2LCSA

Yeast nbp2p sh3 domain in complex with a peptide from ste20p
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
67
structure length
67
Chain Sequence
MAIVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAP1-binding protein 2
publication title Distinct Peptide Binding Specificities of Src Homology 3 (SH3) Protein Domains Can Be Determined by Modulation of Local Energetics across the Binding Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase, signaling protein
total genus 8
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lcsA00
1YNZA 1MV3A 2DM1A 3M0QA 4OMQA 1VYUA 4R0KA 4RUGA 3U23A 4Z8AA 1XOVA 2ROTA 1NLPC 3H0HA 1BU1A 1VA7A 4CC2A 2OI3A 3O5ZA 3VS5A 2K3BA 2KE9A 1M3BA 3EG1A 1VYVA 3I5SA 1OV3A 4J9BA 2CREA 1NG2A 2VVKA 2NUZA 4X1VA 4AFQC 2D0NA 1ZLMA 1WFWA 2NWMA 1SPKA 2J6OA 3IQLA 2IIMA 1T0HA 2LP5A 2FG0A 1KSWA 1UECA 1Z9ZA 2LCSA 1FYNA 2FPDA 3REAB 1QKWA 1UTIA 4JJBA 1SHGA 3RNJA 3EGUA 2J6FA 2AZVA 2O9VA 2OJ2A 4D8DA 3EG2A 3VS4A 4AG1C 1K0SA 2KNBB 1YWOA 2CH4A 1PKTA 1X27A 1E7OA 2F2XA 1K1ZA 2O31A 1M30A 3NMZC 1BBZA 3PVLA 1MUZA 2DILA 4J9IA 2A28A 4EIKA 1WXTA 2EGCA 2JM8A 1OPLA 4OMPA 2DLPA 2BZYA 1X43A 1QWFA 2FRWA 2J7IA 1WLPB 2KXCA 3ULRB 4RTYA 1T0JA 1QLYA 2EYWA 2BZXA 2DYBA 2RQRA 1PNJA 1AOJA 4Z89A 2SRCA 1UHFA 1OOTA 2O88A 1HD3A 1W1FA 2M51A 1PRLC 2RNAA 4F16A 2KRMA 3H41A 4LUEA 1QCFA 4KRTA 1X6BA 1GBQA 2GTJA 1JU5C 4QT7A 1EFNA 1W70A 2JMAA 2DMOA 2HEQA 2EYYA 1WXBA 1Z9QA 5EC7A 2JS0A 4J9DA 4DEXA 2X3XD 2EW3A 1RLQC 1J3TA 1GBRA 1AZEA 1U06A 2J6KA 1UUEA 1FMKA 5HCKA 4ESRA 3PVQA 2JTEA 1VYTA 1JEGA 1PKSA 2GBQA 2KYBA 4ZNXA 1ABOA 4IIMA 1M3CA 2RPNA 2AK5A 1PRMC 1ZSGA 2H8HA 2J05A 1WA7A 2W0ZA 3VS7A 1IO6A 3EG3A 1HJDA 1AWJA 2AKKA 2ROLA 2RQUA 2DF6A 1T3LA 1M8MA 1AZGB 1ZX6A 2LQWA 3SEMA 3I35A 2KROA 4CC4B 2HDAA 5IXFA 2LZ6B 2M0YA 1GCQA 2DL4A 2CUBA 1Y0MA 3JV3A 2E5KA 2LJ0A 4F14A 3I9QA 2MOXA 2EBPA 3UATA 2JMCA 1YP5A 4LNPA 4HCKA 5GJWB 1RUWA 2OAWA 4JJDA 1E6HA 1UE9A 1AEYA 2LJ1A 2ED0A 2C0IA 2BZ8A 4F17A 1WIEA 2VKNA 2RMOA 4J9GA 3REBB 1ZUYA 1OEBA 1JO8A 1GFCA 1YN8A 2D8HA 3LH5A 2YDLA 4M4ZA 1TUCA 2B86A 3VS6A 2L3SA 1UJ0A 4LE9A 3H0IA 3NGPA 2HBWA 1MV0B 1AWWA 1UGVA 2LQNA 1UFFA 1KIKA 1AD5A 3FJ5A 4OMNA 2KR3A 4IIOA 5IHNA 2DA9A 2DBKA 1A0NB 1K0XA 2RF0A 2RQTA 2DL3A 1AWXA 2A37A 3EHQA 2YSQA 2AZSA 1CKAA 2DE0X 2KYMA 1NEBA 3VS2A 1AWOA 2RQWA 3UA7A 3R6NA 2JT4A 2DX1A 4RTZA 2GTOA 2C0TA 2EGAA 4OMOA 2KEAA 2KT1A 2KT8A 4AFSC 1I07A 2I0NA 1SEMA 4LUDA 2KXDA 1JXOA 1WYXA 2CT3A 1I1JA 4CC3A 1ZUUA 2FPEA 1JQQA 2KGTA 4JJCA 2DL8A 1ABQA 3THKA 4K11A 1QKXA 2EVRA 1UG1A 2BTTA 2DBMA 1S1NA 5FW9A 4J9HA 1PHTA 2CSIA 1WDXA 3VS0A 2L0AA 1SSHA 1UDLA 4LN2A 1M3AA 3VS1A 2LNHB 2JS2A 4JPBW 3QWXX 1OPKA 1SRMA 1B07A 5IHKA 2YUNA 1X6GA 2RN8A 4RTWA 3NHNA 3VRYA 2FPFA 3UF4A 2D1XA 2PZ1A 4J9CA 1H8KA 1ARKA 2CH4W 4J9FA 1JXMA 2V1QA 1H3HA 3A98A 1GRIA 1N5ZA 3VS3A 2G6FX 2O9SA 3SHWA 1B3QA 3KFVA 4HVVA 2HCKA 2O2OA 1GFDA 1TG0A 2JM9A 5GJVB 4A63B 5ECAA 1AVZC 2QDLA 1LCKA 1W6XA 2GNCA 1U3OA 4HVWA 2DRKA 1K9AA 1NM7A 3H0FA 2A36A 5FWCA 1SHFA 1YCSB 1G83A 1X2QA 2ESWA 3PE0A 4D8KA 2K6DA 4AFZC 1K4US 1GCQC 1I0CA 1CSKA 2ECZA 1Y57A 3QWYA 2L2PA 2W10A 3TSWA 3GBQA 1KFZA 4JZ4A 1X69A 2LX7A 1GL5A 4RTXA 2ED1A 2GQIA 2D8JA 2PTKA 3M0UA 1X2KA 1UHCA 2EQIA 3M0SA 2CUDA 2EYZA 3NPFA 4Y92A 1K76A 2F2WA 4GLMA 2ABLA 3EHRA 2YT6A 1NYGA 2L3PA 1T3SA 2KRSA 2DNUA 3UA6A 2ENMA 5I22A 2K79A 2RQVA 2CSQA 2KRNA 1RI9A 1HSQA 2A08A 2JXBA 1GCPA 1WXUA 2K2MA 5L23A 4E6RA 2GGRA 3M0RA 1BB9A 4RTTA 2XMFA 5FWBA 2FRYA 3TSZA 2JW4A 1UJYA 1M27C 2V1RA 4J9EA 4RTVA 4RTUA 4AFUC 1NLOC 2PNIA 2EGEA 4WCIA 4AG2C 3M0TA 2VWFA 3C0CA 1CKBA 1WX6A 2YUQA 2EPDA 2EYXA 1ZUKA 4OMLA 1NYFA 2KBTA 3CQTA 2K9GA 1QWEA 1ZBJA 4ORZA 1TUDA 2LJ3A 4CC7A 3VRZA 3M0PA 1G2BA 2MIOA 1BK2A 1SRLA 3ZL7C 1KJWA 2CT4A 2HSPA 2F2VA 3EG0A 4OMMA 2FO0A 5IHIA 1U5SA 5IXBA 2EKHA 1H92A 1V1CA 2LMJA 2FEIA 1PWTA 2L3QA 2YUOA 4JZ3A 3RBBB 2CDTA 5IH2A 3I5RA 2K7AA 3TVTA 2J06A 4FSSA 2DRMA 5I11A 2AKLA 1YWPA 4GBQA 4DEYA 4HVUA 2C0OA 2X3WD 2DL7A 1E6GA 2P4RA 2SEMA 1WI7A 1NEGA 2YUPA 2MCNA 4Z88A 2DJQA 1RLPC 2DL5A 2DVJA 4HXJA
chains in the Genus database with same CATH superfamily
4MZPA 3RDVA 1YNZA 3CD6Q 4JDSA 1VYUA 2DETA 1VQ7A 4BB7A 4J6WA 4JRIA 5FU7B 1YITQ 1MNDA 3ASKA 4LD6A 3TCJA 1M3BA 4PJMA 1VYVA 4PLLA 5GAOp 1Y96B 1HXDA 4J9BA 2RI3A 5GAMe 3E19A 3EGDA 4M75B 1I5LA 1VQKA 4C8QD 3G6ET 2CZ7B 1ZLMA 1SPKA 2QQSA 2X4YA 3OYGA 2ZPHB 2LP5A 1KHCA 1RAGB 1RI0A 1FYNA 3REAB 3SWNB 1RAEB 4N0AC 5GMKj 4BDYA 5CKBA 3OA6A 1FX7A 3VS4A 1K0SA 1YWOA 2CH4A 2QGGA 2O31A 4JLGA 3NMZC 4C8QE 2OTLT 3PVLA 4FL6A 4M78G 2A7YA 2HQHA 2JM8A 2EGCA 1OPLA 4YTLA 2QA4T 2DLPA 1WHLA 3HKSA 4XTXA 4JS4A 4RTYA 4EMKA 4IUVA 1QLYA 2EJ9A 3M9QA 5M9OA 5LJ3j 1KC8C 2DYBA 1FXXA 3CMEA 3V8JA 1PD0A 4DBQA 1PNJA 2RB6A 3HL8A 4MZMA 2MYSA 4M75D 2HZYA 2O88A 1VQ7T 1W1FA 1R8OB 2L89A 2M51A 3MP8A 3A1PA 4BY6B 3H41A 3DLMA 3QPHA 2M16A 1C0MA 1ZSZC 2LVMA 3PMTA 2DD4A 3RKWA 1W2BP 2E6ZA 3FB9A 1W70A 1Z9QA 4M77B 5EC7A 2XDPA 4J9DA 2X3XD 2EW3A 3OYIA 2LCLA 4KBMB 3LW5E 4MDXA 1PM3A 3MEUA 1N27A 2P84A 5FRNA 1C6VX 2RPNA 3M5AA 3JB9F 1HJDA 2ROLA 1QP3A 2DF6A 4A4EA 1D3BA 3HRUA 1AZGB 1ZX6A 2AIRB 3MEAA 2JUFA 2KROA 3VU3C 4FYWB 4CC4B 1BI1A 3OBWA 2M0YA 3MEVA 3G71A 4JRKA 3JV3A 2DK3A 2E5KA 2LJ0A 4B9XA 2HNIA 2XI9A 2M9UA 5GMKi 2EBPA 3CMET 3MHXA 5CKEA 1K8AC 2VGNA 2OAWA 2LJ1A 2ED0A 3CC2A 2MPXC 3O8VA 2F1LA 4JRPA 4J6YA 2VKNA 2RMOA 3QYHB 4M77D 1KQSS 4RG8A 2D0QB 4JJNK 2A3LA 4E7ZA 2XDDA 3JCMJ 3M59A 3VS6A 2VXEA 1UJ0A 4LE9A 3OMGA 2RJDA 3H0IA 4ZGJB 2EIFA 3NGPA 4M78A 1MV0B 1AWWA 1KIKA 2MF2A 3CBOA 1N8RR 4M77E 4OMNA 3CBPA 3NTKA 1IGQA 1NBEB 2FZGB 2Y4YA 3G6EQ 1K0XA 2DL3A 3QIIA 3HRTA 1N8RC 3DB3A 4HT9A 2YSQA 5GAN2 3VS2A 1WQ7A 3OYEA 2RQWA 2DX1A 2D9TA 3EFSA 3CXCP 2RD1A 4M7DA 2KSSA 4IUPA 2KXDA 5HK3A 4DOWA 4PFZA 3OW2S 1LJOA 2LT1A 1WYXA 2CT3A 2OTLQ 4B6MA 3A8HB 2DEUA 3CC4A 2QQAA 1X75C 4ATOA 1QKXA 5GAN7 4CI0C 1M5Q1 1SSFA 1S1NA 2X4WA 1PHTA 1WHMA 4M7AC 1WDXA 2IVWA 4LN2A 1WJRA 2EQUA 4C92G 2ZPBB 3TU4K 2JTFA 5CQYA 2XD0A 5FRMA 1VQ7Q 3QKJA 4C92F 3JCMP 2LCCA 5I2MA 1H3ZA 1WGSA 3SFMA 1OPKA 3FDRA 4C92C 2RN8A 3JCMf 3UF4A 3M57A 2LTOA 4IUQA 3BY7A 9ATCB 5CO7A 3CCST 2JVVA 5LJ5h 1VQKQ 3EG9A 3EGXB 4ZTJA 1BIAA 1M1KR 1N5ZA 3VS3A 1UEBA 3PNWC 3GP8A 1QCOA 4KUIA 3LH0A 2YLBA 1VIEA 1M1KC 1G8XA 4HVWA 4A53A 2HQEA 1RAHB 2PU9B 3PE0A 2HKQB 3UPUA 3EH2A 1CSKA 1Q7YR 3I56A 3CCMT 2OTJA 1R0CB 1TXQA 3URGA 3L2ZA 4ANJA 1YJNA 3GNGA 3OMCA 5J26A 3MP6A 4RMOA 2GQIA 1DJ7B 3M0UA 1X2KA 1Q7YC 3M0SA 3CMEQ 4A4GA 5GAN6 1TS9A 5GAOm 2H3JA 3NPFA 3EH1A 5GAOq 4XAXB 4GLMA 2RJEA 2RQVA 3CCEA 2KRNA 2QTVA 3J81E 4IKFA 2HSEB 1HSQA 5GAMh 2K2MA 3OS1A 4MDWA 3KBGA 5A0LA 1BB9A 4RTTA 3DKMA 5IN1A 2FRYA 3TSZA 2JW4A 4P5NA 1YCYA 1M27C 2CP7A 2ZCFB 4J9EA 3VYHB 4DOVA 2RK1A 4II1A 4E2FB 1M2OA 1OZ3A 2NUTA 4AG2C 4OB3B 2LNVA 2X4JA 3L2WA 2DFUA 4C8QA 5LJ5d 3P8HA 2K9GA 5GMKe 3CCRA 3LX7A 3UT1A 3E2UA 2RM4A 5FROA 3A8LB 1B7TA 1WHHA 1B34B 2MIOA 1YJNT 1Q95G 2X35A 3KXTA 3G71Q 3EG0A 4XTVA 2LMJA 2B8AA 3CD6T 3RBBB 1ZSZB 2CDTA 2WSFE 1K73R 3I5RA 3OYCA 3L2QA 3HTRA 3DLLA 3CC2Q 1YWPA 4DEYA 3CCET 1K73C 1NEGA 2K5IA 1Y96A 4XQ3A 3AT1B 3LLRA 4M75A 4ZGEB 2CP3A 1Q86R 1MMGA 4C5HA 4F7UG 4L6V5 4HXJA 4OMQA 4R0KA 3U23A 4F7UF 2QAZA 3X25B 3EFOA 5J3BA 4QQ6A 2AHJB 1Q86C 3QG1A 3H0HA 2VC8A 1BU1A 2BIVA 4CC2A 3I55A 2OI3A 3VS5A 2K3BA 5GAMd 4C5IA 3SWNA 3G4SA 3A8MB 1G5VA 1VQ5A 3I5SA 1QVGA 1OV3A 3EAEA 4BE0A 2VGMA 4PJOB 4Y91A 2PVGB 1NG2A 2VVKA 3JSCA 1UGPB 3RKYA 2NUZA 1WJSA 4AFQC 1WFWA 5GAOn 1GXIE 2E1HA 2BE9B 3S3OA 1S72A 1KSWA 2LCSA 3CCJA 3RUXA 1MNEA 1F1BB 4BE2A 2L8DA 3CC4Q 5DLOA 3PIOA 2DYIA 3OSSC 4D8DA 2OJ2A 3EG2A 3X24B 2K3YA 1PCXA 2OAUA 1KK7A 1MUZA 1QVFP 2A28A 1WXTA 4OMPA 4OB0B 2V8JA 3J80E 1TUGB 2FRWA 1WLPB 3ULRB 3CPWS 5AT1B 4HA8A 2BZXA 2E5QA 2P4TA 4M77A 3PGGA 1AOJA 4PJOD 1UHFA 1HD3A 4E7HA 2YRVA 4C5GA 3LYIA 1KHIA 3I55T 1PRLC 2HMAA 4KT0E 4BUGA 4EMKC 1X6BA 1GBQA 2JNGA 1JU5C 4PNOA 2YRCA 4QT7A 1M4ZA 4PLIA 1WZOA 5GANf 2DIGA 2HEQA 2LX9A 2RI5A 5DM7R 2KAFA 3RERA 2JS0A 2VUBA 4DEXA 3OYNA 5LJ5g 1S72T 4M7AB 1J3TA 5FU6B 1UUEA 4FCYA 2XICA 3CCJT 1FMKA 2COYA 4ESRA 4KUDK 3QJ6A 1ZA1B 2GBQA 1N8RU 2EQKA 2KYBA 4ZNXA 3I56Q 2OTJQ 2MAMA 3VS7A 1D1AA 1YJNQ 3EG3A 2DTOA 1AWJA 2AKKA 1KQ2A 1VQPA 1T3LA 4OB2B 3PFSA 1NE8A 5GAN5 2HDAA 3GOXA 4XTYA 2LZ6B 4IUUA 1GCQA 4E7LA 1Y0MA 4DBRA 4WTOB 2CS7A 3L2RA 4KGZB 3UATA 2JMCA 4LNPA 3CCEQ 2CP5A 3VJPA 5KYXB 2PVOB 1BI0A 1RL2A 3M58A 4E47A 1KD1R 2BZ8A 1Y71A 3L2VA 2E10A 2Y90A 3R6OA 3A8OB 1ZUYA 1JO8A 1GFCA 1RABB 2QGFB 2QXFA 4M7AD 2PUKB 3HHTB 2B86A 4Y28E 1XQHA 4QQGA 4ZTFA 1KD1C 3NTIA 3V7SA 4RCBA 1YJWA 2L3SA 2RHIA 1D09B 4KGVB 3QDRB 2HKNA 1KQ1A 2L3RA 5GAMg 2DTHA 4FU6A 2IG0A 2KVQG 2CP2A 1LVKA 2ZPIB 1N9RA 3CCRQ 1KC8R 3MO8A 4AMCA 2KR3A 2GCXA 2MI6A 4C0GA 3E9GA 1Q81C 1K9MR 4M7AE 5GANj 2DBKA 2RF0A 1AWXA 4M78F 4FYVB 3EHQA 3V8LA 1C1AA 2AZSA 4XU2A 1M1KU 1VQPT 4M78C 5CKHA 5KYUB 2I2LA 1VQNA 3UA7A 2PUOB 1K9MC 4BACA 5KYNA 2C0TA 2EGAA 1NPPA 4C92E 4AFSC 4L5GA 3VUBA 2DXBA 4CC3A 4FSXA 4M7DG 1JQQA 1M8VA 3MP1A 2EVRA 1TWBA 3MPUB 1Q7YU 1VQKT 2BTTA 2GF7A 1QVPA 1FWZA 2BE7D 5FW9A 1KQSP 4J9HA 2RJFA 4ELZC 3QUIA 2CSIA 2L0AA 2HAXA 3CCLA 2DVEA 1D1CA 1ZQ1A 4WF2A 3VS1A 4JPBW 3M54A 1I81A 2AT1B 3ME9A 3I55Q 3JCMe 1W4SA 1D0ZA 3G4SQ 4J7IA 1VQ5Q 2FPFA 5GMKh 1UB4A 1H641 4UC4A 2RHXA 1VIFA 2KDSA 2V1QA 3NFCA 4XTUA 1K8AR 2G6FX 1B3QA 4HVVA 2P0QA 3L42A 1TG0A 5GJVB 1S72Q 5ECAA 2NYSA 1YFNA 2RHUA 1AVZC 2QDLA 3OYLA 1VQNT 3CCJQ 3OYBA 3OYHA 1OULA 2GNCA 3PIPA 1P92A 1U3OA 3MJXA 5LJ3h 3ZFJA 2DZ9A 2CYZB 5FWCA 2A36A 4PJOG 2JTMA 1SHFA 1YCSB 1X2QA 2ESWA 4D8KA 2K6DA 2YWWA 3OW2P 4E7JA 1O9SA 4AFZC 3J7AF 2KI7A 3OYKA 2ECZA 3TSWA 3OB9A 3JCMW 1KFZA 1X69A 4N0AA 4RTXA 3JAME 2JOYA 2RA2A 2EQIA 5A0GA 2CUDA 5GAOr 3CCLT 3JB9J 4Y92A 1K76A 2YT6A 1K73U 1NYGA 2L3PA 2EAYA 2ENMA 3OS5A 2DEQA 3OYDA 2QTXA 2CSQA 5C6SA 5CK9A 1GCPA 4LXCA 4QKUA 2WSCE 4NOYA 1IZ6A 4J83A 2CZ1B 4J6XA 2GGRA 4O6JA 3M0RA 2EJGA 1NPRA 2K4YA 2K5LA 2XMFA 4ZN1A 2XKOC 2E41A 2JN0A 3T9NA 3G71T 1Q86U 1B34A 3V7RA 4RTVA 4HCZA 3UWNA 1NLOC 2PNIA 4B9WA 2EGEA 4WCIA 2RH2A 1ZSZA 2YUQA 1BKBA 3X28B 2EYXA 5GAN3 1ZUKA 3CC2T 2E64A 1MHNA 2D6FA 1QCNA 4MZTA 3MKDA 1ZBJA 3P8BB 1VQPQ 4R55A 2FL7A 2DD5A 3A5ZB 1TUDA 4C8QG 4RKUE 4MMLA 3VRZA 3M0PA 1G2BA 5CKDA 4C8QF 4OVAA 1KJWA 4OMMA 1U5SA 5IXBA 4PJLA 1V1CA 2FEIA 5LJ3d 1PWTA 2L3QA 4EMKB 3C94A 2RI2A 3V7CA 5IH2A 2OX7A 3GLXA 2J06A 5I21A 5I11A 4XTZA 5KE3A 2C0OA 2X3WD 1E6GA 2HL5C 2P4RA 1ZA2B 4AT1B 1WI7A 2EQMA 4MMKA 2DO3A 2YUPA 1JBMA 2ZPEB 2MCNA 4PJOA 3GNFB 1YJWQ 3S3NA 3JB9H 1BI2A 4J8OA 2DL5A 2DVJA 1M2VB 4F04B 5I2SA 4JRQA 5GAOl 2DM1A 3M0QA 4RUGA 4Z8AA 4M75G 5FU7C 1XOVA 1YIJA 4KGXB 4DBHA 4KH0B 4PK4A 4M75F 3CC4T 2ZPGB 1M1FA 3O5ZA 5CQXA 2KE9A 3EG1A 1XTDA 4DQ2A 2JZ2A 2EQJA 2CREA 4FYYB 2YHTA 2YRDA 4EPCA 2C06A 1ZBXA 1VQ9A 1VQNQ 3HRSA 3C12A 2J6OA 3IQLA 2IIMA 4DA4A 1WPYA 2KY9A 4FM4B 2FG0A 4XU3A 5A2QE 3SWNC 3QZ5B 2H3EB 3VUZA 3CEYA 1UTIA 4HCBA 3D7SB 3JCMc 3EGUA 2J6FA 2O9VA 4FT4A 4GY5A 2KNBB 1PKTA 1X27A 1E7OA 2F2XA 1K1ZA 3H9NA 1KG1A 4NL3A 1BBZA 4J9IA 2QQBA 4E7KA 1JB0E 3CCLQ 3ZEHA 5C0MA 2HBPA 1NJIR 2J7IA 1YJ9A 4IURA 3Q1JA 5IT9E 3FRNA 2EYWA 4JUVA 2K5FA 3META 2JJ9A 2P0KA 5CIUA 1IRXA 1PG5B 4GLKA 3WXMB 4M78B 1YIJT 3OYAA 1OOTA 4BY6C 1NJIC 3M53A 4M7AA 2RNAA 3HPWA 4M77G 3I56T 1JJ2A 4F16A 2OTJT 2KRMA 3CCQA 1KD1U 4LUEA 3LWHA 4M77F 4QVCA 1QCFA 4FIBA 2COZA 2GTJA 5GANe 3KUFA 2VXFA 3OS2A 1U1SA 1EFNA 1MMNA 4EMHA 2DMOA 2EYYA 4KULA 1RLQC 1GBRA 4OGEA 2WACA 2FVUA 2G3RA 1AZEA 2J6KA 3PVQA 2JTEA 1VYTA 1PKSA 1ABOA 1G3SA 2V8IA 5KYXA 4IIMA 1KC8U 1M3CA 2EJFA 2AK5A 2ZAEA 1PRMC 3TEEA 1K9MU 3PTAA 3M56A 3PMIA 1M8MA 1I4K1 2LQWA 1TTHB 3OBYA 5LJ3g 5IXFA 3M4YA 1UGQB 2BKDN 2DL4A 1XNIA 3CPWP 3JCMh 4ZN3A 2MOXA 4CRIA 1FMVA 1YP5A 5CR2A 5GJWB 1RUWA 1U8RA 4JJDA 1UE9A 1R77A 3CCRT 4A4HA 2C0IA 1BIBA 1WIEA 3E1SA 3JCMb 4M78E 1PD1A 4J9GA 3SD4A 3GIBA 3CCQT 2E3IA 2R57A 4N4HA 3EG9B 4IUTA 4M4ZA 1TUCA 4Z02A 5CKFA 3CCVA 2LRQA 2DZCA 5GAN4 3WVDB 1QVGP 2PQWA 5KYUA 2DPPB 1TOVA 4LDYA 2HBWA 3GF5A 4LDWA 1UGVA 2LQNA 1VQ4A 2WSEE 3RR6A 1AD5A 4A4FA 2XIDA 2QK0A 4ZGDB 2QI2A 3JB9D 5IHNA 2KK4A 2DA9A 1A0NB 2RQTA 1Y07A 1R0BG 4QVZA 2LQKA 4FT2A 1NZ9A 2A37A 2E3HA 2ZZDA 1K8AU 1CKAA 2DE0X 1AWOA 4RCCA 4LD9K 2F5TX 3R6NA 2JT4A 3LGFA 4OMOA 1RAAB 1I5OB 1TU0B 2KT1A 2KT8A 3EFRA 1RAFB 3F70A 1JXOA 3G4ST 1I1JA 1ZUUA 4ELYC 1PSEA 2FPEA 1VQ5T 2KGTA 1ABQA 3THKA 4K11A 4KH1B 1QVGS 1UG1A 3SDZA 1M9SA 1QP2A 2NUPB 2FHDA 3FC3A 3M55A 2PVDB 4D6WA 2FZKB 3VS0A 3S6WA 1M3AA 3JCMd 3CCVT 1YIJQ 1X6OA 2HQXA 3QWXX 3QO3A 5IHKA 4RTWA 3VRYA 1WHGA 3NHNA 4C0DC 1VQ4T 2D1XA 2X51A 2PZ1A 4C92B 4C0ZA 1ARKA 2CH4W 2DAQA 1H3HA 1VQ9Q 2XG8D 1WJQA 3SHWA 3KFVA 2QA4A 3E9FA 1GFDA 1MGQA 2LQ8A 2QASA 1OU8A 2M02A 1W6XA 1K9AA 1NM7A 1OU9A 2CP0A 1G83A 1VQ6A 3OYJA 4FW1A 3CPFA 5GMKm 2O4XB 5CVIA 1Y57A 2W10A 1IB8A 3QSUA 3GBQA 4EMGA 2LX7A 4BI4A 3OYYA 1GL5A 4TVRA 1YJ9Q 2YXYA 2LC4A 1ZHIA 3FLGA 2D8JA 2PTKA 1Q81R 2BUDA 4C92D 2DJZA 3QYGB 3EHRA 3EFOB 2RJCA 3BE3A 5AYFA 4A4KA 1T3SA 3UA6A 1OX9A 8ATCB 1V76A 2K79A 3CCQQ 1RI9A 2JXBA 1D0XA 1WXUA 4N4GA 4E6RA 4C5EA 1LPLA 4PJNA 2QDYB 3C95A 2MWPA 2V1RA 5EG2A 1QW1A 1VQOA 5KCHA 4RTUA 4OMFB 4AFUC 2CZ6B 1YI2A 1EZZB 1IGUA 4PJJA 2EFIA 1IHWA 1CKBA 3HP9A 2F5KA 4XU0A 2ZPFB 4M7DF 2V26A 3MCAB 1W2BA 4OMLA 1NYFA 2KBTA 1VQ6T 4C0FA 1KQSA 4ORZA 4M7DC 3FIFA 3LGLA 5D6YA 3EGXA 5LJ5f 2LJ3A 2Z0WA 4CC7A 2E4HA 4N4IA 1BK2A 1SRLA 3X26B 3RKXA 3ZL7C 2HSPA 4BI8B 1YJWT 2F2VA 1YBYA 2CKKA 3X20B 3OYFA 3DB4A 1H92A 3BDUA 4EDUA 5KYYB 1N9SA 2YUOA 1UGRB 2DIQA 4JZ3A 1OI1A 1M2VA 2E65A 4X9CA 1BCOA 2V8KA 4M75E 3TVTA 2K7AA 6AT1B 2CGHA 1QMCA 1WQWA 4FSSA 4GBQA 1IHVA 2FZCB 4HVUA 2DL7A 1PC0A 3UDCA 1BI3A 3JB9G 3OY9A 4V2SA 2SEMA 3TREA 5GANh 2QQRA 4XU1A 3CCVQ 3JCMg 5IAYA 1VQLA 2DJQA 1NJIU 3H6ZA 1MV3A 3CMAA 3A8GB 1VQOT 2R5AA 4LDUA 1VQ4Q 3OW2A 2ROTA 1NLPC 1WHJA 3JB9I 4PJOF 1YI2T 1VA7A 4X34A 1XJWB 4F7UB 2QEXA 5KYWB 4PJOC 1I8FA 2EKOA 4XTWA 3L2UA 3MEWA 2EYQA 5HK0A 1BCMA 2VASA 1W2BS 5GAMf 4X1VA 1M1GA 2D0NA 4BD3A 2NWMA 4QVDA 2DKGA 1VQ8A 1T0HA 1SKUB 3L1AA 1IXDA 3JCMX 1WNLA 4JLIA 1UECA 1Z9ZA 4PFPA 2FPDA 1QKWA 4JJBA 1SHGA 1LNXA 3RNJA 2AZVA 5LJ5j 3QZ9B 2XK0A 4AG1C 2DXTA 3EGDB 2XDBA 3CCSA 1M30A 3CXCA 1G3YA 2O01E 3RIRA 2DILA 1Q82R 3QXEB 4EIKA 2RHYA 3G7ZA 2BZYA 1X43A 1QWFA 4HCCA 8AT1B 3FJPA 1M90R 1VQLT 2KXCA 1T0JA 3HFNA 4BI3A 1Q82C 2K3XA 3FEOA 2RQRA 3HFOA 3CMAT 4Z89A 1ACMB 2SRCA 3BFMA 1M90C 5L8RE 4JS5A 3OQ5A 3CC7A 2FB7A 5GANd 2QEXT 1HK9A 4M7AG 1RACB 3CCMA 4KRTA 1G3TA 2E70A 2QA4Q 4F7UE 4M7AF 3ER0A 4C8QC 2JMAA 1WXBA 4E7SA 1IREB 1VQ8T 5FU6C 1EX4A 2LDMA 1VQMA 1U06A 1VQ6Q 3RMQA 1U1TA 5HCKA 4O5VA 1JEGA 1LOJA 5GAMj 4PL6A 2EWNA 7AT1B 3N5BB 1ZSGA 2H8HA 2J05A 1WA7A 2W0ZA 2RO0A 1IO6A 4E7IA 2RQUA 4C0DB 3QBYA 2NLUA 3SEMA 4R56A 3I35A 3CXCS 1D0YA 2MWOA 3CCUA 3C4SA 4NL2A 2CUBA 1YHQA 1G3WA 3AHUA 4F14A 3I9QA 3V8KA 2VV5A 2VYTA 2E6NA 3WVEB 4HCKA 4M75C 5DLQE 1E6HA 1AEYA 3ZBDA 4F17A 3CC7T 1D3BB 2QYZA 2QG9B 3REBB 1OZ2A 1OEBA 1YN8A 3VV0A 2D8HA 3LH5A 5KCOA 2YDLA 1VQOQ 4A54A 3BW1A 1YI2Q 5J39A 2XU8A 3CD6A 5DY9A 1UFFA 3PT9A 4FW2A 2DTIA 5FLXE 3FJ5A 4BDZA 1VQMT 5D6XA 2M0OA 4FYXB 1YITA 1OYXA 1SF9A 4IIOA 3JCMV 2GQVA 5HKCA 2KYMA 1NEBA 3BDLA 2NUPA 4RTZA 2GTOA 4BE1A 2CP6A 4L59A 3OS0A 3CCUT 2KEAA 1I07A 4NS5A 1YHQT 2I0NA 1SEMA 5KH6A 4LUDA 4PKCC 3HSBA 5CCAA 3H8ZA 4J7FA 4JJCA 2DL8A 2IPOB 5D7UA 4LDXA 4C92A 4M77C 2KQWA 2X4XA 1VQ9T 1VQLQ 2DBMA 1SSHA 1UDLA 1JJ2P 4M7DB 3CMAQ 3G1JA 1Q81U 2LNHB 2JS2A 2FYKA 1SRMA 1B07A 4XK8E 2YUNA 5GANg 2QEXQ 2QQ9A 1X6GA 2M1HA 4RG2A 2RK2A 2F69A 2K2VA 4J9CA 5HY6A 5LJ3e 1H8KA 1YITT 4J9FA 4M78D 1JXMA 2O4XA 2RHZA 4QQDA 3A98A 1GRIA 1MMAA 2E12A 2O9SA 1BYMA 1VQ8Q 1YJ9T 1AHJB 3CPWA 2HCKA 2ZGWA 2O2OA 3INZA 4OP0A 4OGCA 2JM9A 4A63B 2YLCA 2VB6A 1LCKA 1EIFA 1VUBA 3OSVA 2DRKA 2MMPA 1JRIA 3H0FA 2ATCB 2XHCA 3GPLA 3CCSQ 1K4US 1GCQC 4M7DD 2GFAA 1I0CA 1OX8A 1JJ2S 3QJYA 2K57A 4J5YA 3RESA 3QWYA 2L2PA 2CZ0B 4JZ4A 3S3MA 2A0FB 2ED1A 2DERA 1X01A 2MK5A 2DXUA 4Q5WA 1UHCA 4QW2A 2EYZA 5KE2A 1SG5A 2COWA 2F2WA 5A0DA 2ABLA 1PSFA 1QVFA 2KRSA 2DNUA 4M7DE 2R5MA 5I22A 3CC7Q 3JRZA 2L5QA 4OF1A 2A08A 3JCMQ 3CCMQ 3LWIA 1HYOA 2DXCA 5L23A 1QQJA 1D1BA 3QDFA 1MMDA 4HKEA 1TH7A 5FWBA 1WHKA 5LL6S 3RMSA 1UJYA 1Y7XA 5GAN8 3OYMA 2HD0A 3P8DA 3VYGA 1VQMQ 5KYYA 4HT8A 3M0TA 2HL3A 3SB2A 2VWFA 3C0CA 1WX6A 2EPDA 2KMTA 3QHSA 3TQ7P 4X9DA 3CQTA 1QWEA 4DBFA 5LJ5e 2GFUA 3G6EA 1RAIB 4ME7A 3CCUQ 1N6AA 4PFOA 2CT4A 1AT1B 2Y4XA 1YHQQ 2FO0A 5IHIA 2EKHA 5D6WA 2R58A 1RADB 2NUTB 4OB1B 1O75A 2P0PA 4PJOE 4C8QB 3NTHA 2DRMA 2AKLA 2X9HA 3M4GA 5LJ3f 5CAIA 5GMKl 1VOMA 2OTLA 3CBMA 1OQKA 3VKIA 1QVFS 4F7UA 5KYWA 1UGSB 4LDVA 1Q82U 1TSFA 4Z88A 1V29B 1FMWA 2LT4A 1RLPC 4VUBA 1M90U
chains in the Genus database with same CATH topology
1YNZA 1MV3A 2DM1A 3M0QA 4OMQA 1VYUA 4R0KA 4RUGA 3U23A 4Z8AA 1XOVA 2ROTA 1NLPC 3H0HA 1BU1A 1VA7A 4CC2A 2OI3A 3O5ZA 3VS5A 2K3BA 2KE9A 1M3BA 3EG1A 1VYVA 3I5SA 1OV3A 4J9BA 2CREA 1NG2A 2VVKA 2NUZA 4X1VA 4AFQC 2D0NA 1ZLMA 1WFWA 2NWMA 1SPKA 2J6OA 3IQLA 2IIMA 1T0HA 2LP5A 2FG0A 1KSWA 1UECA 1Z9ZA 2LCSA 1FYNA 2FPDA 3REAB 1QKWA 1UTIA 4JJBA 1SHGA 3RNJA 3EGUA 2J6FA 2AZVA 2O9VA 2OJ2A 4D8DA 3EG2A 3VS4A 4AG1C 1K0SA 2KNBB 1YWOA 2CH4A 1PKTA 1X27A 1E7OA 2F2XA 1K1ZA 2O31A 1M30A 3NMZC 1BBZA 3PVLA 1MUZA 2DILA 4J9IA 2A28A 4EIKA 1WXTA 2EGCA 2JM8A 1OPLA 4OMPA 2DLPA 2BZYA 1X43A 1QWFA 2FRWA 2J7IA 1WLPB 2KXCA 3ULRB 4RTYA 1T0JA 1QLYA 2EYWA 2BZXA 2DYBA 2RQRA 1PNJA 1AOJA 4Z89A 2SRCA 1UHFA 1OOTA 2O88A 1HD3A 1W1FA 2M51A 1PRLC 2RNAA 4F16A 2KRMA 3H41A 4LUEA 1QCFA 4KRTA 1X6BA 1GBQA 2GTJA 1JU5C 4QT7A 1EFNA 1W70A 2JMAA 2DMOA 2HEQA 2EYYA 1WXBA 1Z9QA 5EC7A 2JS0A 4J9DA 4DEXA 2X3XD 2EW3A 1RLQC 1J3TA 1GBRA 1AZEA 1U06A 2J6KA 1UUEA 1FMKA 5HCKA 4ESRA 3PVQA 2JTEA 1VYTA 1JEGA 1PKSA 2GBQA 2KYBA 4ZNXA 1ABOA 4IIMA 1M3CA 2RPNA 2AK5A 1PRMC 1ZSGA 2H8HA 2J05A 1WA7A 2W0ZA 3VS7A 1IO6A 3EG3A 1HJDA 1AWJA 2AKKA 2ROLA 2RQUA 2DF6A 1T3LA 1M8MA 1AZGB 1ZX6A 2LQWA 3SEMA 3I35A 2KROA 4CC4B 2HDAA 5IXFA 2LZ6B 2M0YA 1GCQA 2DL4A 2CUBA 1Y0MA 3JV3A 2E5KA 2LJ0A 4F14A 3I9QA 2MOXA 2EBPA 3UATA 2JMCA 1YP5A 4LNPA 4HCKA 5GJWB 1RUWA 2OAWA 4JJDA 1E6HA 1UE9A 1AEYA 2LJ1A 2ED0A 2C0IA 2BZ8A 4F17A 1WIEA 2VKNA 2RMOA 4J9GA 3REBB 1ZUYA 1OEBA 1JO8A 1GFCA 1YN8A 2D8HA 3LH5A 2YDLA 4M4ZA 1TUCA 2B86A 3VS6A 2L3SA 1UJ0A 4LE9A 3H0IA 3NGPA 2HBWA 1MV0B 1AWWA 1UGVA 2LQNA 1UFFA 1KIKA 1AD5A 3FJ5A 4OMNA 2KR3A 4IIOA 5IHNA 2DA9A 2DBKA 1A0NB 1K0XA 2RF0A 2RQTA 2DL3A 1AWXA 2A37A 3EHQA 2YSQA 2AZSA 1CKAA 2DE0X 2KYMA 1NEBA 3VS2A 1AWOA 2RQWA 3UA7A 3R6NA 2JT4A 2DX1A 4RTZA 2GTOA 2C0TA 2EGAA 4OMOA 2KEAA 2KT1A 2KT8A 4AFSC 1I07A 2I0NA 1SEMA 4LUDA 2KXDA 1JXOA 1WYXA 2CT3A 1I1JA 4CC3A 1ZUUA 2FPEA 1JQQA 2KGTA 4JJCA 2DL8A 1ABQA 3THKA 4K11A 1QKXA 2EVRA 1UG1A 2BTTA 2DBMA 1S1NA 5FW9A 4J9HA 1PHTA 2CSIA 1WDXA 3VS0A 2L0AA 1SSHA 1UDLA 4LN2A 1M3AA 3VS1A 2LNHB 2JS2A 4JPBW 3QWXX 1OPKA 1SRMA 1B07A 5IHKA 2YUNA 1X6GA 2RN8A 4RTWA 3NHNA 3VRYA 2FPFA 3UF4A 2D1XA 2PZ1A 4J9CA 1H8KA 1ARKA 2CH4W 4J9FA 1JXMA 2V1QA 1H3HA 3A98A 1GRIA 1N5ZA 3VS3A 2G6FX 2O9SA 3SHWA 1B3QA 3KFVA 4HVVA 2HCKA 2O2OA 1GFDA 1TG0A 2JM9A 5GJVB 4A63B 5ECAA 1AVZC 2QDLA 1LCKA 1W6XA 2GNCA 1U3OA 4HVWA 2DRKA 1K9AA 1NM7A 3H0FA 2A36A 5FWCA 1SHFA 1YCSB 1G83A 1X2QA 2ESWA 3PE0A 4D8KA 2K6DA 4AFZC 1K4US 1GCQC 1I0CA 1CSKA 2ECZA 1Y57A 3QWYA 2L2PA 2W10A 3TSWA 3GBQA 1KFZA 4JZ4A 1X69A 2LX7A 1GL5A 4RTXA 2ED1A 2GQIA 2D8JA 2PTKA 3M0UA 1X2KA 1UHCA 2EQIA 3M0SA 2CUDA 2EYZA 3NPFA 4Y92A 1K76A 2F2WA 4GLMA 2ABLA 3EHRA 2YT6A 1NYGA 2L3PA 1T3SA 2KRSA 2DNUA 3UA6A 2ENMA 5I22A 2K79A 2RQVA 2CSQA 2KRNA 1RI9A 1HSQA 2A08A 2JXBA 1GCPA 1WXUA 2K2MA 5L23A 4E6RA 2GGRA 3M0RA 1BB9A 4RTTA 2XMFA 5FWBA 2FRYA 3TSZA 2JW4A 1UJYA 1M27C 2V1RA 4J9EA 4RTVA 4RTUA 4AFUC 1NLOC 2PNIA 2EGEA 4WCIA 4AG2C 3M0TA 2VWFA 3C0CA 1CKBA 1WX6A 2YUQA 2EPDA 2EYXA 1ZUKA 4OMLA 1NYFA 2KBTA 3CQTA 2K9GA 1QWEA 1ZBJA 4ORZA 1TUDA 2LJ3A 4CC7A 3VRZA 3M0PA 1G2BA 2MIOA 1BK2A 1SRLA 3ZL7C 1KJWA 2CT4A 2HSPA 2F2VA 3EG0A 4OMMA 2FO0A 5IHIA 1U5SA 5IXBA 2EKHA 1H92A 1V1CA 2LMJA 2FEIA 1PWTA 2L3QA 2YUOA 4JZ3A 3RBBB 2CDTA 5IH2A 3I5RA 2K7AA 3TVTA 2J06A 4FSSA 2DRMA 5I11A 2AKLA 1YWPA 4GBQA 4DEYA 4HVUA 2C0OA 2X3WD 2DL7A 1E6GA 2P4RA 2SEMA 1WI7A 1NEGA 2YUPA 2MCNA 4Z88A 2DJQA 1RLPC 2DL5A 2DVJA 4HXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNZ A;  1MV3 A;  2DM1 A;  3M0Q A;  4OMQ A;  1VYU A;  4R0K A;  4RUG A;  3U23 A;  4Z8A A;  1XOV A;  2ROT A;  1NLP C;  3H0H A;  1BU1 A;  1VA7 A;  4CC2 A;  2OI3 A;  3O5Z A;  3VS5 A;  2K3B A;  2KE9 A;  1M3B A;  3EG1 A;  1VYV A;  3I5S A;  1OV3 A;  4J9B A;  2CRE A;  1NG2 A;  2VVK A;  2NUZ A;  4X1V A;  4AFQ C;  2D0N A;  1ZLM A;  1WFW A;  2NWM A;  1SPK A;  2J6O A;  3IQL A;  2IIM A;  1T0H A;  2LP5 A;  2FG0 A;  1KSW A;  1UEC A;  1Z9Z A;  2LCS A;  1FYN A;  2FPD A;  3REA B;  1QKW A;  1UTI A;  4JJB A;  1SHG A;  3RNJ A;  3EGU A;  2J6F A;  2AZV A;  2O9V A;  2OJ2 A;  4D8D A;  3EG2 A;  3VS4 A;  4AG1 C;  1K0S A;  2KNB B;  1YWO A;  2CH4 A;  1PKT A;  1X27 A;  1E7O A;  2F2X A;  1K1Z A;  2O31 A;  1M30 A;  3NMZ C;  1BBZ A;  3PVL A;  1MUZ A;  2DIL A;  4J9I A;  2A28 A;  4EIK A;  1WXT A;  2EGC A;  2JM8 A;  1OPL A;  4OMP A;  2DLP A;  2BZY A;  1X43 A;  1QWF A;  2FRW A;  2J7I A;  1WLP B;  2KXC A;  3ULR B;  4RTY A;  1T0J A;  1QLY A;  2EYW A;  2BZX A;  2DYB A;  2RQR A;  1PNJ A;  1AOJ A;  4Z89 A;  2SRC A;  1UHF A;  1OOT A;  2O88 A;  1HD3 A;  1W1F A;  2M51 A;  1PRL C;  2RNA A;  4F16 A;  2KRM A;  3H41 A;  4LUE A;  1QCF A;  4KRT A;  1X6B A;  1GBQ A;  2GTJ A;  1JU5 C;  4QT7 A;  1EFN A;  1W70 A;  2JMA A;  2DMO A;  2HEQ A;  2EYY A;  1WXB A;  1Z9Q A;  5EC7 A;  2JS0 A;  4J9D A;  4DEX A;  2X3X D;  2EW3 A;  1RLQ C;  1J3T A;  1GBR A;  1AZE A;  1U06 A;  2J6K A;  1UUE A;  1FMK A;  5HCK A;  4ESR A;  3PVQ A;  2JTE A;  1VYT A;  1JEG A;  1PKS A;  2GBQ A;  2KYB A;  4ZNX A;  1ABO A;  4IIM A;  1M3C A;  2RPN A;  2AK5 A;  1PRM C;  1ZSG A;  2H8H A;  2J05 A;  1WA7 A;  2W0Z A;  3VS7 A;  1IO6 A;  3EG3 A;  1HJD A;  1AWJ A;  2AKK A;  2ROL A;  2RQU A;  2DF6 A;  1T3L A;  1M8M A;  1AZG B;  1ZX6 A;  2LQW A;  3SEM A;  3I35 A;  2KRO A;  4CC4 B;  2HDA A;  5IXF A;  2LZ6 B;  2M0Y A;  1GCQ A;  2DL4 A;  2CUB A;  1Y0M A;  3JV3 A;  2E5K A;  2LJ0 A;  4F14 A;  3I9Q A;  2MOX A;  2EBP A;  3UAT A;  2JMC A;  1YP5 A;  4LNP A;  4HCK A;  5GJW B;  1RUW A;  2OAW A;  4JJD A;  1E6H A;  1UE9 A;  1AEY A;  2LJ1 A;  2ED0 A;  2C0I A;  2BZ8 A;  4F17 A;  1WIE A;  2VKN A;  2RMO A;  4J9G A;  3REB B;  1ZUY A;  1OEB A;  1JO8 A;  1GFC A;  1YN8 A;  2D8H A;  3LH5 A;  2YDL A;  4M4Z A;  1TUC A;  2B86 A;  3VS6 A;  2L3S A;  1UJ0 A;  4LE9 A;  3H0I A;  3NGP A;  2HBW A;  1MV0 B;  1AWW A;  1UGV A;  2LQN A;  1UFF A;  1KIK A;  1AD5 A;  3FJ5 A;  4OMN A;  2KR3 A;  4IIO A;  5IHN A;  2DA9 A;  2DBK A;  1A0N B;  1K0X A;  2RF0 A;  2RQT A;  2DL3 A;  1AWX A;  2A37 A;  3EHQ A;  2YSQ A;  2AZS A;  1CKA A;  2DE0 X;  2KYM A;  1NEB A;  3VS2 A;  1AWO A;  2RQW A;  3UA7 A;  3R6N A;  2JT4 A;  2DX1 A;  4RTZ A;  2GTO A;  2C0T A;  2EGA A;  4OMO A;  2KEA A;  2KT1 A;  2KT8 A;  4AFS C;  1I07 A;  2I0N A;  1SEM A;  4LUD A;  2KXD A;  1JXO A;  1WYX A;  2CT3 A;  1I1J A;  4CC3 A;  1ZUU A;  2FPE A;  1JQQ A;  2KGT A;  4JJC A;  2DL8 A;  1ABQ A;  3THK A;  4K11 A;  1QKX A;  2EVR A;  1UG1 A;  2BTT A;  2DBM A;  1S1N A;  5FW9 A;  4J9H A;  1PHT A;  2CSI A;  1WDX A;  3VS0 A;  2L0A A;  1SSH A;  1UDL A;  4LN2 A;  1M3A A;  3VS1 A;  2LNH B;  2JS2 A;  4JPB W;  3QWX X;  1OPK A;  1SRM A;  1B07 A;  5IHK A;  2YUN A;  1X6G A;  2RN8 A;  4RTW A;  3NHN A;  3VRY A;  2FPF A;  3UF4 A;  2D1X A;  2PZ1 A;  4J9C A;  1H8K A;  1ARK A;  2CH4 W;  4J9F A;  1JXM A;  2V1Q A;  1H3H A;  3A98 A;  1GRI A;  1N5Z A;  3VS3 A;  2G6F X;  2O9S A;  3SHW A;  1B3Q A;  3KFV A;  4HVV A;  2HCK A;  2O2O A;  1GFD A;  1TG0 A;  2JM9 A;  5GJV B;  4A63 B;  5ECA A;  1AVZ C;  2QDL A;  1LCK A;  1W6X A;  2GNC A;  1U3O A;  4HVW A;  2DRK A;  1K9A A;  1NM7 A;  3H0F A;  2A36 A;  5FWC A;  1SHF A;  1YCS B;  1G83 A;  1X2Q A;  2ESW A;  3PE0 A;  4D8K A;  2K6D A;  4AFZ C;  1K4U S;  1GCQ C;  1I0C A;  1CSK A;  2ECZ A;  1Y57 A;  3QWY A;  2L2P A;  2W10 A;  3TSW A;  3GBQ A;  1KFZ A;  4JZ4 A;  1X69 A;  2LX7 A;  1GL5 A;  4RTX A;  2ED1 A;  2GQI A;  2D8J A;  2PTK A;  3M0U A;  1X2K A;  1UHC A;  2EQI A;  3M0S A;  2CUD A;  2EYZ A;  3NPF A;  4Y92 A;  1K76 A;  2F2W A;  4GLM A;  2ABL A;  3EHR A;  2YT6 A;  1NYG A;  2L3P A;  1T3S A;  2KRS A;  2DNU A;  3UA6 A;  2ENM A;  5I22 A;  2K79 A;  2RQV A;  2CSQ A;  2KRN A;  1RI9 A;  1HSQ A;  2A08 A;  2JXB A;  1GCP A;  1WXU A;  2K2M A;  5L23 A;  4E6R A;  2GGR A;  3M0R A;  1BB9 A;  4RTT A;  2XMF A;  5FWB A;  2FRY A;  3TSZ A;  2JW4 A;  1UJY A;  1M27 C;  2V1R A;  4J9E A;  4RTV A;  4RTU A;  4AFU C;  1NLO C;  2PNI A;  2EGE A;  4WCI A;  4AG2 C;  3M0T A;  2VWF A;  3C0C A;  1CKB A;  1WX6 A;  2YUQ A;  2EPD A;  2EYX A;  1ZUK A;  4OML A;  1NYF A;  2KBT A;  3CQT A;  2K9G A;  1QWE A;  1ZBJ A;  4ORZ A;  1TUD A;  2LJ3 A;  4CC7 A;  3VRZ A;  3M0P A;  1G2B A;  2MIO A;  1BK2 A;  1SRL A;  3ZL7 C;  1KJW A;  2CT4 A;  2HSP A;  2F2V A;  3EG0 A;  4OMM A;  2FO0 A;  5IHI A;  1U5S A;  5IXB A;  2EKH A;  1H92 A;  1V1C A;  2LMJ A;  2FEI A;  1PWT A;  2L3Q A;  2YUO A;  4JZ3 A;  3RBB B;  2CDT A;  5IH2 A;  3I5R A;  2K7A A;  3TVT A;  2J06 A;  4FSS A;  2DRM A;  5I11 A;  2AKL A;  1YWP A;  4GBQ A;  4DEY A;  4HVU A;  2C0O A;  2X3W D;  2DL7 A;  1E6G A;  2P4R A;  2SEM A;  1WI7 A;  1NEG A;  2YUP A;  2MCN A;  4Z88 A;  2DJQ A;  1RLP C;  2DL5 A;  2DVJ A;  4HXJ A; 
#chains in the Genus database with same CATH topology
 4MZP A;  3RDV A;  1YNZ A;  3CD6 Q;  4JDS A;  1VYU A;  2DET A;  1VQ7 A;  4BB7 A;  4J6W A;  4JRI A;  5FU7 B;  1YIT Q;  1MND A;  3ASK A;  4LD6 A;  3TCJ A;  1M3B A;  4PJM A;  1VYV A;  4PLL A;  5GAO p;  1Y96 B;  1HXD A;  4J9B A;  2RI3 A;  5GAM e;  3E19 A;  3EGD A;  4M75 B;  1I5L A;  1VQK A;  4C8Q D;  3G6E T;  2CZ7 B;  1ZLM A;  1SPK A;  2QQS A;  2X4Y A;  3OYG A;  2ZPH B;  2LP5 A;  1KHC A;  1RAG B;  1RI0 A;  1FYN A;  3REA B;  3SWN B;  1RAE B;  4N0A C;  5GMK j;  4BDY A;  5CKB A;  3OA6 A;  1FX7 A;  3VS4 A;  1K0S A;  1YWO A;  2CH4 A;  2QGG A;  2O31 A;  4JLG A;  3NMZ C;  4C8Q E;  2OTL T;  3PVL A;  4FL6 A;  4M78 G;  2A7Y A;  2HQH A;  2JM8 A;  2EGC A;  1OPL A;  4YTL A;  2QA4 T;  2DLP A;  1WHL A;  3HKS A;  4XTX A;  4JS4 A;  4RTY A;  4EMK A;  4IUV A;  1QLY A;  2EJ9 A;  3M9Q A;  5M9O A;  5LJ3 j;  1KC8 C;  2DYB A;  1FXX A;  3CME A;  3V8J A;  1PD0 A;  4DBQ A;  1PNJ A;  2RB6 A;  3HL8 A;  4MZM A;  2MYS A;  4M75 D;  2HZY A;  2O88 A;  1VQ7 T;  1W1F A;  1R8O B;  2L89 A;  2M51 A;  3MP8 A;  3A1P A;  4BY6 B;  3H41 A;  3DLM A;  3QPH A;  2M16 A;  1C0M A;  1ZSZ C;  2LVM A;  3PMT A;  2DD4 A;  3RKW A;  1W2B P;  2E6Z A;  3FB9 A;  1W70 A;  1Z9Q A;  4M77 B;  5EC7 A;  2XDP A;  4J9D A;  2X3X D;  2EW3 A;  3OYI A;  2LCL A;  4KBM B;  3LW5 E;  4MDX A;  1PM3 A;  3MEU A;  1N27 A;  2P84 A;  5FRN A;  1C6V X;  2RPN A;  3M5A A;  3JB9 F;  1HJD A;  2ROL A;  1QP3 A;  2DF6 A;  4A4E A;  1D3B A;  3HRU A;  1AZG B;  1ZX6 A;  2AIR B;  3MEA A;  2JUF A;  2KRO A;  3VU3 C;  4FYW B;  4CC4 B;  1BI1 A;  3OBW A;  2M0Y A;  3MEV A;  3G71 A;  4JRK A;  3JV3 A;  2DK3 A;  2E5K A;  2LJ0 A;  4B9X A;  2HNI A;  2XI9 A;  2M9U A;  5GMK i;  2EBP A;  3CME T;  3MHX A;  5CKE A;  1K8A C;  2VGN A;  2OAW A;  2LJ1 A;  2ED0 A;  3CC2 A;  2MPX C;  3O8V A;  2F1L A;  4JRP A;  4J6Y A;  2VKN A;  2RMO A;  3QYH B;  4M77 D;  1KQS S;  4RG8 A;  2D0Q B;  4JJN K;  2A3L A;  4E7Z A;  2XDD A;  3JCM J;  3M59 A;  3VS6 A;  2VXE A;  1UJ0 A;  4LE9 A;  3OMG A;  2RJD A;  3H0I A;  4ZGJ B;  2EIF A;  3NGP A;  4M78 A;  1MV0 B;  1AWW A;  1KIK A;  2MF2 A;  3CBO A;  1N8R R;  4M77 E;  4OMN A;  3CBP A;  3NTK A;  1IGQ A;  1NBE B;  2FZG B;  2Y4Y A;  3G6E Q;  1K0X A;  2DL3 A;  3QII A;  3HRT A;  1N8R C;  3DB3 A;  4HT9 A;  2YSQ A;  5GAN 2;  3VS2 A;  1WQ7 A;  3OYE A;  2RQW A;  2DX1 A;  2D9T A;  3EFS A;  3CXC P;  2RD1 A;  4M7D A;  2KSS A;  4IUP A;  2KXD A;  5HK3 A;  4DOW A;  4PFZ A;  3OW2 S;  1LJO A;  2LT1 A;  1WYX A;  2CT3 A;  2OTL Q;  4B6M A;  3A8H B;  2DEU A;  3CC4 A;  2QQA A;  1X75 C;  4ATO A;  1QKX A;  5GAN 7;  4CI0 C;  1M5Q 1;  1SSF A;  1S1N A;  2X4W A;  1PHT A;  1WHM A;  4M7A C;  1WDX A;  2IVW A;  4LN2 A;  1WJR A;  2EQU A;  4C92 G;  2ZPB B;  3TU4 K;  2JTF A;  5CQY A;  2XD0 A;  5FRM A;  1VQ7 Q;  3QKJ A;  4C92 F;  3JCM P;  2LCC A;  5I2M A;  1H3Z A;  1WGS A;  3SFM A;  1OPK A;  3FDR A;  4C92 C;  2RN8 A;  3JCM f;  3UF4 A;  3M57 A;  2LTO A;  4IUQ A;  3BY7 A;  9ATC B;  5CO7 A;  3CCS T;  2JVV A;  5LJ5 h;  1VQK Q;  3EG9 A;  3EGX B;  4ZTJ A;  1BIA A;  1M1K R;  1N5Z A;  3VS3 A;  1UEB A;  3PNW C;  3GP8 A;  1QCO A;  4KUI A;  3LH0 A;  2YLB A;  1VIE A;  1M1K C;  1G8X A;  4HVW A;  4A53 A;  2HQE A;  1RAH B;  2PU9 B;  3PE0 A;  2HKQ B;  3UPU A;  3EH2 A;  1CSK A;  1Q7Y R;  3I56 A;  3CCM T;  2OTJ A;  1R0C B;  1TXQ A;  3URG A;  3L2Z A;  4ANJ A;  1YJN A;  3GNG A;  3OMC A;  5J26 A;  3MP6 A;  4RMO A;  2GQI A;  1DJ7 B;  3M0U A;  1X2K A;  1Q7Y C;  3M0S A;  3CME Q;  4A4G A;  5GAN 6;  1TS9 A;  5GAO m;  2H3J A;  3NPF A;  3EH1 A;  5GAO q;  4XAX B;  4GLM A;  2RJE A;  2RQV A;  3CCE A;  2KRN A;  2QTV A;  3J81 E;  4IKF A;  2HSE B;  1HSQ A;  5GAM h;  2K2M A;  3OS1 A;  4MDW A;  3KBG A;  5A0L A;  1BB9 A;  4RTT A;  3DKM A;  5IN1 A;  2FRY A;  3TSZ A;  2JW4 A;  4P5N A;  1YCY A;  1M27 C;  2CP7 A;  2ZCF B;  4J9E A;  3VYH B;  4DOV A;  2RK1 A;  4II1 A;  4E2F B;  1M2O A;  1OZ3 A;  2NUT A;  4AG2 C;  4OB3 B;  2LNV A;  2X4J A;  3L2W A;  2DFU A;  4C8Q A;  5LJ5 d;  3P8H A;  2K9G A;  5GMK e;  3CCR A;  3LX7 A;  3UT1 A;  3E2U A;  2RM4 A;  5FRO A;  3A8L B;  1B7T A;  1WHH A;  1B34 B;  2MIO A;  1YJN T;  1Q95 G;  2X35 A;  3KXT A;  3G71 Q;  3EG0 A;  4XTV A;  2LMJ A;  2B8A A;  3CD6 T;  3RBB B;  1ZSZ B;  2CDT A;  2WSF E;  1K73 R;  3I5R A;  3OYC A;  3L2Q A;  3HTR A;  3DLL A;  3CC2 Q;  1YWP A;  4DEY A;  3CCE T;  1K73 C;  1NEG A;  2K5I A;  1Y96 A;  4XQ3 A;  3AT1 B;  3LLR A;  4M75 A;  4ZGE B;  2CP3 A;  1Q86 R;  1MMG A;  4C5H A;  4F7U G;  4L6V 5;  4HXJ A;  4OMQ A;  4R0K A;  3U23 A;  4F7U F;  2QAZ A;  3X25 B;  3EFO A;  5J3B A;  4QQ6 A;  2AHJ B;  1Q86 C;  3QG1 A;  3H0H A;  2VC8 A;  1BU1 A;  2BIV A;  4CC2 A;  3I55 A;  2OI3 A;  3VS5 A;  2K3B A;  5GAM d;  4C5I A;  3SWN A;  3G4S A;  3A8M B;  1G5V A;  1VQ5 A;  3I5S A;  1QVG A;  1OV3 A;  3EAE A;  4BE0 A;  2VGM A;  4PJO B;  4Y91 A;  2PVG B;  1NG2 A;  2VVK A;  3JSC A;  1UGP B;  3RKY A;  2NUZ A;  1WJS A;  4AFQ C;  1WFW A;  5GAO n;  1GXI E;  2E1H A;  2BE9 B;  3S3O A;  1S72 A;  1KSW A;  2LCS A;  3CCJ A;  3RUX A;  1MNE A;  1F1B B;  4BE2 A;  2L8D A;  3CC4 Q;  5DLO A;  3PIO A;  2DYI A;  3OSS C;  4D8D A;  2OJ2 A;  3EG2 A;  3X24 B;  2K3Y A;  1PCX A;  2OAU A;  1KK7 A;  1MUZ A;  1QVF P;  2A28 A;  1WXT A;  4OMP A;  4OB0 B;  2V8J A;  3J80 E;  1TUG B;  2FRW A;  1WLP B;  3ULR B;  3CPW S;  5AT1 B;  4HA8 A;  2BZX A;  2E5Q A;  2P4T A;  4M77 A;  3PGG A;  1AOJ A;  4PJO D;  1UHF A;  1HD3 A;  4E7H A;  2YRV A;  4C5G A;  3LYI A;  1KHI A;  3I55 T;  1PRL C;  2HMA A;  4KT0 E;  4BUG A;  4EMK C;  1X6B A;  1GBQ A;  2JNG A;  1JU5 C;  4PNO A;  2YRC A;  4QT7 A;  1M4Z A;  4PLI A;  1WZO A;  5GAN f;  2DIG A;  2HEQ A;  2LX9 A;  2RI5 A;  5DM7 R;  2KAF A;  3RER A;  2JS0 A;  2VUB A;  4DEX A;  3OYN A;  5LJ5 g;  1S72 T;  4M7A B;  1J3T A;  5FU6 B;  1UUE A;  4FCY A;  2XIC A;  3CCJ T;  1FMK A;  2COY A;  4ESR A;  4KUD K;  3QJ6 A;  1ZA1 B;  2GBQ A;  1N8R U;  2EQK A;  2KYB A;  4ZNX A;  3I56 Q;  2OTJ Q;  2MAM A;  3VS7 A;  1D1A A;  1YJN Q;  3EG3 A;  2DTO A;  1AWJ A;  2AKK A;  1KQ2 A;  1VQP A;  1T3L A;  4OB2 B;  3PFS A;  1NE8 A;  5GAN 5;  2HDA A;  3GOX A;  4XTY A;  2LZ6 B;  4IUU A;  1GCQ A;  4E7L A;  1Y0M A;  4DBR A;  4WTO B;  2CS7 A;  3L2R A;  4KGZ B;  3UAT A;  2JMC A;  4LNP A;  3CCE Q;  2CP5 A;  3VJP A;  5KYX B;  2PVO B;  1BI0 A;  1RL2 A;  3M58 A;  4E47 A;  1KD1 R;  2BZ8 A;  1Y71 A;  3L2V A;  2E10 A;  2Y90 A;  3R6O A;  3A8O B;  1ZUY A;  1JO8 A;  1GFC A;  1RAB B;  2QGF B;  2QXF A;  4M7A D;  2PUK B;  3HHT B;  2B86 A;  4Y28 E;  1XQH A;  4QQG A;  4ZTF A;  1KD1 C;  3NTI A;  3V7S A;  4RCB A;  1YJW A;  2L3S A;  2RHI A;  1D09 B;  4KGV B;  3QDR B;  2HKN A;  1KQ1 A;  2L3R A;  5GAM g;  2DTH A;  4FU6 A;  2IG0 A;  2KVQ G;  2CP2 A;  1LVK A;  2ZPI B;  1N9R A;  3CCR Q;  1KC8 R;  3MO8 A;  4AMC A;  2KR3 A;  2GCX A;  2MI6 A;  4C0G A;  3E9G A;  1Q81 C;  1K9M R;  4M7A E;  5GAN j;  2DBK A;  2RF0 A;  1AWX A;  4M78 F;  4FYV B;  3EHQ A;  3V8L A;  1C1A A;  2AZS A;  4XU2 A;  1M1K U;  1VQP T;  4M78 C;  5CKH A;  5KYU B;  2I2L A;  1VQN A;  3UA7 A;  2PUO B;  1K9M C;  4BAC A;  5KYN A;  2C0T A;  2EGA A;  1NPP A;  4C92 E;  4AFS C;  4L5G A;  3VUB A;  2DXB A;  4CC3 A;  4FSX A;  4M7D G;  1JQQ A;  1M8V A;  3MP1 A;  2EVR A;  1TWB A;  3MPU B;  1Q7Y U;  1VQK T;  2BTT A;  2GF7 A;  1QVP A;  1FWZ A;  2BE7 D;  5FW9 A;  1KQS P;  4J9H A;  2RJF A;  4ELZ C;  3QUI A;  2CSI A;  2L0A A;  2HAX A;  3CCL A;  2DVE A;  1D1C A;  1ZQ1 A;  4WF2 A;  3VS1 A;  4JPB W;  3M54 A;  1I81 A;  2AT1 B;  3ME9 A;  3I55 Q;  3JCM e;  1W4S A;  1D0Z A;  3G4S Q;  4J7I A;  1VQ5 Q;  2FPF A;  5GMK h;  1UB4 A;  1H64 1;  4UC4 A;  2RHX A;  1VIF A;  2KDS A;  2V1Q A;  3NFC A;  4XTU A;  1K8A R;  2G6F X;  1B3Q A;  4HVV A;  2P0Q A;  3L42 A;  1TG0 A;  5GJV B;  1S72 Q;  5ECA A;  2NYS A;  1YFN A;  2RHU A;  1AVZ C;  2QDL A;  3OYL A;  1VQN T;  3CCJ Q;  3OYB A;  3OYH A;  1OUL A;  2GNC A;  3PIP A;  1P92 A;  1U3O A;  3MJX A;  5LJ3 h;  3ZFJ A;  2DZ9 A;  2CYZ B;  5FWC A;  2A36 A;  4PJO G;  2JTM A;  1SHF A;  1YCS B;  1X2Q A;  2ESW A;  4D8K A;  2K6D A;  2YWW A;  3OW2 P;  4E7J A;  1O9S A;  4AFZ C;  3J7A F;  2KI7 A;  3OYK A;  2ECZ A;  3TSW A;  3OB9 A;  3JCM W;  1KFZ A;  1X69 A;  4N0A A;  4RTX A;  3JAM E;  2JOY A;  2RA2 A;  2EQI A;  5A0G A;  2CUD A;  5GAO r;  3CCL T;  3JB9 J;  4Y92 A;  1K76 A;  2YT6 A;  1K73 U;  1NYG A;  2L3P A;  2EAY A;  2ENM A;  3OS5 A;  2DEQ A;  3OYD A;  2QTX A;  2CSQ A;  5C6S A;  5CK9 A;  1GCP A;  4LXC A;  4QKU A;  2WSC E;  4NOY A;  1IZ6 A;  4J83 A;  2CZ1 B;  4J6X A;  2GGR A;  4O6J A;  3M0R A;  2EJG A;  1NPR A;  2K4Y A;  2K5L A;  2XMF A;  4ZN1 A;  2XKO C;  2E41 A;  2JN0 A;  3T9N A;  3G71 T;  1Q86 U;  1B34 A;  3V7R A;  4RTV A;  4HCZ A;  3UWN A;  1NLO C;  2PNI A;  4B9W A;  2EGE A;  4WCI A;  2RH2 A;  1ZSZ A;  2YUQ A;  1BKB A;  3X28 B;  2EYX A;  5GAN 3;  1ZUK A;  3CC2 T;  2E64 A;  1MHN A;  2D6F A;  1QCN A;  4MZT A;  3MKD A;  1ZBJ A;  3P8B B;  1VQP Q;  4R55 A;  2FL7 A;  2DD5 A;  3A5Z B;  1TUD A;  4C8Q G;  4RKU E;  4MML A;  3VRZ A;  3M0P A;  1G2B A;  5CKD A;  4C8Q F;  4OVA A;  1KJW A;  4OMM A;  1U5S A;  5IXB A;  4PJL A;  1V1C A;  2FEI A;  5LJ3 d;  1PWT A;  2L3Q A;  4EMK B;  3C94 A;  2RI2 A;  3V7C A;  5IH2 A;  2OX7 A;  3GLX A;  2J06 A;  5I21 A;  5I11 A;  4XTZ A;  5KE3 A;  2C0O A;  2X3W D;  1E6G A;  2HL5 C;  2P4R A;  1ZA2 B;  4AT1 B;  1WI7 A;  2EQM A;  4MMK A;  2DO3 A;  2YUP A;  1JBM A;  2ZPE B;  2MCN A;  4PJO A;  3GNF B;  1YJW Q;  3S3N A;  3JB9 H;  1BI2 A;  4J8O A;  2DL5 A;  2DVJ A;  1M2V B;  4F04 B;  5I2S A;  4JRQ A;  5GAO l;  2DM1 A;  3M0Q A;  4RUG A;  4Z8A A;  4M75 G;  5FU7 C;  1XOV A;  1YIJ A;  4KGX B;  4DBH A;  4KH0 B;  4PK4 A;  4M75 F;  3CC4 T;  2ZPG B;  1M1F A;  3O5Z A;  5CQX A;  2KE9 A;  3EG1 A;  1XTD A;  4DQ2 A;  2JZ2 A;  2EQJ A;  2CRE A;  4FYY B;  2YHT A;  2YRD A;  4EPC A;  2C06 A;  1ZBX A;  1VQ9 A;  1VQN Q;  3HRS A;  3C12 A;  2J6O A;  3IQL A;  2IIM A;  4DA4 A;  1WPY A;  2KY9 A;  4FM4 B;  2FG0 A;  4XU3 A;  5A2Q E;  3SWN C;  3QZ5 B;  2H3E B;  3VUZ A;  3CEY A;  1UTI A;  4HCB A;  3D7S B;  3JCM c;  3EGU A;  2J6F A;  2O9V A;  4FT4 A;  4GY5 A;  2KNB B;  1PKT A;  1X27 A;  1E7O A;  2F2X A;  1K1Z A;  3H9N A;  1KG1 A;  4NL3 A;  1BBZ A;  4J9I A;  2QQB A;  4E7K A;  1JB0 E;  3CCL Q;  3ZEH A;  5C0M A;  2HBP A;  1NJI R;  2J7I A;  1YJ9 A;  4IUR A;  3Q1J A;  5IT9 E;  3FRN A;  2EYW A;  4JUV A;  2K5F A;  3MET A;  2JJ9 A;  2P0K A;  5CIU A;  1IRX A;  1PG5 B;  4GLK A;  3WXM B;  4M78 B;  1YIJ T;  3OYA A;  1OOT A;  4BY6 C;  1NJI C;  3M53 A;  4M7A A;  2RNA A;  3HPW A;  4M77 G;  3I56 T;  1JJ2 A;  4F16 A;  2OTJ T;  2KRM A;  3CCQ A;  1KD1 U;  4LUE A;  3LWH A;  4M77 F;  4QVC A;  1QCF A;  4FIB A;  2COZ A;  2GTJ A;  5GAN e;  3KUF A;  2VXF A;  3OS2 A;  1U1S A;  1EFN A;  1MMN A;  4EMH A;  2DMO A;  2EYY A;  4KUL A;  1RLQ C;  1GBR A;  4OGE A;  2WAC A;  2FVU A;  2G3R A;  1AZE A;  2J6K A;  3PVQ A;  2JTE A;  1VYT A;  1PKS A;  1ABO A;  1G3S A;  2V8I A;  5KYX A;  4IIM A;  1KC8 U;  1M3C A;  2EJF A;  2AK5 A;  2ZAE A;  1PRM C;  3TEE A;  1K9M U;  3PTA A;  3M56 A;  3PMI A;  1M8M A;  1I4K 1;  2LQW A;  1TTH B;  3OBY A;  5LJ3 g;  5IXF A;  3M4Y A;  1UGQ B;  2BKD N;  2DL4 A;  1XNI A;  3CPW P;  3JCM h;  4ZN3 A;  2MOX A;  4CRI A;  1FMV A;  1YP5 A;  5CR2 A;  5GJW B;  1RUW A;  1U8R A;  4JJD A;  1UE9 A;  1R77 A;  3CCR T;  4A4H A;  2C0I A;  1BIB A;  1WIE A;  3E1S A;  3JCM b;  4M78 E;  1PD1 A;  4J9G A;  3SD4 A;  3GIB A;  3CCQ T;  2E3I A;  2R57 A;  4N4H A;  3EG9 B;  4IUT A;  4M4Z A;  1TUC A;  4Z02 A;  5CKF A;  3CCV A;  2LRQ A;  2DZC A;  5GAN 4;  3WVD B;  1QVG P;  2PQW A;  5KYU A;  2DPP B;  1TOV A;  4LDY A;  2HBW A;  3GF5 A;  4LDW A;  1UGV A;  2LQN A;  1VQ4 A;  2WSE E;  3RR6 A;  1AD5 A;  4A4F A;  2XID A;  2QK0 A;  4ZGD B;  2QI2 A;  3JB9 D;  5IHN A;  2KK4 A;  2DA9 A;  1A0N B;  2RQT A;  1Y07 A;  1R0B G;  4QVZ A;  2LQK A;  4FT2 A;  1NZ9 A;  2A37 A;  2E3H A;  2ZZD A;  1K8A U;  1CKA A;  2DE0 X;  1AWO A;  4RCC A;  4LD9 K;  2F5T X;  3R6N A;  2JT4 A;  3LGF A;  4OMO A;  1RAA B;  1I5O B;  1TU0 B;  2KT1 A;  2KT8 A;  3EFR A;  1RAF B;  3F70 A;  1JXO A;  3G4S T;  1I1J A;  1ZUU A;  4ELY C;  1PSE A;  2FPE A;  1VQ5 T;  2KGT A;  1ABQ A;  3THK A;  4K11 A;  4KH1 B;  1QVG S;  1UG1 A;  3SDZ A;  1M9S A;  1QP2 A;  2NUP B;  2FHD A;  3FC3 A;  3M55 A;  2PVD B;  4D6W A;  2FZK B;  3VS0 A;  3S6W A;  1M3A A;  3JCM d;  3CCV T;  1YIJ Q;  1X6O A;  2HQX A;  3QWX X;  3QO3 A;  5IHK A;  4RTW A;  3VRY A;  1WHG A;  3NHN A;  4C0D C;  1VQ4 T;  2D1X A;  2X51 A;  2PZ1 A;  4C92 B;  4C0Z A;  1ARK A;  2CH4 W;  2DAQ A;  1H3H A;  1VQ9 Q;  2XG8 D;  1WJQ A;  3SHW A;  3KFV A;  2QA4 A;  3E9F A;  1GFD A;  1MGQ A;  2LQ8 A;  2QAS A;  1OU8 A;  2M02 A;  1W6X A;  1K9A A;  1NM7 A;  1OU9 A;  2CP0 A;  1G83 A;  1VQ6 A;  3OYJ A;  4FW1 A;  3CPF A;  5GMK m;  2O4X B;  5CVI A;  1Y57 A;  2W10 A;  1IB8 A;  3QSU A;  3GBQ A;  4EMG A;  2LX7 A;  4BI4 A;  3OYY A;  1GL5 A;  4TVR A;  1YJ9 Q;  2YXY A;  2LC4 A;  1ZHI A;  3FLG A;  2D8J A;  2PTK A;  1Q81 R;  2BUD A;  4C92 D;  2DJZ A;  3QYG B;  3EHR A;  3EFO B;  2RJC A;  3BE3 A;  5AYF A;  4A4K A;  1T3S A;  3UA6 A;  1OX9 A;  8ATC B;  1V76 A;  2K79 A;  3CCQ Q;  1RI9 A;  2JXB A;  1D0X A;  1WXU A;  4N4G A;  4E6R A;  4C5E A;  1LPL A;  4PJN A;  2QDY B;  3C95 A;  2MWP A;  2V1R A;  5EG2 A;  1QW1 A;  1VQO A;  5KCH A;  4RTU A;  4OMF B;  4AFU C;  2CZ6 B;  1YI2 A;  1EZZ B;  1IGU A;  4PJJ A;  2EFI A;  1IHW A;  1CKB A;  3HP9 A;  2F5K A;  4XU0 A;  2ZPF B;  4M7D F;  2V26 A;  3MCA B;  1W2B A;  4OML A;  1NYF A;  2KBT A;  1VQ6 T;  4C0F A;  1KQS A;  4ORZ A;  4M7D C;  3FIF A;  3LGL A;  5D6Y A;  3EGX A;  5LJ5 f;  2LJ3 A;  2Z0W A;  4CC7 A;  2E4H A;  4N4I A;  1BK2 A;  1SRL A;  3X26 B;  3RKX A;  3ZL7 C;  2HSP A;  4BI8 B;  1YJW T;  2F2V A;  1YBY A;  2CKK A;  3X20 B;  3OYF A;  3DB4 A;  1H92 A;  3BDU A;  4EDU A;  5KYY B;  1N9S A;  2YUO A;  1UGR B;  2DIQ A;  4JZ3 A;  1OI1 A;  1M2V A;  2E65 A;  4X9C A;  1BCO A;  2V8K A;  4M75 E;  3TVT A;  2K7A A;  6AT1 B;  2CGH A;  1QMC A;  1WQW A;  4FSS A;  4GBQ A;  1IHV A;  2FZC B;  4HVU A;  2DL7 A;  1PC0 A;  3UDC A;  1BI3 A;  3JB9 G;  3OY9 A;  4V2S A;  2SEM A;  3TRE A;  5GAN h;  2QQR A;  4XU1 A;  3CCV Q;  3JCM g;  5IAY A;  1VQL A;  2DJQ A;  1NJI U;  3H6Z A;  1MV3 A;  3CMA A;  3A8G B;  1VQO T;  2R5A A;  4LDU A;  1VQ4 Q;  3OW2 A;  2ROT A;  1NLP C;  1WHJ A;  3JB9 I;  4PJO F;  1YI2 T;  1VA7 A;  4X34 A;  1XJW B;  4F7U B;  2QEX A;  5KYW B;  4PJO C;  1I8F A;  2EKO A;  4XTW A;  3L2U A;  3MEW A;  2EYQ A;  5HK0 A;  1BCM A;  2VAS A;  1W2B S;  5GAM f;  4X1V A;  1M1G A;  2D0N A;  4BD3 A;  2NWM A;  4QVD A;  2DKG A;  1VQ8 A;  1T0H A;  1SKU B;  3L1A A;  1IXD A;  3JCM X;  1WNL A;  4JLI A;  1UEC A;  1Z9Z A;  4PFP A;  2FPD A;  1QKW A;  4JJB A;  1SHG A;  1LNX A;  3RNJ A;  2AZV A;  5LJ5 j;  3QZ9 B;  2XK0 A;  4AG1 C;  2DXT A;  3EGD B;  2XDB A;  3CCS A;  1M30 A;  3CXC A;  1G3Y A;  2O01 E;  3RIR A;  2DIL A;  1Q82 R;  3QXE B;  4EIK A;  2RHY A;  3G7Z A;  2BZY A;  1X43 A;  1QWF A;  4HCC A;  8AT1 B;  3FJP A;  1M90 R;  1VQL T;  2KXC A;  1T0J A;  3HFN A;  4BI3 A;  1Q82 C;  2K3X A;  3FEO A;  2RQR A;  3HFO A;  3CMA T;  4Z89 A;  1ACM B;  2SRC A;  3BFM A;  1M90 C;  5L8R E;  4JS5 A;  3OQ5 A;  3CC7 A;  2FB7 A;  5GAN d;  2QEX T;  1HK9 A;  4M7A G;  1RAC B;  3CCM A;  4KRT A;  1G3T A;  2E70 A;  2QA4 Q;  4F7U E;  4M7A F;  3ER0 A;  4C8Q C;  2JMA A;  1WXB A;  4E7S A;  1IRE B;  1VQ8 T;  5FU6 C;  1EX4 A;  2LDM A;  1VQM A;  1U06 A;  1VQ6 Q;  3RMQ A;  1U1T A;  5HCK A;  4O5V A;  1JEG A;  1LOJ A;  5GAM j;  4PL6 A;  2EWN A;  7AT1 B;  3N5B B;  1ZSG A;  2H8H A;  2J05 A;  1WA7 A;  2W0Z A;  2RO0 A;  1IO6 A;  4E7I A;  2RQU A;  4C0D B;  3QBY A;  2NLU A;  3SEM A;  4R56 A;  3I35 A;  3CXC S;  1D0Y A;  2MWO A;  3CCU A;  3C4S A;  4NL2 A;  2CUB A;  1YHQ A;  1G3W A;  3AHU A;  4F14 A;  3I9Q A;  3V8K A;  2VV5 A;  2VYT A;  2E6N A;  3WVE B;  4HCK A;  4M75 C;  5DLQ E;  1E6H A;  1AEY A;  3ZBD A;  4F17 A;  3CC7 T;  1D3B B;  2QYZ A;  2QG9 B;  3REB B;  1OZ2 A;  1OEB A;  1YN8 A;  3VV0 A;  2D8H A;  3LH5 A;  5KCO A;  2YDL A;  1VQO Q;  4A54 A;  3BW1 A;  1YI2 Q;  5J39 A;  2XU8 A;  3CD6 A;  5DY9 A;  1UFF A;  3PT9 A;  4FW2 A;  2DTI A;  5FLX E;  3FJ5 A;  4BDZ A;  1VQM T;  5D6X A;  2M0O A;  4FYX B;  1YIT A;  1OYX A;  1SF9 A;  4IIO A;  3JCM V;  2GQV A;  5HKC A;  2KYM A;  1NEB A;  3BDL A;  2NUP A;  4RTZ A;  2GTO A;  4BE1 A;  2CP6 A;  4L59 A;  3OS0 A;  3CCU T;  2KEA A;  1I07 A;  4NS5 A;  1YHQ T;  2I0N A;  1SEM A;  5KH6 A;  4LUD A;  4PKC C;  3HSB A;  5CCA A;  3H8Z A;  4J7F A;  4JJC A;  2DL8 A;  2IPO B;  5D7U A;  4LDX A;  4C92 A;  4M77 C;  2KQW A;  2X4X A;  1VQ9 T;  1VQL Q;  2DBM A;  1SSH A;  1UDL A;  1JJ2 P;  4M7D B;  3CMA Q;  3G1J A;  1Q81 U;  2LNH B;  2JS2 A;  2FYK A;  1SRM A;  1B07 A;  4XK8 E;  2YUN A;  5GAN g;  2QEX Q;  2QQ9 A;  1X6G A;  2M1H A;  4RG2 A;  2RK2 A;  2F69 A;  2K2V A;  4J9C A;  5HY6 A;  5LJ3 e;  1H8K A;  1YIT T;  4J9F A;  4M78 D;  1JXM A;  2O4X A;  2RHZ A;  4QQD A;  3A98 A;  1GRI A;  1MMA A;  2E12 A;  2O9S A;  1BYM A;  1VQ8 Q;  1YJ9 T;  1AHJ B;  3CPW A;  2HCK A;  2ZGW A;  2O2O A;  3INZ A;  4OP0 A;  4OGC A;  2JM9 A;  4A63 B;  2YLC A;  2VB6 A;  1LCK A;  1EIF A;  1VUB A;  3OSV A;  2DRK A;  2MMP A;  1JRI A;  3H0F A;  2ATC B;  2XHC A;  3GPL A;  3CCS Q;  1K4U S;  1GCQ C;  4M7D D;  2GFA A;  1I0C A;  1OX8 A;  1JJ2 S;  3QJY A;  2K57 A;  4J5Y A;  3RES A;  3QWY A;  2L2P A;  2CZ0 B;  4JZ4 A;  3S3M A;  2A0F B;  2ED1 A;  2DER A;  1X01 A;  2MK5 A;  2DXU A;  4Q5W A;  1UHC A;  4QW2 A;  2EYZ A;  5KE2 A;  1SG5 A;  2COW A;  2F2W A;  5A0D A;  2ABL A;  1PSF A;  1QVF A;  2KRS A;  2DNU A;  4M7D E;  2R5M A;  5I22 A;  3CC7 Q;  3JRZ A;  2L5Q A;  4OF1 A;  2A08 A;  3JCM Q;  3CCM Q;  3LWI A;  1HYO A;  2DXC A;  5L23 A;  1QQJ A;  1D1B A;  3QDF A;  1MMD A;  4HKE A;  1TH7 A;  5FWB A;  1WHK A;  5LL6 S;  3RMS A;  1UJY A;  1Y7X A;  5GAN 8;  3OYM A;  2HD0 A;  3P8D A;  3VYG A;  1VQM Q;  5KYY A;  4HT8 A;  3M0T A;  2HL3 A;  3SB2 A;  2VWF A;  3C0C A;  1WX6 A;  2EPD A;  2KMT A;  3QHS A;  3TQ7 P;  4X9D A;  3CQT A;  1QWE A;  4DBF A;  5LJ5 e;  2GFU A;  3G6E A;  1RAI B;  4ME7 A;  3CCU Q;  1N6A A;  4PFO A;  2CT4 A;  1AT1 B;  2Y4X A;  1YHQ Q;  2FO0 A;  5IHI A;  2EKH A;  5D6W A;  2R58 A;  1RAD B;  2NUT B;  4OB1 B;  1O75 A;  2P0P A;  4PJO E;  4C8Q B;  3NTH A;  2DRM A;  2AKL A;  2X9H A;  3M4G A;  5LJ3 f;  5CAI A;  5GMK l;  1VOM A;  2OTL A;  3CBM A;  1OQK A;  3VKI A;  1QVF S;  4F7U A;  5KYW A;  1UGS B;  4LDV A;  1Q82 U;  1TSF A;  4Z88 A;  1V29 B;  1FMW A;  2LT4 A;  1RLP C;  4VUB A;  1M90 U; 
#chains in the Genus database with same CATH homology
 1YNZ A;  1MV3 A;  2DM1 A;  3M0Q A;  4OMQ A;  1VYU A;  4R0K A;  4RUG A;  3U23 A;  4Z8A A;  1XOV A;  2ROT A;  1NLP C;  3H0H A;  1BU1 A;  1VA7 A;  4CC2 A;  2OI3 A;  3O5Z A;  3VS5 A;  2K3B A;  2KE9 A;  1M3B A;  3EG1 A;  1VYV A;  3I5S A;  1OV3 A;  4J9B A;  2CRE A;  1NG2 A;  2VVK A;  2NUZ A;  4X1V A;  4AFQ C;  2D0N A;  1ZLM A;  1WFW A;  2NWM A;  1SPK A;  2J6O A;  3IQL A;  2IIM A;  1T0H A;  2LP5 A;  2FG0 A;  1KSW A;  1UEC A;  1Z9Z A;  2LCS A;  1FYN A;  2FPD A;  3REA B;  1QKW A;  1UTI A;  4JJB A;  1SHG A;  3RNJ A;  3EGU A;  2J6F A;  2AZV A;  2O9V A;  2OJ2 A;  4D8D A;  3EG2 A;  3VS4 A;  4AG1 C;  1K0S A;  2KNB B;  1YWO A;  2CH4 A;  1PKT A;  1X27 A;  1E7O A;  2F2X A;  1K1Z A;  2O31 A;  1M30 A;  3NMZ C;  1BBZ A;  3PVL A;  1MUZ A;  2DIL A;  4J9I A;  2A28 A;  4EIK A;  1WXT A;  2EGC A;  2JM8 A;  1OPL A;  4OMP A;  2DLP A;  2BZY A;  1X43 A;  1QWF A;  2FRW A;  2J7I A;  1WLP B;  2KXC A;  3ULR B;  4RTY A;  1T0J A;  1QLY A;  2EYW A;  2BZX A;  2DYB A;  2RQR A;  1PNJ A;  1AOJ A;  4Z89 A;  2SRC A;  1UHF A;  1OOT A;  2O88 A;  1HD3 A;  1W1F A;  2M51 A;  1PRL C;  2RNA A;  4F16 A;  2KRM A;  3H41 A;  4LUE A;  1QCF A;  4KRT A;  1X6B A;  1GBQ A;  2GTJ A;  1JU5 C;  4QT7 A;  1EFN A;  1W70 A;  2JMA A;  2DMO A;  2HEQ A;  2EYY A;  1WXB A;  1Z9Q A;  5EC7 A;  2JS0 A;  4J9D A;  4DEX A;  2X3X D;  2EW3 A;  1RLQ C;  1J3T A;  1GBR A;  1AZE A;  1U06 A;  2J6K A;  1UUE A;  1FMK A;  5HCK A;  4ESR A;  3PVQ A;  2JTE A;  1VYT A;  1JEG A;  1PKS A;  2GBQ A;  2KYB A;  4ZNX A;  1ABO A;  4IIM A;  1M3C A;  2RPN A;  2AK5 A;  1PRM C;  1ZSG A;  2H8H A;  2J05 A;  1WA7 A;  2W0Z A;  3VS7 A;  1IO6 A;  3EG3 A;  1HJD A;  1AWJ A;  2AKK A;  2ROL A;  2RQU A;  2DF6 A;  1T3L A;  1M8M A;  1AZG B;  1ZX6 A;  2LQW A;  3SEM A;  3I35 A;  2KRO A;  4CC4 B;  2HDA A;  5IXF A;  2LZ6 B;  2M0Y A;  1GCQ A;  2DL4 A;  2CUB A;  1Y0M A;  3JV3 A;  2E5K A;  2LJ0 A;  4F14 A;  3I9Q A;  2MOX A;  2EBP A;  3UAT A;  2JMC A;  1YP5 A;  4LNP A;  4HCK A;  5GJW B;  1RUW A;  2OAW A;  4JJD A;  1E6H A;  1UE9 A;  1AEY A;  2LJ1 A;  2ED0 A;  2C0I A;  2BZ8 A;  4F17 A;  1WIE A;  2VKN A;  2RMO A;  4J9G A;  3REB B;  1ZUY A;  1OEB A;  1JO8 A;  1GFC A;  1YN8 A;  2D8H A;  3LH5 A;  2YDL A;  4M4Z A;  1TUC A;  2B86 A;  3VS6 A;  2L3S A;  1UJ0 A;  4LE9 A;  3H0I A;  3NGP A;  2HBW A;  1MV0 B;  1AWW A;  1UGV A;  2LQN A;  1UFF A;  1KIK A;  1AD5 A;  3FJ5 A;  4OMN A;  2KR3 A;  4IIO A;  5IHN A;  2DA9 A;  2DBK A;  1A0N B;  1K0X A;  2RF0 A;  2RQT A;  2DL3 A;  1AWX A;  2A37 A;  3EHQ A;  2YSQ A;  2AZS A;  1CKA A;  2DE0 X;  2KYM A;  1NEB A;  3VS2 A;  1AWO A;  2RQW A;  3UA7 A;  3R6N A;  2JT4 A;  2DX1 A;  4RTZ A;  2GTO A;  2C0T A;  2EGA A;  4OMO A;  2KEA A;  2KT1 A;  2KT8 A;  4AFS C;  1I07 A;  2I0N A;  1SEM A;  4LUD A;  2KXD A;  1JXO A;  1WYX A;  2CT3 A;  1I1J A;  4CC3 A;  1ZUU A;  2FPE A;  1JQQ A;  2KGT A;  4JJC A;  2DL8 A;  1ABQ A;  3THK A;  4K11 A;  1QKX A;  2EVR A;  1UG1 A;  2BTT A;  2DBM A;  1S1N A;  5FW9 A;  4J9H A;  1PHT A;  2CSI A;  1WDX A;  3VS0 A;  2L0A A;  1SSH A;  1UDL A;  4LN2 A;  1M3A A;  3VS1 A;  2LNH B;  2JS2 A;  4JPB W;  3QWX X;  1OPK A;  1SRM A;  1B07 A;  5IHK A;  2YUN A;  1X6G A;  2RN8 A;  4RTW A;  3NHN A;  3VRY A;  2FPF A;  3UF4 A;  2D1X A;  2PZ1 A;  4J9C A;  1H8K A;  1ARK A;  2CH4 W;  4J9F A;  1JXM A;  2V1Q A;  1H3H A;  3A98 A;  1GRI A;  1N5Z A;  3VS3 A;  2G6F X;  2O9S A;  3SHW A;  1B3Q A;  3KFV A;  4HVV A;  2HCK A;  2O2O A;  1GFD A;  1TG0 A;  2JM9 A;  5GJV B;  4A63 B;  5ECA A;  1AVZ C;  2QDL A;  1LCK A;  1W6X A;  2GNC A;  1U3O A;  4HVW A;  2DRK A;  1K9A A;  1NM7 A;  3H0F A;  2A36 A;  5FWC A;  1SHF A;  1YCS B;  1G83 A;  1X2Q A;  2ESW A;  3PE0 A;  4D8K A;  2K6D A;  4AFZ C;  1K4U S;  1GCQ C;  1I0C A;  1CSK A;  2ECZ A;  1Y57 A;  3QWY A;  2L2P A;  2W10 A;  3TSW A;  3GBQ A;  1KFZ A;  4JZ4 A;  1X69 A;  2LX7 A;  1GL5 A;  4RTX A;  2ED1 A;  2GQI A;  2D8J A;  2PTK A;  3M0U A;  1X2K A;  1UHC A;  2EQI A;  3M0S A;  2CUD A;  2EYZ A;  3NPF A;  4Y92 A;  1K76 A;  2F2W A;  4GLM A;  2ABL A;  3EHR A;  2YT6 A;  1NYG A;  2L3P A;  1T3S A;  2KRS A;  2DNU A;  3UA6 A;  2ENM A;  5I22 A;  2K79 A;  2RQV A;  2CSQ A;  2KRN A;  1RI9 A;  1HSQ A;  2A08 A;  2JXB A;  1GCP A;  1WXU A;  2K2M A;  5L23 A;  4E6R A;  2GGR A;  3M0R A;  1BB9 A;  4RTT A;  2XMF A;  5FWB A;  2FRY A;  3TSZ A;  2JW4 A;  1UJY A;  1M27 C;  2V1R A;  4J9E A;  4RTV A;  4RTU A;  4AFU C;  1NLO C;  2PNI A;  2EGE A;  4WCI A;  4AG2 C;  3M0T A;  2VWF A;  3C0C A;  1CKB A;  1WX6 A;  2YUQ A;  2EPD A;  2EYX A;  1ZUK A;  4OML A;  1NYF A;  2KBT A;  3CQT A;  2K9G A;  1QWE A;  1ZBJ A;  4ORZ A;  1TUD A;  2LJ3 A;  4CC7 A;  3VRZ A;  3M0P A;  1G2B A;  2MIO A;  1BK2 A;  1SRL A;  3ZL7 C;  1KJW A;  2CT4 A;  2HSP A;  2F2V A;  3EG0 A;  4OMM A;  2FO0 A;  5IHI A;  1U5S A;  5IXB A;  2EKH A;  1H92 A;  1V1C A;  2LMJ A;  2FEI A;  1PWT A;  2L3Q A;  2YUO A;  4JZ3 A;  3RBB B;  2CDT A;  5IH2 A;  3I5R A;  2K7A A;  3TVT A;  2J06 A;  4FSS A;  2DRM A;  5I11 A;  2AKL A;  1YWP A;  4GBQ A;  4DEY A;  4HVU A;  2C0O A;  2X3W D;  2DL7 A;  1E6G A;  2P4R A;  2SEM A;  1WI7 A;  1NEG A;  2YUP A;  2MCN A;  4Z88 A;  2DJQ A;  1RLP C;  2DL5 A;  2DVJ A;  4HXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...