2LCEA

Chemical shift assignment of hr4436b from homo sapiens, northeast structural genomics consortium
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
MTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Hr4436B.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords B-cell lymphoma 6 protein
total genus 10
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lceA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lceA02
2YTDA 2EM5A 2MDGA 2EN2A 2D9HA 2DLKA 2EM6A 2EMFA 2EMLA 1Z1BA 1DGCA 2EQ3A 1ZU1A 2EOHA 1RMDA 1X6HA 2RPCA 2EQ1A 4X9JA 1ZR9A 2YTJA 1P47A 1G2DC 2EMAA 2PRTA 5KL2A 4R2DA 2EN3A 1KJKA 2EOMA 2EPRA 4GZNC 2BB8A 2NABA 3EPKA 2J7JA 2DRPA 2EOJA 4R2QA 2EORA 2ENCA 2EMXA 2EL4A 2WBSA 2LCEA 2EM4A 2R1FA 2EM7A 3EPJA 2EOEA 2MKNA 2YRMA 2YTGA 2EMHA 1AAYA 1TF6A 2EM3A 2YTOA 4F6MA 2JPAA 1A1GA 2EOQA 2YTIA 2LT7A 1JK2A 2EL6A 2EOOA 2YRHA 2EM9A 1B69A 2GHFA 2EN6A 2DLQA 2EPUA 2EMGA 5KL3A 2EMBA 2EPCA 2EMKA 3MHHC 2YRKA 3EPLA 2EOIA 2YTEA 4F2JC 1YSAC 1A1KA 2CTDA 2EMWA 5KL6A 1YUJA 2EPAA 1G2FC 2EOZA 2EN4A 2A25A 1X3CA 3M99B 2EM2A 2EOFA 2LO3A 2EMIA 2EN7A 4R2AA 1A1IA 1BB8A 4R2PA 1A1FA 2DMIA 2EOYA 2YU8A 2YTFA 4IS1C 3UK3C 2EMCA 1TF3A 2CT1A 4IJDA 2EPZA 4R2CA 5KL7A 2EMZA 1MEYC 1YUIA 2EJ4A 2LV2A 2YU5A 2EN8A 2VRDA 2WBUA 2LVHA 2EPPA 2EE8A 2CSHA 2ENAA 1A1JA 1A1LA 2WCC3 2YSOA 2EPXA 2ELYA 2ELZA 4FK5C 2DGCA 2YTNA 2MKDA 3MHSC 4R2RA 1LLMC 5KL5A 1X6EA 2EQ0A 2EOXA 1UN6B 2RSIA 4F6NA 1X5WA 2EMYA 4R2EA 1UBDC 1X6FA 1ZAAC 2HGHA 2GLIA 1BBOA 1NCSA 2YTQA 4M9VC 3EPHA 2EP3A 2YSPA 4R2SA 2I13A 1F2IG 2EN1A 1TN9A 2EL5A 1WJPA 2YTPA 2E72A 3VHTB 2M9AA 2WBTA 2EM8A 4WSGA 2ADRA 2ENHA 2JP9A 2EOSA 1JK1A 5KL4A 1A1HA 2EM0A
chains in the Genus database with same CATH superfamily
2EM5A 2JOXA 2DLKA 1RQ0A 2EQ3A 1ZU1A 4BMJA 4J8ZA 4X9JA 2DMYA 1T39A 4DR6E 2EOMA 4GZNC 3EPKA 2J7JA 2DRPA 4LF8E 2EOJA 4BC7A 4RH8A 2EORA 2ODRD 2L92A 3LLHA 2JWOA 1IQSA 4DUYE 1YYKA 3EPJA 2E5LE 2MKNA 1UILA 2YTOA 2H36X 4F9AB 2B3TB 2L2NA 3ADLA 2DLQA 4O5GA 2EPUA 4GKKE 4BHCA 3J7Yp 4M2ZA 3BIDA 3MHHC 2V87A 2EOIA 2V89A 4ZYDA 5AE2A 3BGHA 3LMLA 4LTYA 1X3CA 4LFCE 2EOFA 5A6BD 2B7VA 2EMIA 3J7AG 2L33A 4KWYA 3HPZA 4F9CB 4DR4E 4NZVA 4JI6E 1QNTA 2DB2A 2EMCA 4X8WA 3UK3C 1YYOA 4DV7E 1NEIA 2JOBA 2CT1A 4IJDA 4ZYHA 4LF6E 1MEYC 1YUIA 1KYQA 2EJ4A 2LV2A 1O0WA 5A6AA 2LTSA 4JV5E 2NUEA 3HQ1A 2LVHA 5DNYA 2EE8A 4BHBA 2CSHA 4OOGC 5AE3A 2YPNA 1YPNA 2EPXA 1GZ6A 2YTNA 5F3WA 2EQ0A 5A2QC 4LF7E 2EOXA 4B3TE 2RSIA 1X5WA 2Q8UA 2ZM6E 2L3JA 1UBDC 4M9VC 3EPHA 5BR8E 4R2SA 1F2IG 2FV4B 4R03A 4Q28A 3THOB 3L00A 1WXRA 1WRJA 1L4SA 2RS6A 4DMIA 2EOSA 2L3CA 1YFHA 1JK1A 4YY3E 1A1HA 4X64E 2YTDA 4JYAE 1WHNA 2YT4A 4P78A 5AC5A 4F54A 2EMFA 1Z1BA 2EOHA 2F8BA 3AV0A 3BBGA 2EZ6A 2G7HA 2K7IA 5AC4A 2EQ1A 2LUPB 2B9DA 3TQMA 1ZR9A 5A6KA 4K0KE 2EMAA 2V86A 2VF1A 4P7DA 5FLXC 5CFFE 2EPOA 2L2MA 4JI5E 2EPRA 4WXCA 4R2QA 3C4TA 4MLVA 2ENCA 4BBYA 1PJSA 1STUA 2EM7A 4O4KA 2YRMA 1AAYA 2EM3A 4JI2E 1A1GA 2EOQA 1UHZA 2EL6A 2EOOA 1B69A 2GHFA 1J5EE 2NUGA 2VQFE 2EMGA 4HEIA 3EPLA 3FIGA 3IWBA 4F2JC 1A1KA 1N36E 1FKAE 5KL6A 2EPMX 2UXCE 2EPAA 3C4BA 2NUFA 3M99B 5A69A 2EM2A 1T38A 2HJJA 3KWRA 2LO3A 3JTZA 3ADIA 1T4NA 2V85A 4DV4E 1BB8A 2M4IA 1A1FA 2DMIA 1N3GA 4F9BB 2YWQA 3H09A 4TUIA 4DV5E 2V8QB 2JYAA 2EMZA 3MSWA 2YU5A 2WZOA 1I94E 1SFEA 4Q35B 1SR9A 4M30A 1GTKA 2ENAA 2WCC3 2ELZA 1WHQA 2MKDA 1LLMC 4JI8E 4JI7E 5A6BA 2CPNA 1XMQE 4NHRA 4F6NA 2JXPA 5IXMB 3C6MA 2EP3A 2YSPA 2EPKX 2I13A 2EN1A 4DR2E 3K6QA 1WJPA 2YTPA 3VHTB 2M9AA 4DV0E 2EM8A 3RMPA 2JP9A 2ENHA 2LRSA 2LUQA 5LMUE 1HNZE 3IWDA 5ADZA 5TSEA 2EM0A 4AQYE 2DIXA 2D9HA 2EM6A 3KZZA 2I9IA 1X47A 3JU0A 1DGCA 1PKPA 1X48A 2RPCA 4DR5E 3DJWA 1P47A 2PRTA 1IBKE 2UUCE 5KL2A 1XNQE 3OTOE 1YYWA 4DV2E 4R2DA 4X66E 4WFTA 4DV1E 5A6JA 2EWLA 2UUBE 2UXDE 3IWCA 2EMXA 2WBSA 2LCEA 2R1FA 1BBGA 4KHPE 2GPIA 2EMHA 4DKKA 1TF6A 4X62E 2YTIA 2LT7A 1JK2A 2YRHA 2EM9A 1EKZA 2EN6A 4DR3E 3HPSA 5KL3A 2EMBA 1DQ3A 4HTGA 2MC5A 4WPYA 2YTEA 2KOUA 4X65E 4N4RB 5AE1A 1YSAC 4LFBE 2UXBE 2RTXA 2EMWA 4GEQB 2V88A 1G2FC 2A25A 4DR7E 1N32E 3F6HA 2M1SA 4ZYGA 4YHHE 4R2AA 2VQEE 1HR0E 4LU9A 3ADGA 5LL6R 3QG5C 2JY9A 2YTFA 2NA2A 2VE7C 3C6KA 5IV8B 2N8XA 1TF3A 2L8TA 2LBSB 2EPZA 5KL7A 2R76A 3F6GA 2EN8A 2EPNA 2VRDA 2WBUA 1T4OA 1DI2A 1EH6A 1A1JA 1A1LA 2YSOA 4LF9E 4FK5C 2ELYA 4TUGA 1XMOE 2DGCA 1XNRE 2JVAA 4L5NC 3MHSC 1FJGE 3BF2A 4DUZE 1ZBQA 1UN6B 2MC6A 4JI1E 2EMYA 3P1XA 4R2EA 1ZAAC 1GQEA 2M7QA 4DV3E 1HNWE 2GLIA 2K4VA 1BBOA 2YTQA 3AUZA 1MGTA 2UUAE 2MDRA 3THNA 2RSMA 4NXME 1IBME 3VYXA 3OMLA 2E72A 2HHHE 4WSGA 3JAMC 4M0VA 4ZYEA 2N3HA 3EQ1A 5KL4A 1TN9A 3J81C 2L2KB 4DR1E 4B3ME 2UU9E 2MDGA 2EN2A 4JI0E 1PJTA 5IWAE 2EMLA 4O43A 3T1HE 1RMDA 2RS7A 2DSYA 1X6HA 1PDAA 4WSPA 4WXDA 3T1YE 2YTJA 1G2DC 3VK6A 5T6JA 4L8NA 2IHR1 4DV6E 1J26A 1HNXE 2EN3A 1KJKA 2BB8A 2NABA 2LMZA 2E1MA 2EPLX 2KHXA 2ODRC 2EL4A 2EM4A 4BS9A 2EOEA 2YTGA 4F6MA 2JPAA 4OX9E 3HTXA 3HXLA 1PJQA 1IQOA 2V83A 2EPCA 2EMKA 3ADJA 2YRKA 4JI4E 2YZTA 4NXNE 1EH7A 3KZYA 4WX9A 2CTDA 4LF4E 1YUJA 2L6MA 2EOZA 2EN4A 4BCAA 4LF5E 1X49A 4BC9A 2EN7A 1EH8A 1A1IA 4R2PA 5IT9C 2FGGA 2EOYA 2LJHA 2YU8A 1IMUA 4LFAE 4IS1C 1AH5A 1QU6A 1YZ9A 2FTXB 4R2CA 5AASA 4WYQB 2HC5A 3VYYA 4B3SE 1N34E 1IBLE 1RC7A 4RHBB 2EPPA 2BBGA 4KZSA 5LMNE 2B7TA 4R8OA 4R2RA 5KL5A 1X6EA 2JR1A 2N3GA 2F4VE 3DF6A 2LTRA 4O24A 1X6FA 2LE2A 5LLQA 2HGHA 1T4LB 1NCSA 4MLQA 2LJUA 2EL5A 2RQLA 1N33E 2KONA 3ZOQB 1ZBTA 3ECRA 4B3RE 2WBTA 3J80C 2ADRA 4JI3E 4I8OA 4GKJE
chains in the Genus database with same CATH topology
2YTDA 2EM5A 2MDGA 2EN2A 2D9HA 2DLKA 2EM6A 2EMFA 2EMLA 1Z1BA 1DGCA 2EQ3A 1ZU1A 2EOHA 1RMDA 1X6HA 2RPCA 2EQ1A 4X9JA 1ZR9A 2YTJA 1P47A 1G2DC 2EMAA 2PRTA 5KL2A 4R2DA 2EN3A 1KJKA 2EOMA 2EPRA 4GZNC 2BB8A 2NABA 3EPKA 2J7JA 2DRPA 2EOJA 4R2QA 2EORA 2ENCA 2EMXA 2EL4A 2WBSA 2LCEA 2EM4A 2R1FA 2EM7A 3EPJA 2EOEA 2MKNA 2YRMA 2YTGA 2EMHA 1AAYA 1TF6A 2EM3A 2YTOA 4F6MA 2JPAA 1A1GA 2EOQA 2YTIA 2LT7A 1JK2A 2EL6A 2EOOA 2YRHA 2EM9A 1B69A 2GHFA 2EN6A 2DLQA 2EPUA 2EMGA 5KL3A 2EMBA 2EPCA 2EMKA 3MHHC 2YRKA 3EPLA 2EOIA 2YTEA 4F2JC 1YSAC 1A1KA 2CTDA 2EMWA 5KL6A 1YUJA 2EPAA 1G2FC 2EOZA 2EN4A 2A25A 1X3CA 3M99B 2EM2A 2EOFA 2LO3A 2EMIA 2EN7A 4R2AA 1A1IA 1BB8A 4R2PA 1A1FA 2DMIA 2EOYA 2YU8A 2YTFA 4IS1C 3UK3C 2EMCA 1TF3A 2CT1A 4IJDA 2EPZA 4R2CA 5KL7A 2EMZA 1MEYC 1YUIA 2EJ4A 2LV2A 2YU5A 2EN8A 2VRDA 2WBUA 2LVHA 2EPPA 2EE8A 2CSHA 2ENAA 1A1JA 1A1LA 2WCC3 2YSOA 2EPXA 2ELYA 2ELZA 4FK5C 2DGCA 2YTNA 2MKDA 3MHSC 4R2RA 1LLMC 5KL5A 1X6EA 2EQ0A 2EOXA 1UN6B 2RSIA 4F6NA 1X5WA 2EMYA 4R2EA 1UBDC 1X6FA 1ZAAC 2HGHA 2GLIA 1BBOA 1NCSA 2YTQA 4M9VC 3EPHA 2EP3A 2YSPA 4R2SA 2I13A 1F2IG 2EN1A 1TN9A 2EL5A 1WJPA 2YTPA 2E72A 3VHTB 2M9AA 2WBTA 2EM8A 4WSGA 2ADRA 2ENHA 2JP9A 2EOSA 1JK1A 5KL4A 1A1HA 2EM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTD A;  2EM5 A;  2MDG A;  2EN2 A;  2D9H A;  2DLK A;  2EM6 A;  2EMF A;  2EML A;  1Z1B A;  1DGC A;  2EQ3 A;  1ZU1 A;  2EOH A;  1RMD A;  1X6H A;  2RPC A;  2EQ1 A;  4X9J A;  1ZR9 A;  2YTJ A;  1P47 A;  1G2D C;  2EMA A;  2PRT A;  5KL2 A;  4R2D A;  2EN3 A;  1KJK A;  2EOM A;  2EPR A;  4GZN C;  2BB8 A;  2NAB A;  3EPK A;  2J7J A;  2DRP A;  2EOJ A;  4R2Q A;  2EOR A;  2ENC A;  2EMX A;  2EL4 A;  2WBS A;  2LCE A;  2EM4 A;  2R1F A;  2EM7 A;  3EPJ A;  2EOE A;  2MKN A;  2YRM A;  2YTG A;  2EMH A;  1AAY A;  1TF6 A;  2EM3 A;  2YTO A;  4F6M A;  2JPA A;  1A1G A;  2EOQ A;  2YTI A;  2LT7 A;  1JK2 A;  2EL6 A;  2EOO A;  2YRH A;  2EM9 A;  1B69 A;  2GHF A;  2EN6 A;  2DLQ A;  2EPU A;  2EMG A;  5KL3 A;  2EMB A;  2EPC A;  2EMK A;  3MHH C;  2YRK A;  3EPL A;  2EOI A;  2YTE A;  4F2J C;  1YSA C;  1A1K A;  2CTD A;  2EMW A;  5KL6 A;  1YUJ A;  2EPA A;  1G2F C;  2EOZ A;  2EN4 A;  2A25 A;  1X3C A;  3M99 B;  2EM2 A;  2EOF A;  2LO3 A;  2EMI A;  2EN7 A;  4R2A A;  1A1I A;  1BB8 A;  4R2P A;  1A1F A;  2DMI A;  2EOY A;  2YU8 A;  2YTF A;  4IS1 C;  3UK3 C;  2EMC A;  1TF3 A;  2CT1 A;  4IJD A;  2EPZ A;  4R2C A;  5KL7 A;  2EMZ A;  1MEY C;  1YUI A;  2EJ4 A;  2LV2 A;  2YU5 A;  2EN8 A;  2VRD A;  2WBU A;  2LVH A;  2EPP A;  2EE8 A;  2CSH A;  2ENA A;  1A1J A;  1A1L A;  2WCC 3;  2YSO A;  2EPX A;  2ELY A;  2ELZ A;  4FK5 C;  2DGC A;  2YTN A;  2MKD A;  3MHS C;  4R2R A;  1LLM C;  5KL5 A;  1X6E A;  2EQ0 A;  2EOX A;  1UN6 B;  2RSI A;  4F6N A;  1X5W A;  2EMY A;  4R2E A;  1UBD C;  1X6F A;  1ZAA C;  2HGH A;  2GLI A;  1BBO A;  1NCS A;  2YTQ A;  4M9V C;  3EPH A;  2EP3 A;  2YSP A;  4R2S A;  2I13 A;  1F2I G;  2EN1 A;  1TN9 A;  2EL5 A;  1WJP A;  2YTP A;  2E72 A;  3VHT B;  2M9A A;  2WBT A;  2EM8 A;  4WSG A;  2ADR A;  2ENH A;  2JP9 A;  2EOS A;  1JK1 A;  5KL4 A;  1A1H A;  2EM0 A; 
#chains in the Genus database with same CATH topology
 2EM5 A;  2JOX A;  2DLK A;  1RQ0 A;  2EQ3 A;  1ZU1 A;  4BMJ A;  4J8Z A;  4X9J A;  2DMY A;  1T39 A;  4DR6 E;  2EOM A;  4GZN C;  3EPK A;  2J7J A;  2DRP A;  4LF8 E;  2EOJ A;  4BC7 A;  4RH8 A;  2EOR A;  2ODR D;  2L92 A;  3LLH A;  2JWO A;  1IQS A;  4DUY E;  1YYK A;  3EPJ A;  2E5L E;  2MKN A;  1UIL A;  2YTO A;  2H36 X;  4F9A B;  2B3T B;  2L2N A;  3ADL A;  2DLQ A;  4O5G A;  2EPU A;  4GKK E;  4BHC A;  3J7Y p;  4M2Z A;  3BID A;  3MHH C;  2V87 A;  2EOI A;  2V89 A;  4ZYD A;  5AE2 A;  3BGH A;  3LML A;  4LTY A;  1X3C A;  4LFC E;  2EOF A;  5A6B D;  2B7V A;  2EMI A;  3J7A G;  2L33 A;  4KWY A;  3HPZ A;  4F9C B;  4DR4 E;  4NZV A;  4JI6 E;  1QNT A;  2DB2 A;  2EMC A;  4X8W A;  3UK3 C;  1YYO A;  4DV7 E;  1NEI A;  2JOB A;  2CT1 A;  4IJD A;  4ZYH A;  4LF6 E;  1MEY C;  1YUI A;  1KYQ A;  2EJ4 A;  2LV2 A;  1O0W A;  5A6A A;  2LTS A;  4JV5 E;  2NUE A;  3HQ1 A;  2LVH A;  5DNY A;  2EE8 A;  4BHB A;  2CSH A;  4OOG C;  5AE3 A;  2YPN A;  1YPN A;  2EPX A;  1GZ6 A;  2YTN A;  5F3W A;  2EQ0 A;  5A2Q C;  4LF7 E;  2EOX A;  4B3T E;  2RSI A;  1X5W A;  2Q8U A;  2ZM6 E;  2L3J A;  1UBD C;  4M9V C;  3EPH A;  5BR8 E;  4R2S A;  1F2I G;  2FV4 B;  4R03 A;  4Q28 A;  3THO B;  3L00 A;  1WXR A;  1WRJ A;  1L4S A;  2RS6 A;  4DMI A;  2EOS A;  2L3C A;  1YFH A;  1JK1 A;  4YY3 E;  1A1H A;  4X64 E;  2YTD A;  4JYA E;  1WHN A;  2YT4 A;  4P78 A;  5AC5 A;  4F54 A;  2EMF A;  1Z1B A;  2EOH A;  2F8B A;  3AV0 A;  3BBG A;  2EZ6 A;  2G7H A;  2K7I A;  5AC4 A;  2EQ1 A;  2LUP B;  2B9D A;  3TQM A;  1ZR9 A;  5A6K A;  4K0K E;  2EMA A;  2V86 A;  2VF1 A;  4P7D A;  5FLX C;  5CFF E;  2EPO A;  2L2M A;  4JI5 E;  2EPR A;  4WXC A;  4R2Q A;  3C4T A;  4MLV A;  2ENC A;  4BBY A;  1PJS A;  1STU A;  2EM7 A;  4O4K A;  2YRM A;  1AAY A;  2EM3 A;  4JI2 E;  1A1G A;  2EOQ A;  1UHZ A;  2EL6 A;  2EOO A;  1B69 A;  2GHF A;  1J5E E;  2NUG A;  2VQF E;  2EMG A;  4HEI A;  3EPL A;  3FIG A;  3IWB A;  4F2J C;  1A1K A;  1N36 E;  1FKA E;  5KL6 A;  2EPM X;  2UXC E;  2EPA A;  3C4B A;  2NUF A;  3M99 B;  5A69 A;  2EM2 A;  1T38 A;  2HJJ A;  3KWR A;  2LO3 A;  3JTZ A;  3ADI A;  1T4N A;  2V85 A;  4DV4 E;  1BB8 A;  2M4I A;  1A1F A;  2DMI A;  1N3G A;  4F9B B;  2YWQ A;  3H09 A;  4TUI A;  4DV5 E;  2V8Q B;  2JYA A;  2EMZ A;  3MSW A;  2YU5 A;  2WZO A;  1I94 E;  1SFE A;  4Q35 B;  1SR9 A;  4M30 A;  1GTK A;  2ENA A;  2WCC 3;  2ELZ A;  1WHQ A;  2MKD A;  1LLM C;  4JI8 E;  4JI7 E;  5A6B A;  2CPN A;  1XMQ E;  4NHR A;  4F6N A;  2JXP A;  5IXM B;  3C6M A;  2EP3 A;  2YSP A;  2EPK X;  2I13 A;  2EN1 A;  4DR2 E;  3K6Q A;  1WJP A;  2YTP A;  3VHT B;  2M9A A;  4DV0 E;  2EM8 A;  3RMP A;  2JP9 A;  2ENH A;  2LRS A;  2LUQ A;  5LMU E;  1HNZ E;  3IWD A;  5ADZ A;  5TSE A;  2EM0 A;  4AQY E;  2DIX A;  2D9H A;  2EM6 A;  3KZZ A;  2I9I A;  1X47 A;  3JU0 A;  1DGC A;  1PKP A;  1X48 A;  2RPC A;  4DR5 E;  3DJW A;  1P47 A;  2PRT A;  1IBK E;  2UUC E;  5KL2 A;  1XNQ E;  3OTO E;  1YYW A;  4DV2 E;  4R2D A;  4X66 E;  4WFT A;  4DV1 E;  5A6J A;  2EWL A;  2UUB E;  2UXD E;  3IWC A;  2EMX A;  2WBS A;  2LCE A;  2R1F A;  1BBG A;  4KHP E;  2GPI A;  2EMH A;  4DKK A;  1TF6 A;  4X62 E;  2YTI A;  2LT7 A;  1JK2 A;  2YRH A;  2EM9 A;  1EKZ A;  2EN6 A;  4DR3 E;  3HPS A;  5KL3 A;  2EMB A;  1DQ3 A;  4HTG A;  2MC5 A;  4WPY A;  2YTE A;  2KOU A;  4X65 E;  4N4R B;  5AE1 A;  1YSA C;  4LFB E;  2UXB E;  2RTX A;  2EMW A;  4GEQ B;  2V88 A;  1G2F C;  2A25 A;  4DR7 E;  1N32 E;  3F6H A;  2M1S A;  4ZYG A;  4YHH E;  4R2A A;  2VQE E;  1HR0 E;  4LU9 A;  3ADG A;  5LL6 R;  3QG5 C;  2JY9 A;  2YTF A;  2NA2 A;  2VE7 C;  3C6K A;  5IV8 B;  2N8X A;  1TF3 A;  2L8T A;  2LBS B;  2EPZ A;  5KL7 A;  2R76 A;  3F6G A;  2EN8 A;  2EPN A;  2VRD A;  2WBU A;  1T4O A;  1DI2 A;  1EH6 A;  1A1J A;  1A1L A;  2YSO A;  4LF9 E;  4FK5 C;  2ELY A;  4TUG A;  1XMO E;  2DGC A;  1XNR E;  2JVA A;  4L5N C;  3MHS C;  1FJG E;  3BF2 A;  4DUZ E;  1ZBQ A;  1UN6 B;  2MC6 A;  4JI1 E;  2EMY A;  3P1X A;  4R2E A;  1ZAA C;  1GQE A;  2M7Q A;  4DV3 E;  1HNW E;  2GLI A;  2K4V A;  1BBO A;  2YTQ A;  3AUZ A;  1MGT A;  2UUA E;  2MDR A;  3THN A;  2RSM A;  4NXM E;  1IBM E;  3VYX A;  3OML A;  2E72 A;  2HHH E;  4WSG A;  3JAM C;  4M0V A;  4ZYE A;  2N3H A;  3EQ1 A;  5KL4 A;  1TN9 A;  3J81 C;  2L2K B;  4DR1 E;  4B3M E;  2UU9 E;  2MDG A;  2EN2 A;  4JI0 E;  1PJT A;  5IWA E;  2EML A;  4O43 A;  3T1H E;  1RMD A;  2RS7 A;  2DSY A;  1X6H A;  1PDA A;  4WSP A;  4WXD A;  3T1Y E;  2YTJ A;  1G2D C;  3VK6 A;  5T6J A;  4L8N A;  2IHR 1;  4DV6 E;  1J26 A;  1HNX E;  2EN3 A;  1KJK A;  2BB8 A;  2NAB A;  2LMZ A;  2E1M A;  2EPL X;  2KHX A;  2ODR C;  2EL4 A;  2EM4 A;  4BS9 A;  2EOE A;  2YTG A;  4F6M A;  2JPA A;  4OX9 E;  3HTX A;  3HXL A;  1PJQ A;  1IQO A;  2V83 A;  2EPC A;  2EMK A;  3ADJ A;  2YRK A;  4JI4 E;  2YZT A;  4NXN E;  1EH7 A;  3KZY A;  4WX9 A;  2CTD A;  4LF4 E;  1YUJ A;  2L6M A;  2EOZ A;  2EN4 A;  4BCA A;  4LF5 E;  1X49 A;  4BC9 A;  2EN7 A;  1EH8 A;  1A1I A;  4R2P A;  5IT9 C;  2FGG A;  2EOY A;  2LJH A;  2YU8 A;  1IMU A;  4LFA E;  4IS1 C;  1AH5 A;  1QU6 A;  1YZ9 A;  2FTX B;  4R2C A;  5AAS A;  4WYQ B;  2HC5 A;  3VYY A;  4B3S E;  1N34 E;  1IBL E;  1RC7 A;  4RHB B;  2EPP A;  2BBG A;  4KZS A;  5LMN E;  2B7T A;  4R8O A;  4R2R A;  5KL5 A;  1X6E A;  2JR1 A;  2N3G A;  2F4V E;  3DF6 A;  2LTR A;  4O24 A;  1X6F A;  2LE2 A;  5LLQ A;  2HGH A;  1T4L B;  1NCS A;  4MLQ A;  2LJU A;  2EL5 A;  2RQL A;  1N33 E;  2KON A;  3ZOQ B;  1ZBT A;  3ECR A;  4B3R E;  2WBT A;  3J80 C;  2ADR A;  4JI3 E;  4I8O A;  4GKJ E; 
#chains in the Genus database with same CATH homology
 2YTD A;  2EM5 A;  2MDG A;  2EN2 A;  2D9H A;  2DLK A;  2EM6 A;  2EMF A;  2EML A;  1Z1B A;  1DGC A;  2EQ3 A;  1ZU1 A;  2EOH A;  1RMD A;  1X6H A;  2RPC A;  2EQ1 A;  4X9J A;  1ZR9 A;  2YTJ A;  1P47 A;  1G2D C;  2EMA A;  2PRT A;  5KL2 A;  4R2D A;  2EN3 A;  1KJK A;  2EOM A;  2EPR A;  4GZN C;  2BB8 A;  2NAB A;  3EPK A;  2J7J A;  2DRP A;  2EOJ A;  4R2Q A;  2EOR A;  2ENC A;  2EMX A;  2EL4 A;  2WBS A;  2LCE A;  2EM4 A;  2R1F A;  2EM7 A;  3EPJ A;  2EOE A;  2MKN A;  2YRM A;  2YTG A;  2EMH A;  1AAY A;  1TF6 A;  2EM3 A;  2YTO A;  4F6M A;  2JPA A;  1A1G A;  2EOQ A;  2YTI A;  2LT7 A;  1JK2 A;  2EL6 A;  2EOO A;  2YRH A;  2EM9 A;  1B69 A;  2GHF A;  2EN6 A;  2DLQ A;  2EPU A;  2EMG A;  5KL3 A;  2EMB A;  2EPC A;  2EMK A;  3MHH C;  2YRK A;  3EPL A;  2EOI A;  2YTE A;  4F2J C;  1YSA C;  1A1K A;  2CTD A;  2EMW A;  5KL6 A;  1YUJ A;  2EPA A;  1G2F C;  2EOZ A;  2EN4 A;  2A25 A;  1X3C A;  3M99 B;  2EM2 A;  2EOF A;  2LO3 A;  2EMI A;  2EN7 A;  4R2A A;  1A1I A;  1BB8 A;  4R2P A;  1A1F A;  2DMI A;  2EOY A;  2YU8 A;  2YTF A;  4IS1 C;  3UK3 C;  2EMC A;  1TF3 A;  2CT1 A;  4IJD A;  2EPZ A;  4R2C A;  5KL7 A;  2EMZ A;  1MEY C;  1YUI A;  2EJ4 A;  2LV2 A;  2YU5 A;  2EN8 A;  2VRD A;  2WBU A;  2LVH A;  2EPP A;  2EE8 A;  2CSH A;  2ENA A;  1A1J A;  1A1L A;  2WCC 3;  2YSO A;  2EPX A;  2ELY A;  2ELZ A;  4FK5 C;  2DGC A;  2YTN A;  2MKD A;  3MHS C;  4R2R A;  1LLM C;  5KL5 A;  1X6E A;  2EQ0 A;  2EOX A;  1UN6 B;  2RSI A;  4F6N A;  1X5W A;  2EMY A;  4R2E A;  1UBD C;  1X6F A;  1ZAA C;  2HGH A;  2GLI A;  1BBO A;  1NCS A;  2YTQ A;  4M9V C;  3EPH A;  2EP3 A;  2YSP A;  4R2S A;  2I13 A;  1F2I G;  2EN1 A;  1TN9 A;  2EL5 A;  1WJP A;  2YTP A;  2E72 A;  3VHT B;  2M9A A;  2WBT A;  2EM8 A;  4WSG A;  2ADR A;  2ENH A;  2JP9 A;  2EOS A;  1JK1 A;  5KL4 A;  1A1H A;  2EM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...