2LCHA

Solution nmr structure of a protein with a redesigned hydrophobic core, northeast structural genomics consortium target or38
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
MGSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRELDKKVSGSYLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of a Protein With a Redesigned Hydrophobic Core, Northeast Structural Genomics Consortium Target OR38
rcsb
source organism Thermotoga maritima
molecule tags De novo protein
molecule keywords Protein OR38
total genus 42
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2lchA00
2OOCA 3MYFA 4PACA 1I5NA 4EUKB 3IQTA 1BDJB 1YVIA 2LCHA 2R25A 3KYJA 1A0BA 3KYIA 1SR2A 1C02A 3U3BA 3US6A 2LP4A 2A0BA 1OXKA 1FR0A 2Q4FA 4G78A 1Y6DA 1QSPA 1C03A 1TQGA 1WN0A 2LD6A 1OXBA
chains in the Genus database with same CATH superfamily
3HKKA 4JURI 2IXNA 4DRIB 4CS9A 4O6NA 2DB4A 3DJNB 4PFPA 4MVOA 3C8ZA 2M4EA 2ZXPA 5E2QA 5L0GA 4I1OB 1Z63A 3ABLC 1OW6A 1BR4A 3QZCA 1WOLA 1U89A 4JZAA 1XZQA 4HEAJ 3FVYA 4IRUA 4PK4A 1VB5A 3W2WA 2Q9CA 1VYIA 1JRAA 2YKZA 3U9MA 3NDBB 1N1CA 2HKVA 2L9JA 3R2PA 3SZRA 4EBJA 4DBRA 3Q6NA 3OA1A 3OEOA 4JC7A 1PV3A 3K33A 3PCVA 3TD7A 4PJLA 1I4ZA 1DOVA 1O3UA 2DI3A 5CI9A 2Q4FA 4OD5A 2WB7A 2EIMC 1T5OA 3GM1A 2EILC 3G4ZA 1QZXA 1YARO 4J30B 4WABA 3RQFA 5DS6A 2P6VA 2XL8A 3KL4A 1MMGA 3DM9B 2IOQA 3C63A 1WASA 2A0UA 1ORJA 4CDYA 2H7OA 3H65A 3IQCA 1JMWA 2HMQA 2ZPAA 4K7BA 5T3TA 3VAYA 4C3BA 2XLEA 3QTHA 5DLJA 2VASA 2L7AA 2B0HA 2XL6A 3EFOA 1PD1A 4A4AA 1MMDA 2HJ3A 3AG2C 2RSEB 2KYHA 3O39A 3F46A 4O6YA 1YYJA 3UMIA 1D0YA 1HW2A 1JPJA 1LE2A 2HV6A 2OEVA 3N2ZB 4MS2A 3WODF 2KSFA 1ZHZA 5KYYB 2V26A 3Q7LA 4HFFB 1FAPB 2Q3TA 2P0NA 2J0WA 2CNWD 4KNWA 4MTFA 3US6A 3C8GD 4DRJB 1A7VA 2WL8A 1VLSA 3RKOF 5K0IA 4MTGA 1V74B 3S29A 3X2QC 3NRHA 1RXQA 1T6QA 2G3VA 3RH3A 1G4WR 4YK5A 1HMDA 3UGOA 4CSAA 1HE9A 1XWJA 3EZIA 1KNYA 2ASRA 1CGOA 5KYWB 4P6IC 3ECSA 2RD9A 3K7DA 2EINC 1I5NA 2XLMA 2J45A 4MNDA 1YA7O 3EGXB 1XZPA 4CIPA 3LUTB 5L0CA 5EHHA 4W8PA 2HUJA 4DVZA 5T1DB 3TJ5A 4IAQA 5DS5A 2L6FA 3DAGA 3CAXA 3GEHA 3ZQYA 1RCPA 4NTAA 2Y3BA 2XS1A 3GM3A 3HTKC 2Q00A 4G7HF 2NUTA 1ZHWA 3K1HA 4E7ZA 2J9WA 3W4YA 5L0FA 4G7OF 2A68F 3EFOB 4RDAA 3EH1A 4JRZA 4XLNF 4GQHA 4EIYA 5A6JA 2LP4A 3MLGA 4CS8C 1Z5ZA 3O55A 4RBNA 1LVKA 1S05A 3AG3C 1QSPA 1K05A 4W8KA 1ZW2A 1Q0FA 3IEEA 2LQGA 1AVOB 1WGWA 3QVYA 3K1IA 2QE9A 1YZCA 2YL0A 3E70C 3RIPA 4OD4A 2JPUA 3LEVA 4XLPF 2R7RA 3C18A 4WGYA 2VCAA 1YVIA 4MTOA 4Z9JA 2GWWA 3U5SA 5IY5C 2WVOA 2LFDA 2OG2A 1VTMP 5COFA 2HV7A 4JEBA 2IBFA 1ZU5A 1TWHA 1OCRC 2FGYA 3EJNA 1ZHTA 3JT1A 4U5GA 5JRAA 3LNRA 2IXPA 3TJ6A 1U0BB 4NCQA 2VCBA 3JZ0A 4JTDB 3DI5A 2GA0A 3DKAA 3ZG1A 2Y3GA 3JRTA 2PFDA 1ST6A 1H9TA 4U5EE 4E0HA 4D4XA 2YVKA 2V3CC 2BL2A 3ZWIA 1BR1A 3RW0A 3JSEO 3V7OA 3T4RA 3B0UX 2ZXRA 2LIGA 1ZU4A 1M2VB 4JE9A 2ICWG 4NTFA 4CS7A 1M2VA 2YLGA 4JCHA 2JX0A 4U9EA 1BDJB 2IXMA 2X0CA 3UGPA 1JR8A 3C62A 2DYRC 4MVUA 1TWAA 4PJJA 2YL1A 2R25A 2LFFA 1A0BA 2KK1A 2PX0A 3BEHA 4MVMA 3ZDLA 1J8YF 4CIHA 2XSEA 3NYLA 3QW0A 3LNMB 5AGFA 1IW7F 256BA 3AQCA 2CCYA 2GFHA 4EBBA 1CGME 4ZLDA 1K04A 3L0IA 2ZD9A 2A0BA 5F28E 3SNHA 2AWCA 3L8JA 3EG9A 3Q7GA 2J9UA 2B0JA 1GGQA 1M6TA 3AG4C 4YJWA 2LK4A 2XM0A 4B6IA 1FNTc 4QDLA 1G4US 4LDRA 3U9JA 4U5CE 2WZLA 3I4UA 1D1CA 4LDQA 1ORSC 4H4KC 1T01A 2NSGA 5AC5A 2EIKC 2OEXA 3ASNC 1A41A 1GS9A 3DE8A 3M4BA 1FMWA 4KC9A 3SEOA 1FFTC 2QY9A 3DXJF 5EK0A 2XXAB 5E3AA 2J7PD 4OIRF 3K6BA 3M79A 4O6MA 3U8VA 1QPUA 2Y69C 2Q7RA 2XLOA 3H2VA 3IQ5A 3GWNA 3B0VC 4ONSA 4BEJA 1A7EA 3LS0A 1NFOA 3FAPB 3IHUA 1SR2A 1WATA 3C7JA 1M57C 3EH2A 5KYWA 2XS8A 1OQCA 2YRFA 1AEPA 3B0PA 2A1DD 3DZAA 3LJBA 4MVRA 2R7SA 1BR2A 3Q6MA 3S84A 1BZ4A 4YT5A 3G4XA 3GORA 2D4UA 3QMKA 3L8IA 1YJGA 1V54C 4BJ1A 2LD6A 4CJGA 1E83A 4Q4ZF 4IWBA 5JP7A 1SZIA 2NUTB 1VMAA 2BC5A 3MYFA 5L3VA 1WTYA 2W45A 4IJJA 4Z9HA 1LS4A 4OIOF 1V55C 4MVQA 2XLDA 1LKXA 2CNWA 4PJMA 3B71A 2C04A 5A6KA 4DBQA 4U9DA 2YQYA 4NC3A 3EQLF 2VC9A 3CQZA 2MWQA 1ORYA 5KYYA 4DOZA 3N0TA 3OWTA 5B1BC 2R05A 4J7YA 3U3BA 4E7SA 2ZXOA 3DM5A 3TULA 1H7IA 4QI0A 2PNOA 3L1MA 1PD0A 4JCZA 5JLIA 2VB6A 1A7DA 2P61A 2F22A 3J06A 4LACB 5DS4A 2EPKX 2GAQA 2VH3A 1YLMA 3FMSA 4BJTA 3MYIA 2J8WA 3UNGC 5JVEA 1BBHA 1OR3A 5HV9A 5A6BA 4PR9A 3V5YA 5BUOA 3RQGA 4CDVA 4JIOA 2KGOA 4FX5A 3TOMA 1H6GA 2H7BA 2KC3A 2FFHA 1EA8A 2R03A 4OINF 1Z23A 4BG0A 1LI5A 2R9RB 1JAFA 3ITFA 3DMDA 3RFYA 1Y4CA 2A6HF 4U5BE 1CPQA 4AL1A 5BQIA 4EWCA 2M64A 2Y3DA 1LE4A 4I3MA 1R5ID 3LESA 1FFHA 4G78A 2AVKA 5BQGA 2QNLA 4JJFA 1K40A 1LS1A 5KYUA 3S9OA 3SXZA 5AC4A 4KBLA 2HJMA 4K0DA 4Q5SF 3U3FA 2XLWA 1DOWA 3M15A 4PACA 2R7UA 1TKNA 3WG7C 5D92A 1GQAA 4NTBA 2YLIA 3IQTA 1VOMA 4U5HA 3EG9B 2XL4A 3K1IC 4HFKB 4XTKA 3W2VA 1JOGA 2J7PA 2Q9BA 3HLZA 1QVXA 2LCHA 5FZTA 3AGUA 4YWQA 5B3SC 2AP3A 3EHNA 3TK0A 3NKDA 4C3DA 5B3IA 1UG7A 2KW3C 4CS8A 3GODA 4Q7CA 3V5ZA 2KQ9A 1Q0KA 1T6IA 1Y6DA 2AU5A 2L6HA 1NU9C 2XXAA 1I4YA 1LI7A 1MNDA 1H9GA 3AJMA 1E84A 1FMVA 4KNVA 2G3KA 1RMVA 2A69F 2YWAA 5EGYA 2EPNA 4CJOA 4JVSA 4DJ9A 4N6CA 2AWYA 1OKKD 2QUPA 2R7OA 4I44A 2E87A 4KI2A 4EUKB 4LLEA 1SF8A 2PBEA 3IPMO 1TR2A 2QLAA 4YN0B 2HSQA 5DQTA 4HE8D 2R7VA 1HY5A 1LPEA 3O6XA 2NSFA 3R7CA 1AUEA 3JRMO 1ZVZA 3VYWA 5L0HA 4E17A 2L6GA 1CPRA 4GYTA 3DWWA 3M4CA 3M1CB 3SXKA 2J0XA 3ZSUA 2R7TA 1G5ZA 2UUIA 1NG1A 1RKCA 1UFBA 4JTAB 2W4MA 4LLCA 3UR3C 4CBEA 5BQHA 2LSEA 5JT4A 2EPOA 4E18A 1OXKA 1MNEA 1S7ZA 1E85A 4ER9A 2EPLX 2TMVP 2QTVA 4H54A 1C03A 3LS1A 4XPWA 3T9OA 1TQGA 1YYXA 3FOOA 3B29A 4G0HA 2HFIA 2KNHA 4JTCB 1VYKA 2CDQA 3ZTZA 4YT2A 2L81A 2HZ8A 4ANJA 3A9CA 3EHMA 2G62A 3EGDA 1U6HA 1OW8A 1VK5A 3HNLA 1Q0MA 4WJ0A 3TOLA 4C3EA 1OCCC 4CX9A 3EGDB 1SYQA 2C03A 3T6BA 3F47A 2H8AA 2NUPB 1MMNA 1YDIA 3I5QA 5TJ5E 2J46A 2Y3HA 4BPMA 5A6BD 5HSWA 1C17M 2UUHA 2W4BA 1NU7D 2J9BA 4PJNA 3BRJA 4NY3A 3U8PA 2EIJC 3U2MA 5A6AA 4YL1A 1JPNA 3KH2A 5A69A 3DJUB 4YT8A 2R7XA 3NMJA 4CSAC 2YL7A 3HJCA 3JSZA 3V5XA 3DAFA 4N4WA 1OXBA 4D4NA 2XLHA 2OOCA 4MVSA 4O79A 4IAOA 3MBGA 5B1AC 5CI8A 3RYLA 5FCLA 2I15A 3W8HA 4RD9A 1RKEA 2Q9AA 3KMIA 4PFOA 4DVYP 4G7ZF 1MMAA 1YAUO 4C7OB 1B68A 1Q0GA 3EPVA 1ZHXA 3KYJA 4N6HA 5T3WA 1IZMA 4C7OA 3KYIA 2O9XA 4IARA 4M63A 5COGA 4O7GA 4BEMJ 4K1OA 4MW3A 5E3CA 2HS5A 2YL3A 2Z15A 1C02A 2R02A 4MW8A 4IGGA 4ULWA 2J9VA 2ETSA 3QW1A 3ABKC 1KTMA 3MX3A 4AE4B 3X1OA 4XPYA 2CW0F 2DYSC 4N06A 4AE4A 2X51A 1VLTA 2WVNA 5JSLA 1CGNA 3UMKA 1SMYF 4P9TA 4YL3A 1HMOA 2DGJA 1QKRA 3FXHA 2OCCC 3GANA 1QLEC 3EZHA 3LAYA 2EPMX 3CSKA 2YZSA 4IB4A 4BJ5A 2YEVA 1APCA 4XEVA 1NFNA 4FAPB 1NLXA 1HW1A 2NG1A 4U5FE 1EQ1A 3RQEA 4XEFA 2HSBA 4CDAA 4EKWA 1M2OA 1D0XA 2OJQA 3LLIA 4LERA 1OKKA 1RKEB 3NG1A 1R4TA 3KPHA 3LLKA 4AK9A 4CS9C 2NPUA 2R7QA 4BJ5C 1GM5A 1ZW3A 1L3PA 3N24A 1V4AA 2ZXWC 3GWLA 3SXMA 2GDCA 3WHNA 4AL0A 3HNJA 4BJ6C 5KYUB 3U0CA 4U5DE 4EBKA 2YLDA 4YL0A 3ZVRA 2YHSA 3DE9A 3S90A 3FDQA 1WN0A 1EI7A 4GEHA 1MQVA 3A11A 1TFKB 3FOPA 2FAPB 1D1BA 2OKUA 3HNKA 1NZEA 3JYHA 3ASOC 4JW1A 4XEKA 2A6EF 3CEXA 4DRHB 4ZLCA 2IXOA 4X0RA 3EGXA 5L0DA 3ATPA 3VF0A 1O5HA 1W2WA 5D91A 5E33A 1WWPA 3IQ6A 1KU2A 1E86A 1ZYRF 1D0ZA 3SP1A 2VCCA 4L6RA 3FAJA 4XQ1A 4QI2A 5KYXA 2CGEA 2XRHA 5F5FA 2IYLD 4E0IA 4BJ6A 3K66A 5KYXB 3GM2A 1FTSA 4Z9IA 2H7VC 3ZIBA 4A2NB 3PHF2 3NYJA 3VM6A 1PCXA 2WVQA 1T9KA 5F5HA 2JD3A 2PX3A 3LEOA 2WZGA 3NMIA 3T6JA 5JS5A 1OCOC 2Y39A 3AG1C 3QVZA 3RF3A 3PDMP 3DD7A 5COMA 1NSGB 3RVZA 4DXWA 4UDVA 2CYDA 1NBBA 3B9QA 4MQ9F 4ULVA 5L3QA 3C8GA 1OW7A 3E9VA 3S0XA 4NQFA 2OQMA 4YT4A 1O87A 2OJED 4R32A 3C8GB 4JJGA 1OCZC 2D5RB 2P1AA 3ZQVA 4F4BA 4AX2A 4XPXA 1TWCA 3VRCA 5L0JA 1TWGA 2I8BA 4LDKA 3I5PA 4J7TA 1D1AA 1QQ3A 1RJ9A 1G8XA 3H2UA 3S28A 3WAQA 4OIQF 4FESA 2PP4A 2KJGA 3NYMA 1RJ9B 4JEAA 1YZAA 4P9FA 1Z6AA 3UMHA 2W9YA 1F1MA 3AGTA 1OR2A 3T6GB 4EHPA 3JTLO 3CZ6A 3L34A 5GPGB 4I1MA 3ZC4A 3AOUA 4MVZA 2P7VA 2XLVA 1YA9A 3FHDA 3MFNA 1J8MF 3GEEA 3SXYA 3S27A 3ZTMA 5CIVA 1ZZPA 4OIPF 3JYYA 3KKBA 3POVA 3TQOA 1ZHYA 2MHRA 4WGZA 3HNIA 3PMRA 5JUAA 2R7WA 3GEIA 3NMKA 2BE5F 2OU6A 3G50A 2NUPA 4J32B 4XWJA 5KYNA 1T6UA 5DVWA 5DQZA 3NKEA 1TFOB 1LM3B 2WZFA 1Z7Qc 2HMZA 2XM4A 3O10A 1E2XA 1M56C 1Z3IX 2MYSA 5L0IA 2IM8A 1Q0DA 3RVYA 3SYNA 1FR0A 3U2LA 1L7CA 4FWVA 2PF4E 3AQBA 1HE1A 4JKVA 3JCUQ 1EKYA 3ABMC 1LIHA 3W8IA
chains in the Genus database with same CATH topology
2OOCA 3MYFA 4PACA 1I5NA 4EUKB 3IQTA 1BDJB 1YVIA 2LCHA 2R25A 3KYJA 1A0BA 3KYIA 1SR2A 1C02A 3U3BA 3US6A 2LP4A 2A0BA 1OXKA 1FR0A 2Q4FA 4G78A 1Y6DA 1QSPA 1C03A 1TQGA 1WN0A 2LD6A 1OXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOC A;  3MYF A;  4PAC A;  1I5N A;  4EUK B;  3IQT A;  1BDJ B;  1YVI A;  2LCH A;  2R25 A;  3KYJ A;  1A0B A;  3KYI A;  1SR2 A;  1C02 A;  3U3B A;  3US6 A;  2LP4 A;  2A0B A;  1OXK A;  1FR0 A;  2Q4F A;  4G78 A;  1Y6D A;  1QSP A;  1C03 A;  1TQG A;  1WN0 A;  2LD6 A;  1OXB A; 
#chains in the Genus database with same CATH topology
 3HKK A;  4JUR I;  2IXN A;  4DRI B;  4CS9 A;  4O6N A;  2DB4 A;  3DJN B;  4PFP A;  4MVO A;  3C8Z A;  2M4E A;  2ZXP A;  5E2Q A;  5L0G A;  4I1O B;  1Z63 A;  3ABL C;  1OW6 A;  1BR4 A;  3QZC A;  1WOL A;  1U89 A;  4JZA A;  1XZQ A;  4HEA J;  3FVY A;  4IRU A;  4PK4 A;  1VB5 A;  3W2W A;  2Q9C A;  1VYI A;  1JRA A;  2YKZ A;  3U9M A;  3NDB B;  1N1C A;  2HKV A;  2L9J A;  3R2P A;  3SZR A;  4EBJ A;  4DBR A;  3Q6N A;  3OA1 A;  3OEO A;  4JC7 A;  1PV3 A;  3K33 A;  3PCV A;  3TD7 A;  4PJL A;  1I4Z A;  1DOV A;  1O3U A;  2DI3 A;  5CI9 A;  2Q4F A;  4OD5 A;  2WB7 A;  2EIM C;  1T5O A;  3GM1 A;  2EIL C;  3G4Z A;  1QZX A;  1YAR O;  4J30 B;  4WAB A;  3RQF A;  5DS6 A;  2P6V A;  2XL8 A;  3KL4 A;  1MMG A;  3DM9 B;  2IOQ A;  3C63 A;  1WAS A;  2A0U A;  1ORJ A;  4CDY A;  2H7O A;  3H65 A;  3IQC A;  1JMW A;  2HMQ A;  2ZPA A;  4K7B A;  5T3T A;  3VAY A;  4C3B A;  2XLE A;  3QTH A;  5DLJ A;  2VAS A;  2L7A A;  2B0H A;  2XL6 A;  3EFO A;  1PD1 A;  4A4A A;  1MMD A;  2HJ3 A;  3AG2 C;  2RSE B;  2KYH A;  3O39 A;  3F46 A;  4O6Y A;  1YYJ A;  3UMI A;  1D0Y A;  1HW2 A;  1JPJ A;  1LE2 A;  2HV6 A;  2OEV A;  3N2Z B;  4MS2 A;  3WOD F;  2KSF A;  1ZHZ A;  5KYY B;  2V26 A;  3Q7L A;  4HFF B;  1FAP B;  2Q3T A;  2P0N A;  2J0W A;  2CNW D;  4KNW A;  4MTF A;  3US6 A;  3C8G D;  4DRJ B;  1A7V A;  2WL8 A;  1VLS A;  3RKO F;  5K0I A;  4MTG A;  1V74 B;  3S29 A;  3X2Q C;  3NRH A;  1RXQ A;  1T6Q A;  2G3V A;  3RH3 A;  1G4W R;  4YK5 A;  1HMD A;  3UGO A;  4CSA A;  1HE9 A;  1XWJ A;  3EZI A;  1KNY A;  2ASR A;  1CGO A;  5KYW B;  4P6I C;  3ECS A;  2RD9 A;  3K7D A;  2EIN C;  1I5N A;  2XLM A;  2J45 A;  4MND A;  1YA7 O;  3EGX B;  1XZP A;  4CIP A;  3LUT B;  5L0C A;  5EHH A;  4W8P A;  2HUJ A;  4DVZ A;  5T1D B;  3TJ5 A;  4IAQ A;  5DS5 A;  2L6F A;  3DAG A;  3CAX A;  3GEH A;  3ZQY A;  1RCP A;  4NTA A;  2Y3B A;  2XS1 A;  3GM3 A;  3HTK C;  2Q00 A;  4G7H F;  2NUT A;  1ZHW A;  3K1H A;  4E7Z A;  2J9W A;  3W4Y A;  5L0F A;  4G7O F;  2A68 F;  3EFO B;  4RDA A;  3EH1 A;  4JRZ A;  4XLN F;  4GQH A;  4EIY A;  5A6J A;  2LP4 A;  3MLG A;  4CS8 C;  1Z5Z A;  3O55 A;  4RBN A;  1LVK A;  1S05 A;  3AG3 C;  1QSP A;  1K05 A;  4W8K A;  1ZW2 A;  1Q0F A;  3IEE A;  2LQG A;  1AVO B;  1WGW A;  3QVY A;  3K1I A;  2QE9 A;  1YZC A;  2YL0 A;  3E70 C;  3RIP A;  4OD4 A;  2JPU A;  3LEV A;  4XLP F;  2R7R A;  3C18 A;  4WGY A;  2VCA A;  1YVI A;  4MTO A;  4Z9J A;  2GWW A;  3U5S A;  5IY5 C;  2WVO A;  2LFD A;  2OG2 A;  1VTM P;  5COF A;  2HV7 A;  4JEB A;  2IBF A;  1ZU5 A;  1TWH A;  1OCR C;  2FGY A;  3EJN A;  1ZHT A;  3JT1 A;  4U5G A;  5JRA A;  3LNR A;  2IXP A;  3TJ6 A;  1U0B B;  4NCQ A;  2VCB A;  3JZ0 A;  4JTD B;  3DI5 A;  2GA0 A;  3DKA A;  3ZG1 A;  2Y3G A;  3JRT A;  2PFD A;  1ST6 A;  1H9T A;  4U5E E;  4E0H A;  4D4X A;  2YVK A;  2V3C C;  2BL2 A;  3ZWI A;  1BR1 A;  3RW0 A;  3JSE O;  3V7O A;  3T4R A;  3B0U X;  2ZXR A;  2LIG A;  1ZU4 A;  1M2V B;  4JE9 A;  2ICW G;  4NTF A;  4CS7 A;  1M2V A;  2YLG A;  4JCH A;  2JX0 A;  4U9E A;  1BDJ B;  2IXM A;  2X0C A;  3UGP A;  1JR8 A;  3C62 A;  2DYR C;  4MVU A;  1TWA A;  4PJJ A;  2YL1 A;  2R25 A;  2LFF A;  1A0B A;  2KK1 A;  2PX0 A;  3BEH A;  4MVM A;  3ZDL A;  1J8Y F;  4CIH A;  2XSE A;  3NYL A;  3QW0 A;  3LNM B;  5AGF A;  1IW7 F;  256B A;  3AQC A;  2CCY A;  2GFH A;  4EBB A;  1CGM E;  4ZLD A;  1K04 A;  3L0I A;  2ZD9 A;  2A0B A;  5F28 E;  3SNH A;  2AWC A;  3L8J A;  3EG9 A;  3Q7G A;  2J9U A;  2B0J A;  1GGQ A;  1M6T A;  3AG4 C;  4YJW A;  2LK4 A;  2XM0 A;  4B6I A;  1FNT c;  4QDL A;  1G4U S;  4LDR A;  3U9J A;  4U5C E;  2WZL A;  3I4U A;  1D1C A;  4LDQ A;  1ORS C;  4H4K C;  1T01 A;  2NSG A;  5AC5 A;  2EIK C;  2OEX A;  3ASN C;  1A41 A;  1GS9 A;  3DE8 A;  3M4B A;  1FMW A;  4KC9 A;  3SEO A;  1FFT C;  2QY9 A;  3DXJ F;  5EK0 A;  2XXA B;  5E3A A;  2J7P D;  4OIR F;  3K6B A;  3M79 A;  4O6M A;  3U8V A;  1QPU A;  2Y69 C;  2Q7R A;  2XLO A;  3H2V A;  3IQ5 A;  3GWN A;  3B0V C;  4ONS A;  4BEJ A;  1A7E A;  3LS0 A;  1NFO A;  3FAP B;  3IHU A;  1SR2 A;  1WAT A;  3C7J A;  1M57 C;  3EH2 A;  5KYW A;  2XS8 A;  1OQC A;  2YRF A;  1AEP A;  3B0P A;  2A1D D;  3DZA A;  3LJB A;  4MVR A;  2R7S A;  1BR2 A;  3Q6M A;  3S84 A;  1BZ4 A;  4YT5 A;  3G4X A;  3GOR A;  2D4U A;  3QMK A;  3L8I A;  1YJG A;  1V54 C;  4BJ1 A;  2LD6 A;  4CJG A;  1E83 A;  4Q4Z F;  4IWB A;  5JP7 A;  1SZI A;  2NUT B;  1VMA A;  2BC5 A;  3MYF A;  5L3V A;  1WTY A;  2W45 A;  4IJJ A;  4Z9H A;  1LS4 A;  4OIO F;  1V55 C;  4MVQ A;  2XLD A;  1LKX A;  2CNW A;  4PJM A;  3B71 A;  2C04 A;  5A6K A;  4DBQ A;  4U9D A;  2YQY A;  4NC3 A;  3EQL F;  2VC9 A;  3CQZ A;  2MWQ A;  1ORY A;  5KYY A;  4DOZ A;  3N0T A;  3OWT A;  5B1B C;  2R05 A;  4J7Y A;  3U3B A;  4E7S A;  2ZXO A;  3DM5 A;  3TUL A;  1H7I A;  4QI0 A;  2PNO A;  3L1M A;  1PD0 A;  4JCZ A;  5JLI A;  2VB6 A;  1A7D A;  2P61 A;  2F22 A;  3J06 A;  4LAC B;  5DS4 A;  2EPK X;  2GAQ A;  2VH3 A;  1YLM A;  3FMS A;  4BJT A;  3MYI A;  2J8W A;  3UNG C;  5JVE A;  1BBH A;  1OR3 A;  5HV9 A;  5A6B A;  4PR9 A;  3V5Y A;  5BUO A;  3RQG A;  4CDV A;  4JIO A;  2KGO A;  4FX5 A;  3TOM A;  1H6G A;  2H7B A;  2KC3 A;  2FFH A;  1EA8 A;  2R03 A;  4OIN F;  1Z23 A;  4BG0 A;  1LI5 A;  2R9R B;  1JAF A;  3ITF A;  3DMD A;  3RFY A;  1Y4C A;  2A6H F;  4U5B E;  1CPQ A;  4AL1 A;  5BQI A;  4EWC A;  2M64 A;  2Y3D A;  1LE4 A;  4I3M A;  1R5I D;  3LES A;  1FFH A;  4G78 A;  2AVK A;  5BQG A;  2QNL A;  4JJF A;  1K40 A;  1LS1 A;  5KYU A;  3S9O A;  3SXZ A;  5AC4 A;  4KBL A;  2HJM A;  4K0D A;  4Q5S F;  3U3F A;  2XLW A;  1DOW A;  3M15 A;  4PAC A;  2R7U A;  1TKN A;  3WG7 C;  5D92 A;  1GQA A;  4NTB A;  2YLI A;  3IQT A;  1VOM A;  4U5H A;  3EG9 B;  2XL4 A;  3K1I C;  4HFK B;  4XTK A;  3W2V A;  1JOG A;  2J7P A;  2Q9B A;  3HLZ A;  1QVX A;  2LCH A;  5FZT A;  3AGU A;  4YWQ A;  5B3S C;  2AP3 A;  3EHN A;  3TK0 A;  3NKD A;  4C3D A;  5B3I A;  1UG7 A;  2KW3 C;  4CS8 A;  3GOD A;  4Q7C A;  3V5Z A;  2KQ9 A;  1Q0K A;  1T6I A;  1Y6D A;  2AU5 A;  2L6H A;  1NU9 C;  2XXA A;  1I4Y A;  1LI7 A;  1MND A;  1H9G A;  3AJM A;  1E84 A;  1FMV A;  4KNV A;  2G3K A;  1RMV A;  2A69 F;  2YWA A;  5EGY A;  2EPN A;  4CJO A;  4JVS A;  4DJ9 A;  4N6C A;  2AWY A;  1OKK D;  2QUP A;  2R7O A;  4I44 A;  2E87 A;  4KI2 A;  4EUK B;  4LLE A;  1SF8 A;  2PBE A;  3IPM O;  1TR2 A;  2QLA A;  4YN0 B;  2HSQ A;  5DQT A;  4HE8 D;  2R7V A;  1HY5 A;  1LPE A;  3O6X A;  2NSF A;  3R7C A;  1AUE A;  3JRM O;  1ZVZ A;  3VYW A;  5L0H A;  4E17 A;  2L6G A;  1CPR A;  4GYT A;  3DWW A;  3M4C A;  3M1C B;  3SXK A;  2J0X A;  3ZSU A;  2R7T A;  1G5Z A;  2UUI A;  1NG1 A;  1RKC A;  1UFB A;  4JTA B;  2W4M A;  4LLC A;  3UR3 C;  4CBE A;  5BQH A;  2LSE A;  5JT4 A;  2EPO A;  4E18 A;  1OXK A;  1MNE A;  1S7Z A;  1E85 A;  4ER9 A;  2EPL X;  2TMV P;  2QTV A;  4H54 A;  1C03 A;  3LS1 A;  4XPW A;  3T9O A;  1TQG A;  1YYX A;  3FOO A;  3B29 A;  4G0H A;  2HFI A;  2KNH A;  4JTC B;  1VYK A;  2CDQ A;  3ZTZ A;  4YT2 A;  2L81 A;  2HZ8 A;  4ANJ A;  3A9C A;  3EHM A;  2G62 A;  3EGD A;  1U6H A;  1OW8 A;  1VK5 A;  3HNL A;  1Q0M A;  4WJ0 A;  3TOL A;  4C3E A;  1OCC C;  4CX9 A;  3EGD B;  1SYQ A;  2C03 A;  3T6B A;  3F47 A;  2H8A A;  2NUP B;  1MMN A;  1YDI A;  3I5Q A;  5TJ5 E;  2J46 A;  2Y3H A;  4BPM A;  5A6B D;  5HSW A;  1C17 M;  2UUH A;  2W4B A;  1NU7 D;  2J9B A;  4PJN A;  3BRJ A;  4NY3 A;  3U8P A;  2EIJ C;  3U2M A;  5A6A A;  4YL1 A;  1JPN A;  3KH2 A;  5A69 A;  3DJU B;  4YT8 A;  2R7X A;  3NMJ A;  4CSA C;  2YL7 A;  3HJC A;  3JSZ A;  3V5X A;  3DAF A;  4N4W A;  1OXB A;  4D4N A;  2XLH A;  2OOC A;  4MVS A;  4O79 A;  4IAO A;  3MBG A;  5B1A C;  5CI8 A;  3RYL A;  5FCL A;  2I15 A;  3W8H A;  4RD9 A;  1RKE A;  2Q9A A;  3KMI A;  4PFO A;  4DVY P;  4G7Z F;  1MMA A;  1YAU O;  4C7O B;  1B68 A;  1Q0G A;  3EPV A;  1ZHX A;  3KYJ A;  4N6H A;  5T3W A;  1IZM A;  4C7O A;  3KYI A;  2O9X A;  4IAR A;  4M63 A;  5COG A;  4O7G A;  4BEM J;  4K1O A;  4MW3 A;  5E3C A;  2HS5 A;  2YL3 A;  2Z15 A;  1C02 A;  2R02 A;  4MW8 A;  4IGG A;  4ULW A;  2J9V A;  2ETS A;  3QW1 A;  3ABK C;  1KTM A;  3MX3 A;  4AE4 B;  3X1O A;  4XPY A;  2CW0 F;  2DYS C;  4N06 A;  4AE4 A;  2X51 A;  1VLT A;  2WVN A;  5JSL A;  1CGN A;  3UMK A;  1SMY F;  4P9T A;  4YL3 A;  1HMO A;  2DGJ A;  1QKR A;  3FXH A;  2OCC C;  3GAN A;  1QLE C;  3EZH A;  3LAY A;  2EPM X;  3CSK A;  2YZS A;  4IB4 A;  4BJ5 A;  2YEV A;  1APC A;  4XEV A;  1NFN A;  4FAP B;  1NLX A;  1HW1 A;  2NG1 A;  4U5F E;  1EQ1 A;  3RQE A;  4XEF A;  2HSB A;  4CDA A;  4EKW A;  1M2O A;  1D0X A;  2OJQ A;  3LLI A;  4LER A;  1OKK A;  1RKE B;  3NG1 A;  1R4T A;  3KPH A;  3LLK A;  4AK9 A;  4CS9 C;  2NPU A;  2R7Q A;  4BJ5 C;  1GM5 A;  1ZW3 A;  1L3P A;  3N24 A;  1V4A A;  2ZXW C;  3GWL A;  3SXM A;  2GDC A;  3WHN A;  4AL0 A;  3HNJ A;  4BJ6 C;  5KYU B;  3U0C A;  4U5D E;  4EBK A;  2YLD A;  4YL0 A;  3ZVR A;  2YHS A;  3DE9 A;  3S90 A;  3FDQ A;  1WN0 A;  1EI7 A;  4GEH A;  1MQV A;  3A11 A;  1TFK B;  3FOP A;  2FAP B;  1D1B A;  2OKU A;  3HNK A;  1NZE A;  3JYH A;  3ASO C;  4JW1 A;  4XEK A;  2A6E F;  3CEX A;  4DRH B;  4ZLC A;  2IXO A;  4X0R A;  3EGX A;  5L0D A;  3ATP A;  3VF0 A;  1O5H A;  1W2W A;  5D91 A;  5E33 A;  1WWP A;  3IQ6 A;  1KU2 A;  1E86 A;  1ZYR F;  1D0Z A;  3SP1 A;  2VCC A;  4L6R A;  3FAJ A;  4XQ1 A;  4QI2 A;  5KYX A;  2CGE A;  2XRH A;  5F5F A;  2IYL D;  4E0I A;  4BJ6 A;  3K66 A;  5KYX B;  3GM2 A;  1FTS A;  4Z9I A;  2H7V C;  3ZIB A;  4A2N B;  3PHF 2;  3NYJ A;  3VM6 A;  1PCX A;  2WVQ A;  1T9K A;  5F5H A;  2JD3 A;  2PX3 A;  3LEO A;  2WZG A;  3NMI A;  3T6J A;  5JS5 A;  1OCO C;  2Y39 A;  3AG1 C;  3QVZ A;  3RF3 A;  3PDM P;  3DD7 A;  5COM A;  1NSG B;  3RVZ A;  4DXW A;  4UDV A;  2CYD A;  1NBB A;  3B9Q A;  4MQ9 F;  4ULV A;  5L3Q A;  3C8G A;  1OW7 A;  3E9V A;  3S0X A;  4NQF A;  2OQM A;  4YT4 A;  1O87 A;  2OJE D;  4R32 A;  3C8G B;  4JJG A;  1OCZ C;  2D5R B;  2P1A A;  3ZQV A;  4F4B A;  4AX2 A;  4XPX A;  1TWC A;  3VRC A;  5L0J A;  1TWG A;  2I8B A;  4LDK A;  3I5P A;  4J7T A;  1D1A A;  1QQ3 A;  1RJ9 A;  1G8X A;  3H2U A;  3S28 A;  3WAQ A;  4OIQ F;  4FES A;  2PP4 A;  2KJG A;  3NYM A;  1RJ9 B;  4JEA A;  1YZA A;  4P9F A;  1Z6A A;  3UMH A;  2W9Y A;  1F1M A;  3AGT A;  1OR2 A;  3T6G B;  4EHP A;  3JTL O;  3CZ6 A;  3L34 A;  5GPG B;  4I1M A;  3ZC4 A;  3AOU A;  4MVZ A;  2P7V A;  2XLV A;  1YA9 A;  3FHD A;  3MFN A;  1J8M F;  3GEE A;  3SXY A;  3S27 A;  3ZTM A;  5CIV A;  1ZZP A;  4OIP F;  3JYY A;  3KKB A;  3POV A;  3TQO A;  1ZHY A;  2MHR A;  4WGZ A;  3HNI A;  3PMR A;  5JUA A;  2R7W A;  3GEI A;  3NMK A;  2BE5 F;  2OU6 A;  3G50 A;  2NUP A;  4J32 B;  4XWJ A;  5KYN A;  1T6U A;  5DVW A;  5DQZ A;  3NKE A;  1TFO B;  1LM3 B;  2WZF A;  1Z7Q c;  2HMZ A;  2XM4 A;  3O10 A;  1E2X A;  1M56 C;  1Z3I X;  2MYS A;  5L0I A;  2IM8 A;  1Q0D A;  3RVY A;  3SYN A;  1FR0 A;  3U2L A;  1L7C A;  4FWV A;  2PF4 E;  3AQB A;  1HE1 A;  4JKV A;  3JCU Q;  1EKY A;  3ABM C;  1LIH A;  3W8I A; 
#chains in the Genus database with same CATH homology
 2OOC A;  3MYF A;  4PAC A;  1I5N A;  4EUK B;  3IQT A;  1BDJ B;  1YVI A;  2LCH A;  2R25 A;  3KYJ A;  1A0B A;  3KYI A;  1SR2 A;  1C02 A;  3U3B A;  3US6 A;  2LP4 A;  2A0B A;  1OXK A;  1FR0 A;  2Q4F A;  4G78 A;  1Y6D A;  1QSP A;  1C03 A;  1TQG A;  1WN0 A;  2LD6 A;  1OXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...