FZKB 2M9UA 2DERA 5LJ5j 1JJ2P 1TSFA 1IB8A 4Y92A 3MJXA 2FZGB 2P0QA 2PVOB 1Q81R 3ULRB 2RQRA 2C0TA 3VS3A 4J8OA 1KD1U 3VV0A 3GF5A 3EG9B 2E6NA 2RI3A 2DTOA 5CQXA 3TSWA 2X4WA 1QVFP 2E10A 3QUIA 1OQKA 2ENMA 4FL6A 3WVEB 2D8HA 3P8DA 5J3BA 1W2BA 2ZCFB 1UHCA 4J7FA 1ZX6A 4DQ2A 3A8HB 1WIEA 1M5Q1 4HXJA 1H641 5GANd 1WJSA 3VS6A 5GMKe 2KRSA 3CCUT 2DJQA 4ZGDB 3NHNA 1YJWQ 1W4SA 1M2VA 1X69A 1NLOC 1OEBA 3JSCA 7AT1B 4HVVA 3JB9I 5CKDA 2E4HA 2CP3A 4M7AA 4JJCA 1M3CA 4GY5A 5LJ3d 3ER0A 1KHIA 2JTFA 1M1GA 3OYHA 3N5BB 3QBYA 2EFIA 4J7IA 2M51A 2QQ9A 3CCEA 3FB9A 2KR3A 5CR2A 3EGXA 4C0FA 2KNBB 3M5AA 5CIUA 3MEWA 2MPXC 2R5AA 5KE3A 2CKKA 2RF0A 4M77F 2EQJA 1RAFB 1PRLC 1KFZA 1K9AA 4M75C 2LCLA 4FSSA 3UPUA 1PC0A 4J5YA 4M7AB 4XU1A 1H92A 5GAN8 5GANf 3A8OB 2V8JA 1XJWB 3MO8A 4M7AD 2QQAA 5GANj 1VQ6A 4OMQA 4NOYA 2X3XD 2LJ0A 3H41A 3I56Q 1QVPA 1D1CA 1WHGA 3EFRA 1V76A 3G4ST 4JUVA 2RNAA 2YHTA 4GLMA 5FRNA 1AHJB 3HHTB 2OAWA 4KULA 1MMNA 3CXCS 2EWNA 1KK7A 2Y4XA 2Z0WA 4KGZB 2RB6A 3CC2A 4L5GA 1YCSB 5GAOq 2HQEA 1E6GA 1CSKA 3CMAT 2X3WD 5LJ3j 1JJ2A 3E19A 2CDTA 2DL5A 4JRPA 3CQTA 4X34A 1MMGA 4C8QC 3OYBA 1O75A 3QJYA 3V7SA 2DL3A 1XTDA 1N8RC 4BE2A 2CUBA 1M30A 2ABLA 3C4SA 4R56A 4PJOB 1ZBJA 1PKTA 3OYDA 1WHMA 2E3IA 1HJDA 4HVWA 2FHDA 2DL7A 1QVFA 4LUDA 2HZYA 4PJOD 1TTHB 3QG1A 1SHFA 1VQ5A 2QDLA 4EMKC 2J7IA 3EH2A 4PK4A 2E12A 2LDMA 2LJ3A 5FWBA 2E1HA 4FW1A 3PIPA 1VA7A 4GLKA 2DF6A 1G5VA 4MMKA 3FIFA 3JCMW 1YI2Q 5FU6C 3CCRQ 1U3OA 2WSEE 1RLQC 1AZEA 4EMGA 1TXQA 1VQ9Q 2EJ9A 4JRQA 3JCMP 3DKMA 1TUGB 2JXBA 3LX7A 2A08A 3GP8A 3P8BB 3JCMg 1B07A 4XTXA 1TG0A 2DE0X 5I11A 1YJ9A 5IAYA 1K9MR 3V7CA 2JOYA 4OGCA 4O6JA 3OW2S 1M90R 1KG1A 1K4US 5IHNA 1N8RU 1K8AR 2ROTA 2WSCE 3EG1A 4DBQA 3CC4Q 1M8VA 1GCQA 1FMWA 1EZZB 3SD4A 2PUOB 1HXDA 1QVGS 5GAN6 1TU0B 4ZTFA 1RABB 1VQ9T 1QP2A 5GAMe 5CO7A 4DEXA 1NE8A 3VYHB 3CCET 2CZ7B 2PTKA 2DL4A 3JCMX 2M0YA 4CC2A 2R58A 2F1LA 3SB2A 2OJ2A 3LYIA 1N9RA 1M4ZA 2PVDB 4R55A 1QKWA 2JT4A 3CC4T 2DBMA 3CCQA 1OV3A 2FL7A 4RUGA 4M7DB 1N6AA 2XICA 2QTVA 3QHSA 1ZSZB 4XTWA 2JJ9A 3J81E 2CP2A 2F2WA 4M7DD 1UG1A 3OYKA 2L8DA 2VXEA 1JEGA 3G71A 1D1AA 1AT1B 2VGMA 1T0HA 3J80E 1Y7XA 1VQPA 5GAOn 4OMMA 1OYXA 3AT1B 1K73R 4C0DB 2DNUA 1VYTA 5DLOA 2VC8A 3G6EA 2GQVA 3OS1A 1ZQ1A 2HNIA 2EYYA 3ASKA 5GJWB 5J39A 4F7UF 1Y96A 5HKCA 4XU3A 3CC2T 3CXCP 1KC8R 3OB9A 3S3NA 5KE2A 1VIEA 2QXFA 4BDYA 1X43A 4JLIA 2QQBA 4XTYA 4IUTA 1NG2A 3L1AA 2DIQA 3OYIA 5GMKj 3L2WA 1V1CA 3QYGB 2O9VA 4PJLA 1SRMA 2R5MA 1Y96B 1WHJA 4M75F 1B3QA 3QIIA 3I35A 2AK5A 2CYZB 2CT4A 1G3SA 4HCCA 3VS7A 2ECZA 3QDRB 1SKUB 4XTUA 3VRYA 3CC7A 3QO3A 1T3SA 1UGSB 3D7SB 1KD1R 2QK0A 4LD6A 1VQLA 2X4JA 4JJDA 4ZN3A 4AFUC 1VQMQ 4AFZC 4OB3B 5GAOp 2LTOA 3MKDA 1JXMA 3JB9J 2O2OA 4BY6C 3OY9A 2DXUA 2J6FA 2KVQG 2XK0A 1YJ9T 1Q86C 5GAOr 4QVZA 4IUPA 2KT8A 4Z8AA 4UC4A 4A54A 2ED1A 3OW2P 3M0PA 2ESWA 1PSFA 1VQ8A 3A8MB 2K2MA 4C8QF 1BIAA 2BE9B 4M77G 2EYQA 2EKHA 2DMOA 1GFCA 4FU6A 5GMKm 2DYIA 3GNFB 2CP5A 3M0QA 1QVGP 3V8LA 2KDSA 3QSUA 1W70A 1BU1A 4B6MA 2AKKA 1G8XA 4RTXA 1TS9A 1YNZA 2P4TA 4C0ZA 2QTXA 5C0MA 1RACB 1X2KA 2EQKA 4DBRA 1YHQQ 2KE9A 4M78E 2XI9A 3ZL7C 2C0OA 2HDAA 2EBPA 2IIMA 2L3RA 1VQPT 5GAMd 2JS0A 3DB3A 2RI5A 4IIOA 1O9SA 4IUVA 4F14A 3VYGA 2GTOA 2PNIA 1WHHA 3CXCA 3G6ET 1MMAA 3FDRA 5A0GA 4XK8E 2PU9B 4QT7A 1VQNQ 2E5QA 4TVRA 2VXFA 4J6YA 1YHQT 1BB9A 4C92E 1S72Q 2VUBA 2FPFA 2RN8A 2E5KA 2RJCA 3VS1A 1K0SA 2YLCA 2QQRA 1UJYA 2DETA 4FYVB 2DEUA 4HA8A 1RAEB 4KGVB 2DPPB 3HPWA 3SWNC 1M1KC 1VUBA 1YJWA 5D6YA 1NYGA 2CZ6B 3PTAA 4WCIA 4C5EA 1R77A 3R6OA 1MNEA 1VQNT 2HL3A 3M0SA 1AOJA 4RTVA 2K57A 3UA7A 5LJ5h 2HKNA 4JS4A 3LWHA 4N0AA 4RKUE 2HQHA 3L2ZA 1S72T 2KYMA 1GCPA 4J6WA 4V2SA 2QQSA 2MI6A 4BACA 1PKSA 3J7AF 3CCMQ 1X2QA 5FU7C 3CC7T 2DVJA 4FYWB 5GAMj 4Y91A 1BI2A 1ZSGA 3H9NA 1VQLT 4QW2A 1WZOA 2DD4A 2LCCA 3VUBA 3X25B 1NPPA 2LT4A 4GBQA 1NBEB 2M0OA 5IH2A 2KGTA 3GPLA 3OW2A 3DLLA 2L3QA 2A37A 4RMOA 2M16A 3L2VA 3M0UA 2DYBA 1M1KU 5LJ5f 3EG0A 3I55Q 1QVGA 1VQ8T 2OTJQ 1JRIA 2GBQA 1I81A 1I5LA 3H0IA 2G6FX 2K5LA 3A98A 3PFSA 1AWXA 1IRXA 3I56A 3HL8A 1WX6A 4C5IA 2E41A 4R0KA 5J26A 1N27A 3META 1Q95G 1K0XA 2VKNA 3DLMA 4ZN1A 5GANg 4ZTJA 1HSQA 1HK9A 1N8RR 3OYCA 1U06A 3Q1JA 4ELYC 4FT2A 1A0NB 2MMPA 3I55T 3TREA 2OTJT 5I22A 1FMVA 1R0CB 2O88A 2BE7D 4ZNXA 3UF4A 1M2OA 5I2SA 3MEVA 2X9HA 2RD1A 4F7UG 9ATCB 4LD9K 2LX9A 3DB4A 3REBB 1V29B 5IN1A 2ROLA 4BB7A 3OYEA 4EIKA 3L2UA 4CC4B 2DZCA 5HY6A 5IXFA 3ZFJA 4XTZA 1FWZA 3NFCA 3VS4A 4PJJA 5FLXE 2EW3A 5GAN2 2JMCA 2VWFA 2A3LA 3PMTA 3R6NA 1NLPC 1ZUUA 5GANh 2KRMA 3MCAB 5LL6S 3H0HA 2LQKA 3RERA 3JCMe 2WSFE 1YI2A 3CCRA 1XOVA 2H8HA 4M75G 3OYGA 2KQWA 4XU2A 5D6XA 1VQ9A 5IT9E 5L23A 1IHWA 5KYXA 2EJGA 2XKOC 3JB9D 1DJ7B 4A53A 4AT1B 3CCSQ 3BFMA 1YJWT 1QCFA 1RAHB 5LJ3h 4HCBA 2LCSA 3HRSA 4J9BA 4PFOA 3PE0A 2OTLQ 1M2VB 1WJRA 4Z88A 1ZBXA 3CC4A 1Y0MA 2FO0A 3FEOA 1BBZA 4N4IA 3HRUA 3NTIA 2FYKA 2HL5C 5A0LA 4KUIA 1M3AA 4C92G 3H8ZA 1EIFA 2DRMA 3CPWS 4M78C 4YTLA 3VU3C 4KT0E 2K5FA 4RCCA 3OYNA 3H0FA 5KYXB 1PNJA 2VYTA 4C8QG 4M7AE 2CSQA 3EG2A 3OMCA 1NZ9A 2LC4A 4BDZA 1YJNQ 3EGXB 1YBYA 2DXCA 2F5TX 2NUPA 4D8DA 2FVUA 5DM7R 2RJEA 4FW2A 2RQVA 3JCMJ 3VS0A 2D1XA 3I9QA 5LJ3f 2YXYA 1YITQ 4C92C 1GL5A 1OPKA 1N5ZA 4AG1C 1YWPA 4MZMA 2KEAA 5IHIA 3PMIA 4JJBA 2NUZA 2RHZA 4LNPA 4M77A 2EGAA 3I56T 4E7JA 2CP0A 2FRYA 1U8RA 1Q82C 3OBYA 1TUCA 4J83A 2O31A 2JZ2A 2EGEA 2JTMA 2MK5A 2LQNA 2O9SA 1K76A 4Z89A 2SEMA 4BD3A 2L0AA 3OMGA 1MHNA 4PJOE 1NPRA 2DTIA 2PVGB 5CQYA 3OQ5A 2KMTA 3MPUB 2BIVA 4LDXA 4FM4B 5CKEA 2COYA 4PL6A 3VRZA 2E65A 2GQIA 1IO6A 3RNJA 1SF9A 1MMDA 1MNDA 4M77B 2KAFA 1J3TA 3AHUA 3JB9H 4JPBW 2FG0A 2YRVA 2X4XA 4C5HA 5ECAA 2EYWA 2L3PA 4M77D 2ZPIB 2D0NA 4FYYB 2MAMA 4JLGA 2YUPA 3SWNA 4RTYA 1ARKA 3S6WA 2J06A 4N4HA 1I0CA 4LUEA 2QEXQ 1Q82U 2P4RA 2VVKA 3PIOA 1YI2T 1S1NA 1EX4A 3CCRT 2FRWA 3VKIA 2KI7A 2DXTA 1UDLA 3A5ZB 4KH1B 4E7HA 4J9IA 3ME9A 1X6OA 1VQMA 4FSXA 3IQLA 1KJWA 4DBHA 1WA7A 3V7RA 5D6WA 4WTOB 1X01A 4LDVA 2EIFA 5GAOl 2K3BA 2XU8A 1D0XA 2Y4YA 4JRKA 1Y71A 4QQGA 2IPOB 4HVUA 2CGHA 3PVQA 1IXDA 2RA2A 4HT9A 4P5NA 1WXBA 1UJ0A 3OYJA 2LQWA 2JNGA 2QASA 2MWOA 4M7DE 4RG2A 4E7KA 1VQ6Q 1PRMC 4B9XA 5HCKA 3CPWP 4OB2B 3CCVQ 2QGFB 2A28A 2B8AA 1JU5C 3JRZA 2GTJA 3NTKA 2JTEA 4CRIA 2CUDA 4IUUA 4OMFB 2DX1A 3OS2A 3QZ5B 3BE3A 2XDPA 4A4KA 2CREA 3EHRA 1EFNA 1W6XA 1OOTA 1YHQA 3EHQA 2HD0A 2J6KA 2KY9A 3CCVT 3ZBDA 2XDDA 4IUQA 1IHVA 1R8OB 2RHUA 4F04B 1PM3A 3HSBA 3QDFA 2RK2A 1PWTA 4AMCA 1PHTA 1UEBA 4RTWA 5M9OA 2DILA 3RMSA 1BIBA 4PLIA 4J9GA 1M9SA 1WNLA 3MP6A 1OULA 1VQNA 4RG8A 4PNOA 2LX7A 2COZA 1M1KR 2KRNA 1M27C 3KUFA 1S72A 3OA6A 1RAIB 2FZCB 3ZEHA 1MUZA 4M78F 2B86A 4OVAA 3LH5A 4OB1B 2XHCA 4O5VA 3NGPA 1AEYA 1WYXA 3VS5A 2P0KA 4F7UA 3INZA 1VQOQ 2DZ9A 5GMKi 4M7AC 4XAXB 1RL2A 3MEAA 2C06A 2F69A 1E7OA 2HKQB 4OGEA 2K4YA 1RI0A 2RHIA 4DOWA 2AT1B 3CMEQ 3CCLQ 1KQ1A 1QP3A 2GNCA 1WHLA 2KBTA 2H3EB 3CBOA 4DEYA 3OYYA 3O8VA 2COWA 2K3YA 1MV0B 2X35A 4C92F 3EG3A 3CCMA 1B7TA 4PJOG 1C6VX 3CPFA 3JCMV 2FB7A 4N4GA 3M0TA 2O4XA 4WF2A 3HP9A 3CD6Q 2JN0A 2CZ0B 1VQOT 4IURA 4F7UB 2YUOA 2C0IA 4M75A 4OMOA 5FWCA 2EAYA 3CMET 4HT8A 3CCLT 2EKOA 1VQMT 2MCNA 1WPYA 2HSPA 2K2VA 4M78A 3G7ZA 5I21A 1U1TA 3CCQQ 2CS7A 2MIOA 4LDYA 4ELZC 3NTHA 1NJIC 4MDXA 3RMQA 2MYSA 2Y90A 4PJOC 1U5SA 3RR6A 5KYUA 1Q7YC 3I55A 3O5ZA 1PSEA 2OTJA 3G71Q 1X6GA 3EGDA 3CPWA 1T0JA 5GAN3 3OYLA 1OX8A 2VGNA 1H8KA 2MOXA 3FRNA 4C92A 4C5GA 1LNXA 4M75B 4JS5A 1FMKA 2VASA 2IG0A 3HFOA 1Q86U 1C1AA 2K3XA 5LJ5g 3I5SA 4JZ4A 4C8QA 4M75D 4FCYA 1WGSA 3FLGA 4K11A 2RMOA 2W10A 3WXMB 5GAMh 3TU4K 1GBRA 5C6SA 5KYWA 2E3HA 1BCMA 3RKYA 3EGDB 4QKUA 3QZ9B 4PKCC 4LN2A 4ZGEB 2QG9B 2DJZA 4EMKA 1WFWA 3VUZA 3MEUA 1NJIU 4ESRA 2RQUA 4OMPA 3TQ7P 1QLYA 5DY9A 5KH6A 2MF2A 1QW1A 4ME7A 5AYFA 1Q7YU 3QWXX 3GOXA 2DL8A 2HCKA 1VQKQ 4C8QB 2YRDA 1OPLA 2HSEB 3QWYA 1YFNA 3EGUA 4BI8B 3KFVA 1SRLA 2BKDN 2ZPEB 4C8QD 2HQXA 2HAXA 2AZVA 1UGRB 2EGCA 2LT1A 4JZ3A 5KYWB 1PCXA 2KK4A 3HFNA 2RPNA 2FPEA 5GAMf 1BKBA 5KYYA 2K79A 4EMKB 4M7DC 2CT3A 2DA9A 2L89A 2RJFA 1F1BB 3QXEB 1ZSZC 1VQ4Q 2HBPA 1RAGB 3CCSA 2E64A 1H3ZA 1I1JA 4X9CA 1VQKT 1CKAA 1I07A 3OSSC 2EQMA 2M02A 2GGRA 5EC7A 3QKJA 1LJOA 5FU6B 1YIJQ 1KQ2A 1KIKA 5GAN5 3CCJQ 2K9GA 2QA4Q 4A4GA 1WJQA 2RJDA 1VQ7Q 3C0CA 2LMJA 2HEQA 1SEMA 4C0DC 4VUBA 4A63B 2AHJB 3CCMT 2EJFA 4EMHA 1GBQA 5I2MA 4OMNA 3UDCA 1OU9A 4KH0B 5KYYB 1NYFA 3UWNA 5GAN4 2RQWA 2AIRB 1UGVA 4J6XA 5IHKA 1YJNA 3QJ6A 3M4YA 4OP0A 4QVCA 2DRKA 2K6DA 3KXTA 2QA4T 4M4ZA 8ATCB 3A1PA 1WI7A 3EH1A 1YITA 2W0ZA 2L2PA 3U23A 4J9EA 4LDUA 3RKXA 1H3HA 2GCXA 4ZGJB 3X24B 4XTVA 2YUNA 3L2QA 5HK0A 3A8GB 6AT1B 5LJ3g 4M7AF 5CVIA 4PJMA 4D8KA 3M58A 3CCUQ 2F2VA 1PD1A 2DEQA 3BDLA 4DOVA 4MDWA 2K7AA 2XDBA 1WQWA 3PNWC 5CKFA 2A7YA 1JQQA 1QQJA 2NUTA 1GFDA 1AD5A 4KUDK 1D09B 4NS5A 3LH0A 4JDSA 4F16A 5KCHA 1B34A 3I5RA 4OF1A 1VYUA 2J05A 3UATA 1ZLMA 2YDLA 2BZXA 4E47A 2CH4W 2RK1A 4M78G 1WLPB 4E2FB 1IGUA 3X26B 2SRCA 2H3JA 4BE0A 1ZHIA 4B9WA 2F5KA 1I5OB 2HBWA 3THKA 3V8KA 4ATOA 4FT4A 4X9DA 1QWFA 2ZGWA 5CK9A 2BTTA 2OX7A 3V8JA 3JCMc 4PJOF 5IXBA 3TSZA 1RAAB 3L2RA 2I2LA 1JXOA 1TUDA 2QEXA 1I8FA 5GMKl 2NUTB 1FXXA 1WXUA 1BCOA 2EQUA 5FRMA 2RO0A 3JV3A 1B34B 2EPDA 3E9FA 1R0BG 3RDVA 4E7SA 1LVKA 1I4K1 2O01E 5CKBA 3CCST 3JAME 1VOMA 1QWEA 1HYOA 1PG5B 2EYZA 3G4SQ 2XMFA 3F70A 2M1HA 1D3BA 1MGQA 3G1JA 4KBMB 3M53A 3C95A 2OTLT 3C94A 4KGXB 4C0GA 1Y07A 1YCYA 2ZZDA 3FJ5A 1WQ7A 1NM7A 3GBQA 5CKHA 3CMAQ 1YN8A 4Y28E 5A2QE 1UTIA 3CEYA 4DBFA 1SSHA 5AT1B 3HTRA 2KYBA 3NPFA 3RKWA 4BY6B 4Q5WA 4PJOA 1OI1A 1XNIA 3CCVA 2PZ1A 1KSWA 3TEEA 2ZAEA 3OSVA 1G3WA 2CZ1B 1YJNT 3PGGA 1BI3A 3HKSA 4OMLA 1D3BB 2A0FB 1KQSS 1HD3A 2X4YA 4J9CA 3UT1A 2J6OA 2NUPB 1YP5A 2JS2A 3M56A 1Q81C 4OB0B 1YITT 1UFFA 2YRCA 1ABOA 3LLRA 1AVZC 3EFSA 3C12A 2V1RA 2K5IA 3TVTA 2G3RA 2DVEA 4M7DF 4HKEA 3RBBB 4L6V5 3VS2A 4II1A 4Z02A 4AFQC 3LGFA 2LP5A 2E6ZA 4LXCA 2QDYB 2OI3A 2P0PA 2V8KA 2D8JA 4M77E 4FIBA 1ACMB 2DAQA 3A8LB 2XIDA 1VYVA 1AWJA 4DA4A 4RTZA 3CBPA 2DD5A 1K1ZA 4NL2A 3P8HA 1JBMA 1XQHA 4ANJA 4NL3A 1Q86R 3BDUA 4HCZA 4N0AC 3E2UA 1VQOA 1ZUYA 3CCEQ 2YUQA 1TH7A 1JO8A 1AWOA 2QGGA 2FPDA 3BY7A 1Q81U 2CH4A 3CMEA 3CCLA 2F2XA 4RCBA 1Z9QA 4M7DA 4BI3A 1D1BA 1ZSZA 4A4FA 3LWIA 1SG5A 1ZA2B 2JVVA 2V26A 2GFUA 3SEMA 1UGQB 3SWNB 2QEXT 2CSIA 4CC3A 1T3LA 1VIFA 3CD6A 4CC7A 4J9DA 2VV5A 1NJIR 3OS5A 1QMCA 2R57A 1Q7YR 1BI0A 5GMKh 1G83A 2RH2A 3JCMd 3S3MA 4LE9A 2KT1A 2AZSA 1QCOA 1W1FA 2EVRA 2DBKA 3WVDB 1WXTA 2PQWA 5FU7B 4PFZA 4JRIA 1GXIE 5GAN7 3JCMh 2QI2A 3JB9G 4AG2C 1PD0A 3CC2Q 1N9SA 3LW5E 5LJ5e 1RUWA 1W2BS 4JJNK 2V1QA 4BI4A 4RTUA 2CP7A 2EQIA 1VQ6T 2DLPA 2LVMA 4XU0A 1M1FA 3H6ZA 2L5QA 5FROA 2LNHB 3MP8A 1UECA 3GLXA 2JM8A 2JMAA 1OZ3A 4MZTA 3M9QA 1IZ6A 1UHFA 4M7AG 3M55A 1VQ5Q 4CI0C 1KQSP 2YLBA 1KHCA 2MWPA 5KCOA 3FJPA 1ABQA 3SHWA 3SDZA 3JCMf 1SPKA 4BUGA 2GFAA 1TOVA 3L42A 2ATCB 4MZPA 2QAZA 1BI1A 2DKGA 1VQKA 4IKFA 1NEBA 2OAUA 2D0QB 3KBGA 2L3SA 1VQ5T 3QPHA 4J9HA 1P92A 2DTHA 2BZ8A 1UGPB 1CKBA 4PFPA 3BW1A 1YJ9Q 1C0MA 2RQTA 1IGQA 3UA6A 4KRTA 2D9TA 1WDXA 4LDWA 5GJVB 4E6RA 1IREB 1AWWA
chains in the Genus database with same CATH topology
3OW2S 2L89A 2RJFA 1YJWT 1KG1A 5LJ3h 3QXEB 1N8RU 1X75C 4HCBA 2V8IA 3HRSA 2HBPA 2WSCE 3CCSA 4MMLA 2E64A 1M8VA 1G3TA 1H3ZA 4X9CA 1VQKT 3OSSC 3X20B 2EQMA 1WJRA 3SD4A 2PUOB 1VQ4A 1ZBXA 1HXDA 3QKJA 3CC4A 1QVGS 1K9MC 5GAN6 1LJOA 3FEOA 2RM4A 4ZTFA 4N4IA 1VQ9T 3HRUA 1M90C 1QP2A 5FU6B 3NTIA 5GAMe 4BDYA 5CO7A 1KQ2A 5GAN5 2FYKA 1K8AC 1NE8A 5L8RE 3VYHB 4A4GA 1WJQA 2RJDA 5A0LA 4KUIA 3CCET 2CZ7B 4D6WA 2PUKB 3JCMX 4C92G 1YIJA 3H8ZA 1EIFA 3CPWS 3CCJA 4M78C 5GAMg 4YTLA 3VU3C 4KT0E 2QA4A 2R58A 4C0DC 1VQ5T 1VQ7A 4VUBA 3SB2A 2AHJB 2K5FA 2EJFA 3LYIA 4RCCA 4EMHA 4F7UE 3OYMA 2LNVA 3OYNA 1N9RA 3LGLA 2VYTA 1M4ZA 2PVDB 5I2MA 4C8QG 4R55A 4M7AE 3UDCA 3OMCA 5HK3A 1NZ9A 3FC3A 1JJ2S 2LC4A 3CC4T 4BDZA 5A0DA 2DXBA 2FL7A 3EAEA 3CCQA 1N6AA 1YBYA 2XICA 4M7DB 3UWNA 5GAN4 5CAIA 2DXCA 3QHSA 4XTWA 2F5TX 4J6XA 2RI2A 3CD6T 1YJNA 2FVUA 5DM7R 3QJ6A 2RJEA 2O4XB 5GANe 3J81E 3M4GA 3M4YA 3JCMJ 4M7DD 3OYKA 4OP0A 2L8DA 4QVCA 2VXEA 5LJ3f 3G71A 3RIRA 3KXTA 2QA4T 2VGMA 1LOJA 3J80E 4C92C 1Y7XA 5DLQE 1VQPA 4XQ3A 5GAOn 1YITA 1QVFS 4MZMA 1OYXA 3CCQT 4M78B 4LDUA 2ZPFB 3RKXA 1G3YA 4C0DB 3PMIA 2GCXA 2RHZA 4ZGJB 4M77C 5CCAA 4M77A 3X24B 5DLOA 2ZPBB 2VC8A 4M75E 4XTVA 3G6EA 2GQVA 3VJPA 5LJ3e 3OS1A 1K9MU 1ZQ1A 2HNIA 3I56T 4E7JA 3ASKA 2E70A 4M78D 1M90U 1U8RA 1Q82C 3OBYA 5J39A 3L2QA 4F7UF 4J83A 1OZ2A 1Y96A 4A4HA 5HK0A 5HKCA 3A8GB 4XU3A 3G71T 1K8AU 3CC2T 5LJ3g 2JZ2A 1K73C 4M7AF 5CVIA 2JTMA 3OB9A 4E7LA 3S3NA 3M58A 4BD3A 2LRQA 5KE2A 1VIEA 2DIGA 4M7DC 3OMGA 3MP1A 2DEQA 3HRTA 3MHXA 2QXFA 1MHNA 4PJOE 3BDLA 1NPRA 4DOVA 4MDWA 3CCUA 2DTIA 2PVGB 4L59A 5CQYA 2KMTA 3CBMA 2KSSA 3OQ5A 4JLIA 1WQWA 2BIVA 2DO3A 2QQBA 2RHXA 3PNWC 4XTYA 4C92B 5CKFA 4LDXA 2D6FA 1KC8C 2XG8D 4IUTA 4M7DG 4FM4B 3PT9A 1KQSA 3M57A 2A7YA 5CKEA 3RESA 4E7IA 4PL6A 2E65A 3URGA 3L1AA 3SFMA 2DIQA 4C92D 3OYIA 1U1SA 5GMKj 4M77B 2KAFA 3T9NA 4KUDK 4EPCA 4NS5A 3L2WA 3AHUA 3JB9H 3LH0A 4JDSA 3QYGB 2YRVA 2X4XA 1B34A 2R5MA 4OF1A 3M54A 3TCJA 1Y96B 4C5HA 5KCHA 2DK3A 4M77D 4M75F 4C8QE 3GIBA 4E47A 5LJ5d 2ZPIB 3QIIA 2RK1A 2NLUA 2MAMA 4M78G 4QQDA 3GNGA 3JCMQ 3X26B 4JLGA 2CYZB 2H3JA 3SWNA 1G3SA 4QVDA 4BE0A 1ZHIA 3OYAA 4HCCA 3QDRB 4B9WA 3QYHB 2F5KA 4XTUA 3S6WA 3V8KA 3QO3A 4N4HA 3CC7A 4FT4A 1UGSB 4X9DA 2ZGWA 4ATOA 4LD6A 5CK9A 3V8JA 1Q82U 3JCMc 4PJOF 1VQLA 3PIOA 3L2RA 2I2LA 1YI2T 2GF7A 3CCRT 3OBWA 1K73U 3E1SA 2X4JA 4QQ6A 4ZN3A 2QEXA 1FX7A 1I8FA 3VKIA 5GMKl 2DXTA 4OB3B 3A5ZB 1FXXA 2LQ8A 2LTOA 2BUDA 5GAOp 2OTLA 4E7HA 1UB4A 3JB9J 2EQUA 4BY6C 3ME9A 1X6OA 4PLLA 2DXUA 1SSFA 3OY9A 4FSXA 3OYFA 3S3OA 2KVQG 1VQMA 1KD1C 5FRMA 2XK0A 2RO0A 1YJ9T 1Q86C 1B34B 3V7RA 5GAOr 4QVZA 5D6WA 4IUPA 1X01A 3E9FA 4LDVA 4UC4A 2EIFA 4A54A 3JCMb 1KC8U 5GAOl 3E9GA 1I4K1 2O01E 2XU8A 5CKBA 3X28B 1JB0E 3JAME 3CCST 1PSFA 1VQ8A 3A8MB 2XD0A 4C8QF 2Y4YA 4JRKA 1BIAA 3F70A 2M1HA 1Y71A 1D3BA 2EYQA 2ZPHB 2RHYA 4M77G 4QQGA 1VQ4T 2CGHA 1MGQA 4KBMB 3M53A 5GMKm 4FU6A 3G4SA 3C95A 2OTLT 3GNFB 3C94A 4BE1A 4C0GA 3V8LA 1Y07A 1YCYA 2ZZDA 4A4EA 1WQ7A 2RA2A 4HT9A 3OS0A 3JB9F 2WACA 2KDSA 4P5NA 5CKHA 1BYMA 3RUXA 3OYJA 2IVWA 4Y28E 5A2QE 1YIJT 3QSUA 2JNGA 3CEYA 2MWOA 3CCJT 4M7DE 5EG2A 4RG2A 4E7KA 2ZPGB 5GAOm 1VQ7T 3M59A 3CMAA 4B9XA 4EDUA 4OB2B 3RKWA 4BY6B 4Q5WA 2JUFA 2P4TA 4C0ZA 2QTXA 4PJOA 1OI1A 1XNIA 3CCVA 5C0MA 2M9UA 2B8AA 5LJ5j 3JRZA 3TEEA 3NTKA 3OSVA 4CRIA 1G3WA 2EQKA 2CZ1B 4IUUA 4OMFB 1YJNT 3OS2A 3QZ5B 2P0QA 3PGGA 2PVOB 2XDPA 1BI3A 3HKSA 1D3BB 4A4KA 1KQSS 4M78E 2XI9A 4J8OA 1KD1U 2X4YA 3VV0A 1YHQA 3UT1A 2L3RA 3GF5A 2HD0A 1VQPT 2E6NA 5GAMd 3M56A 2KY9A 3DB3A 2RI5A 1Q81C 4OB0B 3CCVT 1YITT 1O9SA 2RI3A 2DTOA 5CQXA 4IUVA 3ZBDA 2XDDA 3LLRA 4IUQA 2X4WA 3EFSA 1R8OB 2RHUA 3C12A 3VYGA 2E10A 3QUIA 2HAXA 2K5IA 4FL6A 3WVEB 3HSBA 2RK2A 3CXCA 3G6ET 2G3RA 2DVEA 3FDRA 4M7DF 5A0GA 4HKEA 4XK8E 1UEBA 2PU9B 4L6V5 3P8DA 5J3BA 1W2BA 2E5QA 2ZCFB 4II1A 4TVRA 4Z02A 2VXFA 5M9OA 4J6YA 4J7FA 3RMSA 1BIBA 4DQ2A 4PLIA 1YHQT 3LGFA 1M9SA 1WNLA 3A8HB 1M5Q1 3MP6A 4C92E 3CCMT 4RG8A 4PNOA 1VQNA 2VUBA 2E6ZA 2RJCA 1H641 2QDYB 5GANd 2YLCA 2QQRA 1WJSA 3KUFA 1S72A 2P0PA 2V8KA 5GMKe 3CCUT 4ZGDB 4M77E 4FIBA 4HA8A 2DAQA 3A8LB 3OA6A 2XIDA 1W4SA 4DA4A 2DPPB 3ZEHA 4M78F 3HPWA 4OVAA 3JSCA 3SWNC 3CBPA 2XHCA 1VUBA 4OB1B 2DD5A 4O5VA 1YJWA 5D6YA 3JB9I 2CZ6B 3PTAA 4C5EA 3R6OA 2P0KA 4F7UA 5CKDA 3INZA 4NL2A 3P8HA 1VQNT 2DZ9A 5GMKi 4M7AC 1JBMA 4XAXB 1RL2A 1XQHA 2K57A 3MEAA 4M7AA 4NL3A 2F69A 2C06A 5LJ5h 4GY5A 4OGEA 5LJ3d 3BDUA 4HCZA 3ER0A 4N0AC 3LWHA 4N0AA 1KHIA 4JS4A 2JTFA 4RKUE 1VQOA 2K4YA 1RI0A 1M1GA 2RHIA 3L2ZA 4DOWA 1S72T 1KQ1A 1QP3A 3OYHA 1TH7A 4J6WA 4V2SA 3N5BB 3QBYA 2QQSA 3CBOA 3BY7A 2EFIA 2MI6A 3OYYA 2QQ9A 4J7IA 4BACA 1Q81U 3O8VA 3CMEA 3CCEA 3J7AF 3CCLA 3FB9A 4RCBA 2K3YA 2X35A 5CR2A 4M7DA 5FU7C 4BI3A 4C0FA 4C92F 3CCMA 4A4FA 3LWIA 3CC7T 5GAMj 3M5AA 4PJOG 5CIUA 3CPFA 3JCMV 2FB7A 3MEWA 4N4GA 2JVVA 2O4XA 4WF2A 4Y91A 2GFUA 1BI2A 1UGQB 3HP9A 4EMKB 1VQLT 2R5AA 2JN0A 2CZ0B 5KE3A 1VQOT 4QW2A 3SWNB 2CKKA 4IURA 4M77F 2EQJA 2DD4A 2LCCA 3VUBA 3X25B 2QEXT 1NPPA 1VIFA 2LT4A 4F7UB 3CD6A 4M75C 3JCMP 4M75A 2M0OA 2LCLA 2VV5A 2EAYA 3OS5A 3UPUA 4J5YA 2XDBA 3CMET 4M7AB 4XU1A 3GPLA 3CCLT 4HT8A 2R57A 2EKOA 3OW2A 1VQMT 3DLLA 1WPYA 2K2VA 5GAN8 4M78A 1BI0A 5GMKh 2RH2A 3JCMd 5GANf 3A8OB 2V8JA 3G7ZA 3S3MA 5I21A 4RMOA 2M16A 1U1TA 3L2VA 3MO8A 4M7AD 2CS7A 1M1KU 4LDYA 4ELZC 3NTHA 2QQAA 5LJ5f 1NJIC 1QVGA 5GANj 4MDXA 1VQ8T 1VQ6A 1JRIA 1I81A 4NOYA 3RMQA 2Y90A 1I5LA 4PJOC 2K5LA 3WVDB 2PQWA 5FU7B 3PFSA 1QVPA 3EFRA 4JRIA 5GAN7 1Q7YC 1GXIE 3JCMh 3I55A 1PSEA 2OTJA 3G4ST 1M1KC 4JUVA 2QI2A 3JB9G 2YHTA 5FRNA 3I56A 1AHJB 3HHTB 1N9SA 4KULA 3HL8A 3CPWA 4C5IA 2E41A 3LW5E 5GAN3 3OYLA 2EWNA 2Y4XA 1N27A 5J26A 3CXCS 2VGNA 3META 2RB6A 3CC2A 5LJ5e 4L5GA 3DLMA 3FRNA 4ZN1A 1W2BS 5GANg 5GAOq 4C92A 4ZTJA 2HQEA 4C5GA 4JJNK 1LNXA 1HK9A 4M75B 4BI4A 3OYCA 4JS5A 3CMAT 5LJ3j 1JJ2A 2IG0A 3E19A 3HFOA 1Q86U 2K3XA 1VQ6T 4JRPA 5LJ5g 4X34A 3Q1JA 2LVMA 4C8QC 4XU0A 4ELYC 3OYBA 4FT2A 1O75A 4C8QA 1M1FA 3QJYA 2MMPA 2L5QA 3H6ZA 4M75D 3TREA 5FROA 3MP8A 3I55T 2OTJT 3V7SA 1WGSA 1XTDA 3GLXA 3FLGA 4BE2A 1N8RC 5I2SA 1OZ3A 3MEVA 2RD1A 4F7UG 3C4SA 4MZTA 3WXMB 5GAMh 3M9QA 4R56A 3TU4K 2LX9A 3DB4A 5C6SA 4LD9K 4PJOB 1IZ6A 1V29B 5IN1A 3M55A 4M7AG 3OYDA 4CI0C 4BB7A 2YLBA 3RKYA 1KHCA 3OYEA 2FHDA 2MWPA 3L2UA 5KCOA 1QVFA 3QZ9B 3FJPA 4PKCC 2DZCA 5HY6A 4PJOD 4ZGEB 3QG1A 1VQ5A 4EMKC 2DJZA 3ZFJA 4XTZA 1FWZA 3NFCA 4EMKA 3SDZA 3JCMf 2E12A 2LDMA 3VUZA 2E1HA 5FLXE 3MEUA 1NJIU 3PIPA 4GLKA 4BUGA 5GAN2 2GFAA 5DY9A 1G5VA 5KH6A 2MF2A 1QW1A 4ME7A 3L42A 5AYFA 1Q7YU 4MMKA 3FIFA 3GOXA 2A3LA 3PMTA 4C8QB 3JCMW 4MZPA 5FU6C 1BI1A 5GANh 3MCAB 5LL6S 4BI8B 2DKGA 2LQKA 2WSEE 3RERA 4EMGA 1VQKA 3JCMe 2OAUA 4IKFA 2D0QB 3KBGA 2WSFE 1YI2A 2BKDN 2EJ9A 2ZPEB 1XOVA 4C8QD 3QPHA 2HQXA 3CCRA 4JRQA 1P92A 1UGRB 2DTHA 3DKMA 2LT1A 3LX7A 4M75G 1UGPB 2KQWA 4XU2A 3OYGA 5D6XA 1VQ9A 3GP8A 3BW1A 5IT9E 3P8BB 3JCMg 2EJGA 4XTXA 2KK4A 2XKOC 3HFNA 3JB9D 2D9TA 5GAMf 1BKBA 1DJ7B 4LDWA 4A53A 5IAYA 1YJ9A 3V7CA 2JOYA 4OGCA 3BFMA 1IREB 4O6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L89 A;  2RJF A;  3S3M A;  2DIQ A;  3OYI A;  2M16 A;  3L2V A;  2X4Y A;  3MO8 A;  3UT1 A;  1H3Z A;  2L3R A;  4NS5 A;  3L2W A;  2E6N A;  3LH0 A;  3NTH A;  2EQM A;  1WJR A;  3SD4 A;  3DB3 A;  2RI5 A;  2YRV A;  3QKJ A;  2X4X A;  2R5M A;  5KCH A;  4C5H A;  2RI3 A;  2PQW A;  3FEO A;  3PFS A;  4IUV A;  4ZTF A;  4N4I A;  3LLR A;  4IUQ A;  2X4W A;  2RHU A;  3NTI A;  3QII A;  4FL6 A;  5FRN A;  2NLU A;  4QQD A;  4A4G A;  2G3R A;  1WJQ A;  2RJD A;  3FDR A;  4C5I A;  3OYL A;  3H8Z A;  3P8D A;  1N27 A;  5J26 A;  4BE0 A;  3OYA A;  2E5Q A;  3MET A;  4II1 A;  4B9W A;  2R58 A;  2F5K A;  4Z02 A;  5M9O A;  3DLM A;  3S6W A;  4N4H A;  3OYN A;  4PLI A;  3LYI A;  4ZTJ A;  2HQE A;  4C5G A;  3LGF A;  3OYM A;  3LGL A;  3MP6 A;  3OYC A;  4LD6 A;  2VYT A;  2IG0 A;  2K3X A;  3OMC A;  3L2R A;  3FC3 A;  2RJC A;  2GF7 A;  4X34 A;  4BDZ A;  4QQ6 A;  3Q1J A;  2LVM A;  3EAE A;  2QQR A;  1WJS A;  3OYB A;  3KUF A;  3UWN A;  3H6Z A;  5FRO A;  3MP8 A;  2LTO A;  2BUD A;  2RI2 A;  4E7H A;  2DAQ A;  3OA6 A;  2EQU A;  1WGS A;  3ME9 A;  4PLL A;  3OY9 A;  3FLG A;  1SSF A;  3QJ6 A;  2RJE A;  2O4X B;  3ZEH A;  3OYF A;  1OZ3 A;  3MEV A;  4OVA A;  2XK0 A;  3OYK A;  2RO0 A;  2L8D A;  3C4S A;  3M9Q A;  4QVZ A;  5D6W A;  3DB4 A;  4IUP A;  5D6Y A;  5C6S A;  3E9F A;  4UC4 A;  5IN1 A;  4C5E A;  2P0K A;  3OYD A;  3E9G A;  3P8H A;  1KHC A;  3OYE A;  2FHD A;  2MWP A;  3L2U A;  5KCO A;  3MEA A;  4GY5 A;  3F70 A;  2M1H A;  4HCZ A;  4QQG A;  1OYX A;  2RHY A;  2JTF A;  1RI0 A;  2RHI A;  2LDM A;  4BE2 A;  3PMI A;  4FU6 A;  3OYH A;  2RHZ A;  3MEU A;  4BE1 A;  3QBY A;  2QQS A;  4A4E A;  2EFI A;  3OS1 A;  5FRM A;  2GFA A;  4BAC A;  1G5V A;  3O8V A;  5KH6 A;  3OS0 A;  4E7J A;  2WAC A;  3L42 A;  3ASK A;  2K3Y A;  2X35 A;  3OYJ A;  5J39 A;  3GOX A;  3L2Q A;  3CEY A;  1OZ2 A;  2MWO A;  4A4H A;  3PMT A;  4RG2 A;  4E7K A;  4A4F A;  2JZ2 A;  4B9X A;  4EDU A;  3S3O A;  5CIU A;  3OB9 A;  4E7L A;  3S3N A;  3MEW A;  4N4G A;  2O4X A;  4IKF A;  4Q5W A;  4BD3 A;  2LRQ A;  2GFU A;  5KE2 A;  2BKD N;  2DIG A;  2R5A A;  2HQX A;  5KE3 A;  3OMG A;  3MP1 A;  1XNI A;  1OI1 A;  2CKK A;  3LX7 A;  4QW2 A;  4IUR A;  1MHN A;  5C0M A;  2EQJ A;  5D6X A;  3BDL A;  2B8A A;  2LCC A;  3OYG A;  4L59 A;  4BDY A;  3OQ5 A;  3NTK A;  2BIV A;  3PNW C;  2RHX A;  4CRI A;  2M0O A;  2EQK A;  4IUU A;  4IUT A;  3OS2 A;  2R57 A;  2EKO A;  2XDP A;  2D9T A;  4E7I A;  5IAY A;  4PL6 A; 
#chains in the Genus database with same CATH topology
 1ZA1 B;  1X75 C;  2V8I A;  2JM9 A;  4MML A;  1G3T A;  1ZUK A;  3X20 B;  1VQ4 A;  1K9M C;  1QKX A;  2NWM A;  1E6H A;  1WHK A;  2RM4 A;  2DFU A;  1M90 C;  1K8A C;  3NMZ C;  5L8R E;  4D6W A;  2PUK B;  1YIJ A;  2P84 A;  2KXD A;  3CCJ A;  5GAM g;  2QA4 A;  1VQ7 A;  2A36 A;  2EYX A;  4F7U E;  3OYM A;  2LNV A;  3LGL A;  2FEI A;  2JW4 A;  1RI9 A;  2I0N A;  5HK3 A;  3FC3 A;  1JJ2 S;  5A0D A;  1D0Y A;  2DXB A;  3EAE A;  5CAI A;  1TWB A;  2RI2 A;  2YWW A;  3CD6 T;  3EFO A;  1QCN A;  2O4X B;  5GAN e;  3M0R A;  1M3B A;  3M4G A;  1VQP Q;  3RIR A;  1LOJ A;  2DM1 A;  1G2B A;  1SHG A;  5DLQ E;  2AKL A;  4XQ3 A;  5FW9 A;  1QVF S;  3G6E Q;  3CCQ T;  4M78 B;  2ZPF B;  1G3Y A;  4M77 C;  2BZY A;  5CCA A;  2QYZ A;  2ZPB B;  4M75 E;  4E7Z A;  3VJP A;  5LJ3 e;  1K9M U;  2KRO A;  2E70 A;  4M78 D;  1M90 U;  4ORZ A;  3G71 T;  1OZ2 A;  4A4H A;  2ED0 A;  1K8A U;  5KYU B;  1K73 C;  3EFO B;  4E7L A;  4F17 A;  4RTT A;  2LRQ A;  1W2B P;  1D0Z A;  1Z9Z A;  2DIG A;  3MP1 A;  1UUE A;  2LJ1 A;  3HRT A;  3MHX A;  1X27 A;  3CCU A;  4L59 A;  3CBM A;  2KSS A;  1BK2 A;  2DO3 A;  4C92 B;  2RHX A;  1OU8 A;  2D6F A;  1KC8 C;  2XG8 D;  4X1V A;  4M7D G;  1KQS A;  3PT9 A;  3M57 A;  3RES A;  4E7I A;  2CP6 A;  3URG A;  3SFM A;  4C92 D;  4J9F A;  1U1S A;  2HMA A;  3T9N A;  4EPC A;  2LZ6 B;  2NYS A;  4IIM A;  3M54 A;  3TCJ A;  2DK3 A;  4C8Q E;  3GIB A;  2YSQ A;  1YWO A;  5LJ5 d;  2NLU A;  4QQD A;  3GNG A;  3JCM Q;  3CC7 Q;  4QVD A;  1LCK A;  3OYA A;  4FYX B;  2X51 A;  1AZG B;  3QYH B;  1VQL Q;  5KYN A;  1UE9 A;  1GCQ C;  1M8M A;  2KXC A;  2GF7 A;  3OBW A;  1K73 U;  3REA B;  3E1S A;  4QQ6 A;  1FX7 A;  1NEG A;  2LQ8 A;  4PJN A;  2OTL A;  2BUD A;  1UB4 A;  4PLL A;  1OX9 A;  3OYF A;  1SSF A;  1FYN A;  1X6B A;  3S3O A;  2YT6 A;  1KD1 C;  1MV3 A;  1VQ8 Q;  4AFS C;  1KC8 U;  3JCM b;  3E9G A;  2VB6 A;  3X28 B;  1JB0 E;  1GRI A;  2XD0 A;  5D7U A;  2ZPH B;  8AT1 B;  2RHY A;  1VQ4 T;  3G4S A;  4BE1 A;  1RLP C;  4A4E A;  3EG9 A;  3OS0 A;  3JB9 F;  2WAC A;  1BYM A;  4HCK A;  3RUX A;  2IVW A;  1YIJ T;  3CCJ T;  5EG2 A;  3PVL A;  2ZPG B;  5GAO m;  1VQ7 T;  3M59 A;  3CMA A;  4EDU A;  1LPL A;  1RAD B;  2JUF A;  1Y57 A;  1Q82 R;  2FZK B;  2M9U A;  2DER A;  5LJ5 j;  1JJ2 P;  1TSF A;  1IB8 A;  4Y92 A;  3MJX A;  2FZG B;  2P0Q A;  2PVO B;  1Q81 R;  3ULR B;  2RQR A;  2C0T A;  3VS3 A;  4J8O A;  1KD1 U;  3VV0 A;  3GF5 A;  3EG9 B;  2E6N A;  2RI3 A;  2DTO A;  5CQX A;  3TSW A;  2X4W A;  1QVF P;  2E10 A;  3QUI A;  1OQK A;  2ENM A;  4FL6 A;  3WVE B;  2D8H A;  3P8D A;  5J3B A;  1W2B A;  2ZCF B;  1UHC A;  4J7F A;  1ZX6 A;  4DQ2 A;  3A8H B;  1WIE A;  1M5Q 1;  4HXJ A;  1H64 1;  5GAN d;  1WJS A;  3VS6 A;  5GMK e;  2KRS A;  3CCU T;  2DJQ A;  4ZGD B;  3NHN A;  1YJW Q;  1W4S A;  1M2V A;  1X69 A;  1NLO C;  1OEB A;  3JSC A;  7AT1 B;  4HVV A;  3JB9 I;  5CKD A;  2E4H A;  2CP3 A;  4M7A A;  4JJC A;  1M3C A;  4GY5 A;  5LJ3 d;  3ER0 A;  1KHI A;  2JTF A;  1M1G A;  3OYH A;  3N5B B;  3QBY A;  2EFI A;  4J7I A;  2M51 A;  2QQ9 A;  3CCE A;  3FB9 A;  2KR3 A;  5CR2 A;  3EGX A;  4C0F A;  2KNB B;  3M5A A;  5CIU A;  3MEW A;  2MPX C;  2R5A A;  5KE3 A;  2CKK A;  2RF0 A;  4M77 F;  2EQJ A;  1RAF B;  1PRL C;  1KFZ A;  1K9A A;  4M75 C;  2LCL A;  4FSS A;  3UPU A;  1PC0 A;  4J5Y A;  4M7A B;  4XU1 A;  1H92 A;  5GAN 8;  5GAN f;  3A8O B;  2V8J A;  1XJW B;  3MO8 A;  4M7A D;  2QQA A;  5GAN j;  1VQ6 A;  4OMQ A;  4NOY A;  2X3X D;  2LJ0 A;  3H41 A;  3I56 Q;  1QVP A;  1D1C A;  1WHG A;  3EFR A;  1V76 A;  3G4S T;  4JUV A;  2RNA A;  2YHT A;  4GLM A;  5FRN A;  1AHJ B;  3HHT B;  2OAW A;  4KUL A;  1MMN A;  3CXC S;  2EWN A;  1KK7 A;  2Y4X A;  2Z0W A;  4KGZ B;  2RB6 A;  3CC2 A;  4L5G A;  1YCS B;  5GAO q;  2HQE A;  1E6G A;  1CSK A;  3CMA T;  2X3W D;  5LJ3 j;  1JJ2 A;  3E19 A;  2CDT A;  2DL5 A;  4JRP A;  3CQT A;  4X34 A;  1MMG A;  4C8Q C;  3OYB A;  1O75 A;  3QJY A;  3V7S A;  2DL3 A;  1XTD A;  1N8R C;  4BE2 A;  2CUB A;  1M30 A;  2ABL A;  3C4S A;  4R56 A;  4PJO B;  1ZBJ A;  1PKT A;  3OYD A;  1WHM A;  2E3I A;  1HJD A;  4HVW A;  2FHD A;  2DL7 A;  1QVF A;  4LUD A;  2HZY A;  4PJO D;  1TTH B;  3QG1 A;  1SHF A;  1VQ5 A;  2QDL A;  4EMK C;  2J7I A;  3EH2 A;  4PK4 A;  2E12 A;  2LDM A;  2LJ3 A;  5FWB A;  2E1H A;  4FW1 A;  3PIP A;  1VA7 A;  4GLK A;  2DF6 A;  1G5V A;  4MMK A;  3FIF A;  3JCM W;  1YI2 Q;  5FU6 C;  3CCR Q;  1U3O A;  2WSE E;  1RLQ C;  1AZE A;  4EMG A;  1TXQ A;  1VQ9 Q;  2EJ9 A;  4JRQ A;  3JCM P;  3DKM A;  1TUG B;  2JXB A;  3LX7 A;  2A08 A;  3GP8 A;  3P8B B;  3JCM g;  1B07 A;  4XTX A;  1TG0 A;  2DE0 X;  5I11 A;  1YJ9 A;  5IAY A;  1K9M R;  3V7C A;  2JOY A;  4OGC A;  4O6J A;  3OW2 S;  1M90 R;  1KG1 A;  1K4U S;  5IHN A;  1N8R U;  1K8A R;  2ROT A;  2WSC E;  3EG1 A;  4DBQ A;  3CC4 Q;  1M8V A;  1GCQ A;  1FMW A;  1EZZ B;  3SD4 A;  2PUO B;  1HXD A;  1QVG S;  5GAN 6;  1TU0 B;  4ZTF A;  1RAB B;  1VQ9 T;  1QP2 A;  5GAM e;  5CO7 A;  4DEX A;  1NE8 A;  3VYH B;  3CCE T;  2CZ7 B;  2PTK A;  2DL4 A;  3JCM X;  2M0Y A;  4CC2 A;  2R58 A;  2F1L A;  3SB2 A;  2OJ2 A;  3LYI A;  1N9R A;  1M4Z A;  2PVD B;  4R55 A;  1QKW A;  2JT4 A;  3CC4 T;  2DBM A;  3CCQ A;  1OV3 A;  2FL7 A;  4RUG A;  4M7D B;  1N6A A;  2XIC A;  2QTV A;  3QHS A;  1ZSZ B;  4XTW A;  2JJ9 A;  3J81 E;  2CP2 A;  2F2W A;  4M7D D;  1UG1 A;  3OYK A;  2L8D A;  2VXE A;  1JEG A;  3G71 A;  1D1A A;  1AT1 B;  2VGM A;  1T0H A;  3J80 E;  1Y7X A;  1VQP A;  5GAO n;  4OMM A;  1OYX A;  3AT1 B;  1K73 R;  4C0D B;  2DNU A;  1VYT A;  5DLO A;  2VC8 A;  3G6E A;  2GQV A;  3OS1 A;  1ZQ1 A;  2HNI A;  2EYY A;  3ASK A;  5GJW B;  5J39 A;  4F7U F;  1Y96 A;  5HKC A;  4XU3 A;  3CC2 T;  3CXC P;  1KC8 R;  3OB9 A;  3S3N A;  5KE2 A;  1VIE A;  2QXF A;  4BDY A;  1X43 A;  4JLI A;  2QQB A;  4XTY A;  4IUT A;  1NG2 A;  3L1A A;  2DIQ A;  3OYI A;  5GMK j;  3L2W A;  1V1C A;  3QYG B;  2O9V A;  4PJL A;  1SRM A;  2R5M A;  1Y96 B;  1WHJ A;  4M75 F;  1B3Q A;  3QII A;  3I35 A;  2AK5 A;  2CYZ B;  2CT4 A;  1G3S A;  4HCC A;  3VS7 A;  2ECZ A;  3QDR B;  1SKU B;  4XTU A;  3VRY A;  3CC7 A;  3QO3 A;  1T3S A;  1UGS B;  3D7S B;  1KD1 R;  2QK0 A;  4LD6 A;  1VQL A;  2X4J A;  4JJD A;  4ZN3 A;  4AFU C;  1VQM Q;  4AFZ C;  4OB3 B;  5GAO p;  2LTO A;  3MKD A;  1JXM A;  3JB9 J;  2O2O A;  4BY6 C;  3OY9 A;  2DXU A;  2J6F A;  2KVQ G;  2XK0 A;  1YJ9 T;  1Q86 C;  5GAO r;  4QVZ A;  4IUP A;  2KT8 A;  4Z8A A;  4UC4 A;  4A54 A;  2ED1 A;  3OW2 P;  3M0P A;  2ESW A;  1PSF A;  1VQ8 A;  3A8M B;  2K2M A;  4C8Q F;  1BIA A;  2BE9 B;  4M77 G;  2EYQ A;  2EKH A;  2DMO A;  1GFC A;  4FU6 A;  5GMK m;  2DYI A;  3GNF B;  2CP5 A;  3M0Q A;  1QVG P;  3V8L A;  2KDS A;  3QSU A;  1W70 A;  1BU1 A;  4B6M A;  2AKK A;  1G8X A;  4RTX A;  1TS9 A;  1YNZ A;  2P4T A;  4C0Z A;  2QTX A;  5C0M A;  1RAC B;  1X2K A;  2EQK A;  4DBR A;  1YHQ Q;  2KE9 A;  4M78 E;  2XI9 A;  3ZL7 C;  2C0O A;  2HDA A;  2EBP A;  2IIM A;  2L3R A;  1VQP T;  5GAM d;  2JS0 A;  3DB3 A;  2RI5 A;  4IIO A;  1O9S A;  4IUV A;  4F14 A;  3VYG A;  2GTO A;  2PNI A;  1WHH A;  3CXC A;  3G6E T;  1MMA A;  3FDR A;  5A0G A;  4XK8 E;  2PU9 B;  4QT7 A;  1VQN Q;  2E5Q A;  4TVR A;  2VXF A;  4J6Y A;  1YHQ T;  1BB9 A;  4C92 E;  1S72 Q;  2VUB A;  2FPF A;  2RN8 A;  2E5K A;  2RJC A;  3VS1 A;  1K0S A;  2YLC A;  2QQR A;  1UJY A;  2DET A;  4FYV B;  2DEU A;  4HA8 A;  1RAE B;  4KGV B;  2DPP B;  3HPW A;  3SWN C;  1M1K C;  1VUB A;  1YJW A;  5D6Y A;  1NYG A;  2CZ6 B;  3PTA A;  4WCI A;  4C5E A;  1R77 A;  3R6O A;  1MNE A;  1VQN T;  2HL3 A;  3M0S A;  1AOJ A;  4RTV A;  2K57 A;  3UA7 A;  5LJ5 h;  2HKN A;  4JS4 A;  3LWH A;  4N0A A;  4RKU E;  2HQH A;  3L2Z A;  1S72 T;  2KYM A;  1GCP A;  4J6W A;  4V2S A;  2QQS A;  2MI6 A;  4BAC A;  1PKS A;  3J7A F;  3CCM Q;  1X2Q A;  5FU7 C;  3CC7 T;  2DVJ A;  4FYW B;  5GAM j;  4Y91 A;  1BI2 A;  1ZSG A;  3H9N A;  1VQL T;  4QW2 A;  1WZO A;  2DD4 A;  2LCC A;  3VUB A;  3X25 B;  1NPP A;  2LT4 A;  4GBQ A;  1NBE B;  2M0O A;  5IH2 A;  2KGT A;  3GPL A;  3OW2 A;  3DLL A;  2L3Q A;  2A37 A;  4RMO A;  2M16 A;  3L2V A;  3M0U A;  2DYB A;  1M1K U;  5LJ5 f;  3EG0 A;  3I55 Q;  1QVG A;  1VQ8 T;  2OTJ Q;  1JRI A;  2GBQ A;  1I81 A;  1I5L A;  3H0I A;  2G6F X;  2K5L A;  3A98 A;  3PFS A;  1AWX A;  1IRX A;  3I56 A;  3HL8 A;  1WX6 A;  4C5I A;  2E41 A;  4R0K A;  5J26 A;  1N27 A;  3MET A;  1Q95 G;  1K0X A;  2VKN A;  3DLM A;  4ZN1 A;  5GAN g;  4ZTJ A;  1HSQ A;  1HK9 A;  1N8R R;  3OYC A;  1U06 A;  3Q1J A;  4ELY C;  4FT2 A;  1A0N B;  2MMP A;  3I55 T;  3TRE A;  2OTJ T;  5I22 A;  1FMV A;  1R0C B;  2O88 A;  2BE7 D;  4ZNX A;  3UF4 A;  1M2O A;  5I2S A;  3MEV A;  2X9H A;  2RD1 A;  4F7U G;  9ATC B;  4LD9 K;  2LX9 A;  3DB4 A;  3REB B;  1V29 B;  5IN1 A;  2ROL A;  4BB7 A;  3OYE A;  4EIK A;  3L2U A;  4CC4 B;  2DZC A;  5HY6 A;  5IXF A;  3ZFJ A;  4XTZ A;  1FWZ A;  3NFC A;  3VS4 A;  4PJJ A;  5FLX E;  2EW3 A;  5GAN 2;  2JMC A;  2VWF A;  2A3L A;  3PMT A;  3R6N A;  1NLP C;  1ZUU A;  5GAN h;  2KRM A;  3MCA B;  5LL6 S;  3H0H A;  2LQK A;  3RER A;  3JCM e;  2WSF E;  1YI2 A;  3CCR A;  1XOV A;  2H8H A;  4M75 G;  3OYG A;  2KQW A;  4XU2 A;  5D6X A;  1VQ9 A;  5IT9 E;  5L23 A;  1IHW A;  5KYX A;  2EJG A;  2XKO C;  3JB9 D;  1DJ7 B;  4A53 A;  4AT1 B;  3CCS Q;  3BFM A;  1YJW T;  1QCF A;  1RAH B;  5LJ3 h;  4HCB A;  2LCS A;  3HRS A;  4J9B A;  4PFO A;  3PE0 A;  2OTL Q;  1M2V B;  1WJR A;  4Z88 A;  1ZBX A;  3CC4 A;  1Y0M A;  2FO0 A;  3FEO A;  1BBZ A;  4N4I A;  3HRU A;  3NTI A;  2FYK A;  2HL5 C;  5A0L A;  4KUI A;  1M3A A;  4C92 G;  3H8Z A;  1EIF A;  2DRM A;  3CPW S;  4M78 C;  4YTL A;  3VU3 C;  4KT0 E;  2K5F A;  4RCC A;  3OYN A;  3H0F A;  5KYX B;  1PNJ A;  2VYT A;  4C8Q G;  4M7A E;  2CSQ A;  3EG2 A;  3OMC A;  1NZ9 A;  2LC4 A;  4BDZ A;  1YJN Q;  3EGX B;  1YBY A;  2DXC A;  2F5T X;  2NUP A;  4D8D A;  2FVU A;  5DM7 R;  2RJE A;  4FW2 A;  2RQV A;  3JCM J;  3VS0 A;  2D1X A;  3I9Q A;  5LJ3 f;  2YXY A;  1YIT Q;  4C92 C;  1GL5 A;  1OPK A;  1N5Z A;  4AG1 C;  1YWP A;  4MZM A;  2KEA A;  5IHI A;  3PMI A;  4JJB A;  2NUZ A;  2RHZ A;  4LNP A;  4M77 A;  2EGA A;  3I56 T;  4E7J A;  2CP0 A;  2FRY A;  1U8R A;  1Q82 C;  3OBY A;  1TUC A;  4J83 A;  2O31 A;  2JZ2 A;  2EGE A;  2JTM A;  2MK5 A;  2LQN A;  2O9S A;  1K76 A;  4Z89 A;  2SEM A;  4BD3 A;  2L0A A;  3OMG A;  1MHN A;  4PJO E;  1NPR A;  2DTI A;  2PVG B;  5CQY A;  3OQ5 A;  2KMT A;  3MPU B;  2BIV A;  4LDX A;  4FM4 B;  5CKE A;  2COY A;  4PL6 A;  3VRZ A;  2E65 A;  2GQI A;  1IO6 A;  3RNJ A;  1SF9 A;  1MMD A;  1MND A;  4M77 B;  2KAF A;  1J3T A;  3AHU A;  3JB9 H;  4JPB W;  2FG0 A;  2YRV A;  2X4X A;  4C5H A;  5ECA A;  2EYW A;  2L3P A;  4M77 D;  2ZPI B;  2D0N A;  4FYY B;  2MAM A;  4JLG A;  2YUP A;  3SWN A;  4RTY A;  1ARK A;  3S6W A;  2J06 A;  4N4H A;  1I0C A;  4LUE A;  2QEX Q;  1Q82 U;  2P4R A;  2VVK A;  3PIO A;  1YI2 T;  1S1N A;  1EX4 A;  3CCR T;  2FRW A;  3VKI A;  2KI7 A;  2DXT A;  1UDL A;  3A5Z B;  4KH1 B;  4E7H A;  4J9I A;  3ME9 A;  1X6O A;  1VQM A;  4FSX A;  3IQL A;  1KJW A;  4DBH A;  1WA7 A;  3V7R A;  5D6W A;  4WTO B;  1X01 A;  4LDV A;  2EIF A;  5GAO l;  2K3B A;  2XU8 A;  1D0X A;  2Y4Y A;  4JRK A;  1Y71 A;  4QQG A;  2IPO B;  4HVU A;  2CGH A;  3PVQ A;  1IXD A;  2RA2 A;  4HT9 A;  4P5N A;  1WXB A;  1UJ0 A;  3OYJ A;  2LQW A;  2JNG A;  2QAS A;  2MWO A;  4M7D E;  4RG2 A;  4E7K A;  1VQ6 Q;  1PRM C;  4B9X A;  5HCK A;  3CPW P;  4OB2 B;  3CCV Q;  2QGF B;  2A28 A;  2B8A A;  1JU5 C;  3JRZ A;  2GTJ A;  3NTK A;  2JTE A;  4CRI A;  2CUD A;  4IUU A;  4OMF B;  2DX1 A;  3OS2 A;  3QZ5 B;  3BE3 A;  2XDP A;  4A4K A;  2CRE A;  3EHR A;  1EFN A;  1W6X A;  1OOT A;  1YHQ A;  3EHQ A;  2HD0 A;  2J6K A;  2KY9 A;  3CCV T;  3ZBD A;  2XDD A;  4IUQ A;  1IHV A;  1R8O B;  2RHU A;  4F04 B;  1PM3 A;  3HSB A;  3QDF A;  2RK2 A;  1PWT A;  4AMC A;  1PHT A;  1UEB A;  4RTW A;  5M9O A;  2DIL A;  3RMS A;  1BIB A;  4PLI A;  4J9G A;  1M9S A;  1WNL A;  3MP6 A;  1OUL A;  1VQN A;  4RG8 A;  4PNO A;  2LX7 A;  2COZ A;  1M1K R;  2KRN A;  1M27 C;  3KUF A;  1S72 A;  3OA6 A;  1RAI B;  2FZC B;  3ZEH A;  1MUZ A;  4M78 F;  2B86 A;  4OVA A;  3LH5 A;  4OB1 B;  2XHC A;  4O5V A;  3NGP A;  1AEY A;  1WYX A;  3VS5 A;  2P0K A;  4F7U A;  3INZ A;  1VQO Q;  2DZ9 A;  5GMK i;  4M7A C;  4XAX B;  1RL2 A;  3MEA A;  2C06 A;  2F69 A;  1E7O A;  2HKQ B;  4OGE A;  2K4Y A;  1RI0 A;  2RHI A;  4DOW A;  2AT1 B;  3CME Q;  3CCL Q;  1KQ1 A;  1QP3 A;  2GNC A;  1WHL A;  2KBT A;  2H3E B;  3CBO A;  4DEY A;  3OYY A;  3O8V A;  2COW A;  2K3Y A;  1MV0 B;  2X35 A;  4C92 F;  3EG3 A;  3CCM A;  1B7T A;  4PJO G;  1C6V X;  3CPF A;  3JCM V;  2FB7 A;  4N4G A;  3M0T A;  2O4X A;  4WF2 A;  3HP9 A;  3CD6 Q;  2JN0 A;  2CZ0 B;  1VQO T;  4IUR A;  4F7U B;  2YUO A;  2C0I A;  4M75 A;  4OMO A;  5FWC A;  2EAY A;  3CME T;  4HT8 A;  3CCL T;  2EKO A;  1VQM T;  2MCN A;  1WPY A;  2HSP A;  2K2V A;  4M78 A;  3G7Z A;  5I21 A;  1U1T A;  3CCQ Q;  2CS7 A;  2MIO A;  4LDY A;  4ELZ C;  3NTH A;  1NJI C;  4MDX A;  3RMQ A;  2MYS A;  2Y90 A;  4PJO C;  1U5S A;  3RR6 A;  5KYU A;  1Q7Y C;  3I55 A;  3O5Z A;  1PSE A;  2OTJ A;  3G71 Q;  1X6G A;  3EGD A;  3CPW A;  1T0J A;  5GAN 3;  3OYL A;  1OX8 A;  2VGN A;  1H8K A;  2MOX A;  3FRN A;  4C92 A;  4C5G A;  1LNX A;  4M75 B;  4JS5 A;  1FMK A;  2VAS A;  2IG0 A;  3HFO A;  1Q86 U;  1C1A A;  2K3X A;  5LJ5 g;  3I5S A;  4JZ4 A;  4C8Q A;  4M75 D;  4FCY A;  1WGS A;  3FLG A;  4K11 A;  2RMO A;  2W10 A;  3WXM B;  5GAM h;  3TU4 K;  1GBR A;  5C6S A;  5KYW A;  2E3H A;  1BCM A;  3RKY A;  3EGD B;  4QKU A;  3QZ9 B;  4PKC C;  4LN2 A;  4ZGE B;  2QG9 B;  2DJZ A;  4EMK A;  1WFW A;  3VUZ A;  3MEU A;  1NJI U;  4ESR A;  2RQU A;  4OMP A;  3TQ7 P;  1QLY A;  5DY9 A;  5KH6 A;  2MF2 A;  1QW1 A;  4ME7 A;  5AYF A;  1Q7Y U;  3QWX X;  3GOX A;  2DL8 A;  2HCK A;  1VQK Q;  4C8Q B;  2YRD A;  1OPL A;  2HSE B;  3QWY A;  1YFN A;  3EGU A;  4BI8 B;  3KFV A;  1SRL A;  2BKD N;  2ZPE B;  4C8Q D;  2HQX A;  2HAX A;  2AZV A;  1UGR B;  2EGC A;  2LT1 A;  4JZ3 A;  5KYW B;  1PCX A;  2KK4 A;  3HFN A;  2RPN A;  2FPE A;  5GAM f;  1BKB A;  5KYY A;  2K79 A;  4EMK B;  4M7D C;  2CT3 A;  2DA9 A;  2L89 A;  2RJF A;  1F1B B;  3QXE B;  1ZSZ C;  1VQ4 Q;  2HBP A;  1RAG B;  3CCS A;  2E64 A;  1H3Z A;  1I1J A;  4X9C A;  1VQK T;  1CKA A;  1I07 A;  3OSS C;  2EQM A;  2M02 A;  2GGR A;  5EC7 A;  3QKJ A;  1LJO A;  5FU6 B;  1YIJ Q;  1KQ2 A;  1KIK A;  5GAN 5;  3CCJ Q;  2K9G A;  2QA4 Q;  4A4G A;  1WJQ A;  2RJD A;  1VQ7 Q;  3C0C A;  2LMJ A;  2HEQ A;  1SEM A;  4C0D C;  4VUB A;  4A63 B;  2AHJ B;  3CCM T;  2EJF A;  4EMH A;  1GBQ A;  5I2M A;  4OMN A;  3UDC A;  1OU9 A;  4KH0 B;  5KYY B;  1NYF A;  3UWN A;  5GAN 4;  2RQW A;  2AIR B;  1UGV A;  4J6X A;  5IHK A;  1YJN A;  3QJ6 A;  3M4Y A;  4OP0 A;  4QVC A;  2DRK A;  2K6D A;  3KXT A;  2QA4 T;  4M4Z A;  8ATC B;  3A1P A;  1WI7 A;  3EH1 A;  1YIT A;  2W0Z A;  2L2P A;  3U23 A;  4J9E A;  4LDU A;  3RKX A;  1H3H A;  2GCX A;  4ZGJ B;  3X24 B;  4XTV A;  2YUN A;  3L2Q A;  5HK0 A;  3A8G B;  6AT1 B;  5LJ3 g;  4M7A F;  5CVI A;  4PJM A;  4D8K A;  3M58 A;  3CCU Q;  2F2V A;  1PD1 A;  2DEQ A;  3BDL A;  4DOV A;  4MDW A;  2K7A A;  2XDB A;  1WQW A;  3PNW C;  5CKF A;  2A7Y A;  1JQQ A;  1QQJ A;  2NUT A;  1GFD A;  1AD5 A;  4KUD K;  1D09 B;  4NS5 A;  3LH0 A;  4JDS A;  4F16 A;  5KCH A;  1B34 A;  3I5R A;  4OF1 A;  1VYU A;  2J05 A;  3UAT A;  1ZLM A;  2YDL A;  2BZX A;  4E47 A;  2CH4 W;  2RK1 A;  4M78 G;  1WLP B;  4E2F B;  1IGU A;  3X26 B;  2SRC A;  2H3J A;  4BE0 A;  1ZHI A;  4B9W A;  2F5K A;  1I5O B;  2HBW A;  3THK A;  3V8K A;  4ATO A;  4FT4 A;  4X9D A;  1QWF A;  2ZGW A;  5CK9 A;  2BTT A;  2OX7 A;  3V8J A;  3JCM c;  4PJO F;  5IXB A;  3TSZ A;  1RAA B;  3L2R A;  2I2L A;  1JXO A;  1TUD A;  2QEX A;  1I8F A;  5GMK l;  2NUT B;  1FXX A;  1WXU A;  1BCO A;  2EQU A;  5FRM A;  2RO0 A;  3JV3 A;  1B34 B;  2EPD A;  3E9F A;  1R0B G;  3RDV A;  4E7S A;  1LVK A;  1I4K 1;  2O01 E;  5CKB A;  3CCS T;  3JAM E;  1VOM A;  1QWE A;  1HYO A;  1PG5 B;  2EYZ A;  3G4S Q;  2XMF A;  3F70 A;  2M1H A;  1D3B A;  1MGQ A;  3G1J A;  4KBM B;  3M53 A;  3C95 A;  2OTL T;  3C94 A;  4KGX B;  4C0G A;  1Y07 A;  1YCY A;  2ZZD A;  3FJ5 A;  1WQ7 A;  1NM7 A;  3GBQ A;  5CKH A;  3CMA Q;  1YN8 A;  4Y28 E;  5A2Q E;  1UTI A;  3CEY A;  4DBF A;  1SSH A;  5AT1 B;  3HTR A;  2KYB A;  3NPF A;  3RKW A;  4BY6 B;  4Q5W A;  4PJO A;  1OI1 A;  1XNI A;  3CCV A;  2PZ1 A;  1KSW A;  3TEE A;  2ZAE A;  3OSV A;  1G3W A;  2CZ1 B;  1YJN T;  3PGG A;  1BI3 A;  3HKS A;  4OML A;  1D3B B;  2A0F B;  1KQS S;  1HD3 A;  2X4Y A;  4J9C A;  3UT1 A;  2J6O A;  2NUP B;  1YP5 A;  2JS2 A;  3M56 A;  1Q81 C;  4OB0 B;  1YIT T;  1UFF A;  2YRC A;  1ABO A;  3LLR A;  1AVZ C;  3EFS A;  3C12 A;  2V1R A;  2K5I A;  3TVT A;  2G3R A;  2DVE A;  4M7D F;  4HKE A;  3RBB B;  4L6V 5;  3VS2 A;  4II1 A;  4Z02 A;  4AFQ C;  3LGF A;  2LP5 A;  2E6Z A;  4LXC A;  2QDY B;  2OI3 A;  2P0P A;  2V8K A;  2D8J A;  4M77 E;  4FIB A;  1ACM B;  2DAQ A;  3A8L B;  2XID A;  1VYV A;  1AWJ A;  4DA4 A;  4RTZ A;  3CBP A;  2DD5 A;  1K1Z A;  4NL2 A;  3P8H A;  1JBM A;  1XQH A;  4ANJ A;  4NL3 A;  1Q86 R;  3BDU A;  4HCZ A;  4N0A C;  3E2U A;  1VQO A;  1ZUY A;  3CCE Q;  2YUQ A;  1TH7 A;  1JO8 A;  1AWO A;  2QGG A;  2FPD A;  3BY7 A;  1Q81 U;  2CH4 A;  3CME A;  3CCL A;  2F2X A;  4RCB A;  1Z9Q A;  4M7D A;  4BI3 A;  1D1B A;  1ZSZ A;  4A4F A;  3LWI A;  1SG5 A;  1ZA2 B;  2JVV A;  2V26 A;  2GFU A;  3SEM A;  1UGQ B;  3SWN B;  2QEX T;  2CSI A;  4CC3 A;  1T3L A;  1VIF A;  3CD6 A;  4CC7 A;  4J9D A;  2VV5 A;  1NJI R;  3OS5 A;  1QMC A;  2R57 A;  1Q7Y R;  1BI0 A;  5GMK h;  1G83 A;  2RH2 A;  3JCM d;  3S3M A;  4LE9 A;  2KT1 A;  2AZS A;  1QCO A;  1W1F A;  2EVR A;  2DBK A;  3WVD B;  1WXT A;  2PQW A;  5FU7 B;  4PFZ A;  4JRI A;  1GXI E;  5GAN 7;  3JCM h;  2QI2 A;  3JB9 G;  4AG2 C;  1PD0 A;  3CC2 Q;  1N9S A;  3LW5 E;  5LJ5 e;  1RUW A;  1W2B S;  4JJN K;  2V1Q A;  4BI4 A;  4RTU A;  2CP7 A;  2EQI A;  1VQ6 T;  2DLP A;  2LVM A;  4XU0 A;  1M1F A;  3H6Z A;  2L5Q A;  5FRO A;  2LNH B;  3MP8 A;  1UEC A;  3GLX A;  2JM8 A;  2JMA A;  1OZ3 A;  4MZT A;  3M9Q A;  1IZ6 A;  1UHF A;  4M7A G;  3M55 A;  1VQ5 Q;  4CI0 C;  1KQS P;  2YLB A;  1KHC A;  2MWP A;  5KCO A;  3FJP A;  1ABQ A;  3SHW A;  3SDZ A;  3JCM f;  1SPK A;  4BUG A;  2GFA A;  1TOV A;  3L42 A;  2ATC B;  4MZP A;  2QAZ A;  1BI1 A;  2DKG A;  1VQK A;  4IKF A;  1NEB A;  2OAU A;  2D0Q B;  3KBG A;  2L3S A;  1VQ5 T;  3QPH A;  4J9H A;  1P92 A;  2DTH A;  2BZ8 A;  1UGP B;  1CKB A;  4PFP A;  3BW1 A;  1YJ9 Q;  1C0M A;  2RQT A;  1IGQ A;  3UA6 A;  4KRT A;  2D9T A;  1WDX A;  4LDW A;  5GJV B;  4E6R A;  1IRE B;  1AWW A; 
#chains in the Genus database with same CATH homology
 3OW2 S;  2L89 A;  2RJF A;  1YJW T;  1KG1 A;  5LJ3 h;  3QXE B;  1N8R U;  1X75 C;  4HCB A;  2V8I A;  3HRS A;  2HBP A;  2WSC E;  3CCS A;  4MML A;  2E64 A;  1M8V A;  1G3T A;  1H3Z A;  4X9C A;  1VQK T;  3OSS C;  3X20 B;  2EQM A;  1WJR A;  3SD4 A;  2PUO B;  1VQ4 A;  1ZBX A;  1HXD A;  3QKJ A;  3CC4 A;  1QVG S;  1K9M C;  5GAN 6;  1LJO A;  3FEO A;  2RM4 A;  4ZTF A;  4N4I A;  1VQ9 T;  3HRU A;  1M90 C;  1QP2 A;  5FU6 B;  3NTI A;  5GAM e;  4BDY A;  5CO7 A;  1KQ2 A;  5GAN 5;  2FYK A;  1K8A C;  1NE8 A;  5L8R E;  3VYH B;  4A4G A;  1WJQ A;  2RJD A;  5A0L A;  4KUI A;  3CCE T;  2CZ7 B;  4D6W A;  2PUK B;  3JCM X;  4C92 G;  1YIJ A;  3H8Z A;  1EIF A;  3CPW S;  3CCJ A;  4M78 C;  5GAM g;  4YTL A;  3VU3 C;  4KT0 E;  2QA4 A;  2R58 A;  4C0D C;  1VQ5 T;  1VQ7 A;  4VUB A;  3SB2 A;  2AHJ B;  2K5F A;  2EJF A;  3LYI A;  4RCC A;  4EMH A;  4F7U E;  3OYM A;  2LNV A;  3OYN A;  1N9R A;  3LGL A;  2VYT A;  1M4Z A;  2PVD B;  5I2M A;  4C8Q G;  4R55 A;  4M7A E;  3UDC A;  3OMC A;  5HK3 A;  1NZ9 A;  3FC3 A;  1JJ2 S;  2LC4 A;  3CC4 T;  4BDZ A;  5A0D A;  2DXB A;  2FL7 A;  3EAE A;  3CCQ A;  1N6A A;  1YBY A;  2XIC A;  4M7D B;  3UWN A;  5GAN 4;  5CAI A;  2DXC A;  3QHS A;  4XTW A;  2F5T X;  4J6X A;  2RI2 A;  3CD6 T;  1YJN A;  2FVU A;  5DM7 R;  3QJ6 A;  2RJE A;  2O4X B;  5GAN e;  3J81 E;  3M4G A;  3M4Y A;  3JCM J;  4M7D D;  3OYK A;  4OP0 A;  2L8D A;  4QVC A;  2VXE A;  5LJ3 f;  3G71 A;  3RIR A;  3KXT A;  2QA4 T;  2VGM A;  1LOJ A;  3J80 E;  4C92 C;  1Y7X A;  5DLQ E;  1VQP A;  4XQ3 A;  5GAO n;  1YIT A;  1QVF S;  4MZM A;  1OYX A;  3CCQ T;  4M78 B;  4LDU A;  2ZPF B;  3RKX A;  1G3Y A;  4C0D B;  3PMI A;  2GCX A;  2RHZ A;  4ZGJ B;  4M77 C;  5CCA A;  4M77 A;  3X24 B;  5DLO A;  2ZPB B;  2VC8 A;  4M75 E;  4XTV A;  3G6E A;  2GQV A;  3VJP A;  5LJ3 e;  3OS1 A;  1K9M U;  1ZQ1 A;  2HNI A;  3I56 T;  4E7J A;  3ASK A;  2E70 A;  4M78 D;  1M90 U;  1U8R A;  1Q82 C;  3OBY A;  5J39 A;  3L2Q A;  4F7U F;  4J83 A;  1OZ2 A;  1Y96 A;  4A4H A;  5HK0 A;  5HKC A;  3A8G B;  4XU3 A;  3G71 T;  1K8A U;  3CC2 T;  5LJ3 g;  2JZ2 A;  1K73 C;  4M7A F;  5CVI A;  2JTM A;  3OB9 A;  4E7L A;  3S3N A;  3M58 A;  4BD3 A;  2LRQ A;  5KE2 A;  1VIE A;  2DIG A;  4M7D C;  3OMG A;  3MP1 A;  2DEQ A;  3HRT A;  3MHX A;  2QXF A;  1MHN A;  4PJO E;  3BDL A;  1NPR A;  4DOV A;  4MDW A;  3CCU A;  2DTI A;  2PVG B;  4L59 A;  5CQY A;  2KMT A;  3CBM A;  2KSS A;  3OQ5 A;  4JLI A;  1WQW A;  2BIV A;  2DO3 A;  2QQB A;  2RHX A;  3PNW C;  4XTY A;  4C92 B;  5CKF A;  4LDX A;  2D6F A;  1KC8 C;  2XG8 D;  4IUT A;  4M7D G;  4FM4 B;  3PT9 A;  1KQS A;  3M57 A;  2A7Y A;  5CKE A;  3RES A;  4E7I A;  4PL6 A;  2E65 A;  3URG A;  3L1A A;  3SFM A;  2DIQ A;  4C92 D;  3OYI A;  1U1S A;  5GMK j;  4M77 B;  2KAF A;  3T9N A;  4KUD K;  4EPC A;  4NS5 A;  3L2W A;  3AHU A;  3JB9 H;  3LH0 A;  4JDS A;  3QYG B;  2YRV A;  2X4X A;  1B34 A;  2R5M A;  4OF1 A;  3M54 A;  3TCJ A;  1Y96 B;  4C5H A;  5KCH A;  2DK3 A;  4M77 D;  4M75 F;  4C8Q E;  3GIB A;  4E47 A;  5LJ5 d;  2ZPI B;  3QII A;  2RK1 A;  2NLU A;  2MAM A;  4M78 G;  4QQD A;  3GNG A;  3JCM Q;  3X26 B;  4JLG A;  2CYZ B;  2H3J A;  3SWN A;  1G3S A;  4QVD A;  4BE0 A;  1ZHI A;  3OYA A;  4HCC A;  3QDR B;  4B9W A;  3QYH B;  2F5K A;  4XTU A;  3S6W A;  3V8K A;  3QO3 A;  4N4H A;  3CC7 A;  4FT4 A;  1UGS B;  4X9D A;  2ZGW A;  4ATO A;  4LD6 A;  5CK9 A;  3V8J A;  1Q82 U;  3JCM c;  4PJO F;  1VQL A;  3PIO A;  3L2R A;  2I2L A;  1YI2 T;  2GF7 A;  3CCR T;  3OBW A;  1K73 U;  3E1S A;  2X4J A;  4QQ6 A;  4ZN3 A;  2QEX A;  1FX7 A;  1I8F A;  3VKI A;  5GMK l;  2DXT A;  4OB3 B;  3A5Z B;  1FXX A;  2LQ8 A;  2LTO A;  2BUD A;  5GAO p;  2OTL A;  4E7H A;  1UB4 A;  3JB9 J;  2EQU A;  4BY6 C;  3ME9 A;  1X6O A;  4PLL A;  2DXU A;  1SSF A;  3OY9 A;  4FSX A;  3OYF A;  3S3O A;  2KVQ G;  1VQM A;  1KD1 C;  5FRM A;  2XK0 A;  2RO0 A;  1YJ9 T;  1Q86 C;  1B34 B;  3V7R A;  5GAO r;  4QVZ A;  5D6W A;  4IUP A;  1X01 A;  3E9F A;  4LDV A;  4UC4 A;  2EIF A;  4A54 A;  3JCM b;  1KC8 U;  5GAO l;  3E9G A;  1I4K 1;  2O01 E;  2XU8 A;  5CKB A;  3X28 B;  1JB0 E;  3JAM E;  3CCS T;  1PSF A;  1VQ8 A;  3A8M B;  2XD0 A;  4C8Q F;  2Y4Y A;  4JRK A;  1BIA A;  3F70 A;  2M1H A;  1Y71 A;  1D3B A;  2EYQ A;  2ZPH B;  2RHY A;  4M77 G;  4QQG A;  1VQ4 T;  2CGH A;  1MGQ A;  4KBM B;  3M53 A;  5GMK m;  4FU6 A;  3G4S A;  3C95 A;  2OTL T;  3GNF B;  3C94 A;  4BE1 A;  4C0G A;  3V8L A;  1Y07 A;  1YCY A;  2ZZD A;  4A4E A;  1WQ7 A;  2RA2 A;  4HT9 A;  3OS0 A;  3JB9 F;  2WAC A;  2KDS A;  4P5N A;  5CKH A;  1BYM A;  3RUX A;  3OYJ A;  2IVW A;  4Y28 E;  5A2Q E;  1YIJ T;  3QSU A;  2JNG A;  3CEY A;  2MWO A;  3CCJ T;  4M7D E;  5EG2 A;  4RG2 A;  4E7K A;  2ZPG B;  5GAO m;  1VQ7 T;  3M59 A;  3CMA A;  4B9X A;  4EDU A;  4OB2 B;  3RKW A;  4BY6 B;  4Q5W A;  2JUF A;  2P4T A;  4C0Z A;  2QTX A;  4PJO A;  1OI1 A;  1XNI A;  3CCV A;  5C0M A;  2M9U A;  2B8A A;  5LJ5 j;  3JRZ A;  3TEE A;  3NTK A;  3OSV A;  4CRI A;  1G3W A;  2EQK A;  2CZ1 B;  4IUU A;  4OMF B;  1YJN T;  3OS2 A;  3QZ5 B;  2P0Q A;  3PGG A;  2PVO B;  2XDP A;  1BI3 A;  3HKS A;  1D3B B;  4A4K A;  1KQS S;  4M78 E;  2XI9 A;  4J8O A;  1KD1 U;  2X4Y A;  3VV0 A;  1YHQ A;  3UT1 A;  2L3R A;  3GF5 A;  2HD0 A;  1VQP T;  2E6N A;  5GAM d;  3M56 A;  2KY9 A;  3DB3 A;  2RI5 A;  1Q81 C;  4OB0 B;  3CCV T;  1YIT T;  1O9S A;  2RI3 A;  2DTO A;  5CQX A;  4IUV A;  3ZBD A;  2XDD A;  3LLR A;  4IUQ A;  2X4W A;  3EFS A;  1R8O B;  2RHU A;  3C12 A;  3VYG A;  2E10 A;  3QUI A;  2HAX A;  2K5I A;  4FL6 A;  3WVE B;  3HSB A;  2RK2 A;  3CXC A;  3G6E T;  2G3R A;  2DVE A;  3FDR A;  4M7D F;  5A0G A;  4HKE A;  4XK8 E;  1UEB A;  2PU9 B;  4L6V 5;  3P8D A;  5J3B A;  1W2B A;  2E5Q A;  2ZCF B;  4II1 A;  4TVR A;  4Z02 A;  2VXF A;  5M9O A;  4J6Y A;  4J7F A;  3RMS A;  1BIB A;  4DQ2 A;  4PLI A;  1YHQ T;  3LGF A;  1M9S A;  1WNL A;  3A8H B;  1M5Q 1;  3MP6 A;  4C92 E;  3CCM T;  4RG8 A;  4PNO A;  1VQN A;  2VUB A;  2E6Z A;  2RJC A;  1H64 1;  2QDY B;  5GAN d;  2YLC A;  2QQR A;  1WJS A;  3KUF A;  1S72 A;  2P0P A;  2V8K A;  5GMK e;  3CCU T;  4ZGD B;  4M77 E;  4FIB A;  4HA8 A;  2DAQ A;  3A8L B;  3OA6 A;  2XID A;  1W4S A;  4DA4 A;  2DPP B;  3ZEH A;  4M78 F;  3HPW A;  4OVA A;  3JSC A;  3SWN C;  3CBP A;  2XHC A;  1VUB A;  4OB1 B;  2DD5 A;  4O5V A;  1YJW A;  5D6Y A;  3JB9 I;  2CZ6 B;  3PTA A;  4C5E A;  3R6O A;  2P0K A;  4F7U A;  5CKD A;  3INZ A;  4NL2 A;  3P8H A;  1VQN T;  2DZ9 A;  5GMK i;  4M7A C;  1JBM A;  4XAX B;  1RL2 A;  1XQH A;  2K57 A;  3MEA A;  4M7A A;  4NL3 A;  2F69 A;  2C06 A;  5LJ5 h;  4GY5 A;  4OGE A;  5LJ3 d;  3BDU A;  4HCZ A;  3ER0 A;  4N0A C;  3LWH A;  4N0A A;  1KHI A;  4JS4 A;  2JTF A;  4RKU E;  1VQO A;  2K4Y A;  1RI0 A;  1M1G A;  2RHI A;  3L2Z A;  4DOW A;  1S72 T;  1KQ1 A;  1QP3 A;  3OYH A;  1TH7 A;  4J6W A;  4V2S A;  3N5B B;  3QBY A;  2QQS A;  3CBO A;  3BY7 A;  2EFI A;  2MI6 A;  3OYY A;  2QQ9 A;  4J7I A;  4BAC A;  1Q81 U;  3O8V A;  3CME A;  3CCE A;  3J7A F;  3CCL A;  3FB9 A;  4RCB A;  2K3Y A;  2X35 A;  5CR2 A;  4M7D A;  5FU7 C;  4BI3 A;  4C0F A;  4C92 F;  3CCM A;  4A4F A;  3LWI A;  3CC7 T;  5GAM j;  3M5A A;  4PJO G;  5CIU A;  3CPF A;  3JCM V;  2FB7 A;  3MEW A;  4N4G A;  2JVV A;  2O4X A;  4WF2 A;  4Y91 A;  2GFU A;  1BI2 A;  1UGQ B;  3HP9 A;  4EMK B;  1VQL T;  2R5A A;  2JN0 A;  2CZ0 B;  5KE3 A;  1VQO T;  4QW2 A;  3SWN B;  2CKK A;  4IUR A;  4M77 F;  2EQJ A;  2DD4 A;  2LCC A;  3VUB A;  3X25 B;  2QEX T;  1NPP A;  1VIF A;  2LT4 A;  4F7U B;  3CD6 A;  4M75 C;  3JCM P;  4M75 A;  2M0O A;  2LCL A;  2VV5 A;  2EAY A;  3OS5 A;  3UPU A;  4J5Y A;  2XDB A;  3CME T;  4M7A B;  4XU1 A;  3GPL A;  3CCL T;  4HT8 A;  2R57 A;  2EKO A;  3OW2 A;  1VQM T;  3DLL A;  1WPY A;  2K2V A;  5GAN 8;  4M78 A;  1BI0 A;  5GMK h;  2RH2 A;  3JCM d;  5GAN f;  3A8O B;  2V8J A;  3G7Z A;  3S3M A;  5I21 A;  4RMO A;  2M16 A;  1U1T A;  3L2V A;  3MO8 A;  4M7A D;  2CS7 A;  1M1K U;  4LDY A;  4ELZ C;  3NTH A;  2QQA A;  5LJ5 f;  1NJI C;  1QVG A;  5GAN j;  4MDX A;  1VQ8 T;  1VQ6 A;  1JRI A;  1I81 A;  4NOY A;  3RMQ A;  2Y90 A;  1I5L A;  4PJO C;  2K5L A;  3WVD B;  2PQW A;  5FU7 B;  3PFS A;  1QVP A;  3EFR A;  4JRI A;  5GAN 7;  1Q7Y C;  1GXI E;  3JCM h;  3I55 A;  1PSE A;  2OTJ A;  3G4S T;  1M1K C;  4JUV A;  2QI2 A;  3JB9 G;  2YHT A;  5FRN A;  3I56 A;  1AHJ B;  3HHT B;  1N9S A;  4KUL A;  3HL8 A;  3CPW A;  4C5I A;  2E41 A;  3LW5 E;  5GAN 3;  3OYL A;  2EWN A;  2Y4X A;  1N27 A;  5J26 A;  3CXC S;  2VGN A;  3MET A;  2RB6 A;  3CC2 A;  5LJ5 e;  4L5G A;  3DLM A;  3FRN A;  4ZN1 A;  1W2B S;  5GAN g;  5GAO q;  4C92 A;  4ZTJ A;  2HQE A;  4C5G A;  4JJN K;  1LNX A;  1HK9 A;  4M75 B;  4BI4 A;  3OYC A;  4JS5 A;  3CMA T;  5LJ3 j;  1JJ2 A;  2IG0 A;  3E19 A;  3HFO A;  1Q86 U;  2K3X A;  1VQ6 T;  4JRP A;  5LJ5 g;  4X34 A;  3Q1J A;  2LVM A;  4C8Q C;  4XU0 A;  4ELY C;  3OYB A;  4FT2 A;  1O75 A;  4C8Q A;  1M1F A;  3QJY A;  2MMP A;  2L5Q A;  3H6Z A;  4M75 D;  3TRE A;  5FRO A;  3MP8 A;  3I55 T;  2OTJ T;  3V7S A;  1WGS A;  1XTD A;  3GLX A;  3FLG A;  4BE2 A;  1N8R C;  5I2S A;  1OZ3 A;  3MEV A;  2RD1 A;  4F7U G;  3C4S A;  4MZT A;  3WXM B;  5GAM h;  3M9Q A;  4R56 A;  3TU4 K;  2LX9 A;  3DB4 A;  5C6S A;  4LD9 K;  4PJO B;  1IZ6 A;  1V29 B;  5IN1 A;  3M55 A;  4M7A G;  3OYD A;  4CI0 C;  4BB7 A;  2YLB A;  3RKY A;  1KHC A;  3OYE A;  2FHD A;  2MWP A;  3L2U A;  5KCO A;  1QVF A;  3QZ9 B;  3FJP A;  4PKC C;  2DZC A;  5HY6 A;  4PJO D;  4ZGE B;  3QG1 A;  1VQ5 A;  4EMK C;  2DJZ A;  3ZFJ A;  4XTZ A;  1FWZ A;  3NFC A;  4EMK A;  3SDZ A;  3JCM f;  2E12 A;  2LDM A;  3VUZ A;  2E1H A;  5FLX E;  3MEU A;  1NJI U;  3PIP A;  4GLK A;  4BUG A;  5GAN 2;  2GFA A;  5DY9 A;  1G5V A;  5KH6 A;  2MF2 A;  1QW1 A;  4ME7 A;  3L42 A;  5AYF A;  1Q7Y U;  4MMK A;  3FIF A;  3GOX A;  2A3L A;  3PMT A;  4C8Q B;  3JCM W;  4MZP A;  5FU6 C;  1BI1 A;  5GAN h;  3MCA B;  5LL6 S;  4BI8 B;  2DKG A;  2LQK A;  2WSE E;  3RER A;  4EMG A;  1VQK A;  3JCM e;  2OAU A;  4IKF A;  2D0Q B;  3KBG A;  2WSF E;  1YI2 A;  2BKD N;  2EJ9 A;  2ZPE B;  1XOV A;  4C8Q D;  3QPH A;  2HQX A;  3CCR A;  4JRQ A;  1P92 A;  1UGR B;  2DTH A;  3DKM A;  2LT1 A;  3LX7 A;  4M75 G;  1UGP B;  2KQW A;  4XU2 A;  3OYG A;  5D6X A;  1VQ9 A;  3GP8 A;  3BW1 A;  5IT9 E;  3P8B B;  3JCM g;  2EJG A;  4XTX A;  2KK4 A;  2XKO C;  3HFN A;  3JB9 D;  2D9T A;  5GAM f;  1BKB A;  1DJ7 B;  4LDW A;  4A53 A;  5IAY A;  1YJ9 A;  3V7C A;  2JOY A;  4OGC A;  3BFM A;  1IRE B;  4O6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...