2LCHA

Solution nmr structure of a protein with a redesigned hydrophobic core, northeast structural genomics consortium target or38
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
b'MGSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRELDKKVSGSYLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein OR38
publication title Solution NMR Structure of a Protein With a Redesigned Hydrophobic Core, Northeast Structural Genomics Consortium Target OR38
rcsb
source organism Thermotoga maritima
molecule tags De novo protein
total genus 42
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2lchA00
1C03A 3US6A 1Y6DA 2LP4A 2R25A 1WN0A 1OXBA 1BDJB 4G78A 1SR2A 2LCHA 1OXKA 3KYIA 4EUKB 1C02A 3U3BA 3MYFA 4PACA 1A0BA 2LD6A 1TQGA 1FR0A 1QSPA 3KYJA 2A0BA 3IQTA 2OOCA 1I5NA 1YVIA 2Q4FA
chains in the Genus database with same CATH superfamily
3VM6A 1R5ID 3T4RA 4YWQA 3HNIA 1V4AA 3H2UA 1QZXA 2R05A 1WN0A 3L8JA 1OXBA 2JD3A 4M63A 3K66A 3M4BA 3EGDB 3U2MA 5CI8A 3BRJA 3C7JA 2VC9A 4JJFA 3T6JA 3CZ6A 2L6HA 2NSGA 2YL1A 3KYIA 4CJGA 3FAPB 1N1CA 1JPNA 2KQ9A 4JC7A 3UR3C 4XLPF 2TMVP 4JTAB 1UG7A 1FFHA 2Q9AA 5COGA 4YL3A 1MQVA 2GDCA 2IM8A 3ASNC 4XPWA 4PK4A 2YEVA 1QQ3A 3GODA 4XLNF 2KNHA 3T6GB 5K0IA 1XWJA 4MW8A 3U8PA 1OCZC 1YVIA 4BJ1A 5KYXB 2DYRC 2XLHA 2YLIA 1M57C 4YN0B 1K05A 5L0JA 2EPKX 2W4MA 2Y3DA 5JT4A 4MS2A 3O55A 2Q7RA 3W4YA 2V3CC 1T9KA 1HW2A 3ZQVA 1LI5A 4JRZA 1CGOA 3B29A 3OEOA 3V5XA 3X1OA 3ATPA 4AX2A 3UNGC 1YLMA 3VYWA 2LFDA 2OG2A 4EHPA 4KNWA 1FFTC 5KYWB 4NY3A 3U3BA 4YT2A 2KK1A 5IY5C 2A69F 2J8WA 4PACA 1OQCA 1DOVA 1O3UA 1VLTA 2XLVA 3TD7A 3GEHA 3SXZA 3ZWIA 3N0TA 4BG0A 2A6HF 3SXMA 1DOWA 2X0CA 1JRAA 3LNMB 4AE4B 4N06A 3KKBA 4L6RA 4LDRA 1A7DA 1QVXA 2Q4FA 1WGWA 2CCYA 1QKRA 3GORA 4DBQA 2OQMA 3RVYA 2Y3BA 1M2OA 2FFHA 3H2VA 1XZQA 2XS8A 3LNRA 4H54A 3L1MA 3S9OA 4D4NA 3FOOA 3A11A 1APCA 2OEVA 5DQTA 2DYSC 1TFOB 2UUHA 1ZZPA 2XM4A 3C18A 4LLCA 3EFOB 2HJ3A 1NFOA 1NU9C 5JRAA 3DWWA 1B68A 2L7AA 1OKKA 1IW7F 5L0DA 5L3VA 4JEBA 4ZLDA 1Z23A 2LQGA 2PF4E 1J8MF 2R9RB 2J9WA 3DE8A 4XPXA 3VAYA 2YRFA 4DJ9A 4Q5SF 3QVZA 1HW1A 5JSLA 2XLMA 1M6TA 4CIHA 2J0WA 5AC5A 2EPLX 2WVQA 4JIOA 4XEKA 3RVZA 1OKKD 4PJJA 4Z9IA 2J46A 5COFA 4CDAA 2XS1A 3QW1A 3S84A 3AG3C 2R7TA 4DVZA 1Y6DA 1HY5A 4H4KC 4NC3A 4BJ5C 4E17A 2W45A 1ZVZA 5A6BA 1ZHZA 3SNHA 3VRCA 3FAJA 2CW0F 2EIKC 4MVSA 1U0BB 5A69A 2HV7A 1OR2A 2J7PA 3RFYA 1L3PA 3L0IA 1CGME 4G0HA 4J32B 3RKOF 2DGJA 2YQYA 5A6BD 4MVZA 2ZXOA 1NSGB 3MFNA 2BL2A 4XQ1A 4MW3A 1CPRA 2XLDA 5A6JA 2OEXA 3JSZA 3QW0A 3VF0A 3DZAA 1LM3B 4I3MA 1D1CA 1T6QA 2IXNA 1E84A 5L0IA 2XXAA 4A2NB 5EK0A 1E2XA 2VCAA 2ZXRA 2UUIA 2OU6A 4NTAA 3K1IC 2PFDA 3DE9A 3POVA 3LUTB 1E83A 3GWNA 2IOQA 2OOCA 3Q7GA 4PJMA 3TOMA 5KYUA 2C03A 3MLGA 3O6XA 4D4XA 1SZIA 1FNTc 1TWAA 2XL6A 3MX3A 2HZ8A 5GPGB 3HJCA 5BQGA 1U89A 2EIJC 2YL3A 3H65A 1A41A 4FWVA 4C3DA 4OIOF 4PJLA 3AGUA 1SF8A 4U5CE 2YL0A 3DMDA 1ZU4A 2KGOA 3I5QA 3GM1A 4JKVA 4XEVA 5DS4A 1CPQA 4MVRA 2HS5A 1MMAA 1T01A 1Q0KA 3NRHA 2D5RB 4NTBA 4B6IA 4BJTA 4K7BA 4FAPB 1NZEA 5TJ5E 1UFBA 4EBJA 3AJMA 4RD9A 2AU5A 3DJNB 5EGYA 1TQGA 1MNDA 2BE5F 1WASA 3L34A 1MMNA 1WATA 2LSEA 4MNDA 1W2WA 1JOGA 2I8BA 2P7VA 3JTLO 3LLIA 1K40A 2AP3A 3ZVRA 4RBNA 4O79A 4U9EA 1RKEA 2EIMC 4A4AA 1OCRC 4MVOA 4JTCB 3LEOA 2P0NA 1G4WR 1LE4A 2J45A 5E3AA 1BR2A 3AOUA 1QLEC 1ZHTA 5JVEA 3FDQA 2AWYA 1FMWA 3NKDA 3JT1A 4PFOA 1H7IA 3NYJA 2FAPB 2EPMX 3ZTMA 4IAQA 4CS7A 1TR2A 2YHSA 256BA 2A6EF 2IYLD 3RH3A 3SEOA 2R02A 3LJBA 1RJ9B 2L9JA 2NSFA 4JZAA 2R7OA 2ICWG 1E86A 4O7GA 2WB7A 3AG1C 5JUAA 1AVOB 3KL4A 2DB4A 4IB4A 3U9MA 2VCBA 4HFKB 4U5FE 3SZRA 2YLGA 1HE9A 3HNKA 3OWTA 2ZXWC 2PX0A 2NUTA 3RQFA 1G5ZA 5DVWA 3W8HA 4U5DE 5L0HA 3JRTA 2A0UA 3U9JA 3US6A 5D91A 2L6GA 3EGXA 3ITFA 3N24A 2CNWA 2MHRA 4JVSA 1RKCA 4C7OA 3ABLC 3W2VA 4NCQA 4BJ6C 2XRHA 1YAUO 2RD9A 1D1AA 1H9GA 3EZIA 2CDQA 3F47A 4J7TA 2H7OA 4JURI 2GAQA 4JCZA 4K1OA 3C8GA 2WZLA 3IQCA 2EPNA 1ZHWA 1A7EA 3BEHA 2HSBA 4KBLA 3F46A 2CNWD 3HKKA 2OJED 1A7VA 4PJNA 5B1BC 3S28A 1KTMA 2HUJA 1AEPA 2P1AA 5CI9A 1LS4A 4EIYA 3MYFA 1YYXA 2VB6A 2A68F 3LS0A 4CS9C 2XLEA 3EPVA 5KYNA 1GS9A 4LDKA 1D1BA 3IQTA 3LAYA 2LIGA 4J7YA 4Z9HA 2L81A 2R7SA 2MWQA 2WVOA 3M79A 4EWCA 1BBHA 4ER9A 2YWAA 1YYJA 2G3KA 3GM3A 2HFIA 1EKYA 3IPMO 2H8AA 4OIPF 4CS8C 3ABKC 4ONSA 5DQZA 2HV6A 4YL1A 4JJGA 4BJ6A 3TJ6A 4ULWA 5B3IA 2ASRA 2NUPA 1YA7O 4OD5A 4JEAA 1PD1A 2Q9CA 1YJGA 1TWHA 3PCVA 4DRJB 1VOMA 1I4YA 4CSAC 1VLSA 3EG9A 1O87A 1M56C 2G62A 3S29A 3MBGA 4I44A 4G7ZF 4CDYA 2Y3GA 1O5HA 1I4ZA 4YK5A 2CGEA 3ZDLA 2AWCA 4QDLA 4YL0A 1GGQA 1ZHYA 2W9YA 5HV9A 1LPEA 5E3CA 2R25A 4Q7CA 4MVUA 4PFPA 5T1DB 5F5FA 2KYHA 3B71A 1BDJB 4U5EE 3WHNA 3GEIA 4O6MA 1Q0MA 3UMIA 3KH2A 3M15A 3G4ZA 3S0XA 2O9XA 2B0JA 3FHDA 4X0RA 4CIPA 5AC4A 2WZGA 4MVMA 4IRUA 3SXYA 4YT8A 4JTDB 3JYYA 4XPYA 1GQAA 4AL1A 1U6HA 3V5ZA 2JX0A 1WWPA 1JAFA 4MVQA 3HTKC 1H6GA 1BZ4A 4IARA 3IQ5A 3TULA 4YJWA 3SXKA 1A0BA 5EHHA 1AUEA 1Z3IX 5JS5A 2LD6A 2J7PD 3NMJA 3NMKA 1VK5A 5D92A 3MYIA 3J06A 1SMYF 3KYJA 1EA8A 2R7QA 3B0PA 2V26A 4MTOA 1MMDA 3C8GB 3DXJF 1FTSA 1C17M 2Y39A 3JSEO 1C03A 1CGNA 1PD0A 4LLEA 2I15A 3NMIA 4AK9A 4ULVA 3E70C 4BJ5A 3AG2C 3QZCA 1M2VA 4N6HA 3O39A 3ZTZA 2GFHA 2ZD9A 3ZQYA 2LCHA 2YZSA 2KC3A 3UGOA 1OR3A 2Q00A 3W2WA 2F22A 4CX9A 3B9QA 1C02A 4PR9A 4OINF 1TWGA 5T3WA 1VYKA 3GANA 3EHNA 1KNYA 1L7CA 1XZPA 3CSKA 3O10A 5FZTA 3JZ0A 4BEMJ 3B0VC 1LVKA 1S7ZA 2IXPA 3EH1A 4I1MA 1VTMP 2ETSA 4IAOA 4YT5A 2PP4A 2VH3A 3HNLA 2Q9BA 4U5BE 4E7SA 5A6AA 2Y3HA 3ABMC 3K1IA 4CDVA 1LI7A 4EKWA 4DVYP 4E0HA 3JRMO 3FMSA 4U5HA 2DI3A 2R7XA 1R4TA 3B0UX 3SYNA 1PV3A 3DJUB 2Z15A 3SP1A 3GEEA 4RDAA 1ZHXA 2GA0A 3EG9B 3Q7LA 5T3TA 1ORJA 1ZYRF 5L0GA 3U0CA 3UMHA 2ZPAA 1HE1A 5F28E 3S27A 5BQIA 4CBEA 3DM9B 2PBEA 3C63A 1VMAA 1PCXA 1Z5ZA 3IEEA 3PMRA 4YT4A 1T6UA 4UDVA 2R7WA 4JW1A 1FAPB 4KI2A 2IXMA 4LDQA 5B1AC 1JMWA 3KPHA 2LFFA 2QE9A 2R7RA 5DLJA 4Q4ZF 3LS1A 3TK0A 2QNLA 2A0BA 3ASOC 3K33A 3LESA 4J30B 2NG1A 3R2PA 4WGYA 3RF3A 3PHF2 3FOPA 5KYYB 2R7VA 1F1MA 4NQFA 2X51A 1ORSC 4FESA 3T6BA 4E18A 5FCLA 1LIHA 1YZCA 3EHMA 3W8IA 2HMQA 3RQGA 2AVKA 4IWBA 4AL0A 5DS6A 2H7VC 4O6YA 3ZC4A 2MYSA 2IXOA 2WL8A 1G4US 1LE2A 2Q3TA 2XXAB 1VB5A 2PNOA 2FGYA 4P9FA 4JE9A 3ZIBA 4BEJA 4C3EA 3UGPA 1WTYA 4O6NA 4OD4A 3FVYA 4QI2A 2R7UA 4N6CA 5F5HA 4K0DA 4DOZA 2G3VA 2D4UA 3DI5A 5KYUB 1NLXA 2YLDA 3RYLA 1ZU5A 3NYLA 3LEVA 3C62A 3C8GD 1FR0A 4IJJA 1M2VB 2A1DD 1OW7A 4ZLCA 2IBFA 3I4UA 2YVKA 2KSFA 3I5PA 2B0HA 1I5NA 4I1OB 3WG7C 5BUOA 3NDBB 4G7HF 2HSQA 1BR1A 3E9VA 4GQHA 4GYTA 3X2QC 3QVYA 2XLWA 2XSEA 4NTFA 3AQCA 3U3FA 2QUPA 1HMDA 4ANJA 1G8XA 1NBBA 4G78A 1RCPA 2M4EA 1GM5A 3TQOA 1SR2A 3V5YA 4U9DA 4Z9JA 4CJOA 1NU7D 1H9TA 3GM2A 2BC5A 2YL7A 1Z7Qc 2HMZA 3EJNA 4EUKB 5CIVA 1KU2A 2KJGA 2H7BA 5L0FA 2WZFA 1D0XA 1RKEB 5COMA 1EI7A 4BPMA 3TJ5A 4DXWA 3Q6MA 1EQ1A 4XTKA 4GEHA 3JCUQ 4CS9A 5E2QA 1D0YA 4HE8D 1TFKB 4MTGA 4WGZA 3RIPA 3K6BA 2J0XA 1VYIA 1YZAA 3GWLA 2JPUA 3C8ZA 3M1CB 3LLKA 2QLAA 3S90A 1HMOA 2LP4A 3L8IA 4XEFA 1K04A 3A9CA 1T5OA 4F4BA 3M4CA 2VCCA 3HLZA 1JPJA 3JYHA 4KNVA 3U8VA 4DBRA 3K7DA 4CS8A 1ZW2A 5AGFA 3NYMA 4W8KA 3AG4C 2R03A 4KC9A 4R32A 1OXKA 3DKAA 2NUTB 2OJQA 4DRIB 4U5GA 2EPOA 5E33A 2OKUA 1BR4A 4FX5A 3T9OA 3AQBA 2QTVA 1ORYA 3EGXB 4CSAA 1FMVA 1Y4CA 3EGDA 4C7OB 1YDIA 2HJMA 2LK4A 4G7OF 3IHUA 2W4BA 2GWWA 5L3QA 2Y69C 1V55C 2KW3C 1RJ9A 3RW0A 3DD7A 4EBKA 3EZHA 3N2ZB 5HSWA 3ZG1A 4MTFA 2C04A 3CAXA 4XWJA 1OCCC 5A6KA 4E0IA 3KMIA 1MNEA 3WODF 3ZSUA 3U5SA 2XLOA 2RSEB 1Q0GA 1V74B 1TWCA 2J9VA 4N4WA 2P61A 1LS1A 2J9UA 2WVNA 2XL8A 5KYXA 4P6IC 4E7ZA 2XL4A 4EBBA 3EH2A 2NPUA 4JCHA 1RXQA 5KYYA 2L6FA 3NKEA 3QMKA 1OW6A 1QPUA 1V54C 3NG1A 4LACB 5JP7A 3PDMP 1JR8A 3K1HA 2OCCC 1QSPA 3DM5A 1J8YF 4WJ0A 2M64A 2PX3A 2HKVA 3G4XA 3WAQA 2CYDA 5KYWA 4LERA 3V7OA 4IGGA 1Z63A 4HFFB 2NUPB 4W8PA 2P6VA 3U2LA 5B3SC 2ZXPA 3IQ6A 3QTHA 3DAGA 5JLIA 3EQLF 3RQEA 4C3BA 4WABA 1NG1A 4P9TA 1D0ZA 1Q0FA 5L0CA 1ST6A 4AE4A 2QY9A 1E85A 3OA1A 2EINC 1T6IA 1Z6AA 1ZW3A 2J9BA 3Q6NA 4MQ9F 3R7CA 3CQZA 4OIQF 1Q0DA 2YKZA 3HNJA 1MMGA 1NFNA 4QI0A 2XM0A 1YA9A 2E87A 1TKNA 2EILC 1RMVA 1OW8A 3TOLA 4HEAJ 1WOLA 1YARO 3EFOA 5BQHA 4OIRF 5DS5A 3DAFA 1SYQA 1S05A 1OCOC 3FXHA 1LKXA 3CEXA 3UMKA 3ECSA 4DRHB 2VASA 3G50A 3AGTA 1IZMA
chains in the Genus database with same CATH topology
1C03A 3US6A 1Y6DA 2LP4A 2R25A 1WN0A 1OXBA 1BDJB 4G78A 1SR2A 2LCHA 1OXKA 3KYIA 4EUKB 1C02A 3U3BA 3MYFA 4PACA 1A0BA 2LD6A 1TQGA 1FR0A 1QSPA 3KYJA 2A0BA 3IQTA 2OOCA 1I5NA 1YVIA 2Q4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C03 A;  3US6 A;  1Y6D A;  2LP4 A;  2R25 A;  1WN0 A;  1OXB A;  1BDJ B;  4G78 A;  1SR2 A;  2LCH A;  1OXK A;  3KYI A;  4EUK B;  1C02 A;  3U3B A;  3MYF A;  4PAC A;  1A0B A;  2LD6 A;  1TQG A;  1FR0 A;  1QSP A;  3KYJ A;  2A0B A;  3IQT A;  2OOC A;  1I5N A;  1YVI A;  2Q4F A; 
#chains in the Genus database with same CATH topology
 3VM6 A;  1R5I D;  3T4R A;  4YWQ A;  3HNI A;  1V4A A;  3H2U A;  1QZX A;  2R05 A;  1WN0 A;  3L8J A;  1OXB A;  2JD3 A;  4M63 A;  3K66 A;  3M4B A;  3EGD B;  3U2M A;  5CI8 A;  3BRJ A;  3C7J A;  2VC9 A;  4JJF A;  3T6J A;  3CZ6 A;  2L6H A;  2NSG A;  2YL1 A;  3KYI A;  4CJG A;  3FAP B;  1N1C A;  1JPN A;  2KQ9 A;  4JC7 A;  3UR3 C;  4XLP F;  2TMV P;  4JTA B;  1UG7 A;  1FFH A;  2Q9A A;  5COG A;  4YL3 A;  1MQV A;  2GDC A;  2IM8 A;  3ASN C;  4XPW A;  4PK4 A;  2YEV A;  1QQ3 A;  3GOD A;  4XLN F;  2KNH A;  3T6G B;  5K0I A;  1XWJ A;  4MW8 A;  3U8P A;  1OCZ C;  1YVI A;  4BJ1 A;  5KYX B;  2DYR C;  2XLH A;  2YLI A;  1M57 C;  4YN0 B;  1K05 A;  5L0J A;  2EPK X;  2W4M A;  2Y3D A;  5JT4 A;  4MS2 A;  3O55 A;  2Q7R A;  3W4Y A;  2V3C C;  1T9K A;  1HW2 A;  3ZQV A;  1LI5 A;  4JRZ A;  1CGO A;  3B29 A;  3OEO A;  3V5X A;  3X1O A;  3ATP A;  4AX2 A;  3UNG C;  1YLM A;  3VYW A;  2LFD A;  2OG2 A;  4EHP A;  4KNW A;  1FFT C;  5KYW B;  4NY3 A;  3U3B A;  4YT2 A;  2KK1 A;  5IY5 C;  2A69 F;  2J8W A;  4PAC A;  1OQC A;  1DOV A;  1O3U A;  1VLT A;  2XLV A;  3TD7 A;  3GEH A;  3SXZ A;  3ZWI A;  3N0T A;  4BG0 A;  2A6H F;  3SXM A;  1DOW A;  2X0C A;  1JRA A;  3LNM B;  4AE4 B;  4N06 A;  3KKB A;  4L6R A;  4LDR A;  1A7D A;  1QVX A;  2Q4F A;  1WGW A;  2CCY A;  1QKR A;  3GOR A;  4DBQ A;  2OQM A;  3RVY A;  2Y3B A;  1M2O A;  2FFH A;  3H2V A;  1XZQ A;  2XS8 A;  3LNR A;  4H54 A;  3L1M A;  3S9O A;  4D4N A;  3FOO A;  3A11 A;  1APC A;  2OEV A;  5DQT A;  2DYS C;  1TFO B;  2UUH A;  1ZZP A;  2XM4 A;  3C18 A;  4LLC A;  3EFO B;  2HJ3 A;  1NFO A;  1NU9 C;  5JRA A;  3DWW A;  1B68 A;  2L7A A;  1OKK A;  1IW7 F;  5L0D A;  5L3V A;  4JEB A;  4ZLD A;  1Z23 A;  2LQG A;  2PF4 E;  1J8M F;  2R9R B;  2J9W A;  3DE8 A;  4XPX A;  3VAY A;  2YRF A;  4DJ9 A;  4Q5S F;  3QVZ A;  1HW1 A;  5JSL A;  2XLM A;  1M6T A;  4CIH A;  2J0W A;  5AC5 A;  2EPL X;  2WVQ A;  4JIO A;  4XEK A;  3RVZ A;  1OKK D;  4PJJ A;  4Z9I A;  2J46 A;  5COF A;  4CDA A;  2XS1 A;  3QW1 A;  3S84 A;  3AG3 C;  2R7T A;  4DVZ A;  1Y6D A;  1HY5 A;  4H4K C;  4NC3 A;  4BJ5 C;  4E17 A;  2W45 A;  1ZVZ A;  5A6B A;  1ZHZ A;  3SNH A;  3VRC A;  3FAJ A;  2CW0 F;  2EIK C;  4MVS A;  1U0B B;  5A69 A;  2HV7 A;  1OR2 A;  2J7P A;  3RFY A;  1L3P A;  3L0I A;  1CGM E;  4G0H A;  4J32 B;  3RKO F;  2DGJ A;  2YQY A;  5A6B D;  4MVZ A;  2ZXO A;  1NSG B;  3MFN A;  2BL2 A;  4XQ1 A;  4MW3 A;  1CPR A;  2XLD A;  5A6J A;  2OEX A;  3JSZ A;  3QW0 A;  3VF0 A;  3DZA A;  1LM3 B;  4I3M A;  1D1C A;  1T6Q A;  2IXN A;  1E84 A;  5L0I A;  2XXA A;  4A2N B;  5EK0 A;  1E2X A;  2VCA A;  2ZXR A;  2UUI A;  2OU6 A;  4NTA A;  3K1I C;  2PFD A;  3DE9 A;  3POV A;  3LUT B;  1E83 A;  3GWN A;  2IOQ A;  2OOC A;  3Q7G A;  4PJM A;  3TOM A;  5KYU A;  2C03 A;  3MLG A;  3O6X A;  4D4X A;  1SZI A;  1FNT c;  1TWA A;  2XL6 A;  3MX3 A;  2HZ8 A;  5GPG B;  3HJC A;  5BQG A;  1U89 A;  2EIJ C;  2YL3 A;  3H65 A;  1A41 A;  4FWV A;  4C3D A;  4OIO F;  4PJL A;  3AGU A;  1SF8 A;  4U5C E;  2YL0 A;  3DMD A;  1ZU4 A;  2KGO A;  3I5Q A;  3GM1 A;  4JKV A;  4XEV A;  5DS4 A;  1CPQ A;  4MVR A;  2HS5 A;  1MMA A;  1T01 A;  1Q0K A;  3NRH A;  2D5R B;  4NTB A;  4B6I A;  4BJT A;  4K7B A;  4FAP B;  1NZE A;  5TJ5 E;  1UFB A;  4EBJ A;  3AJM A;  4RD9 A;  2AU5 A;  3DJN B;  5EGY A;  1TQG A;  1MND A;  2BE5 F;  1WAS A;  3L34 A;  1MMN A;  1WAT A;  2LSE A;  4MND A;  1W2W A;  1JOG A;  2I8B A;  2P7V A;  3JTL O;  3LLI A;  1K40 A;  2AP3 A;  3ZVR A;  4RBN A;  4O79 A;  4U9E A;  1RKE A;  2EIM C;  4A4A A;  1OCR C;  4MVO A;  4JTC B;  3LEO A;  2P0N A;  1G4W R;  1LE4 A;  2J45 A;  5E3A A;  1BR2 A;  3AOU A;  1QLE C;  1ZHT A;  5JVE A;  3FDQ A;  2AWY A;  1FMW A;  3NKD A;  3JT1 A;  4PFO A;  1H7I A;  3NYJ A;  2FAP B;  2EPM X;  3ZTM A;  4IAQ A;  4CS7 A;  1TR2 A;  2YHS A;  256B A;  2A6E F;  2IYL D;  3RH3 A;  3SEO A;  2R02 A;  3LJB A;  1RJ9 B;  2L9J A;  2NSF A;  4JZA A;  2R7O A;  2ICW G;  1E86 A;  4O7G A;  2WB7 A;  3AG1 C;  5JUA A;  1AVO B;  3KL4 A;  2DB4 A;  4IB4 A;  3U9M A;  2VCB A;  4HFK B;  4U5F E;  3SZR A;  2YLG A;  1HE9 A;  3HNK A;  3OWT A;  2ZXW C;  2PX0 A;  2NUT A;  3RQF A;  1G5Z A;  5DVW A;  3W8H A;  4U5D E;  5L0H A;  3JRT A;  2A0U A;  3U9J A;  3US6 A;  5D91 A;  2L6G A;  3EGX A;  3ITF A;  3N24 A;  2CNW A;  2MHR A;  4JVS A;  1RKC A;  4C7O A;  3ABL C;  3W2V A;  4NCQ A;  4BJ6 C;  2XRH A;  1YAU O;  2RD9 A;  1D1A A;  1H9G A;  3EZI A;  2CDQ A;  3F47 A;  4J7T A;  2H7O A;  4JUR I;  2GAQ A;  4JCZ A;  4K1O A;  3C8G A;  2WZL A;  3IQC A;  2EPN A;  1ZHW A;  1A7E A;  3BEH A;  2HSB A;  4KBL A;  3F46 A;  2CNW D;  3HKK A;  2OJE D;  1A7V A;  4PJN A;  5B1B C;  3S28 A;  1KTM A;  2HUJ A;  1AEP A;  2P1A A;  5CI9 A;  1LS4 A;  4EIY A;  3MYF A;  1YYX A;  2VB6 A;  2A68 F;  3LS0 A;  4CS9 C;  2XLE A;  3EPV A;  5KYN A;  1GS9 A;  4LDK A;  1D1B A;  3IQT A;  3LAY A;  2LIG A;  4J7Y A;  4Z9H A;  2L81 A;  2R7S A;  2MWQ A;  2WVO A;  3M79 A;  4EWC A;  1BBH A;  4ER9 A;  2YWA A;  1YYJ A;  2G3K A;  3GM3 A;  2HFI A;  1EKY A;  3IPM O;  2H8A A;  4OIP F;  4CS8 C;  3ABK C;  4ONS A;  5DQZ A;  2HV6 A;  4YL1 A;  4JJG A;  4BJ6 A;  3TJ6 A;  4ULW A;  5B3I A;  2ASR A;  2NUP A;  1YA7 O;  4OD5 A;  4JEA A;  1PD1 A;  2Q9C A;  1YJG A;  1TWH A;  3PCV A;  4DRJ B;  1VOM A;  1I4Y A;  4CSA C;  1VLS A;  3EG9 A;  1O87 A;  1M56 C;  2G62 A;  3S29 A;  3MBG A;  4I44 A;  4G7Z F;  4CDY A;  2Y3G A;  1O5H A;  1I4Z A;  4YK5 A;  2CGE A;  3ZDL A;  2AWC A;  4QDL A;  4YL0 A;  1GGQ A;  1ZHY A;  2W9Y A;  5HV9 A;  1LPE A;  5E3C A;  2R25 A;  4Q7C A;  4MVU A;  4PFP A;  5T1D B;  5F5F A;  2KYH A;  3B71 A;  1BDJ B;  4U5E E;  3WHN A;  3GEI A;  4O6M A;  1Q0M A;  3UMI A;  3KH2 A;  3M15 A;  3G4Z A;  3S0X A;  2O9X A;  2B0J A;  3FHD A;  4X0R A;  4CIP A;  5AC4 A;  2WZG A;  4MVM A;  4IRU A;  3SXY A;  4YT8 A;  4JTD B;  3JYY A;  4XPY A;  1GQA A;  4AL1 A;  1U6H A;  3V5Z A;  2JX0 A;  1WWP A;  1JAF A;  4MVQ A;  3HTK C;  1H6G A;  1BZ4 A;  4IAR A;  3IQ5 A;  3TUL A;  4YJW A;  3SXK A;  1A0B A;  5EHH A;  1AUE A;  1Z3I X;  5JS5 A;  2LD6 A;  2J7P D;  3NMJ A;  3NMK A;  1VK5 A;  5D92 A;  3MYI A;  3J06 A;  1SMY F;  3KYJ A;  1EA8 A;  2R7Q A;  3B0P A;  2V26 A;  4MTO A;  1MMD A;  3C8G B;  3DXJ F;  1FTS A;  1C17 M;  2Y39 A;  3JSE O;  1C03 A;  1CGN A;  1PD0 A;  4LLE A;  2I15 A;  3NMI A;  4AK9 A;  4ULV A;  3E70 C;  4BJ5 A;  3AG2 C;  3QZC A;  1M2V A;  4N6H A;  3O39 A;  3ZTZ A;  2GFH A;  2ZD9 A;  3ZQY A;  2LCH A;  2YZS A;  2KC3 A;  3UGO A;  1OR3 A;  2Q00 A;  3W2W A;  2F22 A;  4CX9 A;  3B9Q A;  1C02 A;  4PR9 A;  4OIN F;  1TWG A;  5T3W A;  1VYK A;  3GAN A;  3EHN A;  1KNY A;  1L7C A;  1XZP A;  3CSK A;  3O10 A;  5FZT A;  3JZ0 A;  4BEM J;  3B0V C;  1LVK A;  1S7Z A;  2IXP A;  3EH1 A;  4I1M A;  1VTM P;  2ETS A;  4IAO A;  4YT5 A;  2PP4 A;  2VH3 A;  3HNL A;  2Q9B A;  4U5B E;  4E7S A;  5A6A A;  2Y3H A;  3ABM C;  3K1I A;  4CDV A;  1LI7 A;  4EKW A;  4DVY P;  4E0H A;  3JRM O;  3FMS A;  4U5H A;  2DI3 A;  2R7X A;  1R4T A;  3B0U X;  3SYN A;  1PV3 A;  3DJU B;  2Z15 A;  3SP1 A;  3GEE A;  4RDA A;  1ZHX A;  2GA0 A;  3EG9 B;  3Q7L A;  5T3T A;  1ORJ A;  1ZYR F;  5L0G A;  3U0C A;  3UMH A;  2ZPA A;  1HE1 A;  5F28 E;  3S27 A;  5BQI A;  4CBE A;  3DM9 B;  2PBE A;  3C63 A;  1VMA A;  1PCX A;  1Z5Z A;  3IEE A;  3PMR A;  4YT4 A;  1T6U A;  4UDV A;  2R7W A;  4JW1 A;  1FAP B;  4KI2 A;  2IXM A;  4LDQ A;  5B1A C;  1JMW A;  3KPH A;  2LFF A;  2QE9 A;  2R7R A;  5DLJ A;  4Q4Z F;  3LS1 A;  3TK0 A;  2QNL A;  2A0B A;  3ASO C;  3K33 A;  3LES A;  4J30 B;  2NG1 A;  3R2P A;  4WGY A;  3RF3 A;  3PHF 2;  3FOP A;  5KYY B;  2R7V A;  1F1M A;  4NQF A;  2X51 A;  1ORS C;  4FES A;  3T6B A;  4E18 A;  5FCL A;  1LIH A;  1YZC A;  3EHM A;  3W8I A;  2HMQ A;  3RQG A;  2AVK A;  4IWB A;  4AL0 A;  5DS6 A;  2H7V C;  4O6Y A;  3ZC4 A;  2MYS A;  2IXO A;  2WL8 A;  1G4U S;  1LE2 A;  2Q3T A;  2XXA B;  1VB5 A;  2PNO A;  2FGY A;  4P9F A;  4JE9 A;  3ZIB A;  4BEJ A;  4C3E A;  3UGP A;  1WTY A;  4O6N A;  4OD4 A;  3FVY A;  4QI2 A;  2R7U A;  4N6C A;  5F5H A;  4K0D A;  4DOZ A;  2G3V A;  2D4U A;  3DI5 A;  5KYU B;  1NLX A;  2YLD A;  3RYL A;  1ZU5 A;  3NYL A;  3LEV A;  3C62 A;  3C8G D;  1FR0 A;  4IJJ A;  1M2V B;  2A1D D;  1OW7 A;  4ZLC A;  2IBF A;  3I4U A;  2YVK A;  2KSF A;  3I5P A;  2B0H A;  1I5N A;  4I1O B;  3WG7 C;  5BUO A;  3NDB B;  4G7H F;  2HSQ A;  1BR1 A;  3E9V A;  4GQH A;  4GYT A;  3X2Q C;  3QVY A;  2XLW A;  2XSE A;  4NTF A;  3AQC A;  3U3F A;  2QUP A;  1HMD A;  4ANJ A;  1G8X A;  1NBB A;  4G78 A;  1RCP A;  2M4E A;  1GM5 A;  3TQO A;  1SR2 A;  3V5Y A;  4U9D A;  4Z9J A;  4CJO A;  1NU7 D;  1H9T A;  3GM2 A;  2BC5 A;  2YL7 A;  1Z7Q c;  2HMZ A;  3EJN A;  4EUK B;  5CIV A;  1KU2 A;  2KJG A;  2H7B A;  5L0F A;  2WZF A;  1D0X A;  1RKE B;  5COM A;  1EI7 A;  4BPM A;  3TJ5 A;  4DXW A;  3Q6M A;  1EQ1 A;  4XTK A;  4GEH A;  3JCU Q;  4CS9 A;  5E2Q A;  1D0Y A;  4HE8 D;  1TFK B;  4MTG A;  4WGZ A;  3RIP A;  3K6B A;  2J0X A;  1VYI A;  1YZA A;  3GWL A;  2JPU A;  3C8Z A;  3M1C B;  3LLK A;  2QLA A;  3S90 A;  1HMO A;  2LP4 A;  3L8I A;  4XEF A;  1K04 A;  3A9C A;  1T5O A;  4F4B A;  3M4C A;  2VCC A;  3HLZ A;  1JPJ A;  3JYH A;  4KNV A;  3U8V A;  4DBR A;  3K7D A;  4CS8 A;  1ZW2 A;  5AGF A;  3NYM A;  4W8K A;  3AG4 C;  2R03 A;  4KC9 A;  4R32 A;  1OXK A;  3DKA A;  2NUT B;  2OJQ A;  4DRI B;  4U5G A;  2EPO A;  5E33 A;  2OKU A;  1BR4 A;  4FX5 A;  3T9O A;  3AQB A;  2QTV A;  1ORY A;  3EGX B;  4CSA A;  1FMV A;  1Y4C A;  3EGD A;  4C7O B;  1YDI A;  2HJM A;  2LK4 A;  4G7O F;  3IHU A;  2W4B A;  2GWW A;  5L3Q A;  2Y69 C;  1V55 C;  2KW3 C;  1RJ9 A;  3RW0 A;  3DD7 A;  4EBK A;  3EZH A;  3N2Z B;  5HSW A;  3ZG1 A;  4MTF A;  2C04 A;  3CAX A;  4XWJ A;  1OCC C;  5A6K A;  4E0I A;  3KMI A;  1MNE A;  3WOD F;  3ZSU A;  3U5S A;  2XLO A;  2RSE B;  1Q0G A;  1V74 B;  1TWC A;  2J9V A;  4N4W A;  2P61 A;  1LS1 A;  2J9U A;  2WVN A;  2XL8 A;  5KYX A;  4P6I C;  4E7Z A;  2XL4 A;  4EBB A;  3EH2 A;  2NPU A;  4JCH A;  1RXQ A;  5KYY A;  2L6F A;  3NKE A;  3QMK A;  1OW6 A;  1QPU A;  1V54 C;  3NG1 A;  4LAC B;  5JP7 A;  3PDM P;  1JR8 A;  3K1H A;  2OCC C;  1QSP A;  3DM5 A;  1J8Y F;  4WJ0 A;  2M64 A;  2PX3 A;  2HKV A;  3G4X A;  3WAQ A;  2CYD A;  5KYW A;  4LER A;  3V7O A;  4IGG A;  1Z63 A;  4HFF B;  2NUP B;  4W8P A;  2P6V A;  3U2L A;  5B3S C;  2ZXP A;  3IQ6 A;  3QTH A;  3DAG A;  5JLI A;  3EQL F;  3RQE A;  4C3B A;  4WAB A;  1NG1 A;  4P9T A;  1D0Z A;  1Q0F A;  5L0C A;  1ST6 A;  4AE4 A;  2QY9 A;  1E85 A;  3OA1 A;  2EIN C;  1T6I A;  1Z6A A;  1ZW3 A;  2J9B A;  3Q6N A;  4MQ9 F;  3R7C A;  3CQZ A;  4OIQ F;  1Q0D A;  2YKZ A;  3HNJ A;  1MMG A;  1NFN A;  4QI0 A;  2XM0 A;  1YA9 A;  2E87 A;  1TKN A;  2EIL C;  1RMV A;  1OW8 A;  3TOL A;  4HEA J;  1WOL A;  1YAR O;  3EFO A;  5BQH A;  4OIR F;  5DS5 A;  3DAF A;  1SYQ A;  1S05 A;  1OCO C;  3FXH A;  1LKX A;  3CEX A;  3UMK A;  3ECS A;  4DRH B;  2VAS A;  3G50 A;  3AGT A;  1IZM A; 
#chains in the Genus database with same CATH homology
 1C03 A;  3US6 A;  1Y6D A;  2LP4 A;  2R25 A;  1WN0 A;  1OXB A;  1BDJ B;  4G78 A;  1SR2 A;  2LCH A;  1OXK A;  3KYI A;  4EUK B;  1C02 A;  3U3B A;  3MYF A;  4PAC A;  1A0B A;  2LD6 A;  1TQG A;  1FR0 A;  1QSP A;  3KYJ A;  2A0B A;  3IQT A;  2OOC A;  1I5N A;  1YVI A;  2Q4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...