2LCHA

Solution nmr structure of a protein with a redesigned hydrophobic core, northeast structural genomics consortium target or38
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
b'MGSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRELDKKVSGSYLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein OR38
publication title Solution NMR Structure of a Protein With a Redesigned Hydrophobic Core, Northeast Structural Genomics Consortium Target OR38
rcsb
source organism Thermotoga maritima
molecule tags De novo protein
total genus 42
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2lchA00
1C03A 3US6A 2Q4FA 2OOCA 1I5NA 1QSPA 3U3BA 2A0BA 4EUKB 4PACA 2LP4A 2LD6A 1OXKA 3KYJA 1A0BA 2LCHA 1TQGA 2R25A 1BDJB 3KYIA 1C02A 1SR2A 4G78A 1OXBA 1Y6DA 1YVIA 3IQTA 1FR0A 3MYFA 1WN0A
chains in the Genus database with same CATH superfamily
3NG1A 3RW0A 1BBHA 3ABMC 4A2NB 4LDKA 1ZHTA 2L6FA 3ATPA 2W4BA 3MBGA 4YN0B 3DAFA 2Q4FA 2XLHA 3LJBA 4NTFA 3ZG1A 4YT5A 3W2VA 1H9TA 3EPVA 2A0BA 1T9KA 2EPOA 3W2WA 1PV3A 3FDQA 1R5ID 4BJ6A 3EG9A 3RKOF 1NU9C 1RJ9B 5KYNA 1SF8A 3ZVRA 4IWBA 2VC9A 1OW8A 4O6MA 2GFHA 3CEXA 1ZU5A 5A6BD 1JMWA 2MWQA 2XLVA 3U2LA 2XLEA 3U3FA 2OKUA 4FWVA 1AUEA 4JEBA 3VF0A 4XLPF 3G4XA 4WABA 4OIQF 3HNJA 4L6RA 1ZW3A 4MVSA 3VM6A 4E7ZA 4AE4A 3DZAA 4C7OA 2V26A 1GQAA 2J8WA 2LIGA 4B6IA 3T6JA 3B29A 4CS8C 5L3VA 3SXZA 2R7XA 2NUTA 2PNOA 3JSZA 3EZHA 3C18A 2NUPA 1FFHA 3K33A 1YARO 1D0ZA 1I4ZA 2A1DD 3NMJA 1D1BA 2EPKX 2KYHA 3LESA 2L7AA 3N24A 2LFDA 4G7HF 5L0IA 2IOQA 1OXKA 2QUPA 1YYJA 2HKVA 4NTBA 1YA7O 4XEKA 4MVMA 3TOMA 4JTDB 4U5EE 2OQMA 1G4WR 3JZ0A 3TK0A 1FMWA 2HJ3A 2HS5A 4F4BA 4CIHA 1M2VA 1LKXA 1EI7A 5JP7A 4EBJA 4O6NA 5K0IA 2GAQA 1ZU4A 2CDQA 2C04A 5DQTA 4LDQA 1ZHZA 1HE1A 2HSBA 2HSQA 2Y3GA 4QI0A 1ZHYA 4I3MA 3NKEA 2Q9AA 4OIRF 1LPEA 3FHDA 3S28A 1MMAA 1ZZPA 4BJTA 4DJ9A 5E3AA 1K04A 3B9QA 4G7OF 1OR2A 3K1HA 2IXPA 4YT4A 2R7OA 1N1CA 3RQEA 1OW7A 2YHSA 5JSLA 5L0GA 2EPNA 5COMA 4IB4A 4LDRA 3HLZA 3KYJA 4N6CA 4PK4A 4QI2A 1YA9A 3ZQVA 5A6AA 1I4YA 1LE4A 4MW3A 4EHPA 1RKEA 2BE5F 3GM1A 3MLGA 2R05A 3DM9B 1XWJA 1OXBA 2H7OA 3GANA 4CS8A 1Z23A 2IM8A 2C03A 3NMIA 4ZLCA 2Y69C 3NRHA 1CPQA 4KBLA 4MW8A 3C8ZA 3C8GA 1B68A 2CCYA 4MTOA 4N4WA 1LE2A 3SP1A 1IZMA 4C3EA 4CJOA 2J9BA 1WWPA 4YJWA 1Y4CA 2VB6A 2OOCA 3AG3C 2Y39A 4AL0A 4CDVA 4OINF 4DVYP 5L0DA 5KYWB 1E83A 2G62A 5D92A 2GA0A 4CJGA 1GM5A 2XLWA 1E84A 3QTHA 3O10A 3AG2C 2XL8A 1VLSA 1XZQA 2CNWD 2L6GA 4OIPF 3N0TA 2Q00A 4DVZA 3KPHA 1TQGA 4NY3A 3TD7A 3SYNA 2Q9CA 1TWGA 2LFFA 3AQCA 3EFOB 4NTAA 4BJ6C 1ST6A 2WZLA 2KJGA 1LVKA 1WOLA 3EGDA 4P9FA 5DS4A 2KQ9A 2XLDA 1TFOB 3K7DA 1FR0A 2DYSC 3ZDLA 4GYTA 3LNRA 1U89A 3MYFA 2JX0A 2KGOA 2EILC 4IRUA 2L81A 5F5HA 1PCXA 5E3CA 3UMHA 1RXQA 3GM3A 5T3TA 4D4NA 4G7ZF 2MYSA 3ASOC 3POVA 3EG9B 3HNLA 2PBEA 1V74B 3TJ6A 1KU2A 2I15A 3T4RA 1G4US 2IBFA 1NFOA 1OKKA 3C63A 3EGXB 2YL3A 4JTCB 3I4UA 4MVQA 3U0CA 1NZEA 2R7TA 3U9MA 3RF3A 4PJMA 1LM3B 2H7VC 2HV7A 1T01A 3RYLA 2B0JA 3GEIA 3NKDA 3U5SA 2FFHA 4CDAA 2IYLD 4J30B 3B0PA 2TMVP 5BUOA 1S7ZA 3UR3C 2AWCA 1QKRA 2I8BA 2UUHA 3IEEA 2XXAB 1WN0A 1H6GA 4O79A 4UDVA 2XS1A 4RD9A 1FNTc 2AU5A 5CIVA 5A6BA 4XWJA 1CGME 3S27A 3K1IC 1CPRA 1Z7Qc 1NU7D 2QLAA 3AG4C 1PD1A 3FXHA 3JSEO 5KYXB 1BR1A 2F22A 1T6IA 2D4UA 2XL4A 3CZ6A 3ZWIA 4E7SA 5E33A 1MMDA 1OW6A 4KNWA 4XPYA 1M2VB 2R25A 2VCAA 4RDAA 3SNHA 3C62A 4J32B 1XZPA 3WAQA 4ONSA 3HJCA 1D0XA 4O6YA 4OIOF 2YEVA 4IJJA 5CI9A 1JOGA 5A6JA 1EKYA 4AX2A 1SZIA 2J0XA 3ZIBA 2YLIA 1Q0KA 4IARA 3BRJA 2Q7RA 3ECSA 3X2QC 5L0CA 4NCQA 2OU6A 3EHNA 5T3WA 3JRMO 5AGFA 4YWQA 3RIPA 1RMVA 4EUKB 5B3IA 3BEHA 1Z6AA 2OEVA 2R7RA 1HE9A 4FESA 4NC3A 4XEVA 4FX5A 3L1MA 1EQ1A 1YZCA 4KNVA 4MVUA 2P0NA 1OCCC 3F47A 1RKEB 3GEHA 2LCHA 1HW2A 3S29A 1Q0FA 1C02A 1D0YA 2EPLX 3L0IA 2VCCA 3Q6NA 4LLCA 2ZPAA 4JIOA 1LI7A 2P7VA 4G78A 4JEAA 3N2ZB 1HY5A 3EH1A 4K1OA 1Y6DA 1FAPB 3A9CA 3C8GB 4ULWA 3NYMA 3IQTA 1ORJA 4I1OB 4U5DE 5KYUA 3HTKC 1LIHA 2KW3C 2L6HA 1CGOA 1O87A 1VOMA 2QNLA 3K1IA 3M4BA 4XLNF 4RBNA 3DJNB 4NQFA 2O9XA 1OCRC 4E18A 5EHHA 2NSFA 5DQZA 2J9UA 1TWHA 3L8JA 2P6VA 4IGGA 4JVSA 3DXJF 3ZQYA 2DYRC 2ETSA 4BEJA 1MMNA 4DRJB 3LS0A 1WTYA 2R7WA 2HV6A 3TULA 5B3SC 1ZVZA 2PP4A 4E0IA 5BQHA 3B0UX 4U5CE 4IAOA 1OCZC 5JS5A 5BQIA 2YRFA 2ZXOA 1TKNA 1YYXA 4JZAA 2J46A 2A0UA 5COFA 4KI2A 1Q0DA 3U9JA 3E9VA 3M4CA 1D1CA 4K0DA 3S84A 2QTVA 4W8PA 2KC3A 3H2UA 4YT8A 3UGPA 1L3PA 2CNWA 4JW1A 2X0CA 3C7JA 4PJNA 2BC5A 2YLDA 3DE8A 2WZFA 2G3KA 4YL0A 2HJMA 2B0HA 2G3VA 2LSEA 4MTFA 2VCBA 3DJUB 5JVEA 2PX0A 1J8YF 3GWLA 4CSAA 5A6KA 2LP4A 1MMGA 2YQYA 2ZXRA 4MS2A 1JAFA 3AGUA 2OCCC 2R7VA 1A0BA 4BPMA 3RQFA 1M2OA 3EH2A 1YJGA 256BA 3ABLC 4ER9A 5AC4A 4JC7A 4PFPA 5KYYB 5T1DB 1UFBA 2XLOA 1HW1A 2VASA 3T6BA 5F28E 3V7OA 3PHF2 3DKAA 4U9DA 1QZXA 2OG2A 2CYDA 3E70C 4BJ5A 2FAPB 4PJJA 1AVOB 2GDCA 1QPUA 3L34A 3W8HA 1R4TA 2VH3A 1VK5A 4HFFB 5JT4A 3OWTA 4Z9IA 4WGYA 4JJGA 5A69A 3KKBA 1JR8A 3O39A 2W45A 4PJLA 4CDYA 1LS1A 2PF4E 4N6HA 2XS8A 2WZGA 4QDLA 4HFKB 4IAQA 3UNGC 4OD5A 4OD4A 4JCZA 2R7QA 3CSKA 1GS9A 2YKZA 4U5GA 5FZTA 2M4EA 1U0BB 1VYKA 4U5FE 4XTKA 3DM5A 1KTMA 3O6XA 3T9OA 2YLGA 4JE9A 1RCPA 5COGA 1WASA 2GWWA 2KK1A 3U2MA 4LLEA 3WODF 4C3BA 4AE4B 4MQ9F 2EINC 3EZIA 4C7OB 1UG7A 5DVWA 3LEVA 4DBRA 4JCHA 4MTGA 1TWCA 4LERA 3UMKA 1O5HA 2NUTB 1CGNA 4H54A 3W4YA 3ZSUA 5TJ5E 2QE9A 2Z15A 4EIYA 3AJMA 2NUPB 4M63A 3US6A 3SEOA 3L8IA 2J7PD 1APCA 2NG1A 1BZ4A 2X51A 3DD7A 3MFNA 5KYWA 3Q7LA 4X0RA 3GORA 2KNHA 4I44A 2LQGA 3FVYA 3OEOA 1MNDA 2Q9BA 4J7TA 1QVXA 4P6IC 4PFOA 2EPMX 2HMQA 4C3DA 2ZXWC 1A7VA 1A7DA 1T6UA 2R02A 4YK5A 5L3QA 1YLMA 1BDJB 3AOUA 1NLXA 1PD0A 3G4ZA 3GODA 5B1BC 4XQ1A 1E86A 3ZTZA 4G0HA 3EFOA 3PCVA 3I5QA 4CS9A 3Q7GA 4P9TA 5KYUB 2RD9A 1G8XA 3DAGA 4U5HA 4JJFA 4MNDA 3JYHA 1NSGB 3JTLO 3TOLA 3JT1A 5DLJA 5GPGB 5JRAA 3IQCA 1L7CA 1U6HA 4U9EA 2AWYA 2Y3BA 1Q0MA 3GM2A 2DI3A 1M6TA 1FMVA 1ZHWA 1G5ZA 3R2PA 3LLKA 4O7GA 4EKWA 1F1MA 1BR2A 2A6HF 2BL2A 3WG7C 1HMOA 2H7BA 3WHNA 1V4AA 3SZRA 2ASRA 1RKCA 1QLEC 2LD6A 3EJNA 4A4AA 3U8VA 4CX9A 1MNEA 2EIMC 3AGTA 4U5BE 3J06A 1SYQA 1IW7F 3EGXA 4CSAC 3G50A 3K6BA 3RH3A 2JD3A 1BR4A 2LK4A 3A11A 4EWCA 1JPJA 3LS1A 3I5PA 3H65A 1J8MF 3FOOA 2HMZA 2XRHA 3KMIA 5L0HA 3M79A 3B71A 3RFYA 1C17M 3SXKA 3SXYA 3ZTMA 1NG1A 3CQZA 4BJ1A 4E0HA 5AC5A 2P61A 3KH2A 2V3CC 3OA1A 2XLMA 3VRCA 2XXAA 2DGJA 3VAYA 3R7CA 3X1OA 3T6GB 1M57C 4KC9A 4BJ5C 5B1AC 1FTSA 1JRAA 1A41A 3LLIA 1DOVA 3RQGA 4JKVA 1VB5A 4YL1A 3EHMA 5L0FA 1S05A 1VMAA 4GQHA 2HZ8A 4D4XA 4CS7A 3FOPA 3IPMO 2HFIA 3NYJA 5JUAA 5KYXA 4FAPB 4WJ0A 1TFKB 1RJ9A 1VYIA 1D1AA 3QZCA 3UMIA 3LAYA 3FMSA 3DWWA 3M1CB 2J9VA 4Z9JA 2ZD9A 5D91A 4K7BA 3SXMA 5E2QA 3EGDB 4XEFA 2J9WA 3ABKC 1A7EA 4CIPA 2IXOA 1M56C 1E2XA 3V5ZA 2R9RB 3W8IA 4ANJA 1DOWA 3M15A 5JLIA 5F5FA 4CBEA 1LS4A 3AQBA 2R7UA 1W2WA 2XM0A 1HMDA 3U8PA 2DB4A 1SMYF 4PR9A 2A6EF 2YWAA 5CI8A 1H7IA 4Q5SF 4ZLDA 2NPUA 4HEAJ 1ZW2A 4N06A 2R7SA 1I5NA 4LACB 3U3BA 1JPNA 2Q3TA 2AVKA 3ASNC 3F46A 1NBBA 2YL0A 5EGYA 1V54C 4MVOA 2H8AA 1ORYA 4XPWA 4AL1A 4DRIB 1FFTC 3DI5A 3QMKA 4I1MA 3V5YA 2ZXPA 2WL8A 1MQVA 1QQ3A 3ITFA 1YAUO 2L9JA 3PMRA 3UGOA 4Q4ZF 2UUIA 5DS5A 3Q6MA 1T6QA 2FGYA 1KNYA 3LNMB 5DS6A 2ICWG 4DXWA 3GWNA 3JCUQ 2HUJA 3S9OA 1K05A 3TJ5A 3IHUA 4DOZA 2CGEA 4CS9C 3V5XA 2OEXA 2D5RB 2YL7A 3S0XA 3PDMP 5IY5C 1O3UA 1EA8A 2WVOA 3DE9A 2AP3A 4ULVA 4DRHB 1YZAA 2OJQA 2EIKC 2XL6A 2W4MA 3C8GD 3HKKA 3NDBB 1Z3IX 2J0WA 2Y3DA 4BEMJ 3FAPB 3FAJA 1E85A 1AEPA 2XM4A 2PFDA 1V55C 3IQ6A 3MX3A 1H9GA 3QVYA 1LI5A 1Q0GA 3VYWA 3MYIA 3HNKA 2KSFA 1ZYRF 1WGWA 3K66A 3NYLA 2A69F 1ZHXA 2J7PA 3JRTA 4BG0A 5FCLA 2R03A 3IQ5A 1TR2A 1YVIA 4GEHA 1GGQA 3CAXA 4MVZA 4J7YA 2IXNA 1NFNA 3H2VA 4YT2A 2CW0F 2QY9A 2IXMA 4MVRA 2PX3A 4E17A 2W9YA 2RSEB 3HNIA 3QVZA 4R32A 5HV9A 5EK0A 1C03A 2YVKA 2XSEA 4Z9HA 2P1AA 2J45A 3GEEA 1ORSC 3LUTB 2JPUA 3JYYA 3RVYA 4JTAB 4WGZA 1QSPA 1T5OA 1K40A 2A68F 2MHRA 1OR3A 3LEOA 2YZSA 4JURI 4JRZA 4PACA 3ZC4A 5L0JA 2M64A 4H4KC 1Z5ZA 3S90A 3AG1C 1TWAA 4Q7CA 3DMDA 1VLTA 1YDIA 2EIJC 4AK9A 2WVQA 4DBQA 4EBKA 3KYIA 1SR2A 1WATA 2E87A 5HSWA 1VTMP 2NSGA 1OCOC 2WB7A 2YL1A 3NMKA 5BQGA 3RVZA 3TQOA 5KYYA 2WVNA 3QW1A 3EQLF 4EBBA 1OQCA 3KL4A 4W8KA 3QW0A 4HE8D 4YL3A 3B0VC 2OJED 3O55A 1Z63A 2Y3HA 1OKKD 4XPXA
chains in the Genus database with same CATH topology
1C03A 3US6A 2Q4FA 2OOCA 1I5NA 1QSPA 3U3BA 2A0BA 4EUKB 4PACA 2LP4A 2LD6A 1OXKA 3KYJA 1A0BA 2LCHA 1TQGA 2R25A 1BDJB 3KYIA 1C02A 1SR2A 4G78A 1OXBA 1Y6DA 1YVIA 3IQTA 1FR0A 3MYFA 1WN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C03 A;  3US6 A;  2Q4F A;  2OOC A;  1I5N A;  1QSP A;  3U3B A;  2A0B A;  4EUK B;  4PAC A;  2LP4 A;  2LD6 A;  1OXK A;  3KYJ A;  1A0B A;  2LCH A;  1TQG A;  2R25 A;  1BDJ B;  3KYI A;  1C02 A;  1SR2 A;  4G78 A;  1OXB A;  1Y6D A;  1YVI A;  3IQT A;  1FR0 A;  3MYF A;  1WN0 A; 
#chains in the Genus database with same CATH topology
 3NG1 A;  3RW0 A;  1BBH A;  3ABM C;  4A2N B;  4LDK A;  1ZHT A;  2L6F A;  3ATP A;  2W4B A;  3MBG A;  4YN0 B;  3DAF A;  2Q4F A;  2XLH A;  3LJB A;  4NTF A;  3ZG1 A;  4YT5 A;  3W2V A;  1H9T A;  3EPV A;  2A0B A;  1T9K A;  2EPO A;  3W2W A;  1PV3 A;  3FDQ A;  1R5I D;  4BJ6 A;  3EG9 A;  3RKO F;  1NU9 C;  1RJ9 B;  5KYN A;  1SF8 A;  3ZVR A;  4IWB A;  2VC9 A;  1OW8 A;  4O6M A;  2GFH A;  3CEX A;  1ZU5 A;  5A6B D;  1JMW A;  2MWQ A;  2XLV A;  3U2L A;  2XLE A;  3U3F A;  2OKU A;  4FWV A;  1AUE A;  4JEB A;  3VF0 A;  4XLP F;  3G4X A;  4WAB A;  4OIQ F;  3HNJ A;  4L6R A;  1ZW3 A;  4MVS A;  3VM6 A;  4E7Z A;  4AE4 A;  3DZA A;  4C7O A;  2V26 A;  1GQA A;  2J8W A;  2LIG A;  4B6I A;  3T6J A;  3B29 A;  4CS8 C;  5L3V A;  3SXZ A;  2R7X A;  2NUT A;  2PNO A;  3JSZ A;  3EZH A;  3C18 A;  2NUP A;  1FFH A;  3K33 A;  1YAR O;  1D0Z A;  1I4Z A;  2A1D D;  3NMJ A;  1D1B A;  2EPK X;  2KYH A;  3LES A;  2L7A A;  3N24 A;  2LFD A;  4G7H F;  5L0I A;  2IOQ A;  1OXK A;  2QUP A;  1YYJ A;  2HKV A;  4NTB A;  1YA7 O;  4XEK A;  4MVM A;  3TOM A;  4JTD B;  4U5E E;  2OQM A;  1G4W R;  3JZ0 A;  3TK0 A;  1FMW A;  2HJ3 A;  2HS5 A;  4F4B A;  4CIH A;  1M2V A;  1LKX A;  1EI7 A;  5JP7 A;  4EBJ A;  4O6N A;  5K0I A;  2GAQ A;  1ZU4 A;  2CDQ A;  2C04 A;  5DQT A;  4LDQ A;  1ZHZ A;  1HE1 A;  2HSB A;  2HSQ A;  2Y3G A;  4QI0 A;  1ZHY A;  4I3M A;  3NKE A;  2Q9A A;  4OIR F;  1LPE A;  3FHD A;  3S28 A;  1MMA A;  1ZZP A;  4BJT A;  4DJ9 A;  5E3A A;  1K04 A;  3B9Q A;  4G7O F;  1OR2 A;  3K1H A;  2IXP A;  4YT4 A;  2R7O A;  1N1C A;  3RQE A;  1OW7 A;  2YHS A;  5JSL A;  5L0G A;  2EPN A;  5COM A;  4IB4 A;  4LDR A;  3HLZ A;  3KYJ A;  4N6C A;  4PK4 A;  4QI2 A;  1YA9 A;  3ZQV A;  5A6A A;  1I4Y A;  1LE4 A;  4MW3 A;  4EHP A;  1RKE A;  2BE5 F;  3GM1 A;  3MLG A;  2R05 A;  3DM9 B;  1XWJ A;  1OXB A;  2H7O A;  3GAN A;  4CS8 A;  1Z23 A;  2IM8 A;  2C03 A;  3NMI A;  4ZLC A;  2Y69 C;  3NRH A;  1CPQ A;  4KBL A;  4MW8 A;  3C8Z A;  3C8G A;  1B68 A;  2CCY A;  4MTO A;  4N4W A;  1LE2 A;  3SP1 A;  1IZM A;  4C3E A;  4CJO A;  2J9B A;  1WWP A;  4YJW A;  1Y4C A;  2VB6 A;  2OOC A;  3AG3 C;  2Y39 A;  4AL0 A;  4CDV A;  4OIN F;  4DVY P;  5L0D A;  5KYW B;  1E83 A;  2G62 A;  5D92 A;  2GA0 A;  4CJG A;  1GM5 A;  2XLW A;  1E84 A;  3QTH A;  3O10 A;  3AG2 C;  2XL8 A;  1VLS A;  1XZQ A;  2CNW D;  2L6G A;  4OIP F;  3N0T A;  2Q00 A;  4DVZ A;  3KPH A;  1TQG A;  4NY3 A;  3TD7 A;  3SYN A;  2Q9C A;  1TWG A;  2LFF A;  3AQC A;  3EFO B;  4NTA A;  4BJ6 C;  1ST6 A;  2WZL A;  2KJG A;  1LVK A;  1WOL A;  3EGD A;  4P9F A;  5DS4 A;  2KQ9 A;  2XLD A;  1TFO B;  3K7D A;  1FR0 A;  2DYS C;  3ZDL A;  4GYT A;  3LNR A;  1U89 A;  3MYF A;  2JX0 A;  2KGO A;  2EIL C;  4IRU A;  2L81 A;  5F5H A;  1PCX A;  5E3C A;  3UMH A;  1RXQ A;  3GM3 A;  5T3T A;  4D4N A;  4G7Z F;  2MYS A;  3ASO C;  3POV A;  3EG9 B;  3HNL A;  2PBE A;  1V74 B;  3TJ6 A;  1KU2 A;  2I15 A;  3T4R A;  1G4U S;  2IBF A;  1NFO A;  1OKK A;  3C63 A;  3EGX B;  2YL3 A;  4JTC B;  3I4U A;  4MVQ A;  3U0C A;  1NZE A;  2R7T A;  3U9M A;  3RF3 A;  4PJM A;  1LM3 B;  2H7V C;  2HV7 A;  1T01 A;  3RYL A;  2B0J A;  3GEI A;  3NKD A;  3U5S A;  2FFH A;  4CDA A;  2IYL D;  4J30 B;  3B0P A;  2TMV P;  5BUO A;  1S7Z A;  3UR3 C;  2AWC A;  1QKR A;  2I8B A;  2UUH A;  3IEE A;  2XXA B;  1WN0 A;  1H6G A;  4O79 A;  4UDV A;  2XS1 A;  4RD9 A;  1FNT c;  2AU5 A;  5CIV A;  5A6B A;  4XWJ A;  1CGM E;  3S27 A;  3K1I C;  1CPR A;  1Z7Q c;  1NU7 D;  2QLA A;  3AG4 C;  1PD1 A;  3FXH A;  3JSE O;  5KYX B;  1BR1 A;  2F22 A;  1T6I A;  2D4U A;  2XL4 A;  3CZ6 A;  3ZWI A;  4E7S A;  5E33 A;  1MMD A;  1OW6 A;  4KNW A;  4XPY A;  1M2V B;  2R25 A;  2VCA A;  4RDA A;  3SNH A;  3C62 A;  4J32 B;  1XZP A;  3WAQ A;  4ONS A;  3HJC A;  1D0X A;  4O6Y A;  4OIO F;  2YEV A;  4IJJ A;  5CI9 A;  1JOG A;  5A6J A;  1EKY A;  4AX2 A;  1SZI A;  2J0X A;  3ZIB A;  2YLI A;  1Q0K A;  4IAR A;  3BRJ A;  2Q7R A;  3ECS A;  3X2Q C;  5L0C A;  4NCQ A;  2OU6 A;  3EHN A;  5T3W A;  3JRM O;  5AGF A;  4YWQ A;  3RIP A;  1RMV A;  4EUK B;  5B3I A;  3BEH A;  1Z6A A;  2OEV A;  2R7R A;  1HE9 A;  4FES A;  4NC3 A;  4XEV A;  4FX5 A;  3L1M A;  1EQ1 A;  1YZC A;  4KNV A;  4MVU A;  2P0N A;  1OCC C;  3F47 A;  1RKE B;  3GEH A;  2LCH A;  1HW2 A;  3S29 A;  1Q0F A;  1C02 A;  1D0Y A;  2EPL X;  3L0I A;  2VCC A;  3Q6N A;  4LLC A;  2ZPA A;  4JIO A;  1LI7 A;  2P7V A;  4G78 A;  4JEA A;  3N2Z B;  1HY5 A;  3EH1 A;  4K1O A;  1Y6D A;  1FAP B;  3A9C A;  3C8G B;  4ULW A;  3NYM A;  3IQT A;  1ORJ A;  4I1O B;  4U5D E;  5KYU A;  3HTK C;  1LIH A;  2KW3 C;  2L6H A;  1CGO A;  1O87 A;  1VOM A;  2QNL A;  3K1I A;  3M4B A;  4XLN F;  4RBN A;  3DJN B;  4NQF A;  2O9X A;  1OCR C;  4E18 A;  5EHH A;  2NSF A;  5DQZ A;  2J9U A;  1TWH A;  3L8J A;  2P6V A;  4IGG A;  4JVS A;  3DXJ F;  3ZQY A;  2DYR C;  2ETS A;  4BEJ A;  1MMN A;  4DRJ B;  3LS0 A;  1WTY A;  2R7W A;  2HV6 A;  3TUL A;  5B3S C;  1ZVZ A;  2PP4 A;  4E0I A;  5BQH A;  3B0U X;  4U5C E;  4IAO A;  1OCZ C;  5JS5 A;  5BQI A;  2YRF A;  2ZXO A;  1TKN A;  1YYX A;  4JZA A;  2J46 A;  2A0U A;  5COF A;  4KI2 A;  1Q0D A;  3U9J A;  3E9V A;  3M4C A;  1D1C A;  4K0D A;  3S84 A;  2QTV A;  4W8P A;  2KC3 A;  3H2U A;  4YT8 A;  3UGP A;  1L3P A;  2CNW A;  4JW1 A;  2X0C A;  3C7J A;  4PJN A;  2BC5 A;  2YLD A;  3DE8 A;  2WZF A;  2G3K A;  4YL0 A;  2HJM A;  2B0H A;  2G3V A;  2LSE A;  4MTF A;  2VCB A;  3DJU B;  5JVE A;  2PX0 A;  1J8Y F;  3GWL A;  4CSA A;  5A6K A;  2LP4 A;  1MMG A;  2YQY A;  2ZXR A;  4MS2 A;  1JAF A;  3AGU A;  2OCC C;  2R7V A;  1A0B A;  4BPM A;  3RQF A;  1M2O A;  3EH2 A;  1YJG A;  256B A;  3ABL C;  4ER9 A;  5AC4 A;  4JC7 A;  4PFP A;  5KYY B;  5T1D B;  1UFB A;  2XLO A;  1HW1 A;  2VAS A;  3T6B A;  5F28 E;  3V7O A;  3PHF 2;  3DKA A;  4U9D A;  1QZX A;  2OG2 A;  2CYD A;  3E70 C;  4BJ5 A;  2FAP B;  4PJJ A;  1AVO B;  2GDC A;  1QPU A;  3L34 A;  3W8H A;  1R4T A;  2VH3 A;  1VK5 A;  4HFF B;  5JT4 A;  3OWT A;  4Z9I A;  4WGY A;  4JJG A;  5A69 A;  3KKB A;  1JR8 A;  3O39 A;  2W45 A;  4PJL A;  4CDY A;  1LS1 A;  2PF4 E;  4N6H A;  2XS8 A;  2WZG A;  4QDL A;  4HFK B;  4IAQ A;  3UNG C;  4OD5 A;  4OD4 A;  4JCZ A;  2R7Q A;  3CSK A;  1GS9 A;  2YKZ A;  4U5G A;  5FZT A;  2M4E A;  1U0B B;  1VYK A;  4U5F E;  4XTK A;  3DM5 A;  1KTM A;  3O6X A;  3T9O A;  2YLG A;  4JE9 A;  1RCP A;  5COG A;  1WAS A;  2GWW A;  2KK1 A;  3U2M A;  4LLE A;  3WOD F;  4C3B A;  4AE4 B;  4MQ9 F;  2EIN C;  3EZI A;  4C7O B;  1UG7 A;  5DVW A;  3LEV A;  4DBR A;  4JCH A;  4MTG A;  1TWC A;  4LER A;  3UMK A;  1O5H A;  2NUT B;  1CGN A;  4H54 A;  3W4Y A;  3ZSU A;  5TJ5 E;  2QE9 A;  2Z15 A;  4EIY A;  3AJM A;  2NUP B;  4M63 A;  3US6 A;  3SEO A;  3L8I A;  2J7P D;  1APC A;  2NG1 A;  1BZ4 A;  2X51 A;  3DD7 A;  3MFN A;  5KYW A;  3Q7L A;  4X0R A;  3GOR A;  2KNH A;  4I44 A;  2LQG A;  3FVY A;  3OEO A;  1MND A;  2Q9B A;  4J7T A;  1QVX A;  4P6I C;  4PFO A;  2EPM X;  2HMQ A;  4C3D A;  2ZXW C;  1A7V A;  1A7D A;  1T6U A;  2R02 A;  4YK5 A;  5L3Q A;  1YLM A;  1BDJ B;  3AOU A;  1NLX A;  1PD0 A;  3G4Z A;  3GOD A;  5B1B C;  4XQ1 A;  1E86 A;  3ZTZ A;  4G0H A;  3EFO A;  3PCV A;  3I5Q A;  4CS9 A;  3Q7G A;  4P9T A;  5KYU B;  2RD9 A;  1G8X A;  3DAG A;  4U5H A;  4JJF A;  4MND A;  3JYH A;  1NSG B;  3JTL O;  3TOL A;  3JT1 A;  5DLJ A;  5GPG B;  5JRA A;  3IQC A;  1L7C A;  1U6H A;  4U9E A;  2AWY A;  2Y3B A;  1Q0M A;  3GM2 A;  2DI3 A;  1M6T A;  1FMV A;  1ZHW A;  1G5Z A;  3R2P A;  3LLK A;  4O7G A;  4EKW A;  1F1M A;  1BR2 A;  2A6H F;  2BL2 A;  3WG7 C;  1HMO A;  2H7B A;  3WHN A;  1V4A A;  3SZR A;  2ASR A;  1RKC A;  1QLE C;  2LD6 A;  3EJN A;  4A4A A;  3U8V A;  4CX9 A;  1MNE A;  2EIM C;  3AGT A;  4U5B E;  3J06 A;  1SYQ A;  1IW7 F;  3EGX A;  4CSA C;  3G50 A;  3K6B A;  3RH3 A;  2JD3 A;  1BR4 A;  2LK4 A;  3A11 A;  4EWC A;  1JPJ A;  3LS1 A;  3I5P A;  3H65 A;  1J8M F;  3FOO A;  2HMZ A;  2XRH A;  3KMI A;  5L0H A;  3M79 A;  3B71 A;  3RFY A;  1C17 M;  3SXK A;  3SXY A;  3ZTM A;  1NG1 A;  3CQZ A;  4BJ1 A;  4E0H A;  5AC5 A;  2P61 A;  3KH2 A;  2V3C C;  3OA1 A;  2XLM A;  3VRC A;  2XXA A;  2DGJ A;  3VAY A;  3R7C A;  3X1O A;  3T6G B;  1M57 C;  4KC9 A;  4BJ5 C;  5B1A C;  1FTS A;  1JRA A;  1A41 A;  3LLI A;  1DOV A;  3RQG A;  4JKV A;  1VB5 A;  4YL1 A;  3EHM A;  5L0F A;  1S05 A;  1VMA A;  4GQH A;  2HZ8 A;  4D4X A;  4CS7 A;  3FOP A;  3IPM O;  2HFI A;  3NYJ A;  5JUA A;  5KYX A;  4FAP B;  4WJ0 A;  1TFK B;  1RJ9 A;  1VYI A;  1D1A A;  3QZC A;  3UMI A;  3LAY A;  3FMS A;  3DWW A;  3M1C B;  2J9V A;  4Z9J A;  2ZD9 A;  5D91 A;  4K7B A;  3SXM A;  5E2Q A;  3EGD B;  4XEF A;  2J9W A;  3ABK C;  1A7E A;  4CIP A;  2IXO A;  1M56 C;  1E2X A;  3V5Z A;  2R9R B;  3W8I A;  4ANJ A;  1DOW A;  3M15 A;  5JLI A;  5F5F A;  4CBE A;  1LS4 A;  3AQB A;  2R7U A;  1W2W A;  2XM0 A;  1HMD A;  3U8P A;  2DB4 A;  1SMY F;  4PR9 A;  2A6E F;  2YWA A;  5CI8 A;  1H7I A;  4Q5S F;  4ZLD A;  2NPU A;  4HEA J;  1ZW2 A;  4N06 A;  2R7S A;  1I5N A;  4LAC B;  3U3B A;  1JPN A;  2Q3T A;  2AVK A;  3ASN C;  3F46 A;  1NBB A;  2YL0 A;  5EGY A;  1V54 C;  4MVO A;  2H8A A;  1ORY A;  4XPW A;  4AL1 A;  4DRI B;  1FFT C;  3DI5 A;  3QMK A;  4I1M A;  3V5Y A;  2ZXP A;  2WL8 A;  1MQV A;  1QQ3 A;  3ITF A;  1YAU O;  2L9J A;  3PMR A;  3UGO A;  4Q4Z F;  2UUI A;  5DS5 A;  3Q6M A;  1T6Q A;  2FGY A;  1KNY A;  3LNM B;  5DS6 A;  2ICW G;  4DXW A;  3GWN A;  3JCU Q;  2HUJ A;  3S9O A;  1K05 A;  3TJ5 A;  3IHU A;  4DOZ A;  2CGE A;  4CS9 C;  3V5X A;  2OEX A;  2D5R B;  2YL7 A;  3S0X A;  3PDM P;  5IY5 C;  1O3U A;  1EA8 A;  2WVO A;  3DE9 A;  2AP3 A;  4ULV A;  4DRH B;  1YZA A;  2OJQ A;  2EIK C;  2XL6 A;  2W4M A;  3C8G D;  3HKK A;  3NDB B;  1Z3I X;  2J0W A;  2Y3D A;  4BEM J;  3FAP B;  3FAJ A;  1E85 A;  1AEP A;  2XM4 A;  2PFD A;  1V55 C;  3IQ6 A;  3MX3 A;  1H9G A;  3QVY A;  1LI5 A;  1Q0G A;  3VYW A;  3MYI A;  3HNK A;  2KSF A;  1ZYR F;  1WGW A;  3K66 A;  3NYL A;  2A69 F;  1ZHX A;  2J7P A;  3JRT A;  4BG0 A;  5FCL A;  2R03 A;  3IQ5 A;  1TR2 A;  1YVI A;  4GEH A;  1GGQ A;  3CAX A;  4MVZ A;  4J7Y A;  2IXN A;  1NFN A;  3H2V A;  4YT2 A;  2CW0 F;  2QY9 A;  2IXM A;  4MVR A;  2PX3 A;  4E17 A;  2W9Y A;  2RSE B;  3HNI A;  3QVZ A;  4R32 A;  5HV9 A;  5EK0 A;  1C03 A;  2YVK A;  2XSE A;  4Z9H A;  2P1A A;  2J45 A;  3GEE A;  1ORS C;  3LUT B;  2JPU A;  3JYY A;  3RVY A;  4JTA B;  4WGZ A;  1QSP A;  1T5O A;  1K40 A;  2A68 F;  2MHR A;  1OR3 A;  3LEO A;  2YZS A;  4JUR I;  4JRZ A;  4PAC A;  3ZC4 A;  5L0J A;  2M64 A;  4H4K C;  1Z5Z A;  3S90 A;  3AG1 C;  1TWA A;  4Q7C A;  3DMD A;  1VLT A;  1YDI A;  2EIJ C;  4AK9 A;  2WVQ A;  4DBQ A;  4EBK A;  3KYI A;  1SR2 A;  1WAT A;  2E87 A;  5HSW A;  1VTM P;  2NSG A;  1OCO C;  2WB7 A;  2YL1 A;  3NMK A;  5BQG A;  3RVZ A;  3TQO A;  5KYY A;  2WVN A;  3QW1 A;  3EQL F;  4EBB A;  1OQC A;  3KL4 A;  4W8K A;  3QW0 A;  4HE8 D;  4YL3 A;  3B0V C;  2OJE D;  3O55 A;  1Z63 A;  2Y3H A;  1OKK D;  4XPX A; 
#chains in the Genus database with same CATH homology
 1C03 A;  3US6 A;  2Q4F A;  2OOC A;  1I5N A;  1QSP A;  3U3B A;  2A0B A;  4EUK B;  4PAC A;  2LP4 A;  2LD6 A;  1OXK A;  3KYJ A;  1A0B A;  2LCH A;  1TQG A;  2R25 A;  1BDJ B;  3KYI A;  1C02 A;  1SR2 A;  4G78 A;  1OXB A;  1Y6D A;  1YVI A;  3IQT A;  1FR0 A;  3MYF A;  1WN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...