2LCEA

Chemical shift assignment of hr4436b from homo sapiens, northeast structural genomics consortium
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
MTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell lymphoma 6 protein
publication title Solution Structure of Hr4436B.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 10
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lceA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lceA02
2ENHA 1A1JA 2EORA 4WSGA 2D9HA 2LT7A 2EOIA 1YUJA 2EOXA 1YUIA 2YTFA 3EPLA 2EMIA 2EL6A 2JP9A 2YTDA 1P47A 2EPUA 1UN6B 2E72A 2EQ0A 2EPCA 2ENCA 4FK5C 2EM5A 2CSHA 1TF6A 1A1IA 2DGCA 2YTEA 2WBUA 2EMFA 5KL3A 1ZU1A 2WBSA 1BBOA 5KL4A 1X5WA 2EL5A 2EMYA 2ENAA 2ADRA 2YU5A 4R2AA 1TF3A 2PRTA 1ZAAC 2YTPA 2EN8A 2DMIA 1UBDC 2MDGA 2YTNA 2EOHA 3M99B 4F6MA 1JK1A 2A25A 2EMWA 2EMAA 4R2PA 3EPKA 2HGHA 2YTOA 2YTQA 2EM6A 2ELYA 2JPAA 2EOMA 2EN3A 2EMXA 2LO3A 4IJDA 4X9JA 2EN2A 4IS1C 2EMZA 1X6EA 2ELZA 2EM0A 2EMKA 2EPPA 2CTDA 2GLIA 2EMHA 1A1LA 4R2EA 2RSIA 2EJ4A 1X3CA 2EM7A 2RPCA 2EOYA 2DLKA 2EOJA 2EM4A 1LLMC 3EPHA 1MEYC 4GZNC 2EOOA 2EMLA 2VRDA 2EMCA 3UK3C 2NABA 1YSAC 2EN7A 1DGCA 1A1FA 1WJPA 2LV2A 2M9AA 2EQ3A 2YTJA 4R2CA 2EQ1A 2WBTA 2YSOA 2YRKA 4R2RA 1AAYA 2YSPA 4R2SA 1X6FA 5KL2A 1B69A 2EOFA 1RMDA 2LCEA 1X6HA 4F2JC 2CT1A 2EM9A 2GHFA 1TN9A 1G2DC 1G2FC 1A1HA 2MKNA 2EPAA 2EOSA 2YU8A 2EM8A 2EOQA 2YRHA 4F6NA 2EPZA 1A1KA 2EOEA 2EM2A 2YTIA 2DLQA 3MHHC 3VHTB 3EPJA 4M9VC 1F2IG 2J7JA 2EPRA 2DRPA 1NCSA 5KL5A 2EN6A 2BB8A 2WCC3 2EPXA 2YRMA 5KL7A 2EN4A 4R2QA 2LVHA 1JK2A 2EMBA 2EL4A 2EOZA 2EE8A 4R2DA 1ZR9A 2EN1A 2I13A 2EMGA 2MKDA 1A1GA 1BB8A 3MHSC 2YTGA 2R1FA 2EP3A 1KJKA 5KL6A 2EM3A 1Z1BA
chains in the Genus database with same CATH superfamily
1RQ0A 2VQFE 2ENHA 1A1JA 5IWAE 1T4NA 2V89A 2V85A 2EORA 1GTKA 2LT7A 2EOXA 1XMOE 1P47A 4B3TE 2NA2A 2ENCA 2CSHA 4P78A 2DGCA 4DV7E 2E5LE 2YTEA 4NHRA 2EPNA 4DV1E 3C4TA 4R2AA 5AC5A 2PRTA 1ZAAC 4HTGA 1UHZA 2DIXA 5LL6R 4WXDA 5AASA 3J7AG 2A25A 2K4VA 3HPZA 3TQMA 2EMAA 3EPKA 4TUIA 1YYOA 1YPNA 2EM6A 4B3SE 2ELYA 4LFAE 4LF8E 2I9IA 2LO3A 2G7HA 3KZYA 2EN2A 4O5GA 2L33A 2EMKA 2CTDA 2GLIA 2EMHA 4BBYA 4WSPA 1PJQA 3OMLA 4Q35B 2EM7A 2EOYA 3ADGA 1XNQE 4WX9A 4GZNC 4NXNE 4X66E 1EH7A 2VRDA 2YZTA 2EMCA 4F9CB 2NABA 1YSAC 4BS9A 1WJPA 2LUQA 1GZ6A 2M7QA 4DV2E 4RHBB 2EQ1A 2V8QB 2YSOA 4JI2E 4DR2E 2YSPA 1X6FA 4BCAA 4ZYHA 2EOFA 3JTZA 3JAMC 3J7Yp 1N36E 2R76A 2CT1A 2LTRA 2N3GA 3IWBA 3T1YE 1G2DC 1G2FC 2EPAA 2KHXA 2EM8A 1FKAE 2CPNA 3QG5C 2HJJA 2L8TA 2LJUA 5AE2A 4X64E 2DLQA 3HPSA 1YYKA 1NCSA 3P1XA 2JOXA 2WCC3 5KL7A 4LFBE 1PJSA 3HQ1A 4LF9E 2EOZA 2EE8A 4BHCA 2FGGA 2I13A 2DSYA 2EMGA 5FLXC 4AQYE 5IT9C 1A1GA 4P7DA 3BF2A 5F3WA 1X47A 1N33E 3F6GA 4J8ZA 2EP3A 5A6BA 5KL6A 1N34E 4GKKE 4JI5E 4F54A 2JY9A 1N3GA 4X8WA 4NZVA 2WZOA 3EQ1A 4JI8E 1YUIA 1IQSA 4JV5E 2YWQA 3C6MA 3T1HE 4YY3E 5A2QC 2L3JA 5IXMB 1TF6A 4B3RE 1A1IA 2H36X 1X48A 3KWRA 1T39A 2EMFA 5KL3A 2WBSA 1YFHA 2L3CA 1X5WA 4BHBA 1ZBQA 2ADRA 2LUPB 2YU5A 1TF3A 2UU9E 2NUGA 2L6MA 3DJWA 4R8OA 4MLQA 1WHQA 4M2ZA 4R2PA 2HC5A 1PJTA 4KHPE 2JWOA 4DV6E 1AH5A 2JPAA 2V86A 2V83A 2F4VE 2VE7C 2EM0A 2V88A 3DF6A 4LF6E 1RC7A 2RSIA 1MGTA 2DLKA 5ADZA 4JI4E 1MEYC 4DR6E 2EOOA 3UK3C 3C6KA 3ADLA 2EN7A 1DGCA 1EH8A 3VK6A 1A1FA 1IMUA 3AV0A 4DR1E 1NEIA 2RS6A 4WYQB 3H09A 4R2RA 2UUBE 1AAYA 4KWYA 2B3TB 2LTSA 4I8OA 5KL2A 1HNWE 1RMDA 4MLVA 3ADIA 1X6HA 2E1MA 3AUZA 2V87A 2M1SA 3MSWA 4WFTA 4ZYDA 3ZOQB 1A1HA 4JI1E 4JYAE 2EPZA 1A1KA 4M9VC 1F2IG 2J7JA 3HXLA 2DRPA 4NXME 1DI2A 2DB2A 1QNTA 5T6JA 1T38A 4R2QA 1X49A 4GKJE 1DQ3A 2EMBA 4O4KA 4DMIA 2MC6A 4R2DA 2F8BA 4YHHE 2EN1A 2IHR1 1EKZA 3FIGA 2R1FA 3LMLA 2EPMX 2MC5A 2YTNA 4L8NA 4Q28A 5AE3A 1L4SA 4WSGA 2D9HA 1YUJA 4LF7E 2YTFA 3K6QA 2JP9A 4BC7A 2E72A 4FK5C 2EM5A 2LE2A 2B9DA 4JI0E 2WBUA 1ZU1A 1UILA 5IV8B 2EL5A 4RH8A 2EMYA 4X65E 2ENAA 2L2MA 2ODRD 2UXBE 4DV4E 4L5NC 2UUAE 2YTPA 2EN8A 2DMIA 4GEQB 2MDGA 4DR4E 3IWDA 2EOHA 2EPKX 2K7IA 3M99B 4M30A 3JU0A 4JI7E 4F6MA 1JK1A 2EMWA 2HGHA 2YTOA 4DV3E 4LTYA 3THNA 1GQEA 2KOUA 2EOMA 2EN3A 1WXRA 3LLHA 5AC4A 4IJDA 4X9JA 3OTOE 4IS1C 2EMZA 1X6EA 2EPPA 1WRJA 5A6KA 5LMUE 2UXDE 2EJ4A 3J81C 1X3CA 2RPCA 4OX9E 1QU6A 3C4BA 1LLMC 1PDAA 4JI6E 2GPIA 4DR5E 1EH6A 1IBLE 4N4RB 1SR9A 2RS7A 2FTXB 4DKKA 3J80C 5A69A 2LMZA 2EQ3A 2YTJA 2WBTA 4DUZE 4M0VA 4R2SA 4DR7E 2BBGA 4WXCA 3KZZA 1B69A 4DR3E 2LCEA 1IBKE 4BC9A 2GHFA 3L00A 2N8XA 3RMPA 2EOSA 1HR0E 2EOQA 2YRHA 2YTIA 3MHHC 3VHTB 3EPJA 5A6BD 5KL5A 2YPNA 2EN6A 2EPXA 2YRMA 2EN4A 5BR8E 1IBME 2EPLX 4ZYGA 2EL4A 1YYWA 1ZR9A 1SFEA 1PKPA 4DV0E 2MDRA 2UXCE 1BB8A 2JXPA 3MHSC 2YTGA 4O43A 2L2KB 1KJKA 2LJHA 1Z1BA 4LF4E 2NUEA 5LMNE 2EOIA 1BBGA 3IWCA 3EPLA 2EMIA 2EL6A 2EZ6A 2VF1A 2YTDA 2EPUA 4TUGA 1UN6B 2EQ0A 2EPCA 1FJGE 5DNYA 4F9AB 1XNRE 4DV5E 1BBOA 2DMYA 5KL4A 3THOB 1UBDC 2ODRC 1T4LB 1J5EE 2JVAA 2LBSB 2LRSA 1HNXE 2B7TA 2YTQA 3VYYA 2RQLA 3F6HA 2EMXA 4LF5E 1N32E 1HNZE 1T4OA 2VQEE 1KYQA 2ELZA 4ZYEA 1A1LA 4R2EA 4F9BB 1YZ9A 4HEIA 2EOJA 2EM4A 5A6AA 2B7VA 4OOGC 3EPHA 5TSEA 5LLQA 4KZSA 4B3ME 4LU9A 2EMLA 1I94E 4K0KE 4LFCE 2UUCE 2ZM6E 1WHNA 2RTXA 1ZBTA 2N3HA 2LV2A 2HHHE 2M9AA 2JOBA 4R2CA 1STUA 2L2NA 2YRKA 3BIDA 1IQOA 1J26A 4O24A 2YT4A 2Q8UA 4F2JC 2EPOA 2EM9A 2NUFA 4JI3E 1TN9A 4DUYE 4BMJA 2MKNA 2YU8A 2RSMA 2FV4B 3BBGA 4F6NA 4X62E 2EOEA 2EM2A 2L92A 2EPRA 2BB8A 5A6JA 5AE1A 3BGHA 3ADJA 2LVHA 3HTXA 1JK2A 2EWLA 5CFFE 2KONA 1XMQE 2JYAA 2MKDA 4WPYA 3VYXA 2M4IA 3ECRA 1O0WA 2JR1A 4R03A 2EM3A
chains in the Genus database with same CATH topology
2ENHA 1A1JA 2EORA 4WSGA 2D9HA 2LT7A 2EOIA 1YUJA 2EOXA 1YUIA 2YTFA 3EPLA 2EMIA 2EL6A 2JP9A 2YTDA 1P47A 2EPUA 1UN6B 2E72A 2EQ0A 2EPCA 2ENCA 4FK5C 2EM5A 2CSHA 1TF6A 1A1IA 2DGCA 2YTEA 2WBUA 2EMFA 5KL3A 1ZU1A 2WBSA 1BBOA 5KL4A 1X5WA 2EL5A 2EMYA 2ENAA 2ADRA 2YU5A 4R2AA 1TF3A 2PRTA 1ZAAC 2YTPA 2EN8A 2DMIA 1UBDC 2MDGA 2YTNA 2EOHA 3M99B 4F6MA 1JK1A 2A25A 2EMWA 2EMAA 4R2PA 3EPKA 2HGHA 2YTOA 2YTQA 2EM6A 2ELYA 2JPAA 2EOMA 2EN3A 2EMXA 2LO3A 4IJDA 4X9JA 2EN2A 4IS1C 2EMZA 1X6EA 2ELZA 2EM0A 2EMKA 2EPPA 2CTDA 2GLIA 2EMHA 1A1LA 4R2EA 2RSIA 2EJ4A 1X3CA 2EM7A 2RPCA 2EOYA 2DLKA 2EOJA 2EM4A 1LLMC 3EPHA 1MEYC 4GZNC 2EOOA 2EMLA 2VRDA 2EMCA 3UK3C 2NABA 1YSAC 2EN7A 1DGCA 1A1FA 1WJPA 2LV2A 2M9AA 2EQ3A 2YTJA 4R2CA 2EQ1A 2WBTA 2YSOA 2YRKA 4R2RA 1AAYA 2YSPA 4R2SA 1X6FA 5KL2A 1B69A 2EOFA 1RMDA 2LCEA 1X6HA 4F2JC 2CT1A 2EM9A 2GHFA 1TN9A 1G2DC 1G2FC 1A1HA 2MKNA 2EPAA 2EOSA 2YU8A 2EM8A 2EOQA 2YRHA 4F6NA 2EPZA 1A1KA 2EOEA 2EM2A 2YTIA 2DLQA 3MHHC 3VHTB 3EPJA 4M9VC 1F2IG 2J7JA 2EPRA 2DRPA 1NCSA 5KL5A 2EN6A 2BB8A 2WCC3 2EPXA 2YRMA 5KL7A 2EN4A 4R2QA 2LVHA 1JK2A 2EMBA 2EL4A 2EOZA 2EE8A 4R2DA 1ZR9A 2EN1A 2I13A 2EMGA 2MKDA 1A1GA 1BB8A 3MHSC 2YTGA 2R1FA 2EP3A 1KJKA 5KL6A 2EM3A 1Z1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENH A;  1A1J A;  2EOR A;  4WSG A;  2D9H A;  2LT7 A;  2EOI A;  1YUJ A;  2EOX A;  1YUI A;  2YTF A;  3EPL A;  2EMI A;  2EL6 A;  2JP9 A;  2YTD A;  1P47 A;  2EPU A;  1UN6 B;  2E72 A;  2EQ0 A;  2EPC A;  2ENC A;  4FK5 C;  2EM5 A;  2CSH A;  1TF6 A;  1A1I A;  2DGC A;  2YTE A;  2WBU A;  2EMF A;  5KL3 A;  1ZU1 A;  2WBS A;  1BBO A;  5KL4 A;  1X5W A;  2EL5 A;  2EMY A;  2ENA A;  2ADR A;  2YU5 A;  4R2A A;  1TF3 A;  2PRT A;  1ZAA C;  2YTP A;  2EN8 A;  2DMI A;  1UBD C;  2MDG A;  2YTN A;  2EOH A;  3M99 B;  4F6M A;  1JK1 A;  2A25 A;  2EMW A;  2EMA A;  4R2P A;  3EPK A;  2HGH A;  2YTO A;  2YTQ A;  2EM6 A;  2ELY A;  2JPA A;  2EOM A;  2EN3 A;  2EMX A;  2LO3 A;  4IJD A;  4X9J A;  2EN2 A;  4IS1 C;  2EMZ A;  1X6E A;  2ELZ A;  2EM0 A;  2EMK A;  2EPP A;  2CTD A;  2GLI A;  2EMH A;  1A1L A;  4R2E A;  2RSI A;  2EJ4 A;  1X3C A;  2EM7 A;  2RPC A;  2EOY A;  2DLK A;  2EOJ A;  2EM4 A;  1LLM C;  3EPH A;  1MEY C;  4GZN C;  2EOO A;  2EML A;  2VRD A;  2EMC A;  3UK3 C;  2NAB A;  1YSA C;  2EN7 A;  1DGC A;  1A1F A;  1WJP A;  2LV2 A;  2M9A A;  2EQ3 A;  2YTJ A;  4R2C A;  2EQ1 A;  2WBT A;  2YSO A;  2YRK A;  4R2R A;  1AAY A;  2YSP A;  4R2S A;  1X6F A;  5KL2 A;  1B69 A;  2EOF A;  1RMD A;  2LCE A;  1X6H A;  4F2J C;  2CT1 A;  2EM9 A;  2GHF A;  1TN9 A;  1G2D C;  1G2F C;  1A1H A;  2MKN A;  2EPA A;  2EOS A;  2YU8 A;  2EM8 A;  2EOQ A;  2YRH A;  4F6N A;  2EPZ A;  1A1K A;  2EOE A;  2EM2 A;  2YTI A;  2DLQ A;  3MHH C;  3VHT B;  3EPJ A;  4M9V C;  1F2I G;  2J7J A;  2EPR A;  2DRP A;  1NCS A;  5KL5 A;  2EN6 A;  2BB8 A;  2WCC 3;  2EPX A;  2YRM A;  5KL7 A;  2EN4 A;  4R2Q A;  2LVH A;  1JK2 A;  2EMB A;  2EL4 A;  2EOZ A;  2EE8 A;  4R2D A;  1ZR9 A;  2EN1 A;  2I13 A;  2EMG A;  2MKD A;  1A1G A;  1BB8 A;  3MHS C;  2YTG A;  2R1F A;  2EP3 A;  1KJK A;  5KL6 A;  2EM3 A;  1Z1B A; 
#chains in the Genus database with same CATH topology
 1RQ0 A;  2VQF E;  2ENH A;  1A1J A;  5IWA E;  1T4N A;  2V89 A;  2V85 A;  2EOR A;  1GTK A;  2LT7 A;  2EOX A;  1XMO E;  1P47 A;  4B3T E;  2NA2 A;  2ENC A;  2CSH A;  4P78 A;  2DGC A;  4DV7 E;  2E5L E;  2YTE A;  4NHR A;  2EPN A;  4DV1 E;  3C4T A;  4R2A A;  5AC5 A;  2PRT A;  1ZAA C;  4HTG A;  1UHZ A;  2DIX A;  5LL6 R;  4WXD A;  5AAS A;  3J7A G;  2A25 A;  2K4V A;  3HPZ A;  3TQM A;  2EMA A;  3EPK A;  4TUI A;  1YYO A;  1YPN A;  2EM6 A;  4B3S E;  2ELY A;  4LFA E;  4LF8 E;  2I9I A;  2LO3 A;  2G7H A;  3KZY A;  2EN2 A;  4O5G A;  2L33 A;  2EMK A;  2CTD A;  2GLI A;  2EMH A;  4BBY A;  4WSP A;  1PJQ A;  3OML A;  4Q35 B;  2EM7 A;  2EOY A;  3ADG A;  1XNQ E;  4WX9 A;  4GZN C;  4NXN E;  4X66 E;  1EH7 A;  2VRD A;  2YZT A;  2EMC A;  4F9C B;  2NAB A;  1YSA C;  4BS9 A;  1WJP A;  2LUQ A;  1GZ6 A;  2M7Q A;  4DV2 E;  4RHB B;  2EQ1 A;  2V8Q B;  2YSO A;  4JI2 E;  4DR2 E;  2YSP A;  1X6F A;  4BCA A;  4ZYH A;  2EOF A;  3JTZ A;  3JAM C;  3J7Y p;  1N36 E;  2R76 A;  2CT1 A;  2LTR A;  2N3G A;  3IWB A;  3T1Y E;  1G2D C;  1G2F C;  2EPA A;  2KHX A;  2EM8 A;  1FKA E;  2CPN A;  3QG5 C;  2HJJ A;  2L8T A;  2LJU A;  5AE2 A;  4X64 E;  2DLQ A;  3HPS A;  1YYK A;  1NCS A;  3P1X A;  2JOX A;  2WCC 3;  5KL7 A;  4LFB E;  1PJS A;  3HQ1 A;  4LF9 E;  2EOZ A;  2EE8 A;  4BHC A;  2FGG A;  2I13 A;  2DSY A;  2EMG A;  5FLX C;  4AQY E;  5IT9 C;  1A1G A;  4P7D A;  3BF2 A;  5F3W A;  1X47 A;  1N33 E;  3F6G A;  4J8Z A;  2EP3 A;  5A6B A;  5KL6 A;  1N34 E;  4GKK E;  4JI5 E;  4F54 A;  2JY9 A;  1N3G A;  4X8W A;  4NZV A;  2WZO A;  3EQ1 A;  4JI8 E;  1YUI A;  1IQS A;  4JV5 E;  2YWQ A;  3C6M A;  3T1H E;  4YY3 E;  5A2Q C;  2L3J A;  5IXM B;  1TF6 A;  4B3R E;  1A1I A;  2H36 X;  1X48 A;  3KWR A;  1T39 A;  2EMF A;  5KL3 A;  2WBS A;  1YFH A;  2L3C A;  1X5W A;  4BHB A;  1ZBQ A;  2ADR A;  2LUP B;  2YU5 A;  1TF3 A;  2UU9 E;  2NUG A;  2L6M A;  3DJW A;  4R8O A;  4MLQ A;  1WHQ A;  4M2Z A;  4R2P A;  2HC5 A;  1PJT A;  4KHP E;  2JWO A;  4DV6 E;  1AH5 A;  2JPA A;  2V86 A;  2V83 A;  2F4V E;  2VE7 C;  2EM0 A;  2V88 A;  3DF6 A;  4LF6 E;  1RC7 A;  2RSI A;  1MGT A;  2DLK A;  5ADZ A;  4JI4 E;  1MEY C;  4DR6 E;  2EOO A;  3UK3 C;  3C6K A;  3ADL A;  2EN7 A;  1DGC A;  1EH8 A;  3VK6 A;  1A1F A;  1IMU A;  3AV0 A;  4DR1 E;  1NEI A;  2RS6 A;  4WYQ B;  3H09 A;  4R2R A;  2UUB E;  1AAY A;  4KWY A;  2B3T B;  2LTS A;  4I8O A;  5KL2 A;  1HNW E;  1RMD A;  4MLV A;  3ADI A;  1X6H A;  2E1M A;  3AUZ A;  2V87 A;  2M1S A;  3MSW A;  4WFT A;  4ZYD A;  3ZOQ B;  1A1H A;  4JI1 E;  4JYA E;  2EPZ A;  1A1K A;  4M9V C;  1F2I G;  2J7J A;  3HXL A;  2DRP A;  4NXM E;  1DI2 A;  2DB2 A;  1QNT A;  5T6J A;  1T38 A;  4R2Q A;  1X49 A;  4GKJ E;  1DQ3 A;  2EMB A;  4O4K A;  4DMI A;  2MC6 A;  4R2D A;  2F8B A;  4YHH E;  2EN1 A;  2IHR 1;  1EKZ A;  3FIG A;  2R1F A;  3LML A;  2EPM X;  2MC5 A;  2YTN A;  4L8N A;  4Q28 A;  5AE3 A;  1L4S A;  4WSG A;  2D9H A;  1YUJ A;  4LF7 E;  2YTF A;  3K6Q A;  2JP9 A;  4BC7 A;  2E72 A;  4FK5 C;  2EM5 A;  2LE2 A;  2B9D A;  4JI0 E;  2WBU A;  1ZU1 A;  1UIL A;  5IV8 B;  2EL5 A;  4RH8 A;  2EMY A;  4X65 E;  2ENA A;  2L2M A;  2ODR D;  2UXB E;  4DV4 E;  4L5N C;  2UUA E;  2YTP A;  2EN8 A;  2DMI A;  4GEQ B;  2MDG A;  4DR4 E;  3IWD A;  2EOH A;  2EPK X;  2K7I A;  3M99 B;  4M30 A;  3JU0 A;  4JI7 E;  4F6M A;  1JK1 A;  2EMW A;  2HGH A;  2YTO A;  4DV3 E;  4LTY A;  3THN A;  1GQE A;  2KOU A;  2EOM A;  2EN3 A;  1WXR A;  3LLH A;  5AC4 A;  4IJD A;  4X9J A;  3OTO E;  4IS1 C;  2EMZ A;  1X6E A;  2EPP A;  1WRJ A;  5A6K A;  5LMU E;  2UXD E;  2EJ4 A;  3J81 C;  1X3C A;  2RPC A;  4OX9 E;  1QU6 A;  3C4B A;  1LLM C;  1PDA A;  4JI6 E;  2GPI A;  4DR5 E;  1EH6 A;  1IBL E;  4N4R B;  1SR9 A;  2RS7 A;  2FTX B;  4DKK A;  3J80 C;  5A69 A;  2LMZ A;  2EQ3 A;  2YTJ A;  2WBT A;  4DUZ E;  4M0V A;  4R2S A;  4DR7 E;  2BBG A;  4WXC A;  3KZZ A;  1B69 A;  4DR3 E;  2LCE A;  1IBK E;  4BC9 A;  2GHF A;  3L00 A;  2N8X A;  3RMP A;  2EOS A;  1HR0 E;  2EOQ A;  2YRH A;  2YTI A;  3MHH C;  3VHT B;  3EPJ A;  5A6B D;  5KL5 A;  2YPN A;  2EN6 A;  2EPX A;  2YRM A;  2EN4 A;  5BR8 E;  1IBM E;  2EPL X;  4ZYG A;  2EL4 A;  1YYW A;  1ZR9 A;  1SFE A;  1PKP A;  4DV0 E;  2MDR A;  2UXC E;  1BB8 A;  2JXP A;  3MHS C;  2YTG A;  4O43 A;  2L2K B;  1KJK A;  2LJH A;  1Z1B A;  4LF4 E;  2NUE A;  5LMN E;  2EOI A;  1BBG A;  3IWC A;  3EPL A;  2EMI A;  2EL6 A;  2EZ6 A;  2VF1 A;  2YTD A;  2EPU A;  4TUG A;  1UN6 B;  2EQ0 A;  2EPC A;  1FJG E;  5DNY A;  4F9A B;  1XNR E;  4DV5 E;  1BBO A;  2DMY A;  5KL4 A;  3THO B;  1UBD C;  2ODR C;  1T4L B;  1J5E E;  2JVA A;  2LBS B;  2LRS A;  1HNX E;  2B7T A;  2YTQ A;  3VYY A;  2RQL A;  3F6H A;  2EMX A;  4LF5 E;  1N32 E;  1HNZ E;  1T4O A;  2VQE E;  1KYQ A;  2ELZ A;  4ZYE A;  1A1L A;  4R2E A;  4F9B B;  1YZ9 A;  4HEI A;  2EOJ A;  2EM4 A;  5A6A A;  2B7V A;  4OOG C;  3EPH A;  5TSE A;  5LLQ A;  4KZS A;  4B3M E;  4LU9 A;  2EML A;  1I94 E;  4K0K E;  4LFC E;  2UUC E;  2ZM6 E;  1WHN A;  2RTX A;  1ZBT A;  2N3H A;  2LV2 A;  2HHH E;  2M9A A;  2JOB A;  4R2C A;  1STU A;  2L2N A;  2YRK A;  3BID A;  1IQO A;  1J26 A;  4O24 A;  2YT4 A;  2Q8U A;  4F2J C;  2EPO A;  2EM9 A;  2NUF A;  4JI3 E;  1TN9 A;  4DUY E;  4BMJ A;  2MKN A;  2YU8 A;  2RSM A;  2FV4 B;  3BBG A;  4F6N A;  4X62 E;  2EOE A;  2EM2 A;  2L92 A;  2EPR A;  2BB8 A;  5A6J A;  5AE1 A;  3BGH A;  3ADJ A;  2LVH A;  3HTX A;  1JK2 A;  2EWL A;  5CFF E;  2KON A;  1XMQ E;  2JYA A;  2MKD A;  4WPY A;  3VYX A;  2M4I A;  3ECR A;  1O0W A;  2JR1 A;  4R03 A;  2EM3 A; 
#chains in the Genus database with same CATH homology
 2ENH A;  1A1J A;  2EOR A;  4WSG A;  2D9H A;  2LT7 A;  2EOI A;  1YUJ A;  2EOX A;  1YUI A;  2YTF A;  3EPL A;  2EMI A;  2EL6 A;  2JP9 A;  2YTD A;  1P47 A;  2EPU A;  1UN6 B;  2E72 A;  2EQ0 A;  2EPC A;  2ENC A;  4FK5 C;  2EM5 A;  2CSH A;  1TF6 A;  1A1I A;  2DGC A;  2YTE A;  2WBU A;  2EMF A;  5KL3 A;  1ZU1 A;  2WBS A;  1BBO A;  5KL4 A;  1X5W A;  2EL5 A;  2EMY A;  2ENA A;  2ADR A;  2YU5 A;  4R2A A;  1TF3 A;  2PRT A;  1ZAA C;  2YTP A;  2EN8 A;  2DMI A;  1UBD C;  2MDG A;  2YTN A;  2EOH A;  3M99 B;  4F6M A;  1JK1 A;  2A25 A;  2EMW A;  2EMA A;  4R2P A;  3EPK A;  2HGH A;  2YTO A;  2YTQ A;  2EM6 A;  2ELY A;  2JPA A;  2EOM A;  2EN3 A;  2EMX A;  2LO3 A;  4IJD A;  4X9J A;  2EN2 A;  4IS1 C;  2EMZ A;  1X6E A;  2ELZ A;  2EM0 A;  2EMK A;  2EPP A;  2CTD A;  2GLI A;  2EMH A;  1A1L A;  4R2E A;  2RSI A;  2EJ4 A;  1X3C A;  2EM7 A;  2RPC A;  2EOY A;  2DLK A;  2EOJ A;  2EM4 A;  1LLM C;  3EPH A;  1MEY C;  4GZN C;  2EOO A;  2EML A;  2VRD A;  2EMC A;  3UK3 C;  2NAB A;  1YSA C;  2EN7 A;  1DGC A;  1A1F A;  1WJP A;  2LV2 A;  2M9A A;  2EQ3 A;  2YTJ A;  4R2C A;  2EQ1 A;  2WBT A;  2YSO A;  2YRK A;  4R2R A;  1AAY A;  2YSP A;  4R2S A;  1X6F A;  5KL2 A;  1B69 A;  2EOF A;  1RMD A;  2LCE A;  1X6H A;  4F2J C;  2CT1 A;  2EM9 A;  2GHF A;  1TN9 A;  1G2D C;  1G2F C;  1A1H A;  2MKN A;  2EPA A;  2EOS A;  2YU8 A;  2EM8 A;  2EOQ A;  2YRH A;  4F6N A;  2EPZ A;  1A1K A;  2EOE A;  2EM2 A;  2YTI A;  2DLQ A;  3MHH C;  3VHT B;  3EPJ A;  4M9V C;  1F2I G;  2J7J A;  2EPR A;  2DRP A;  1NCS A;  5KL5 A;  2EN6 A;  2BB8 A;  2WCC 3;  2EPX A;  2YRM A;  5KL7 A;  2EN4 A;  4R2Q A;  2LVH A;  1JK2 A;  2EMB A;  2EL4 A;  2EOZ A;  2EE8 A;  4R2D A;  1ZR9 A;  2EN1 A;  2I13 A;  2EMG A;  2MKD A;  1A1G A;  1BB8 A;  3MHS C;  2YTG A;  2R1F A;  2EP3 A;  1KJK A;  5KL6 A;  2EM3 A;  1Z1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...