2LCHA

Solution nmr structure of a protein with a redesigned hydrophobic core, northeast structural genomics consortium target or38
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
MGSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRELDKKVSGSYLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein OR38
publication title Solution NMR Structure of a Protein With a Redesigned Hydrophobic Core, Northeast Structural Genomics Consortium Target OR38
rcsb
source organism Thermotoga maritima
molecule tags De novo protein
total genus 42
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2lchA00
2OOCA 1BDJB 1A0BA 2LCHA 3U3BA 3KYIA 1SR2A 2R25A 3MYFA 1I5NA 3US6A 1FR0A 1OXKA 1C03A 2LD6A 1WN0A 3KYJA 2A0BA 1TQGA 2LP4A 1QSPA 4EUKB 3IQTA 1OXBA 2Q4FA 1Y6DA 4G78A 1C02A 1YVIA 4PACA
chains in the Genus database with same CATH superfamily
1I4YA 2XLWA 5B1BC 1M56C 4BJ5A 4MTGA 1NZEA 4EKWA 2Y39A 3EFOA 4PFPA 2OJQA 1V55C 2I8BA 1TWCA 3NRHA 2YL0A 1XWJA 4CDYA 3LLKA 2G62A 3LS0A 4ANJA 2RSEB 1ZYRF 2VH3A 1G4WR 4U9EA 3US6A 3V5XA 4EHPA 1CGNA 3GWNA 2HFIA 3B0PA 4JVSA 2LSEA 1J8MF 4I3MA 4KNWA 2HS5A 3LJBA 1QLEC 3QMKA 3E9VA 3TJ6A 4E7ZA 2YHSA 1A7VA 3SXYA 3TJ5A 2J9WA 4Q4ZF 2CNWA 2NUTA 4L6RA 1JR8A 2EIMC 2XM4A 4OIPF 2J8WA 2GFHA 2YZSA 2OG2A 2DGJA 2C03A 3UNGC 4PJNA 4GYTA 2KNHA 3U5SA 4RD9A 3IHUA 4YT5A 1OCCC 1YAUO 3K1HA 1A41A 5A6JA 1RKEA 2R9RB 3O6XA 3ZQVA 3O39A 1V4AA 3ECSA 3Q7GA 2NUPB 3H2UA 5DLJA 4OIQF 3OA1A 4U5DE 3WG7C 2W9YA 3O10A 1R5ID 4JTAB 4N4WA 3V5ZA 2L81A 2LD6A 4DRJB 2PX3A 4YL1A 1ST6A 2EPKX 2AWCA 3EPVA 1OKKA 1AEPA 2KYHA 4U5GA 2KJGA 5T3WA 4DRIB 5AC4A 1MNDA 2Q3TA 3U3FA 3FDQA 1H7IA 3RF3A 3QVZA 2L6HA 4Q5SF 4WGZA 1JRAA 4MVUA 5L0JA 2GAQA 4HFKB 3R7CA 1T5OA 1M6TA 4JCZA 2J0WA 1L7CA 2H8AA 2JX0A 3BRJA 2J9VA 3MX3A 4Z9HA 4YJWA 4YT2A 4J32B 2VCCA 4C7OA 1B68A 5JT4A 4K7BA 3EGXB 3K33A 1FFTC 4CS7A 4CS8C 5TJ5E 1APCA 3TOMA 3V7OA 2R7RA 1VTMP 1C03A 3EG9A 3UMIA 3H2VA 4Z9JA 1MMAA 5A6BA 2HMQA 1L3PA 3TD7A 2DYSC 3IEEA 1RJ9A 5E3AA 3U8VA 4MW3A 2Q00A 5KYYA 4NY3A 5JUAA 1A7DA 2R7VA 3C62A 1MNEA 3M4BA 3U9MA 1YJGA 3C8GB 3DM9B 3N2ZB 1IZMA 5E2QA 1SF8A 2J7PD 1VMAA 2XL6A 2P6VA 5F28E 1GM5A 1M57C 1ZHXA 1FFHA 2J9UA 3NYMA 3VYWA 3HNJA 3LNRA 4KNVA 1D1AA 2PNOA 1OR2A 1TWGA 2W4MA 2P1AA 2ZXRA 4K0DA 1JPNA 3AQBA 3HNIA 1YZCA 3HJCA 4LDKA 3T6BA 3ZTZA 2R7WA 2BC5A 3LS1A 1M2OA 4E17A 1VK5A 3MFNA 5DS4A 3B0UX 3S27A 1QSPA 3EZHA 4Z9IA 1MMNA 1KNYA 4H4KC 5D91A 3MBGA 5L0IA 1OXBA 3S84A 1C02A 1ORJA 1QVXA 1LE4A 1ZU5A 4I1OB 3RQFA 3FXHA 2XXAA 2QUPA 3G4ZA 2OOCA 3B0VC 4JCHA 3FHDA 1PD0A 1BBHA 1D0YA 2OU6A 2RD9A 4MVSA 2KC3A 3RVZA 4DBRA 3PDMP 3DWWA 3UR3C 3TULA 3SP1A 2V26A 4O79A 4ZLCA 4D4XA 1YZAA 3S28A 4OD4A 3HNKA 4MNDA 2VCAA 3NYJA 1SZIA 4NQFA 3L8IA 2R7QA 3NKEA 3S0XA 3ABLC 1HW2A 3AG2C 2QNLA 5JSLA 3VAYA 3EHNA 3ZTMA 2P0NA 3W8HA 2Q9AA 4U5EE 4C3DA 4JW1A 3POVA 1NLXA 5T1DB 4M63A 5B3SC 2J7PA 3MLGA 4DRHB 2Q9BA 2EIKC 2IXPA 3IQTA 3K1IC 4U5BE 5COGA 4D4NA 3DE9A 3DXJF 3NMJA 4MW8A 4U5FE 4XQ1A 1GQAA 4BJTA 1LE2A 3TK0A 4EWCA 1Q0GA 2YEVA 3C8GD 3HTKC 3KL4A 2PF4E 3I5QA 4E18A 2WL8A 5A6KA 2WZGA 4BJ6C 2NUPA 3ZDLA 2R25A 4EIYA 2XM0A 1D1BA 1GGQA 1LM3B 1OCOC 1T6IA 2WZFA 5D92A 1OCZC 2OKUA 2XL8A 3EZIA 3LLIA 4OIRF 5JVEA 1CGME 4DJ9A 4E7SA 5EGYA 2R7UA 2EPMX 2Y3HA 1ORYA 4WABA 1HW1A 3JYHA 2IM8A 3Q7LA 1G5ZA 1OW8A 2MWQA 2VC9A 3DI5A 4GEHA 5A69A 3NDBB 1KTMA 2DB4A 5A6AA 4XPWA 3NMIA 2Y69C 1VLSA 2J0XA 4CBEA 5A6BD 1WGWA 4BEJA 5KYNA 2CCYA 1FTSA 2YLGA 4EBBA 1BDJB 2WB7A 3DJNB 3L1MA 3AG3C 2ASRA 4BJ1A 2HSQA 2IOQA 1C17M 1QQ3A 3EH2A 1G8XA 3M4CA 2DI3A 3GORA 3GM3A 3U3BA 1ORSC 2P61A 3EGXA 4XLPF 1OR3A 2PX0A 3ITFA 1JMWA 2PP4A 3OWTA 4NC3A 4AL1A 2KK1A 1YARO 4HFFB 2XXAB 4JURI 3UMHA 3J06A 2FGYA 4DVZA 3NKDA 2AU5A 3IQ5A 3IPMO 2VCBA 3AOUA 1NU9C 5CI8A 2LIGA 5EHHA 2MYSA 4IARA 1Z5ZA 2A1DD 3GANA 4UDVA 5E33A 3SYNA 3ZIBA 3SXKA 4PR9A 2R7XA 5F5FA 1LKXA 3HLZA 3C8GA 4A2NB 1RCPA 2Y3DA 2ICWG 3W4YA 4P9FA 2DYRC 3LNMB 4E0IA 1VB5A 3QW1A 3UMKA 3I5PA 2QE9A 1H6GA 2WVNA 256BA 3RQEA 2F22A 2AVKA 3F47A 3EH1A 4HEAJ 4ULWA 2AWYA 3AGTA 4BG0A 3W2VA 2D5RB 1TFKB 1OW7A 2M64A 1IW7F 4XEFA 3EGDB 4CIHA 1WWPA 2WVOA 3T4RA 1V74B 2YL1A 4JTCB 2H7OA 5F5HA 4G7ZF 4MTOA 5COMA 5KYUA 1BR4A 3KKBA 3JSEO 1I4ZA 1QPUA 3KYJA 3GEEA 3S90A 2IXMA 3SZRA 1U0BB 4E0HA 5KYWB 2PFDA 4HE8D 4DOZA 5KYYB 3U2LA 1FMVA 2A6HF 2P7VA 1QZXA 2A69F 1ZZPA 1NU7D 3L8JA 4FX5A 2NG1A 2R7TA 4PFOA 3DKAA 2WZLA 1YVIA 4QI0A 4NTAA 2M4EA 2X51A 4W8KA 1AUEA 1EI7A 4G7HF 5DVWA 3TQOA 4I1MA 1O3UA 4Q7CA 5E3CA 2W45A 1CPQA 4QDLA 5GPGB 2Y3BA 3GODA 4IAOA 1YLMA 4XLNF 3ZWIA 5KYXB 3EJNA 4MVMA 2L9JA 4YT8A 5JS5A 4CS9C 1J8YF 1T6QA 4NTFA 1BR1A 4LLEA 3DJUB 4JKVA 3RVYA 2BL2A 4CSAC 4I44A 4LLCA 3T9OA 1FR0A 2JPUA 4MVZA 3U9JA 3X2QC 1D0XA 2EILC 2HJ3A 1EA8A 1ZU4A 3C7JA 4JIOA 3O55A 4FESA 3F46A 4G0HA 3SXZA 4AE4B 5L3VA 2EPOA 1D0ZA 5KYUB 3X1OA 4XEVA 1Z3IX 4ULVA 1XZQA 2QLAA 1T01A 2NSGA 3M1CB 4OINF 2UUHA 4IWBA 5COFA 4NCQA 3A11A 2X0CA 4ZLDA 3RIPA 3AG1C 4KI2A 2XLVA 5JLIA 4U5HA 3NYLA 1DOVA 2FFHA 4U5CE 4CS8A 1K04A 1HMOA 1LIHA 4KC9A 1TFOB 5B3IA 3M79A 1U89A 2B0JA 3W2WA 3NG1A 2NSFA 1CPRA 1UFBA 5L0FA 3MYFA 1Z7Qc 4BJ5C 4YL3A 2R02A 3DM5A 3JRTA 4NTBA 4FAPB 1H9TA 3FOPA 4GQHA 4MVQA 1M2VA 1AVOB 1PD1A 4RDAA 1LS4A 2LFFA 5HSWA 1O87A 3C8ZA 4XTKA 3B9QA 3LAYA 2L7AA 3AQCA 4MS2A 3RKOF 1OW6A 2XSEA 2HV6A 3FAJA 4R32A 3SEOA 2XS1A 2VB6A 3KMIA 1E83A 4WGYA 2L6FA 2YLIA 1NFNA 1YYXA 2R05A 2YQYA 5FCLA 3RQGA 3K6BA 2EINC 4JEBA 4OIOF 2GWWA 1E2XA 3DD7A 2LCHA 1VYIA 2OEVA 4KBLA 1BR2A 5AC5A 2C04A 1EKYA 1SR2A 2EPNA 3G4XA 1TWHA 4B6IA 1CGOA 1YYJA 2G3VA 2HJMA 2HUJA 4O6NA 3PMRA 1K40A 1E84A 2V3CC 1HE1A 4LERA 4OD5A 2O9XA 3SXMA 5DQZA 2A0BA 3K66A 1M2VB 1XZPA 1MMDA 3PCVA 1OQCA 4EUKB 1KU2A 3DAFA 3LESA 4J30B 4J7TA 1RMVA 4G78A 4YWQA 3BEHA 3U2MA 3E70C 3QZCA 3RH3A 2J46A 2GA0A 1Z23A 5L0CA 1DOWA 2GDCA 3ASNC 3N0TA 1Z63A 2IYLD 1NFOA 3CSKA 1T9KA 2ETSA 4JC7A 2Q9CA 3DAGA 1TKNA 4IRUA 4JJFA 2R03A 5T3TA 2HKVA 3LUTB 4BEMJ 1Z6AA 1Q0MA 4MVOA 2CGEA 3EGDA 3I4UA 3TOLA 1RKCA 2NPUA 2UUIA 2W4BA 3JT1A 4O6MA 3ZQYA 2LK4A 3AJMA 4JE9A 2R7SA 3K1IA 4FWVA 3KH2A 3ABKC 2HV7A 2CW0F 3HKKA 3VF0A 5DQTA 1TQGA 2LP4A 1PV3A 1HMDA 4MTFA 5KYWA 5BQIA 2J9BA 2OCCC 1LI5A 2XRHA 2XLDA 2XL4A 1LS1A 3DMDA 3DZAA 3GWLA 3QW0A 4LACB 2E87A 2H7BA 1ZHZA 5B1AC 4N6HA 3M15A 3JSZA 3QVYA 1TR2A 1Y6DA 2XLMA 3VRCA 4P6IC 5HV9A 3UGOA 4QI2A 4JJGA 2Q7RA 4G7OF 5L0HA 2OQMA 4BJ6A 3VM6A 5BQHA 2A0UA 2L6GA 2YL7A 4PJMA 2EIJC 4C3BA 5KYXA 1Y4CA 2KSFA 2WVQA 3EFOB 2LFDA 2KGOA 1QKRA 1GS9A 2YVKA 1VYKA 2IBFA 2XLHA 3KPHA 4C3EA 4MVRA 2CDQA 5IY5C 4A4AA 4N6CA 1BZ4A 1Q0DA 4AE4A 2IXNA 4U9DA 3NMKA 2ZD9A 4DVYP 2LQGA 3JCUQ 4AK9A 2H7VC 1ZHTA 3U0CA 2A6EF 2B0HA 4YL0A 4CIPA 3CEXA 1Q0KA 3DE8A 2YL3A 5DS5A 2NUTB 3GEIA 2YLDA 1HY5A 4PJLA 1FNTc 4IB4A 3SNHA 3AG4C 2D4UA 3L34A 2ZXWC 1N1CA 3JZ0A 1TWAA 1FAPB 3GM1A 1RKEB 3CQZA 3KYIA 1ZHWA 1WATA 3V5YA 3CAXA 3H65A 3ASOC 3ZSUA 3EQLF 3RW0A 5BQGA 1Q0FA 3G50A 4BPMA 1ZW2A 2QTVA 2OEXA 4YK5A 3PHF2 4EBJA 4IAQA 2JD3A 4J7YA 3WAQA 4F4BA 3R2PA 4YT4A 1EQ1A 1WOLA 3GM2A 1R4TA 3ZG1A 3UGPA 3WODF 1VOMA 2FAPB 3OEOA 3Q6MA 4ONSA 1NG1A 3S9OA 2CYDA 5L0DA 2Q4FA 3B71A 4XPXA 4EBKA 2AP3A 2ZXOA 3S29A 1ZVZA 4JRZA 1E86A 2YKZA 4X0RA 4PJJA 3IQCA 3A9CA 4P9TA 3ZC4A 2PBEA 3B29A 1LPEA 4DBQA 1MMGA 1A7EA 3EHMA 1D1CA 4K1OA 3WHNA 3RFYA 3IQ6A 1YDIA 1VLTA 2ZPAA 5BUOA 1ZHYA 2HSBA 1LVKA 3GEHA 5JRAA 4DXWA 4C7OB 3K7DA 5L0GA 4CJOA 1O5HA 1FMWA 2KQ9A 3ZVRA 5CIVA 3ATPA 1NSGB 3C63A 1I5NA 1MQVA 3C18A 4IGGA 3T6JA 1W2WA 4AL0A 5K0IA 1OXKA 3EG9B 1WN0A 1SYQA 3JRMO 4H54A 5CI9A 3CZ6A 1ZW3A 2I15A 2XLEA 2IXOA 3FAPB 3N24A 4JEAA 1JAFA 5EK0A 1JPJA 1PCXA 4AX2A 1UG7A 1RJ9B 1WASA 2OJED 3QTHA 2A68F 3JYYA 4CDAA 3LEVA 4XWJA 4O7GA 2J45A 2XS8A 3W8IA 4ER9A 2HMZA 1V54C 4JZAA 1K05A 4JTDB 1G4US 2CNWD 3JTLO 4LDQA 1OCRC 1YA9A 4XEKA 1F1MA 4CS9A 1WTYA 2ZXPA 4CSAA 1A0BA 1T6UA 2G3KA 3FVYA 4CDVA 4O6YA 5FZTA 2HZ8A 4YN0B 4IJJA 2TMVP 3ABMC 5AGFA 4N06A 2Z15A 3FOOA 2BE5F 4MQ9F 5JP7A 2YWAA 3L0IA 1JOGA 3LEOA 3HNLA 3MYIA 4LDRA 2KW3C 1NBBA 1S7ZA 2QY9A 5L3QA 1YA7O 2EPLX 2YRFA 4WJ0A 2VASA 1E85A 3Q6NA 1HE9A 1LI7A 3RYLA 4RBNA 1H9GA 5DS6A 4W8PA 4CJGA 1RXQA 1U6HA 3T6GB 1S05A 4XPYA 3U8PA 4CX9A 2R7OA 1OKKD 2MHRA 2XLOA 2Y3GA 4PACA 4PK4A 3FMSA 3AGUA 1SMYF
chains in the Genus database with same CATH topology
2OOCA 1BDJB 1A0BA 2LCHA 3U3BA 3KYIA 1SR2A 2R25A 3MYFA 1I5NA 3US6A 1FR0A 1OXKA 1C03A 2LD6A 1WN0A 3KYJA 2A0BA 1TQGA 2LP4A 1QSPA 4EUKB 3IQTA 1OXBA 2Q4FA 1Y6DA 4G78A 1C02A 1YVIA 4PACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOC A;  1BDJ B;  1A0B A;  2LCH A;  3U3B A;  3KYI A;  1SR2 A;  2R25 A;  3MYF A;  1I5N A;  3US6 A;  1FR0 A;  1OXK A;  1C03 A;  2LD6 A;  1WN0 A;  3KYJ A;  2A0B A;  1TQG A;  2LP4 A;  1QSP A;  4EUK B;  3IQT A;  1OXB A;  2Q4F A;  1Y6D A;  4G78 A;  1C02 A;  1YVI A;  4PAC A; 
#chains in the Genus database with same CATH topology
 1I4Y A;  2XLW A;  5B1B C;  1M56 C;  4BJ5 A;  4MTG A;  1NZE A;  4EKW A;  2Y39 A;  3EFO A;  4PFP A;  2OJQ A;  1V55 C;  2I8B A;  1TWC A;  3NRH A;  2YL0 A;  1XWJ A;  4CDY A;  3LLK A;  2G62 A;  3LS0 A;  4ANJ A;  2RSE B;  1ZYR F;  2VH3 A;  1G4W R;  4U9E A;  3US6 A;  3V5X A;  4EHP A;  1CGN A;  3GWN A;  2HFI A;  3B0P A;  4JVS A;  2LSE A;  1J8M F;  4I3M A;  4KNW A;  2HS5 A;  3LJB A;  1QLE C;  3QMK A;  3E9V A;  3TJ6 A;  4E7Z A;  2YHS A;  1A7V A;  3SXY A;  3TJ5 A;  2J9W A;  4Q4Z F;  2CNW A;  2NUT A;  4L6R A;  1JR8 A;  2EIM C;  2XM4 A;  4OIP F;  2J8W A;  2GFH A;  2YZS A;  2OG2 A;  2DGJ A;  2C03 A;  3UNG C;  4PJN A;  4GYT A;  2KNH A;  3U5S A;  4RD9 A;  3IHU A;  4YT5 A;  1OCC C;  1YAU O;  3K1H A;  1A41 A;  5A6J A;  1RKE A;  2R9R B;  3O6X A;  3ZQV A;  3O39 A;  1V4A A;  3ECS A;  3Q7G A;  2NUP B;  3H2U A;  5DLJ A;  4OIQ F;  3OA1 A;  4U5D E;  3WG7 C;  2W9Y A;  3O10 A;  1R5I D;  4JTA B;  4N4W A;  3V5Z A;  2L81 A;  2LD6 A;  4DRJ B;  2PX3 A;  4YL1 A;  1ST6 A;  2EPK X;  2AWC A;  3EPV A;  1OKK A;  1AEP A;  2KYH A;  4U5G A;  2KJG A;  5T3W A;  4DRI B;  5AC4 A;  1MND A;  2Q3T A;  3U3F A;  3FDQ A;  1H7I A;  3RF3 A;  3QVZ A;  2L6H A;  4Q5S F;  4WGZ A;  1JRA A;  4MVU A;  5L0J A;  2GAQ A;  4HFK B;  3R7C A;  1T5O A;  1M6T A;  4JCZ A;  2J0W A;  1L7C A;  2H8A A;  2JX0 A;  3BRJ A;  2J9V A;  3MX3 A;  4Z9H A;  4YJW A;  4YT2 A;  4J32 B;  2VCC A;  4C7O A;  1B68 A;  5JT4 A;  4K7B A;  3EGX B;  3K33 A;  1FFT C;  4CS7 A;  4CS8 C;  5TJ5 E;  1APC A;  3TOM A;  3V7O A;  2R7R A;  1VTM P;  1C03 A;  3EG9 A;  3UMI A;  3H2V A;  4Z9J A;  1MMA A;  5A6B A;  2HMQ A;  1L3P A;  3TD7 A;  2DYS C;  3IEE A;  1RJ9 A;  5E3A A;  3U8V A;  4MW3 A;  2Q00 A;  5KYY A;  4NY3 A;  5JUA A;  1A7D A;  2R7V A;  3C62 A;  1MNE A;  3M4B A;  3U9M A;  1YJG A;  3C8G B;  3DM9 B;  3N2Z B;  1IZM A;  5E2Q A;  1SF8 A;  2J7P D;  1VMA A;  2XL6 A;  2P6V A;  5F28 E;  1GM5 A;  1M57 C;  1ZHX A;  1FFH A;  2J9U A;  3NYM A;  3VYW A;  3HNJ A;  3LNR A;  4KNV A;  1D1A A;  2PNO A;  1OR2 A;  1TWG A;  2W4M A;  2P1A A;  2ZXR A;  4K0D A;  1JPN A;  3AQB A;  3HNI A;  1YZC A;  3HJC A;  4LDK A;  3T6B A;  3ZTZ A;  2R7W A;  2BC5 A;  3LS1 A;  1M2O A;  4E17 A;  1VK5 A;  3MFN A;  5DS4 A;  3B0U X;  3S27 A;  1QSP A;  3EZH A;  4Z9I A;  1MMN A;  1KNY A;  4H4K C;  5D91 A;  3MBG A;  5L0I A;  1OXB A;  3S84 A;  1C02 A;  1ORJ A;  1QVX A;  1LE4 A;  1ZU5 A;  4I1O B;  3RQF A;  3FXH A;  2XXA A;  2QUP A;  3G4Z A;  2OOC A;  3B0V C;  4JCH A;  3FHD A;  1PD0 A;  1BBH A;  1D0Y A;  2OU6 A;  2RD9 A;  4MVS A;  2KC3 A;  3RVZ A;  4DBR A;  3PDM P;  3DWW A;  3UR3 C;  3TUL A;  3SP1 A;  2V26 A;  4O79 A;  4ZLC A;  4D4X A;  1YZA A;  3S28 A;  4OD4 A;  3HNK A;  4MND A;  2VCA A;  3NYJ A;  1SZI A;  4NQF A;  3L8I A;  2R7Q A;  3NKE A;  3S0X A;  3ABL C;  1HW2 A;  3AG2 C;  2QNL A;  5JSL A;  3VAY A;  3EHN A;  3ZTM A;  2P0N A;  3W8H A;  2Q9A A;  4U5E E;  4C3D A;  4JW1 A;  3POV A;  1NLX A;  5T1D B;  4M63 A;  5B3S C;  2J7P A;  3MLG A;  4DRH B;  2Q9B A;  2EIK C;  2IXP A;  3IQT A;  3K1I C;  4U5B E;  5COG A;  4D4N A;  3DE9 A;  3DXJ F;  3NMJ A;  4MW8 A;  4U5F E;  4XQ1 A;  1GQA A;  4BJT A;  1LE2 A;  3TK0 A;  4EWC A;  1Q0G A;  2YEV A;  3C8G D;  3HTK C;  3KL4 A;  2PF4 E;  3I5Q A;  4E18 A;  2WL8 A;  5A6K A;  2WZG A;  4BJ6 C;  2NUP A;  3ZDL A;  2R25 A;  4EIY A;  2XM0 A;  1D1B A;  1GGQ A;  1LM3 B;  1OCO C;  1T6I A;  2WZF A;  5D92 A;  1OCZ C;  2OKU A;  2XL8 A;  3EZI A;  3LLI A;  4OIR F;  5JVE A;  1CGM E;  4DJ9 A;  4E7S A;  5EGY A;  2R7U A;  2EPM X;  2Y3H A;  1ORY A;  4WAB A;  1HW1 A;  3JYH A;  2IM8 A;  3Q7L A;  1G5Z A;  1OW8 A;  2MWQ A;  2VC9 A;  3DI5 A;  4GEH A;  5A69 A;  3NDB B;  1KTM A;  2DB4 A;  5A6A A;  4XPW A;  3NMI A;  2Y69 C;  1VLS A;  2J0X A;  4CBE A;  5A6B D;  1WGW A;  4BEJ A;  5KYN A;  2CCY A;  1FTS A;  2YLG A;  4EBB A;  1BDJ B;  2WB7 A;  3DJN B;  3L1M A;  3AG3 C;  2ASR A;  4BJ1 A;  2HSQ A;  2IOQ A;  1C17 M;  1QQ3 A;  3EH2 A;  1G8X A;  3M4C A;  2DI3 A;  3GOR A;  3GM3 A;  3U3B A;  1ORS C;  2P61 A;  3EGX A;  4XLP F;  1OR3 A;  2PX0 A;  3ITF A;  1JMW A;  2PP4 A;  3OWT A;  4NC3 A;  4AL1 A;  2KK1 A;  1YAR O;  4HFF B;  2XXA B;  4JUR I;  3UMH A;  3J06 A;  2FGY A;  4DVZ A;  3NKD A;  2AU5 A;  3IQ5 A;  3IPM O;  2VCB A;  3AOU A;  1NU9 C;  5CI8 A;  2LIG A;  5EHH A;  2MYS A;  4IAR A;  1Z5Z A;  2A1D D;  3GAN A;  4UDV A;  5E33 A;  3SYN A;  3ZIB A;  3SXK A;  4PR9 A;  2R7X A;  5F5F A;  1LKX A;  3HLZ A;  3C8G A;  4A2N B;  1RCP A;  2Y3D A;  2ICW G;  3W4Y A;  4P9F A;  2DYR C;  3LNM B;  4E0I A;  1VB5 A;  3QW1 A;  3UMK A;  3I5P A;  2QE9 A;  1H6G A;  2WVN A;  256B A;  3RQE A;  2F22 A;  2AVK A;  3F47 A;  3EH1 A;  4HEA J;  4ULW A;  2AWY A;  3AGT A;  4BG0 A;  3W2V A;  2D5R B;  1TFK B;  1OW7 A;  2M64 A;  1IW7 F;  4XEF A;  3EGD B;  4CIH A;  1WWP A;  2WVO A;  3T4R A;  1V74 B;  2YL1 A;  4JTC B;  2H7O A;  5F5H A;  4G7Z F;  4MTO A;  5COM A;  5KYU A;  1BR4 A;  3KKB A;  3JSE O;  1I4Z A;  1QPU A;  3KYJ A;  3GEE A;  3S90 A;  2IXM A;  3SZR A;  1U0B B;  4E0H A;  5KYW B;  2PFD A;  4HE8 D;  4DOZ A;  5KYY B;  3U2L A;  1FMV A;  2A6H F;  2P7V A;  1QZX A;  2A69 F;  1ZZP A;  1NU7 D;  3L8J A;  4FX5 A;  2NG1 A;  2R7T A;  4PFO A;  3DKA A;  2WZL A;  1YVI A;  4QI0 A;  4NTA A;  2M4E A;  2X51 A;  4W8K A;  1AUE A;  1EI7 A;  4G7H F;  5DVW A;  3TQO A;  4I1M A;  1O3U A;  4Q7C A;  5E3C A;  2W45 A;  1CPQ A;  4QDL A;  5GPG B;  2Y3B A;  3GOD A;  4IAO A;  1YLM A;  4XLN F;  3ZWI A;  5KYX B;  3EJN A;  4MVM A;  2L9J A;  4YT8 A;  5JS5 A;  4CS9 C;  1J8Y F;  1T6Q A;  4NTF A;  1BR1 A;  4LLE A;  3DJU B;  4JKV A;  3RVY A;  2BL2 A;  4CSA C;  4I44 A;  4LLC A;  3T9O A;  1FR0 A;  2JPU A;  4MVZ A;  3U9J A;  3X2Q C;  1D0X A;  2EIL C;  2HJ3 A;  1EA8 A;  1ZU4 A;  3C7J A;  4JIO A;  3O55 A;  4FES A;  3F46 A;  4G0H A;  3SXZ A;  4AE4 B;  5L3V A;  2EPO A;  1D0Z A;  5KYU B;  3X1O A;  4XEV A;  1Z3I X;  4ULV A;  1XZQ A;  2QLA A;  1T01 A;  2NSG A;  3M1C B;  4OIN F;  2UUH A;  4IWB A;  5COF A;  4NCQ A;  3A11 A;  2X0C A;  4ZLD A;  3RIP A;  3AG1 C;  4KI2 A;  2XLV A;  5JLI A;  4U5H A;  3NYL A;  1DOV A;  2FFH A;  4U5C E;  4CS8 A;  1K04 A;  1HMO A;  1LIH A;  4KC9 A;  1TFO B;  5B3I A;  3M79 A;  1U89 A;  2B0J A;  3W2W A;  3NG1 A;  2NSF A;  1CPR A;  1UFB A;  5L0F A;  3MYF A;  1Z7Q c;  4BJ5 C;  4YL3 A;  2R02 A;  3DM5 A;  3JRT A;  4NTB A;  4FAP B;  1H9T A;  3FOP A;  4GQH A;  4MVQ A;  1M2V A;  1AVO B;  1PD1 A;  4RDA A;  1LS4 A;  2LFF A;  5HSW A;  1O87 A;  3C8Z A;  4XTK A;  3B9Q A;  3LAY A;  2L7A A;  3AQC A;  4MS2 A;  3RKO F;  1OW6 A;  2XSE A;  2HV6 A;  3FAJ A;  4R32 A;  3SEO A;  2XS1 A;  2VB6 A;  3KMI A;  1E83 A;  4WGY A;  2L6F A;  2YLI A;  1NFN A;  1YYX A;  2R05 A;  2YQY A;  5FCL A;  3RQG A;  3K6B A;  2EIN C;  4JEB A;  4OIO F;  2GWW A;  1E2X A;  3DD7 A;  2LCH A;  1VYI A;  2OEV A;  4KBL A;  1BR2 A;  5AC5 A;  2C04 A;  1EKY A;  1SR2 A;  2EPN A;  3G4X A;  1TWH A;  4B6I A;  1CGO A;  1YYJ A;  2G3V A;  2HJM A;  2HUJ A;  4O6N A;  3PMR A;  1K40 A;  1E84 A;  2V3C C;  1HE1 A;  4LER A;  4OD5 A;  2O9X A;  3SXM A;  5DQZ A;  2A0B A;  3K66 A;  1M2V B;  1XZP A;  1MMD A;  3PCV A;  1OQC A;  4EUK B;  1KU2 A;  3DAF A;  3LES A;  4J30 B;  4J7T A;  1RMV A;  4G78 A;  4YWQ A;  3BEH A;  3U2M A;  3E70 C;  3QZC A;  3RH3 A;  2J46 A;  2GA0 A;  1Z23 A;  5L0C A;  1DOW A;  2GDC A;  3ASN C;  3N0T A;  1Z63 A;  2IYL D;  1NFO A;  3CSK A;  1T9K A;  2ETS A;  4JC7 A;  2Q9C A;  3DAG A;  1TKN A;  4IRU A;  4JJF A;  2R03 A;  5T3T A;  2HKV A;  3LUT B;  4BEM J;  1Z6A A;  1Q0M A;  4MVO A;  2CGE A;  3EGD A;  3I4U A;  3TOL A;  1RKC A;  2NPU A;  2UUI A;  2W4B A;  3JT1 A;  4O6M A;  3ZQY A;  2LK4 A;  3AJM A;  4JE9 A;  2R7S A;  3K1I A;  4FWV A;  3KH2 A;  3ABK C;  2HV7 A;  2CW0 F;  3HKK A;  3VF0 A;  5DQT A;  1TQG A;  2LP4 A;  1PV3 A;  1HMD A;  4MTF A;  5KYW A;  5BQI A;  2J9B A;  2OCC C;  1LI5 A;  2XRH A;  2XLD A;  2XL4 A;  1LS1 A;  3DMD A;  3DZA A;  3GWL A;  3QW0 A;  4LAC B;  2E87 A;  2H7B A;  1ZHZ A;  5B1A C;  4N6H A;  3M15 A;  3JSZ A;  3QVY A;  1TR2 A;  1Y6D A;  2XLM A;  3VRC A;  4P6I C;  5HV9 A;  3UGO A;  4QI2 A;  4JJG A;  2Q7R A;  4G7O F;  5L0H A;  2OQM A;  4BJ6 A;  3VM6 A;  5BQH A;  2A0U A;  2L6G A;  2YL7 A;  4PJM A;  2EIJ C;  4C3B A;  5KYX A;  1Y4C A;  2KSF A;  2WVQ A;  3EFO B;  2LFD A;  2KGO A;  1QKR A;  1GS9 A;  2YVK A;  1VYK A;  2IBF A;  2XLH A;  3KPH A;  4C3E A;  4MVR A;  2CDQ A;  5IY5 C;  4A4A A;  4N6C A;  1BZ4 A;  1Q0D A;  4AE4 A;  2IXN A;  4U9D A;  3NMK A;  2ZD9 A;  4DVY P;  2LQG A;  3JCU Q;  4AK9 A;  2H7V C;  1ZHT A;  3U0C A;  2A6E F;  2B0H A;  4YL0 A;  4CIP A;  3CEX A;  1Q0K A;  3DE8 A;  2YL3 A;  5DS5 A;  2NUT B;  3GEI A;  2YLD A;  1HY5 A;  4PJL A;  1FNT c;  4IB4 A;  3SNH A;  3AG4 C;  2D4U A;  3L34 A;  2ZXW C;  1N1C A;  3JZ0 A;  1TWA A;  1FAP B;  3GM1 A;  1RKE B;  3CQZ A;  3KYI A;  1ZHW A;  1WAT A;  3V5Y A;  3CAX A;  3H65 A;  3ASO C;  3ZSU A;  3EQL F;  3RW0 A;  5BQG A;  1Q0F A;  3G50 A;  4BPM A;  1ZW2 A;  2QTV A;  2OEX A;  4YK5 A;  3PHF 2;  4EBJ A;  4IAQ A;  2JD3 A;  4J7Y A;  3WAQ A;  4F4B A;  3R2P A;  4YT4 A;  1EQ1 A;  1WOL A;  3GM2 A;  1R4T A;  3ZG1 A;  3UGP A;  3WOD F;  1VOM A;  2FAP B;  3OEO A;  3Q6M A;  4ONS A;  1NG1 A;  3S9O A;  2CYD A;  5L0D A;  2Q4F A;  3B71 A;  4XPX A;  4EBK A;  2AP3 A;  2ZXO A;  3S29 A;  1ZVZ A;  4JRZ A;  1E86 A;  2YKZ A;  4X0R A;  4PJJ A;  3IQC A;  3A9C A;  4P9T A;  3ZC4 A;  2PBE A;  3B29 A;  1LPE A;  4DBQ A;  1MMG A;  1A7E A;  3EHM A;  1D1C A;  4K1O A;  3WHN A;  3RFY A;  3IQ6 A;  1YDI A;  1VLT A;  2ZPA A;  5BUO A;  1ZHY A;  2HSB A;  1LVK A;  3GEH A;  5JRA A;  4DXW A;  4C7O B;  3K7D A;  5L0G A;  4CJO A;  1O5H A;  1FMW A;  2KQ9 A;  3ZVR A;  5CIV A;  3ATP A;  1NSG B;  3C63 A;  1I5N A;  1MQV A;  3C18 A;  4IGG A;  3T6J A;  1W2W A;  4AL0 A;  5K0I A;  1OXK A;  3EG9 B;  1WN0 A;  1SYQ A;  3JRM O;  4H54 A;  5CI9 A;  3CZ6 A;  1ZW3 A;  2I15 A;  2XLE A;  2IXO A;  3FAP B;  3N24 A;  4JEA A;  1JAF A;  5EK0 A;  1JPJ A;  1PCX A;  4AX2 A;  1UG7 A;  1RJ9 B;  1WAS A;  2OJE D;  3QTH A;  2A68 F;  3JYY A;  4CDA A;  3LEV A;  4XWJ A;  4O7G A;  2J45 A;  2XS8 A;  3W8I A;  4ER9 A;  2HMZ A;  1V54 C;  4JZA A;  1K05 A;  4JTD B;  1G4U S;  2CNW D;  3JTL O;  4LDQ A;  1OCR C;  1YA9 A;  4XEK A;  1F1M A;  4CS9 A;  1WTY A;  2ZXP A;  4CSA A;  1A0B A;  1T6U A;  2G3K A;  3FVY A;  4CDV A;  4O6Y A;  5FZT A;  2HZ8 A;  4YN0 B;  4IJJ A;  2TMV P;  3ABM C;  5AGF A;  4N06 A;  2Z15 A;  3FOO A;  2BE5 F;  4MQ9 F;  5JP7 A;  2YWA A;  3L0I A;  1JOG A;  3LEO A;  3HNL A;  3MYI A;  4LDR A;  2KW3 C;  1NBB A;  1S7Z A;  2QY9 A;  5L3Q A;  1YA7 O;  2EPL X;  2YRF A;  4WJ0 A;  2VAS A;  1E85 A;  3Q6N A;  1HE9 A;  1LI7 A;  3RYL A;  4RBN A;  1H9G A;  5DS6 A;  4W8P A;  4CJG A;  1RXQ A;  1U6H A;  3T6G B;  1S05 A;  4XPY A;  3U8P A;  4CX9 A;  2R7O A;  1OKK D;  2MHR A;  2XLO A;  2Y3G A;  4PAC A;  4PK4 A;  3FMS A;  3AGU A;  1SMY F; 
#chains in the Genus database with same CATH homology
 2OOC A;  1BDJ B;  1A0B A;  2LCH A;  3U3B A;  3KYI A;  1SR2 A;  2R25 A;  3MYF A;  1I5N A;  3US6 A;  1FR0 A;  1OXK A;  1C03 A;  2LD6 A;  1WN0 A;  3KYJ A;  2A0B A;  1TQG A;  2LP4 A;  1QSP A;  4EUK B;  3IQT A;  1OXB A;  2Q4F A;  1Y6D A;  4G78 A;  1C02 A;  1YVI A;  4PAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...