2LCSA

Yeast nbp2p sh3 domain in complex with a peptide from ste20p
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
67
structure length
67
Chain Sequence
MAIVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Peptide Binding Specificities of Src Homology 3 (SH3) Protein Domains Can Be Determined by Modulation of Local Energetics across the Binding Interface.
pubmed doi rcsb
molecule keywords NAP1-binding protein 2
molecule tags Transferase, signaling protein
source organism Saccharomyces cerevisiae
total genus 8
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lcsA00
1U06A 2DA9A 2GQIA 1VA7A 1YWOA 2SRCA 2NUZA 3EHQA 1X2KA 3VS0A 1M27C 3UA7A 4OMMA 2K79A 4AFZC 1GRIA 3NPFA 2EKHA 4OMNA 4ESRA 1FMKA 1U3OA 1T3LA 2EYWA 4RTYA 1QWFA 2DLPA 2KEAA 2LJ3A 1ZUKA 3QWXX 2JS0A 2DNUA 2A37A 2HCKA 1X43A 1YWPA 1GFCA 1NLPC 4J9GA 3RBBB 3NHNA 2KXDA 4Z89A 1WFWA 1K76A 5FW9A 4K11A 1BBZA 1UDLA 2YT6A 1KFZA 3UA6A 2CT3A 3PE0A 3PVLA 5FWBA 2DMOA 2EQIA 1GL5A 2D1XA 4CC2A 2RQVA 1I07A 3TSWA 2DJQA 3GBQA 1ZUYA 2B86A 4JZ3A 1HJDA 4JJCA 1PKSA 1QWEA 1SHFA 1AOJA 3EG0A 5IHIA 1ZLMA 3M0SA 2L3QA 1I1JA 2GBQA 1UG1A 1GBQA 2J6FA 1OEBA 2LJ1A 1PKTA 1ABQA 2L0AA 2VKNA 2YDLA 3THKA 3I5RA 1WYXA 3RNJA 4AFQC 2EW3A 4Y92A 2OI3A 4LE9A 3VS1A 2V1RA 1UTIA 1W70A 1Z9ZA 1X27A 2GNCA 2CDTA 2NWMA 2PNIA 1H3HA 1NEGA 1TUDA 1MV3A 1WI7A 2EGEA 2J6KA 4GBQA 2CH4W 1OV3A 5EC7A 1MUZA 5IH2A 1YN8A 3A98A 1KJWA 2D8HA 1UJ0A 4A63B 2K6DA 2EPDA 2HBWA 2C0IA 2SEMA 3UF4A 1A0NB 2EYZA 1E7OA 4HCKA 2AZVA 3H0FA 2J05A 2LX7A 1NYGA 4RTUA 3EG3A 1M3BA 1SSHA 4J9FA 3M0UA 1Z9QA 1B07A 2DBKA 1IO6A 1JEGA 5I22A 4E6RA 1YCSB 4RUGA 2RQTA 2JW4A 2PZ1A 3KFVA 1PNJA 1RLPC 2MOXA 4J9CA 4LN2A 2KNBB 3TVTA 3VS2A 2V1QA 2K3BA 3FJ5A 2ED1A 1S1NA 4AG1C 1PRLC 1VYUA 3VS4A 1T0HA 1AZGB 2DRMA 2AK5A 4OMQA 1G83A 4JPBW 1Y0MA 1AZEA 1VYTA 3I5SA 3NMZC 1CKAA 1WX6A 2HEQA 1UECA 1YP5A 4J9DA 2H8HA 2KROA 1K9AA 2CUBA 1J3TA 1HSQA 2O88A 2CUDA 2KGTA 2JMCA 2LCSA 4DEYA 2OAWA 2A08A 2YUPA 2KE9A 2CSQA 4AG2C 2JTEA 1NEBA 1EFNA 1BK2A 3O5ZA 4OMOA 1GBRA 1BU1A 1RUWA 2DYBA 1XOVA 1AWJA 1K0SA 2ENMA 2RNAA 1UHCA 2GTJA 4J9BA 1PWTA 2RN8A 2C0OA 2F2XA 1HD3A 2YUQA 4RTZA 2A36A 1MV0B 1NLOC 4LNPA 5IXFA 4RTVA 4JJBA 1OPLA 1WDXA 2DL5A 3M0QA 2BZ8A 4LUDA 2M0YA 4X1VA 1M30A 2DE0X 1W1FA 2EYYA 2KBTA 1GCQA 1K4US 5L23A 2D0NA 1SHGA 4ZNXA 3VS3A 1ZBJA 1JO8A 5GJVB 2LQNA 2RPNA 2ED0A 2EGCA 2JXBA 4JJDA 2GGRA 2OJ2A 2MCNA 2KR3A 1RLQC 2AKKA 4HVUA 3CQTA 2KYBA 2LNHB 1I0CA 2D8JA 3JV3A 2O2OA 2ROLA 2O9SA 1N5ZA 2VWFA 4D8KA 1QLYA 2LJ0A 1LCKA 2JM9A 1GCPA 3NGPA 1QCFA 1X69A 2J06A 2BTTA 2L2PA 1G2BA 2DILA 1JU5C 1TG0A 2DL8A 1SRLA 5GJWB 2LP5A 4F16A 3H41A 4J9IA 4J9EA 3EGUA 4EIKA 1T3SA 4Z88A 2ESWA 1WXBA 3VRZA 1ZSGA 2FPFA 4HVVA 1T0JA 5HCKA 1ARKA 1PRMC 2YUOA 3REBB 4LUEA 2W0ZA 2LZ6B 2EYXA 1ZUUA 1WXTA 2X3XD 2ROTA 2C0TA 2BZXA 4D8DA 4WCIA 1AWOA 3QWYA 1UFFA 1WLPB 1KIKA 4DEXA 4F17A 2FPDA 4GLMA 2CT4A 1K0XA 4M4ZA 1TUCA 2KRNA 1WXUA 1U5SA 1X6BA 2JS2A 2DL4A 4HXJA 4RTTA 4CC3A 2PTKA 1W6XA 1WIEA 2P4RA 2L3PA 1AWXA 1OPKA 1SEMA 5IHKA 1YNZA 2AKLA 3TSZA 1JXMA 3IQLA 1GFDA 2X3WD 3EHRA 4HVWA 2IIMA 2KRMA 3VS5A 1UJYA 2E5KA 2CREA 1VYVA 2ABLA 2FEIA 5FWCA 1AD5A 1UGVA 4CC4B 2BZYA 2DVJA 3SEMA 4JZ4A 2K2MA 4RTXA 2KT8A 4OMLA 1UE9A 1X6GA 2A28A 3VRYA 1M3AA 1Y57A 2JT4A 3M0PA 1H92A 1B3QA 2VVKA 4AFSC 1NM7A 1KSWA 2HDAA 3EG2A 1SPKA 2EGAA 2RQRA 3ZL7C 4CC7A 1BB9A 1V1CA 1OOTA 4AFUC 2HSPA 5IXBA 2LQWA 2YUNA 1UUEA 3M0TA 3ULRB 2CH4A 3M0RA 2ECZA 2XMFA 2KT1A 5I11A 2RQWA 1PHTA 2YSQA 2DBMA 1E6HA 4IIOA 4QT7A 1AEYA 2J6OA 2KRSA 3EG1A 1JXOA 2DF6A 2KXCA 1NG2A 2MIOA 3UATA 2KYMA 1ABOA 1UHFA 5IHNA 2K9GA 3C0CA 4F14A 2O9VA 2RF0A 1GCQC 2DRKA 1AVZC 5ECAA 3PVQA 1ZX6A 2JMAA 2QDLA 3SHWA 3U23A 2LMJA 3H0HA 1H8KA 2DX1A 2FRWA 1CSKA 2CSIA 3R6NA 2EVRA 4KRTA 1WA7A 1AWWA 3VS7A 2DL3A 3I9QA 4RTWA 2DL7A 2GTOA 1CKBA 1NYFA 2EBPA 4Z8AA 2RMOA 4ORZA 3LH5A 3I35A 4J9HA 1FYNA 2FO0A 4IIMA 1M3CA 2RQUA 2W10A 4OMPA 2I0NA 1K1ZA 2L3SA 2K7AA 2F2VA 3VS6A 2J7IA 3H0IA 2O31A 1JQQA 1QKXA 2FPEA 1M8MA 1QKWA 2FRYA 2AZSA 2M51A 4FSSA 1SRMA 2F2WA 4R0KA 1X2QA 2JM8A 2G6FX 2FG0A 1E6GA 1RI9A 2DM1A 3REAB
chains in the Genus database with same CATH superfamily
1U06A 3V8JA 1JB0E 1MMGA 4ELYC 3GOXA 3DLLA 3BE3A 1X2KA 3EHQA 5FROA 1UGSB 1XNIA 1M1KR 1M1FA 1WHKA 2HL5C 4ZTFA 2VXEA 5KYUB 2EYWA 2Y4YA 4CI0C 2DLPA 2KEAA 4BD3A 1VQ7Q 1YITT 4X9CA 3QWXX 2E65A 3I55A 1X43A 4J7FA 1WHJA 4J9GA 4DBHA 2LDMA 1LOJA 4M7AE 5GAN2 2CKKA 1D1CA 4OGEA 1YHQA 1QVGA 1OX9A 4K11A 3G6EQ 1UDLA 2YT6A 4PNOA 1KFZA 4NL3A 4V2SA 3H8ZA 2DMOA 2EQIA 3CCEQ 1YJ9T 5GAMd 3EH2A 4CC2A 5GANf 2RQVA 4C92G 3JAME 1KQSP 1HJDA 2ZAEA 3OSVA 4JJCA 1SHFA 4M7DA 2G3RA 2RA2A 5IHIA 1KC8C 4PFOA 2CYZB 2GBQA 4O5VA 1QCNA 2QASA 2KQWA 4QVDA 1WYXA 4ZGEB 2O4XB 2WSEE 3EGXB 4RG8A 1UTIA 4HCZA 2COWA 2PNIA 1MV3A 2J6KA 1OV3A 3HFOA 4JS4A 3A98A 2EPDA 3L2RA 3WVEB 2SEMA 5GAN5 5CR2A 1E7OA 4XTYA 4PJOF 4HCKA 1M1KU 2AZVA 5LJ5d 4F7UA 2Z0WA 4KH1B 3MKDA 2J05A 2LX7A 3EG3A 3FC3A 1H641 3P8HA 2XKOC 3CEYA 3M0UA 1YITQ 5KE2A 3V7CA 2DBKA 1IO6A 1Q82R 2JVVA 4M7AB 2FL7A 2EQMA 1YJNQ 2HSEB 2OX7A 3TQ7P 2ED1A 1VYUA 2CS7A 1NPRA 2DRMA 3CCLA 3CCMA 3OY9A 1YJ9Q 1AZEA 1VYTA 3NMZC 3UDCA 2F69A 4L59A 5CIUA 5GAMe 1PG5B 3TEEA 5CKHA 3CCRT 1KQSS 2QEXT 1J3TA 1HSQA 2P4TA 1M5Q1 3EFOB 5GAOq 2KGTA 2JMCA 2BE9B 1R77A 2F1LA 2OAWA 2CP3A 4C0DC 4DEYA 2D6FA 4PJOG 4PJJA 1NEBA 1EFNA 4OMOA 4QQ6A 1M2VA 3X25B 1BU1A 3MHXA 1VQOT 2DYBA 1AWJA 1S72T 3MEWA 3QDFA 1RAAB 2DETA 4J9BA 2RH2A 1W2BS 2X4XA 2QGGA 2YUQA 3PNWC 3Q1JA 1QCOA 2VXFA 2LCCA 1VQPQ 2MF2A 5IXFA 3CCST 4JJBA 1O9SA 4PKCC 4BI3A 3QBYA 4LUDA 3OB9A 2VYTA 1M30A 3JCMe 2DE0X 2EYYA 1K4US 4ZNXA 3VS3A 3G4ST 2QQBA 2RPNA 5LJ5e 2E64A 4M78D 2JXBA 2KDSA 1VQMT 1Q82U 3X20B 4C8QD 4D6WA 2GGRA 4IUQA 5GAMg 3OMCA 1GXIE 3JCMW 2RM4A 2P84A 2PVDB 2YRDA 4HVUA 1TS9A 1BI0A 3V8KA 4XU0A 3CXCA 1R8OB 2ROLA 2QQ9A 2JUFA 2O9SA 4M75D 2JM9A 5A2QE 4M7DC 1QCFA 5KE3A 2L2PA 2DILA 1TG0A 1KQ1A 3OBWA 1AHJB 1VQ6Q 1RAHB 4Q5WA 3KXTA 3ER0A 2IVWA 4PJOA 2CZ0B 2F5TX 3A8OB 4TVRA 3RDVA 2BE7D 2FPFA 1BI1A 1C1AA 5HCKA 1NJIC 5LJ5g 3PT9A 2WACA 4IKFA 2VC8A 2CP6A 1ZUUA 3V7SA 1Q82C 1Q81R 5FLXE 2AHJB 4C0GA 2JZ2A 4J7IA 2I2LA 3INZA 2NUTB 2FPDA 4GLMA 2QGFB 2CT4A 4XTVA 2KRNA 1EZZB 2MPXC 5GAOp 3CBOA 2BUDA 1U5SA 3MEVA 1KQ2A 4FYYB 4HXJA 1I5OB 2PTKA 4A4HA 3NTKA 1W6XA 1U8RA 1AWXA 1Q7YU 3OYJA 2M1HA 2AKLA 1KD1C 3TSZA 1JXMA 1B34B 1UGPB 4BDYA 1QMCA 2GFUA 4GY5A 3GF5A 4FM4B 2IIMA 4OB0B 2KRMA 3M4YA 2R57A 3VS5A 1RL2A 2PUOB 2NUPB 4JRQA 4LXCA 3GLXA 2FZGB 3CPWS 4JZ4A 4RTXA 3WVDB 4FYWB 4ATOA 2KVQG 3EGDA 3J80E 4M7DE 4M77G 1NM7A 3JB9F 2HDAA 2QG9B 3EG2A 3S3NA 4NOYA 1OQKA 1D3BB 5J26A 1TU0B 5GAN3 3LLRA 5C6SA 1BB9A 3JCMb 2CZ6B 1TTHB 2V8IA 1V1CA 1I4K1 2ATCB 2WSFE 3MP6A 2QYZA 2YUNA 2OTLA 3ULRB 1VIEA 1G3SA 2ECZA 3MPUB 5FRNA 4FW2A 2YSQA 2RI5A 3MP8A 2FYKA 3OMGA 2J6OA 5HKCA 1Q81U 3QZ5B 1LVKA 4EMHA 1QVFS 1QVPA 3I55T 1D0ZA 1UHFA 3SDZA 4F7UE 3L2VA 4F14A 1ZHIA 3CMEQ 4RMOA 4OMFB 3HSBA 3U23A 3EG9A 1N6AA 3EAEA 2P0KA 2CSIA 2F5KA 4MZPA 1IGUA 2HQXA 3JB9J 1IXDA 4OVAA 4MMKA 4JUVA 2EBPA 3LH5A 3OYGA 3I35A 4M7AD 2ZPHB 5LJ3d 1FYNA 1YI2A 3VUBA 3JCMP 2MWOA 4OMPA 3VS6A 3G71T 2MAMA 2FPEA 4BE2A 4C92E 1QKWA 2M51A 4FSSA 1SRMA 1X2QA 2JM8A 1RABB 2G6FX 1VQ4Q 4M77A 1OX8A 2DM1A 3G1JA 3C94A 1VA7A 2MYSA 1Q81C 5LJ3j 2A3LA 2L89A 3CCQA 1HXDA 4PJOC 3JSCA 4EPCA 4IUUA 2JOYA 3NFCA 3H6ZA 1VQ8A 4BY6C 1FMKA 1U3OA 1T3LA 5I2MA 4RTYA 2RJDA 2DEQA 1QWFA 2DYIA 2LJ3A 1M9SA 4JRPA 1QW1A 1KHIA 2QAZA 3P8DA 2DNUA 2A37A 3RBBB 2LCLA 2QQSA 2M02A 2HMAA 3I55Q 3AT1B 1BBZA 4LD9K 4J6WA 3M5AA 1BCMA 4DBRA 3PE0A 1YHQQ 1GL5A 3F70A 3GPLA 5KYYB 1I07A 5GMKm 3CCLT 2DJQA 3GBQA 3CCMT 1ZUYA 1QWEA 4C8QB 1AOJA 3EG0A 2QQAA 1IHVA 1UG1A 2XU8A 2J6FA 2LJ1A 1PKTA 1ABQA 2ZZDA 5KH6A 3I5RA 3RNJA 2DTOA 3UT1A 2EJGA 4C92B 4Y92A 3OYFA 2V1RA 1Z9ZA 2GNCA 2HQEA 3L1AA 3E19A 2CP5A 1TUDA 3DB3A 2EGEA 4GBQA 2P0QA 2VGMA 3V7RA 2E41A 5EC7A 1UJ0A 4E2FB 2K6DA 1QVGP 5IT9E 2HBWA 4QKUA 4PJOE 5I21A 2ZPIB 2COZA 2CZ1B 1ZBXA 3H0FA 4XTWA 2FVUA 2EIFA 1SSHA 4J9FA 4NS5A 3A8MB 3LX7A 3CCVA 3M54A 2ZPFB 2ZPBB 4X9DA 1JEGA 4HT9A 4C5HA 4E6RA 1PD1A 1R0BG 1BI2A 2RQTA 5GANh 1RLPC 4J9CA 2E5QA 2DXCA 3HHTB 3VS2A 4M78F 4AG1C 2K3YA 1FMWA 1ZA1B 3A5ZB 1T0HA 4DBQA 2AK5A 1Y07A 5LJ3g 1G83A 5GMKl 4QVZA 3I5SA 4F7UG 3SWNA 2EWNA 3CCLQ 1YP5A 2H8HA 3TCJA 2CUBA 2O88A 2BKDN 3QHSA 2LCSA 3TU4K 3QZ9B 5AYFA 4P5NA 5FU7C 2XI9A 4AG2C 3LH0A 4M75F 1Y7XA 5FRMA 4C0FA 1K0SA 1EIFA 4WF2A 1UHCA 5HY6A 1V29B 3CCJA 1X6OA 1TWBA 1TXQA 2JN0A 1ZSZB 2K3XA 3CMAQ 1MV0B 3HTRA 3PMIA 5D6WA 1M90R 1NLOC 4M77C 2HKNA 1IREB 4JRIA 1OPLA 1X01A 5KCOA 4EMKA 1WDXA 2DL5A 4LDYA 1QVGS 1BIBA 4A54A 2M0YA 4JLIA 4DOWA 2K4YA 3EH1A 5GANj 2DEUA 3MEUA 1VQNQ 5L23A 2D0NA 2A0FB 2M9UA 3X28B 5CAIA 3NTHA 5CVIA 2LQNA 2ED0A 3G71A 2K5FA 5FU6C 2CGHA 3CC2A 4DQ2A 1FMVA 2VGNA 2JTMA 5IN1A 2MCNA 3JCMh 1VQLA 1RAIB 4B9WA 1RLQC 2AKKA 1VUBA 2GFAA 2ZCFB 5KYXB 2O01E 1PCXA 2QTVA 1Y96A 2OAUA 5GAMf 2X4JA 1YJWA 4PJLA 1QP2A 2E6NA 5GAOr 4JS5A 2DTIA 4D8KA 1QLYA 3CD6A 4DOVA 1NJIR 1GCPA 4RCBA 1X69A 2J06A 1JU5C 1MNDA 2EQJA 1WHMA 3BY7A 5GJWB 3H41A 3QG1A 4E7SA 3EGDB 4AMCA 4Z88A 3FDRA 1M2OA 1WXBA 3VRZA 1ZSGA 1T0JA 5LL6S 1ARKA 1PRMC 2YUOA 3REBB 4M77E 4M7DD 2OTLT 1M90U 2LZ6B 3RMSA 4D8DA 3FLGA 2C0TA 2BZXA 3JCMf 4WCIA 4N4HA 3QWYA 1KIKA 4DEXA 6AT1B 1XJWB 5LJ5f 1KD1R 1AT1B 3A8GB 2QK0A 4OGCA 2YRCA 3CXCP 3H9NA 1G8XA 2EQKA 4DA4A 1X6BA 4HCCA 2JS2A 4RTTA 4CC3A 4Y28E 1WIEA 2P4RA 4E7ZA 3FRNA 5D7UA 3M9QA 1OPKA 3UWNA 2LVMA 2HAXA 1YNZA 2XK0A 5DLOA 2HQHA 4DBFA 3EG9B 1SKUB 4RKUE 3PIOA 2MI6A 1W2BA 2E10A 4PFPA 2RI3A 1UEBA 2VB6A 2CREA 1VYVA 4FIBA 5GAN8 3G6EA 1YI2T 1AD5A 2BZYA 2GCXA 3M58A 4ZGDB 3OYAA 4OMLA 1UE9A 1KK7A 3SWNC 1NJIU 4M7AF 2M0OA 5FU7B 5CQXA 1B3QA 3VYHB 2QXFA 4AFSC 3JCMX 1WHLA 3EFSA 3URGA 3CCEA 1BYMA 4B9XA 1SPKA 5HK0A 1M90C 2DD5A 2Y4XA 1VOMA 3ZL7C 3QYGB 3JB9I 2R58A 3S3MA 1Q86R 1I5LA 1OOTA 4EDUA 1WPYA 3MEAA 1NZ9A 1UUEA 4PFZA 4UC4A 4M77B 4XAXB 3CCQT 5KYNA 2RQWA 2QA4T 1VQ8T 4C92D 4ZN1A 4ANJA 4QT7A 1AEYA 2MMPA 2H3JA 3PGGA 4JDSA 1JXOA 2CP7A 2KXCA 1NG2A 4BI4A 1U1TA 1ABOA 1KD1U 2K9GA 3CCRQ 2DRKA 2EJ9A 2YLBA 2QEXQ 3E2UA 4OB2B 5ECAA 2JMAA 1RAFB 4J5YA 1H8KA 5KYUA 5CO7A 2EJFA 5I2SA 1XTDA 1VQOQ 3VS7A 4RTWA 1S72Q 1IRXA 2DJZA 3RR6A 2RMOA 4ORZA 4MZTA 1VIFA 3R6OA 1YJNA 2HBPA 2PVGB 2K7AA 2J7IA 3CCSQ 5KYWB 5GAOn 3LWHA 1U1SA 1YI2Q 1QKXA 1VQ9A 1BIAA 3RKYA 5DLQE 3QSUA 4WTOB 3G4SQ 1E6GA 1RI9A 5GAN6 1JJ2P 4O6JA 1LJOA 2MK5A 2DA9A 2RD1A 4E7HA 1YWOA 1VQMQ 1Q86U 1M27C 3UA7A 3OYCA 1Q95G 2K79A 4AFZC 4Y91A 3CCUA 2MWPA 4N4IA 2EKHA 2O4XA 4OMNA 3CCQQ 4E7KA 1FX7A 4BUGA 1MHNA 1ZUKA 3SB2A 2JS0A 3P8BB 4FL6A 3J81E 2HCKA 1YWPA 2XHCA 4Z02A 1GFCA 2DIQA 3CCVT 1SF9A 2FHDA 2XDPA 3DB4A 4Z89A 1WFWA 1PC0A 4C0DB 4GLKA 1VQPA 4PJOD 2COYA 1WJSA 3UA6A 3VUZA 3PFSA 2CT3A 3PVLA 2GQVA 5FWBA 2P0PA 3L2ZA 2DK3A 3LGLA 3HRSA 5CKFA 3TSWA 2KK4A 2B86A 2RHUA 5KCHA 4M7AA 1PKSA 3CBMA 3JCMQ 1ZLMA 4FSXA 4KT0E 1GBQA 2LQ8A 2E6ZA 3GNFB 2L0AA 2VKNA 2YDLA 1Q86C 3THKA 1WQWA 2DVEA 4CRIA 1JJ2A 4AFQC 3HRTA 3VV0A 2RJCA 2XDDA 3FJPA 5GMKh 3VS1A 1OI1A 1W70A 1X27A 1IHWA 4KGVB 1H3HA 1NEGA 1WI7A 4PLIA 4KUIA 4ME7A 2CH4W 1WJRA 3CCJT 1MUZA 1YN8A 1KJWA 3QPHA 3META 5D6XA 2DZCA 2C0IA 3JB9G 1D1AA 1WZOA 1MGQA 1MNEA 9ATCB 4II1A 1VQ6A 1NYGA 3OS2A 1D0XA 1HYOA 2OTJA 1B07A 5I22A 4M7DB 1EX4A 2YWWA 1YCSB 5J39A 4X34A 3CC2T 2JW4A 3KFVA 3BDLA 2MOXA 1VQLT 3TVTA 4XK8E 3FJ5A 1S1NA 4RG2A 3VS4A 4PK4A 2X35A 3RMQA 2QTXA 1Y0MA 4JPBW 3CC4A 3N5BB 1LNXA 1YJWT 4LDVA 5GMKj 1UECA 2QA4A 2RJFA 3T9NA 2KROA 1Y96B 2RB6A 2DPPB 4XTXA 1YCYA 4KGXB 3CD6T 5LJ3f 3GNGA 2RK2A 4LDWA 4VUBA 5M9OA 1OZ2A 3RESA 2KE9A 3O5ZA 4F7UB 1GBRA 1XOVA 1MMAA 2ENMA 2RNAA 3NTIA 4HA8A 1SSFA 2GTJA 2RN8A 2C0OA 2F2XA 4MDXA 3VYGA 4RTZA 1G3YA 1RADB 5A0GA 2IG0A 3KUFA 4FT2A 4RTVA 3OW2P 4BI8B 3QXEB 1LPLA 4FYXB 1TUGB 1GCQA 2DTHA 1ZBJA 1JO8A 4MZMA 5GJVB 2V8JA 1F1BB 8AT1B 2KAFA 4M77D 4FYVB 2KR3A 5LJ3e 3G71Q 3CC2Q 1PD0A 3X24B 1N9RA 1VQLQ 2YXYA 2NUTA 1OYXA 5GMKi 1M2VB 1VQKA 1I0CA 1BCOA 3FIFA 2R5AA 5GAOm 1UB4A 3OYYA 4L6V5 2O2OA 3LWIA 3CMEA 2LC4A 1N5ZA 2VWFA 3C4SA 2LJ0A 3CC7A 3FB9A 3G6ET 1C6VX 4M7AC 2DIGA 3NGPA 4KGZB 3ZEHA 2DL8A 1B34A 4A4FA 1YIJA 3L2QA 2CZ7B 2LP5A 4F16A 3CCET 4J9IA 3HL8A 4PL6A 4E7LA 4HCBA 2X4WA 4JLGA 4EIKA 4EMGA 1T3SA 2A7YA 3FEOA 3OW2A 1KG1A 4LDXA 1OZ3A 4HVVA 2EFIA 2LT4A 4J8OA 2E1HA 1KHCA 3DLMA 1OU9A 2W0ZA 1Y71A 2C06A 2EYXA 2X3XD 1WXTA 1ZQ1A 2DXUA 3QJYA 4J6XA 4C8QF 4R55A 2XDBA 1N27A 3HKSA 2X9HA 1VQ5A 3OYHA 1UFFA 1WLPB 4E47A 4F17A 2L5QA 3CCMQ 1VQ4A 2VUBA 2ZGWA 1TUCA 2EYQA 1JBMA 1WXUA 4C92F 3ZBDA 4PLLA 2DERA 3C95A 2V8KA 2E70A 2RHYA 2VASA 7AT1B 3I56A 3OQ5A 5CQYA 4QW2A 5GANd 1SEMA 5IHKA 5GAMh 3LW5E 3BFMA 3IQLA 1TH7A 1GFDA 3OYKA 3KBGA 4ZTJA 1DJ7B 3A1PA 2KI7A 1UJYA 2WSCE 3QIIA 5GAOl 4PJOB 2DAQA 1N8RR 2XICA 4XU2A 5EG2A 4BY6B 2ABLA 2FEIA 5FWCA 4LD6A 4CC4B 1YJNT 2DVJA 4M78G 3SEMA 5J3BA 2KT8A 1X6GA 2A28A 3VRYA 1M3AA 2JT4A 2VVKA 4C8QG 1XQHA 3HP9A 1PM3A 1VQ9T 8ATCB 1D0YA 2YLCA 2EGAA 2RQRA 3VKIA 2B8AA 2E3HA 3S6WA 5AT1B 4RCCA 2K5IA 1BKBA 2DD4A 5IXBA 3OYEA 1K9MC 2CH4A 3M0RA 2EKOA 1OULA 2KT1A 5LJ5h 4M75G 5CCAA 3CCUT 2RJEA 2CP2A 4IIOA 4BE1A 3OYLA 5GAMj 1W2BP 2JJ9A 5IHNA 2DZ9A 3C0CA 4FW1A 3UPUA 4R56A 1GCQC 4A4EA 1AVZC 3OYMA 3SHWA 3PVQA 2QDLA 1VQPT 3BDUA 2LMJA 3H0HA 3JCMd 2DX1A 2FRWA 2M16A 4KBMB 5C0MA 2E4HA 2LX9A 3M55A 2EVRA 3G7ZA 4KRTA 2DL3A 3I9QA 1CKBA 1NYFA 3WXMB 3LYIA 3QDRB 5GANe 4BE0A 4J9HA 4AT1B 2W10A 4MMLA 3L2WA 1K1ZA 2L3SA 1N8RU 1RI0A 2F2VA 2EAYA 4MDWA 1B7TA 2O31A 1JQQA 3QYHB 2PVOB 1M8MA 5KYYA 2D9TA 3X26B 2AZSA 4M78A 2VV5A 2F2WA 3OYBA 3L2UA 5LJ5j 4R0KA 1VQ9Q 1KQSA 2FG0A 4C0ZA 4IIMA 4C8QA 1M4ZA 2K57A 1TSFA 2GQIA 4N0AA 2SRCA 2NLUA 2NUZA 3VS0A 2HZYA 1MMNA 4OMMA 3A8LB 1VQ7A 3QKJA 1GRIA 4J83A 4F04B 3NPFA 4C92A 4E7IA 4ESRA 4IUVA 1N9SA 4IUTA 3CCUQ 4JJNK 1TOVA 1VQ6T 4M75A 3BW1A 3V8LA 2OTJT 2HL3A 1NLPC 1WGSA 3NHNA 2KXDA 1M1KC 2X4YA 1OU8A 3VU3C 2RHZA 5GANg 3CMAA 1K76A 2RHXA 5FW9A 4IURA 3OYNA 4ZGJB 4YTLA 1IB8A 4C5EA 3OYDA 1N8RC 2D1XA 4ELZC 1QQJA 4B6MA 1VQNA 2HKQB 2DXTA 1JRIA 4JZ3A 3CC4T 3MCAB 4XU3A 3JRZA 3EFRA 5D6YA 3M0SA 3C12A 3MJXA 2L3QA 3O8VA 1I1JA 2OTLQ 2V26A 1OEBA 1BI3A 2PUKB 4KH0B 2JNGA 3OSSC 1G3TA 1ACMB 5CKEA 1Q7YR 4EMKC 2EW3A 3E9FA 4QVCA 2OI3A 4LE9A 3A8HB 3HRUA 2YHTA 5FU6B 2XD0A 2CDTA 2NWMA 2K2VA 4QQDA 4L5GA 5IH2A 3CXCS 4A4KA 2D8HA 4BB7A 4A63B 3UF4A 3CPWP 1PSEA 2JTFA 4M7AG 1A0NB 2EYZA 2H3EB 3DKMA 2LNVA 1YITA 1FWZA 4RTUA 4J6YA 1M3BA 1K8AR 1Z9QA 3LGFA 1K73R 1M1GA 1ZSZA 1QP3A 3JCMg 2OTJQ 4RUGA 3E9GA 2DXBA 3PMTA 3AHUA 2PZ1A 1PNJA 3HFNA 4LN2A 3OYIA 2KNBB 1RAGB 2V1QA 2K3BA 1YJ9A 1PRLC 3CBPA 3QUIA 4N4GA 1AZGB 2NYSA 4M77F 3JCMV 4OMQA 1QVFP 1VQKT 5DM7R 1G5VA 1CKAA 1O75A 1V76A 1WX6A 5IAYA 2HEQA 4J9DA 1D09B 3CPFA 1K9AA 2DFUA 3CMET 3CC4Q 4C5IA 4LDUA 1RACB 1IZ6A 2CUDA 3EGXA 3CC7T 2QA4Q 1VQ8Q 2BIVA 2A08A 5KYXA 2KSSA 2YUPA 2LTOA 2CSQA 5GAN4 2JTEA 1BK2A 1YIJT 2LRQA 1RUWA 2L3RA 1HK9A 1PWTA 3CPWA 1HD3A 3M53A 4BACA 4M78C 2E3IA 2A36A 1W4SA 1NBEB 3HPWA 3OS5A 4PJMA 4C8QC 2HD0A 4LNPA 2KY9A 4N0AC 2EQUA 3SD4A 4OB3B 3M0QA 4XTUA 2BZ8A 2RO0A 4X1VA 1VQ5T 1W1FA 2KBTA 1SHGA 5CK9A 4C92C 1VQ4T 2HNIA 4OP0A 4IUPA 1K8AU 2EGCA 1K73U 1G3WA 2R5MA 3GIBA 4XU1A 3SWNB 4HT8A 4JJDA 4M75C 2OJ2A 3I56T 3D7SB 1QVFA 1R0CB 3CQTA 5CKBA 2KYBA 2LNHB 4HKEA 1D1BA 1P92A 3RERA 2D8JA 3OS0A 2FZKB 3EFOA 1JJ2S 5LJ3h 1YBYA 3JV3A 2DKGA 1Q7YC 1VQKQ 3CCRA 2KMTA 4E7JA 3E1SA 2QEXA 3MO8A 2AIRB 1LCKA 2CP0A 3QO3A 2BTTA 1H3ZA 1G2BA 1YHQT 1SRLA 3CC7Q 4EMKB 4NL2A 3JCMJ 1VQOA 4J9EA 4JRKA 1S72A 3EGUA 1YIJQ 2ESWA 3VJPA 3CCVQ 4ZN3A 5DY9A 3ZFJA 4KULA 4M78E 2X51A 3ASKA 3CCSA 1UGQB 4LUEA 3OS1A 4C8QE 3JB9H 2QDYB 1K8AC 1K73C 2ROTA 1AWOA 1IGQA 3RIRA 4OF1A 4A4GA 4FCYA 2DO3A 2AT1B 2RI2A 4PJNA 3G4SA 2YRVA 1K0XA 4M4ZA 1VQ5Q 1MMDA 1VQMA 1WJQA 2ZPGB 1M8VA 2DL4A 4M75E 3TREA 3J7AF 3ME9A 2L3PA 3OBYA 1ZSZC 3M59A 2RHIA 3I56Q 1PSFA 1NE8A 2X3WD 4FT4A 4KUDK 4A53A 3S3OA 3EHRA 4HVWA 1WHHA 1WHGA 4XTZA 3CCJQ 4OB1B 2E5KA 1I8FA 5A0LA 1FXXA 2QQRA 3RKXA 3PTAA 1UGVA 2PU9B 1WQ7A 2K2MA 3RUXA 4XQ3A 3M0PA 1Y57A 1SG5A 1K9MR 3MP1A 4M7DF 1H92A 2D0QB 1KSWA 2XIDA 1KC8R 3GP8A 4CC7A 3M57A 2L8DA 2QI2A 4AFUC 4M78B 2XG8D 2HSPA 2LQWA 2FZCB 5KYWA 1I81A 3M0TA 5GMKe 2XMFA 1YFNA 5I11A 1VQ7T 1PHTA 2DBMA 1E6HA 1C0MA 5CKDA 5HK3A 2KRSA 3M56A 1ZA2B 3EG1A 2DF6A 2K5LA 2MIOA 3UATA 2KYMA 3QJ6A 2FB7A 1YJWQ 4F7UF 2O9VA 2RF0A 2Y90A 4M75B 3CD6Q 3CMAT 1ZX6A 2E12A 2RK1A 3L42A 4FU6A 1NPPA 1CSKA 3PIPA 1RAEB 3R6NA 3JCMc 2GF7A 4M7DG 1WA7A 4QQGA 1AWWA 2IPOB 2DL7A 2GTOA 2NUPA 2ZPEB 1VQNT 4Z8AA 3SFMA 2LT1A 5L8RE 2FO0A 2LQKA 3OA6A 3JB9D 1M3CA 2RQUA 2I0NA 2PQWA 3H0IA 1D3BA 3OW2S 1X75C 3RKWA 1K9MU 2FRYA 1UGRB 1KC8U 5A0DA 1WNLA 4C5GA 3M4GA 4BDZA 5GAN7 3REAB
chains in the Genus database with same CATH topology
1U06A 2DA9A 2GQIA 1VA7A 1YWOA 2SRCA 2NUZA 3EHQA 1X2KA 3VS0A 1M27C 3UA7A 4OMMA 2K79A 4AFZC 1GRIA 3NPFA 2EKHA 4OMNA 4ESRA 1FMKA 1U3OA 1T3LA 2EYWA 4RTYA 1QWFA 2DLPA 2KEAA 2LJ3A 1ZUKA 3QWXX 2JS0A 2DNUA 2A37A 2HCKA 1X43A 1YWPA 1GFCA 1NLPC 4J9GA 3RBBB 3NHNA 2KXDA 4Z89A 1WFWA 1K76A 5FW9A 4K11A 1BBZA 1UDLA 2YT6A 1KFZA 3UA6A 2CT3A 3PE0A 3PVLA 5FWBA 2DMOA 2EQIA 1GL5A 2D1XA 4CC2A 2RQVA 1I07A 3TSWA 2DJQA 3GBQA 1ZUYA 2B86A 4JZ3A 1HJDA 4JJCA 1PKSA 1QWEA 1SHFA 1AOJA 3EG0A 5IHIA 1ZLMA 3M0SA 2L3QA 1I1JA 2GBQA 1UG1A 1GBQA 2J6FA 1OEBA 2LJ1A 1PKTA 1ABQA 2L0AA 2VKNA 2YDLA 3THKA 3I5RA 1WYXA 3RNJA 4AFQC 2EW3A 4Y92A 2OI3A 4LE9A 3VS1A 2V1RA 1UTIA 1W70A 1Z9ZA 1X27A 2GNCA 2CDTA 2NWMA 2PNIA 1H3HA 1NEGA 1TUDA 1MV3A 1WI7A 2EGEA 2J6KA 4GBQA 2CH4W 1OV3A 5EC7A 1MUZA 5IH2A 1YN8A 3A98A 1KJWA 2D8HA 1UJ0A 4A63B 2K6DA 2EPDA 2HBWA 2C0IA 2SEMA 3UF4A 1A0NB 2EYZA 1E7OA 4HCKA 2AZVA 3H0FA 2J05A 2LX7A 1NYGA 4RTUA 3EG3A 1M3BA 1SSHA 4J9FA 3M0UA 1Z9QA 1B07A 2DBKA 1IO6A 1JEGA 5I22A 4E6RA 1YCSB 4RUGA 2RQTA 2JW4A 2PZ1A 3KFVA 1PNJA 1RLPC 2MOXA 4J9CA 4LN2A 2KNBB 3TVTA 3VS2A 2V1QA 2K3BA 3FJ5A 2ED1A 1S1NA 4AG1C 1PRLC 1VYUA 3VS4A 1T0HA 1AZGB 2DRMA 2AK5A 4OMQA 1G83A 4JPBW 1Y0MA 1AZEA 1VYTA 3I5SA 3NMZC 1CKAA 1WX6A 2HEQA 1UECA 1YP5A 4J9DA 2H8HA 2KROA 1K9AA 2CUBA 1J3TA 1HSQA 2O88A 2CUDA 2KGTA 2JMCA 2LCSA 4DEYA 2OAWA 2A08A 2YUPA 2KE9A 2CSQA 4AG2C 2JTEA 1NEBA 1EFNA 1BK2A 3O5ZA 4OMOA 1GBRA 1BU1A 1RUWA 2DYBA 1XOVA 1AWJA 1K0SA 2ENMA 2RNAA 1UHCA 2GTJA 4J9BA 1PWTA 2RN8A 2C0OA 2F2XA 1HD3A 2YUQA 4RTZA 2A36A 1MV0B 1NLOC 4LNPA 5IXFA 4RTVA 4JJBA 1OPLA 1WDXA 2DL5A 3M0QA 2BZ8A 4LUDA 2M0YA 4X1VA 1M30A 2DE0X 1W1FA 2EYYA 2KBTA 1GCQA 1K4US 5L23A 2D0NA 1SHGA 4ZNXA 3VS3A 1ZBJA 1JO8A 5GJVB 2LQNA 2RPNA 2ED0A 2EGCA 2JXBA 4JJDA 2GGRA 2OJ2A 2MCNA 2KR3A 1RLQC 2AKKA 4HVUA 3CQTA 2KYBA 2LNHB 1I0CA 2D8JA 3JV3A 2O2OA 2ROLA 2O9SA 1N5ZA 2VWFA 4D8KA 1QLYA 2LJ0A 1LCKA 2JM9A 1GCPA 3NGPA 1QCFA 1X69A 2J06A 2BTTA 2L2PA 1G2BA 2DILA 1JU5C 1TG0A 2DL8A 1SRLA 5GJWB 2LP5A 4F16A 3H41A 4J9IA 4J9EA 3EGUA 4EIKA 1T3SA 4Z88A 2ESWA 1WXBA 3VRZA 1ZSGA 2FPFA 4HVVA 1T0JA 5HCKA 1ARKA 1PRMC 2YUOA 3REBB 4LUEA 2W0ZA 2LZ6B 2EYXA 1ZUUA 1WXTA 2X3XD 2ROTA 2C0TA 2BZXA 4D8DA 4WCIA 1AWOA 3QWYA 1UFFA 1WLPB 1KIKA 4DEXA 4F17A 2FPDA 4GLMA 2CT4A 1K0XA 4M4ZA 1TUCA 2KRNA 1WXUA 1U5SA 1X6BA 2JS2A 2DL4A 4HXJA 4RTTA 4CC3A 2PTKA 1W6XA 1WIEA 2P4RA 2L3PA 1AWXA 1OPKA 1SEMA 5IHKA 1YNZA 2AKLA 3TSZA 1JXMA 3IQLA 1GFDA 2X3WD 3EHRA 4HVWA 2IIMA 2KRMA 3VS5A 1UJYA 2E5KA 2CREA 1VYVA 2ABLA 2FEIA 5FWCA 1AD5A 1UGVA 4CC4B 2BZYA 2DVJA 3SEMA 4JZ4A 2K2MA 4RTXA 2KT8A 4OMLA 1UE9A 1X6GA 2A28A 3VRYA 1M3AA 1Y57A 2JT4A 3M0PA 1H92A 1B3QA 2VVKA 4AFSC 1NM7A 1KSWA 2HDAA 3EG2A 1SPKA 2EGAA 2RQRA 3ZL7C 4CC7A 1BB9A 1V1CA 1OOTA 4AFUC 2HSPA 5IXBA 2LQWA 2YUNA 1UUEA 3M0TA 3ULRB 2CH4A 3M0RA 2ECZA 2XMFA 2KT1A 5I11A 2RQWA 1PHTA 2YSQA 2DBMA 1E6HA 4IIOA 4QT7A 1AEYA 2J6OA 2KRSA 3EG1A 1JXOA 2DF6A 2KXCA 1NG2A 2MIOA 3UATA 2KYMA 1ABOA 1UHFA 5IHNA 2K9GA 3C0CA 4F14A 2O9VA 2RF0A 1GCQC 2DRKA 1AVZC 5ECAA 3PVQA 1ZX6A 2JMAA 2QDLA 3SHWA 3U23A 2LMJA 3H0HA 1H8KA 2DX1A 2FRWA 1CSKA 2CSIA 3R6NA 2EVRA 4KRTA 1WA7A 1AWWA 3VS7A 2DL3A 3I9QA 4RTWA 2DL7A 2GTOA 1CKBA 1NYFA 2EBPA 4Z8AA 2RMOA 4ORZA 3LH5A 3I35A 4J9HA 1FYNA 2FO0A 4IIMA 1M3CA 2RQUA 2W10A 4OMPA 2I0NA 1K1ZA 2L3SA 2K7AA 2F2VA 3VS6A 2J7IA 3H0IA 2O31A 1JQQA 1QKXA 2FPEA 1M8MA 1QKWA 2FRYA 2AZSA 2M51A 4FSSA 1SRMA 2F2WA 4R0KA 1X2QA 2JM8A 2G6FX 2FG0A 1E6GA 1RI9A 2DM1A 3REAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U06 A;  2DA9 A;  2GQI A;  1VA7 A;  1YWO A;  2SRC A;  2NUZ A;  3EHQ A;  1X2K A;  3VS0 A;  1M27 C;  3UA7 A;  4OMM A;  2K79 A;  4AFZ C;  1GRI A;  3NPF A;  2EKH A;  4OMN A;  4ESR A;  1FMK A;  1U3O A;  1T3L A;  2EYW A;  4RTY A;  1QWF A;  2DLP A;  2KEA A;  2LJ3 A;  1ZUK A;  3QWX X;  2JS0 A;  2DNU A;  2A37 A;  2HCK A;  1X43 A;  1YWP A;  1GFC A;  1NLP C;  4J9G A;  3RBB B;  3NHN A;  2KXD A;  4Z89 A;  1WFW A;  1K76 A;  5FW9 A;  4K11 A;  1BBZ A;  1UDL A;  2YT6 A;  1KFZ A;  3UA6 A;  2CT3 A;  3PE0 A;  3PVL A;  5FWB A;  2DMO A;  2EQI A;  1GL5 A;  2D1X A;  4CC2 A;  2RQV A;  1I07 A;  3TSW A;  2DJQ A;  3GBQ A;  1ZUY A;  2B86 A;  4JZ3 A;  1HJD A;  4JJC A;  1PKS A;  1QWE A;  1SHF A;  1AOJ A;  3EG0 A;  5IHI A;  1ZLM A;  3M0S A;  2L3Q A;  1I1J A;  2GBQ A;  1UG1 A;  1GBQ A;  2J6F A;  1OEB A;  2LJ1 A;  1PKT A;  1ABQ A;  2L0A A;  2VKN A;  2YDL A;  3THK A;  3I5R A;  1WYX A;  3RNJ A;  4AFQ C;  2EW3 A;  4Y92 A;  2OI3 A;  4LE9 A;  3VS1 A;  2V1R A;  1UTI A;  1W70 A;  1Z9Z A;  1X27 A;  2GNC A;  2CDT A;  2NWM A;  2PNI A;  1H3H A;  1NEG A;  1TUD A;  1MV3 A;  1WI7 A;  2EGE A;  2J6K A;  4GBQ A;  2CH4 W;  1OV3 A;  5EC7 A;  1MUZ A;  5IH2 A;  1YN8 A;  3A98 A;  1KJW A;  2D8H A;  1UJ0 A;  4A63 B;  2K6D A;  2EPD A;  2HBW A;  2C0I A;  2SEM A;  3UF4 A;  1A0N B;  2EYZ A;  1E7O A;  4HCK A;  2AZV A;  3H0F A;  2J05 A;  2LX7 A;  1NYG A;  4RTU A;  3EG3 A;  1M3B A;  1SSH A;  4J9F A;  3M0U A;  1Z9Q A;  1B07 A;  2DBK A;  1IO6 A;  1JEG A;  5I22 A;  4E6R A;  1YCS B;  4RUG A;  2RQT A;  2JW4 A;  2PZ1 A;  3KFV A;  1PNJ A;  1RLP C;  2MOX A;  4J9C A;  4LN2 A;  2KNB B;  3TVT A;  3VS2 A;  2V1Q A;  2K3B A;  3FJ5 A;  2ED1 A;  1S1N A;  4AG1 C;  1PRL C;  1VYU A;  3VS4 A;  1T0H A;  1AZG B;  2DRM A;  2AK5 A;  4OMQ A;  1G83 A;  4JPB W;  1Y0M A;  1AZE A;  1VYT A;  3I5S A;  3NMZ C;  1CKA A;  1WX6 A;  2HEQ A;  1UEC A;  1YP5 A;  4J9D A;  2H8H A;  2KRO A;  1K9A A;  2CUB A;  1J3T A;  1HSQ A;  2O88 A;  2CUD A;  2KGT A;  2JMC A;  2LCS A;  4DEY A;  2OAW A;  2A08 A;  2YUP A;  2KE9 A;  2CSQ A;  4AG2 C;  2JTE A;  1NEB A;  1EFN A;  1BK2 A;  3O5Z A;  4OMO A;  1GBR A;  1BU1 A;  1RUW A;  2DYB A;  1XOV A;  1AWJ A;  1K0S A;  2ENM A;  2RNA A;  1UHC A;  2GTJ A;  4J9B A;  1PWT A;  2RN8 A;  2C0O A;  2F2X A;  1HD3 A;  2YUQ A;  4RTZ A;  2A36 A;  1MV0 B;  1NLO C;  4LNP A;  5IXF A;  4RTV A;  4JJB A;  1OPL A;  1WDX A;  2DL5 A;  3M0Q A;  2BZ8 A;  4LUD A;  2M0Y A;  4X1V A;  1M30 A;  2DE0 X;  1W1F A;  2EYY A;  2KBT A;  1GCQ A;  1K4U S;  5L23 A;  2D0N A;  1SHG A;  4ZNX A;  3VS3 A;  1ZBJ A;  1JO8 A;  5GJV B;  2LQN A;  2RPN A;  2ED0 A;  2EGC A;  2JXB A;  4JJD A;  2GGR A;  2OJ2 A;  2MCN A;  2KR3 A;  1RLQ C;  2AKK A;  4HVU A;  3CQT A;  2KYB A;  2LNH B;  1I0C A;  2D8J A;  3JV3 A;  2O2O A;  2ROL A;  2O9S A;  1N5Z A;  2VWF A;  4D8K A;  1QLY A;  2LJ0 A;  1LCK A;  2JM9 A;  1GCP A;  3NGP A;  1QCF A;  1X69 A;  2J06 A;  2BTT A;  2L2P A;  1G2B A;  2DIL A;  1JU5 C;  1TG0 A;  2DL8 A;  1SRL A;  5GJW B;  2LP5 A;  4F16 A;  3H41 A;  4J9I A;  4J9E A;  3EGU A;  4EIK A;  1T3S A;  4Z88 A;  2ESW A;  1WXB A;  3VRZ A;  1ZSG A;  2FPF A;  4HVV A;  1T0J A;  5HCK A;  1ARK A;  1PRM C;  2YUO A;  3REB B;  4LUE A;  2W0Z A;  2LZ6 B;  2EYX A;  1ZUU A;  1WXT A;  2X3X D;  2ROT A;  2C0T A;  2BZX A;  4D8D A;  4WCI A;  1AWO A;  3QWY A;  1UFF A;  1WLP B;  1KIK A;  4DEX A;  4F17 A;  2FPD A;  4GLM A;  2CT4 A;  1K0X A;  4M4Z A;  1TUC A;  2KRN A;  1WXU A;  1U5S A;  1X6B A;  2JS2 A;  2DL4 A;  4HXJ A;  4RTT A;  4CC3 A;  2PTK A;  1W6X A;  1WIE A;  2P4R A;  2L3P A;  1AWX A;  1OPK A;  1SEM A;  5IHK A;  1YNZ A;  2AKL A;  3TSZ A;  1JXM A;  3IQL A;  1GFD A;  2X3W D;  3EHR A;  4HVW A;  2IIM A;  2KRM A;  3VS5 A;  1UJY A;  2E5K A;  2CRE A;  1VYV A;  2ABL A;  2FEI A;  5FWC A;  1AD5 A;  1UGV A;  4CC4 B;  2BZY A;  2DVJ A;  3SEM A;  4JZ4 A;  2K2M A;  4RTX A;  2KT8 A;  4OML A;  1UE9 A;  1X6G A;  2A28 A;  3VRY A;  1M3A A;  1Y57 A;  2JT4 A;  3M0P A;  1H92 A;  1B3Q A;  2VVK A;  4AFS C;  1NM7 A;  1KSW A;  2HDA A;  3EG2 A;  1SPK A;  2EGA A;  2RQR A;  3ZL7 C;  4CC7 A;  1BB9 A;  1V1C A;  1OOT A;  4AFU C;  2HSP A;  5IXB A;  2LQW A;  2YUN A;  1UUE A;  3M0T A;  3ULR B;  2CH4 A;  3M0R A;  2ECZ A;  2XMF A;  2KT1 A;  5I11 A;  2RQW A;  1PHT A;  2YSQ A;  2DBM A;  1E6H A;  4IIO A;  4QT7 A;  1AEY A;  2J6O A;  2KRS A;  3EG1 A;  1JXO A;  2DF6 A;  2KXC A;  1NG2 A;  2MIO A;  3UAT A;  2KYM A;  1ABO A;  1UHF A;  5IHN A;  2K9G A;  3C0C A;  4F14 A;  2O9V A;  2RF0 A;  1GCQ C;  2DRK A;  1AVZ C;  5ECA A;  3PVQ A;  1ZX6 A;  2JMA A;  2QDL A;  3SHW A;  3U23 A;  2LMJ A;  3H0H A;  1H8K A;  2DX1 A;  2FRW A;  1CSK A;  2CSI A;  3R6N A;  2EVR A;  4KRT A;  1WA7 A;  1AWW A;  3VS7 A;  2DL3 A;  3I9Q A;  4RTW A;  2DL7 A;  2GTO A;  1CKB A;  1NYF A;  2EBP A;  4Z8A A;  2RMO A;  4ORZ A;  3LH5 A;  3I35 A;  4J9H A;  1FYN A;  2FO0 A;  4IIM A;  1M3C A;  2RQU A;  2W10 A;  4OMP A;  2I0N A;  1K1Z A;  2L3S A;  2K7A A;  2F2V A;  3VS6 A;  2J7I A;  3H0I A;  2O31 A;  1JQQ A;  1QKX A;  2FPE A;  1M8M A;  1QKW A;  2FRY A;  2AZS A;  2M51 A;  4FSS A;  1SRM A;  2F2W A;  4R0K A;  1X2Q A;  2JM8 A;  2G6F X;  2FG0 A;  1E6G A;  1RI9 A;  2DM1 A;  3REA B; 
#chains in the Genus database with same CATH topology
 1U06 A;  3V8J A;  1JB0 E;  1MMG A;  4ELY C;  3GOX A;  3DLL A;  3BE3 A;  1X2K A;  3EHQ A;  5FRO A;  1UGS B;  1XNI A;  1M1K R;  1M1F A;  1WHK A;  2HL5 C;  4ZTF A;  2VXE A;  5KYU B;  2EYW A;  2Y4Y A;  4CI0 C;  2DLP A;  2KEA A;  4BD3 A;  1VQ7 Q;  1YIT T;  4X9C A;  3QWX X;  2E65 A;  3I55 A;  1X43 A;  4J7F A;  1WHJ A;  4J9G A;  4DBH A;  2LDM A;  1LOJ A;  4M7A E;  5GAN 2;  2CKK A;  1D1C A;  4OGE A;  1YHQ A;  1QVG A;  1OX9 A;  4K11 A;  3G6E Q;  1UDL A;  2YT6 A;  4PNO A;  1KFZ A;  4NL3 A;  4V2S A;  3H8Z A;  2DMO A;  2EQI A;  3CCE Q;  1YJ9 T;  5GAM d;  3EH2 A;  4CC2 A;  5GAN f;  2RQV A;  4C92 G;  3JAM E;  1KQS P;  1HJD A;  2ZAE A;  3OSV A;  4JJC A;  1SHF A;  4M7D A;  2G3R A;  2RA2 A;  5IHI A;  1KC8 C;  4PFO A;  2CYZ B;  2GBQ A;  4O5V A;  1QCN A;  2QAS A;  2KQW A;  4QVD A;  1WYX A;  4ZGE B;  2O4X B;  2WSE E;  3EGX B;  4RG8 A;  1UTI A;  4HCZ A;  2COW A;  2PNI A;  1MV3 A;  2J6K A;  1OV3 A;  3HFO A;  4JS4 A;  3A98 A;  2EPD A;  3L2R A;  3WVE B;  2SEM A;  5GAN 5;  5CR2 A;  1E7O A;  4XTY A;  4PJO F;  4HCK A;  1M1K U;  2AZV A;  5LJ5 d;  4F7U A;  2Z0W A;  4KH1 B;  3MKD A;  2J05 A;  2LX7 A;  3EG3 A;  3FC3 A;  1H64 1;  3P8H A;  2XKO C;  3CEY A;  3M0U A;  1YIT Q;  5KE2 A;  3V7C A;  2DBK A;  1IO6 A;  1Q82 R;  2JVV A;  4M7A B;  2FL7 A;  2EQM A;  1YJN Q;  2HSE B;  2OX7 A;  3TQ7 P;  2ED1 A;  1VYU A;  2CS7 A;  1NPR A;  2DRM A;  3CCL A;  3CCM A;  3OY9 A;  1YJ9 Q;  1AZE A;  1VYT A;  3NMZ C;  3UDC A;  2F69 A;  4L59 A;  5CIU A;  5GAM e;  1PG5 B;  3TEE A;  5CKH A;  3CCR T;  1KQS S;  2QEX T;  1J3T A;  1HSQ A;  2P4T A;  1M5Q 1;  3EFO B;  5GAO q;  2KGT A;  2JMC A;  2BE9 B;  1R77 A;  2F1L A;  2OAW A;  2CP3 A;  4C0D C;  4DEY A;  2D6F A;  4PJO G;  4PJJ A;  1NEB A;  1EFN A;  4OMO A;  4QQ6 A;  1M2V A;  3X25 B;  1BU1 A;  3MHX A;  1VQO T;  2DYB A;  1AWJ A;  1S72 T;  3MEW A;  3QDF A;  1RAA B;  2DET A;  4J9B A;  2RH2 A;  1W2B S;  2X4X A;  2QGG A;  2YUQ A;  3PNW C;  3Q1J A;  1QCO A;  2VXF A;  2LCC A;  1VQP Q;  2MF2 A;  5IXF A;  3CCS T;  4JJB A;  1O9S A;  4PKC C;  4BI3 A;  3QBY A;  4LUD A;  3OB9 A;  2VYT A;  1M30 A;  3JCM e;  2DE0 X;  2EYY A;  1K4U S;  4ZNX A;  3VS3 A;  3G4S T;  2QQB A;  2RPN A;  5LJ5 e;  2E64 A;  4M78 D;  2JXB A;  2KDS A;  1VQM T;  1Q82 U;  3X20 B;  4C8Q D;  4D6W A;  2GGR A;  4IUQ A;  5GAM g;  3OMC A;  1GXI E;  3JCM W;  2RM4 A;  2P84 A;  2PVD B;  2YRD A;  4HVU A;  1TS9 A;  1BI0 A;  3V8K A;  4XU0 A;  3CXC A;  1R8O B;  2ROL A;  2QQ9 A;  2JUF A;  2O9S A;  4M75 D;  2JM9 A;  5A2Q E;  4M7D C;  1QCF A;  5KE3 A;  2L2P A;  2DIL A;  1TG0 A;  1KQ1 A;  3OBW A;  1AHJ B;  1VQ6 Q;  1RAH B;  4Q5W A;  3KXT A;  3ER0 A;  2IVW A;  4PJO A;  2CZ0 B;  2F5T X;  3A8O B;  4TVR A;  3RDV A;  2BE7 D;  2FPF A;  1BI1 A;  1C1A A;  5HCK A;  1NJI C;  5LJ5 g;  3PT9 A;  2WAC A;  4IKF A;  2VC8 A;  2CP6 A;  1ZUU A;  3V7S A;  1Q82 C;  1Q81 R;  5FLX E;  2AHJ B;  4C0G A;  2JZ2 A;  4J7I A;  2I2L A;  3INZ A;  2NUT B;  2FPD A;  4GLM A;  2QGF B;  2CT4 A;  4XTV A;  2KRN A;  1EZZ B;  2MPX C;  5GAO p;  3CBO A;  2BUD A;  1U5S A;  3MEV A;  1KQ2 A;  4FYY B;  4HXJ A;  1I5O B;  2PTK A;  4A4H A;  3NTK A;  1W6X A;  1U8R A;  1AWX A;  1Q7Y U;  3OYJ A;  2M1H A;  2AKL A;  1KD1 C;  3TSZ A;  1JXM A;  1B34 B;  1UGP B;  4BDY A;  1QMC A;  2GFU A;  4GY5 A;  3GF5 A;  4FM4 B;  2IIM A;  4OB0 B;  2KRM A;  3M4Y A;  2R57 A;  3VS5 A;  1RL2 A;  2PUO B;  2NUP B;  4JRQ A;  4LXC A;  3GLX A;  2FZG B;  3CPW S;  4JZ4 A;  4RTX A;  3WVD B;  4FYW B;  4ATO A;  2KVQ G;  3EGD A;  3J80 E;  4M7D E;  4M77 G;  1NM7 A;  3JB9 F;  2HDA A;  2QG9 B;  3EG2 A;  3S3N A;  4NOY A;  1OQK A;  1D3B B;  5J26 A;  1TU0 B;  5GAN 3;  3LLR A;  5C6S A;  1BB9 A;  3JCM b;  2CZ6 B;  1TTH B;  2V8I A;  1V1C A;  1I4K 1;  2ATC B;  2WSF E;  3MP6 A;  2QYZ A;  2YUN A;  2OTL A;  3ULR B;  1VIE A;  1G3S A;  2ECZ A;  3MPU B;  5FRN A;  4FW2 A;  2YSQ A;  2RI5 A;  3MP8 A;  2FYK A;  3OMG A;  2J6O A;  5HKC A;  1Q81 U;  3QZ5 B;  1LVK A;  4EMH A;  1QVF S;  1QVP A;  3I55 T;  1D0Z A;  1UHF A;  3SDZ A;  4F7U E;  3L2V A;  4F14 A;  1ZHI A;  3CME Q;  4RMO A;  4OMF B;  3HSB A;  3U23 A;  3EG9 A;  1N6A A;  3EAE A;  2P0K A;  2CSI A;  2F5K A;  4MZP A;  1IGU A;  2HQX A;  3JB9 J;  1IXD A;  4OVA A;  4MMK A;  4JUV A;  2EBP A;  3LH5 A;  3OYG A;  3I35 A;  4M7A D;  2ZPH B;  5LJ3 d;  1FYN A;  1YI2 A;  3VUB A;  3JCM P;  2MWO A;  4OMP A;  3VS6 A;  3G71 T;  2MAM A;  2FPE A;  4BE2 A;  4C92 E;  1QKW A;  2M51 A;  4FSS A;  1SRM A;  1X2Q A;  2JM8 A;  1RAB B;  2G6F X;  1VQ4 Q;  4M77 A;  1OX8 A;  2DM1 A;  3G1J A;  3C94 A;  1VA7 A;  2MYS A;  1Q81 C;  5LJ3 j;  2A3L A;  2L89 A;  3CCQ A;  1HXD A;  4PJO C;  3JSC A;  4EPC A;  4IUU A;  2JOY A;  3NFC A;  3H6Z A;  1VQ8 A;  4BY6 C;  1FMK A;  1U3O A;  1T3L A;  5I2M A;  4RTY A;  2RJD A;  2DEQ A;  1QWF A;  2DYI A;  2LJ3 A;  1M9S A;  4JRP A;  1QW1 A;  1KHI A;  2QAZ A;  3P8D A;  2DNU A;  2A37 A;  3RBB B;  2LCL A;  2QQS A;  2M02 A;  2HMA A;  3I55 Q;  3AT1 B;  1BBZ A;  4LD9 K;  4J6W A;  3M5A A;  1BCM A;  4DBR A;  3PE0 A;  1YHQ Q;  1GL5 A;  3F70 A;  3GPL A;  5KYY B;  1I07 A;  5GMK m;  3CCL T;  2DJQ A;  3GBQ A;  3CCM T;  1ZUY A;  1QWE A;  4C8Q B;  1AOJ A;  3EG0 A;  2QQA A;  1IHV A;  1UG1 A;  2XU8 A;  2J6F A;  2LJ1 A;  1PKT A;  1ABQ A;  2ZZD A;  5KH6 A;  3I5R A;  3RNJ A;  2DTO A;  3UT1 A;  2EJG A;  4C92 B;  4Y92 A;  3OYF A;  2V1R A;  1Z9Z A;  2GNC A;  2HQE A;  3L1A A;  3E19 A;  2CP5 A;  1TUD A;  3DB3 A;  2EGE A;  4GBQ A;  2P0Q A;  2VGM A;  3V7R A;  2E41 A;  5EC7 A;  1UJ0 A;  4E2F B;  2K6D A;  1QVG P;  5IT9 E;  2HBW A;  4QKU A;  4PJO E;  5I21 A;  2ZPI B;  2COZ A;  2CZ1 B;  1ZBX A;  3H0F A;  4XTW A;  2FVU A;  2EIF A;  1SSH A;  4J9F A;  4NS5 A;  3A8M B;  3LX7 A;  3CCV A;  3M54 A;  2ZPF B;  2ZPB B;  4X9D A;  1JEG A;  4HT9 A;  4C5H A;  4E6R A;  1PD1 A;  1R0B G;  1BI2 A;  2RQT A;  5GAN h;  1RLP C;  4J9C A;  2E5Q A;  2DXC A;  3HHT B;  3VS2 A;  4M78 F;  4AG1 C;  2K3Y A;  1FMW A;  1ZA1 B;  3A5Z B;  1T0H A;  4DBQ A;  2AK5 A;  1Y07 A;  5LJ3 g;  1G83 A;  5GMK l;  4QVZ A;  3I5S A;  4F7U G;  3SWN A;  2EWN A;  3CCL Q;  1YP5 A;  2H8H A;  3TCJ A;  2CUB A;  2O88 A;  2BKD N;  3QHS A;  2LCS A;  3TU4 K;  3QZ9 B;  5AYF A;  4P5N A;  5FU7 C;  2XI9 A;  4AG2 C;  3LH0 A;  4M75 F;  1Y7X A;  5FRM A;  4C0F A;  1K0S A;  1EIF A;  4WF2 A;  1UHC A;  5HY6 A;  1V29 B;  3CCJ A;  1X6O A;  1TWB A;  1TXQ A;  2JN0 A;  1ZSZ B;  2K3X A;  3CMA Q;  1MV0 B;  3HTR A;  3PMI A;  5D6W A;  1M90 R;  1NLO C;  4M77 C;  2HKN A;  1IRE B;  4JRI A;  1OPL A;  1X01 A;  5KCO A;  4EMK A;  1WDX A;  2DL5 A;  4LDY A;  1QVG S;  1BIB A;  4A54 A;  2M0Y A;  4JLI A;  4DOW A;  2K4Y A;  3EH1 A;  5GAN j;  2DEU A;  3MEU A;  1VQN Q;  5L23 A;  2D0N A;  2A0F B;  2M9U A;  3X28 B;  5CAI A;  3NTH A;  5CVI A;  2LQN A;  2ED0 A;  3G71 A;  2K5F A;  5FU6 C;  2CGH A;  3CC2 A;  4DQ2 A;  1FMV A;  2VGN A;  2JTM A;  5IN1 A;  2MCN A;  3JCM h;  1VQL A;  1RAI B;  4B9W A;  1RLQ C;  2AKK A;  1VUB A;  2GFA A;  2ZCF B;  5KYX B;  2O01 E;  1PCX A;  2QTV A;  1Y96 A;  2OAU A;  5GAM f;  2X4J A;  1YJW A;  4PJL A;  1QP2 A;  2E6N A;  5GAO r;  4JS5 A;  2DTI A;  4D8K A;  1QLY A;  3CD6 A;  4DOV A;  1NJI R;  1GCP A;  4RCB A;  1X69 A;  2J06 A;  1JU5 C;  1MND A;  2EQJ A;  1WHM A;  3BY7 A;  5GJW B;  3H41 A;  3QG1 A;  4E7S A;  3EGD B;  4AMC A;  4Z88 A;  3FDR A;  1M2O A;  1WXB A;  3VRZ A;  1ZSG A;  1T0J A;  5LL6 S;  1ARK A;  1PRM C;  2YUO A;  3REB B;  4M77 E;  4M7D D;  2OTL T;  1M90 U;  2LZ6 B;  3RMS A;  4D8D A;  3FLG A;  2C0T A;  2BZX A;  3JCM f;  4WCI A;  4N4H A;  3QWY A;  1KIK A;  4DEX A;  6AT1 B;  1XJW B;  5LJ5 f;  1KD1 R;  1AT1 B;  3A8G B;  2QK0 A;  4OGC A;  2YRC A;  3CXC P;  3H9N A;  1G8X A;  2EQK A;  4DA4 A;  1X6B A;  4HCC A;  2JS2 A;  4RTT A;  4CC3 A;  4Y28 E;  1WIE A;  2P4R A;  4E7Z A;  3FRN A;  5D7U A;  3M9Q A;  1OPK A;  3UWN A;  2LVM A;  2HAX A;  1YNZ A;  2XK0 A;  5DLO A;  2HQH A;  4DBF A;  3EG9 B;  1SKU B;  4RKU E;  3PIO A;  2MI6 A;  1W2B A;  2E10 A;  4PFP A;  2RI3 A;  1UEB A;  2VB6 A;  2CRE A;  1VYV A;  4FIB A;  5GAN 8;  3G6E A;  1YI2 T;  1AD5 A;  2BZY A;  2GCX A;  3M58 A;  4ZGD B;  3OYA A;  4OML A;  1UE9 A;  1KK7 A;  3SWN C;  1NJI U;  4M7A F;  2M0O A;  5FU7 B;  5CQX A;  1B3Q A;  3VYH B;  2QXF A;  4AFS C;  3JCM X;  1WHL A;  3EFS A;  3URG A;  3CCE A;  1BYM A;  4B9X A;  1SPK A;  5HK0 A;  1M90 C;  2DD5 A;  2Y4X A;  1VOM A;  3ZL7 C;  3QYG B;  3JB9 I;  2R58 A;  3S3M A;  1Q86 R;  1I5L A;  1OOT A;  4EDU A;  1WPY A;  3MEA A;  1NZ9 A;  1UUE A;  4PFZ A;  4UC4 A;  4M77 B;  4XAX B;  3CCQ T;  5KYN A;  2RQW A;  2QA4 T;  1VQ8 T;  4C92 D;  4ZN1 A;  4ANJ A;  4QT7 A;  1AEY A;  2MMP A;  2H3J A;  3PGG A;  4JDS A;  1JXO A;  2CP7 A;  2KXC A;  1NG2 A;  4BI4 A;  1U1T A;  1ABO A;  1KD1 U;  2K9G A;  3CCR Q;  2DRK A;  2EJ9 A;  2YLB A;  2QEX Q;  3E2U A;  4OB2 B;  5ECA A;  2JMA A;  1RAF B;  4J5Y A;  1H8K A;  5KYU A;  5CO7 A;  2EJF A;  5I2S A;  1XTD A;  1VQO Q;  3VS7 A;  4RTW A;  1S72 Q;  1IRX A;  2DJZ A;  3RR6 A;  2RMO A;  4ORZ A;  4MZT A;  1VIF A;  3R6O A;  1YJN A;  2HBP A;  2PVG B;  2K7A A;  2J7I A;  3CCS Q;  5KYW B;  5GAO n;  3LWH A;  1U1S A;  1YI2 Q;  1QKX A;  1VQ9 A;  1BIA A;  3RKY A;  5DLQ E;  3QSU A;  4WTO B;  3G4S Q;  1E6G A;  1RI9 A;  5GAN 6;  1JJ2 P;  4O6J A;  1LJO A;  2MK5 A;  2DA9 A;  2RD1 A;  4E7H A;  1YWO A;  1VQM Q;  1Q86 U;  1M27 C;  3UA7 A;  3OYC A;  1Q95 G;  2K79 A;  4AFZ C;  4Y91 A;  3CCU A;  2MWP A;  4N4I A;  2EKH A;  2O4X A;  4OMN A;  3CCQ Q;  4E7K A;  1FX7 A;  4BUG A;  1MHN A;  1ZUK A;  3SB2 A;  2JS0 A;  3P8B B;  4FL6 A;  3J81 E;  2HCK A;  1YWP A;  2XHC A;  4Z02 A;  1GFC A;  2DIQ A;  3CCV T;  1SF9 A;  2FHD A;  2XDP A;  3DB4 A;  4Z89 A;  1WFW A;  1PC0 A;  4C0D B;  4GLK A;  1VQP A;  4PJO D;  2COY A;  1WJS A;  3UA6 A;  3VUZ A;  3PFS A;  2CT3 A;  3PVL A;  2GQV A;  5FWB A;  2P0P A;  3L2Z A;  2DK3 A;  3LGL A;  3HRS A;  5CKF A;  3TSW A;  2KK4 A;  2B86 A;  2RHU A;  5KCH A;  4M7A A;  1PKS A;  3CBM A;  3JCM Q;  1ZLM A;  4FSX A;  4KT0 E;  1GBQ A;  2LQ8 A;  2E6Z A;  3GNF B;  2L0A A;  2VKN A;  2YDL A;  1Q86 C;  3THK A;  1WQW A;  2DVE A;  4CRI A;  1JJ2 A;  4AFQ C;  3HRT A;  3VV0 A;  2RJC A;  2XDD A;  3FJP A;  5GMK h;  3VS1 A;  1OI1 A;  1W70 A;  1X27 A;  1IHW A;  4KGV B;  1H3H A;  1NEG A;  1WI7 A;  4PLI A;  4KUI A;  4ME7 A;  2CH4 W;  1WJR A;  3CCJ T;  1MUZ A;  1YN8 A;  1KJW A;  3QPH A;  3MET A;  5D6X A;  2DZC A;  2C0I A;  3JB9 G;  1D1A A;  1WZO A;  1MGQ A;  1MNE A;  9ATC B;  4II1 A;  1VQ6 A;  1NYG A;  3OS2 A;  1D0X A;  1HYO A;  2OTJ A;  1B07 A;  5I22 A;  4M7D B;  1EX4 A;  2YWW A;  1YCS B;  5J39 A;  4X34 A;  3CC2 T;  2JW4 A;  3KFV A;  3BDL A;  2MOX A;  1VQL T;  3TVT A;  4XK8 E;  3FJ5 A;  1S1N A;  4RG2 A;  3VS4 A;  4PK4 A;  2X35 A;  3RMQ A;  2QTX A;  1Y0M A;  4JPB W;  3CC4 A;  3N5B B;  1LNX A;  1YJW T;  4LDV A;  5GMK j;  1UEC A;  2QA4 A;  2RJF A;  3T9N A;  2KRO A;  1Y96 B;  2RB6 A;  2DPP B;  4XTX A;  1YCY A;  4KGX B;  3CD6 T;  5LJ3 f;  3GNG A;  2RK2 A;  4LDW A;  4VUB A;  5M9O A;  1OZ2 A;  3RES A;  2KE9 A;  3O5Z A;  4F7U B;  1GBR A;  1XOV A;  1MMA A;  2ENM A;  2RNA A;  3NTI A;  4HA8 A;  1SSF A;  2GTJ A;  2RN8 A;  2C0O A;  2F2X A;  4MDX A;  3VYG A;  4RTZ A;  1G3Y A;  1RAD B;  5A0G A;  2IG0 A;  3KUF A;  4FT2 A;  4RTV A;  3OW2 P;  4BI8 B;  3QXE B;  1LPL A;  4FYX B;  1TUG B;  1GCQ A;  2DTH A;  1ZBJ A;  1JO8 A;  4MZM A;  5GJV B;  2V8J A;  1F1B B;  8AT1 B;  2KAF A;  4M77 D;  4FYV B;  2KR3 A;  5LJ3 e;  3G71 Q;  3CC2 Q;  1PD0 A;  3X24 B;  1N9R A;  1VQL Q;  2YXY A;  2NUT A;  1OYX A;  5GMK i;  1M2V B;  1VQK A;  1I0C A;  1BCO A;  3FIF A;  2R5A A;  5GAO m;  1UB4 A;  3OYY A;  4L6V 5;  2O2O A;  3LWI A;  3CME A;  2LC4 A;  1N5Z A;  2VWF A;  3C4S A;  2LJ0 A;  3CC7 A;  3FB9 A;  3G6E T;  1C6V X;  4M7A C;  2DIG A;  3NGP A;  4KGZ B;  3ZEH A;  2DL8 A;  1B34 A;  4A4F A;  1YIJ A;  3L2Q A;  2CZ7 B;  2LP5 A;  4F16 A;  3CCE T;  4J9I A;  3HL8 A;  4PL6 A;  4E7L A;  4HCB A;  2X4W A;  4JLG A;  4EIK A;  4EMG A;  1T3S A;  2A7Y A;  3FEO A;  3OW2 A;  1KG1 A;  4LDX A;  1OZ3 A;  4HVV A;  2EFI A;  2LT4 A;  4J8O A;  2E1H A;  1KHC A;  3DLM A;  1OU9 A;  2W0Z A;  1Y71 A;  2C06 A;  2EYX A;  2X3X D;  1WXT A;  1ZQ1 A;  2DXU A;  3QJY A;  4J6X A;  4C8Q F;  4R55 A;  2XDB A;  1N27 A;  3HKS A;  2X9H A;  1VQ5 A;  3OYH A;  1UFF A;  1WLP B;  4E47 A;  4F17 A;  2L5Q A;  3CCM Q;  1VQ4 A;  2VUB A;  2ZGW A;  1TUC A;  2EYQ A;  1JBM A;  1WXU A;  4C92 F;  3ZBD A;  4PLL A;  2DER A;  3C95 A;  2V8K A;  2E70 A;  2RHY A;  2VAS A;  7AT1 B;  3I56 A;  3OQ5 A;  5CQY A;  4QW2 A;  5GAN d;  1SEM A;  5IHK A;  5GAM h;  3LW5 E;  3BFM A;  3IQL A;  1TH7 A;  1GFD A;  3OYK A;  3KBG A;  4ZTJ A;  1DJ7 B;  3A1P A;  2KI7 A;  1UJY A;  2WSC E;  3QII A;  5GAO l;  4PJO B;  2DAQ A;  1N8R R;  2XIC A;  4XU2 A;  5EG2 A;  4BY6 B;  2ABL A;  2FEI A;  5FWC A;  4LD6 A;  4CC4 B;  1YJN T;  2DVJ A;  4M78 G;  3SEM A;  5J3B A;  2KT8 A;  1X6G A;  2A28 A;  3VRY A;  1M3A A;  2JT4 A;  2VVK A;  4C8Q G;  1XQH A;  3HP9 A;  1PM3 A;  1VQ9 T;  8ATC B;  1D0Y A;  2YLC A;  2EGA A;  2RQR A;  3VKI A;  2B8A A;  2E3H A;  3S6W A;  5AT1 B;  4RCC A;  2K5I A;  1BKB A;  2DD4 A;  5IXB A;  3OYE A;  1K9M C;  2CH4 A;  3M0R A;  2EKO A;  1OUL A;  2KT1 A;  5LJ5 h;  4M75 G;  5CCA A;  3CCU T;  2RJE A;  2CP2 A;  4IIO A;  4BE1 A;  3OYL A;  5GAM j;  1W2B P;  2JJ9 A;  5IHN A;  2DZ9 A;  3C0C A;  4FW1 A;  3UPU A;  4R56 A;  1GCQ C;  4A4E A;  1AVZ C;  3OYM A;  3SHW A;  3PVQ A;  2QDL A;  1VQP T;  3BDU A;  2LMJ A;  3H0H A;  3JCM d;  2DX1 A;  2FRW A;  2M16 A;  4KBM B;  5C0M A;  2E4H A;  2LX9 A;  3M55 A;  2EVR A;  3G7Z A;  4KRT A;  2DL3 A;  3I9Q A;  1CKB A;  1NYF A;  3WXM B;  3LYI A;  3QDR B;  5GAN e;  4BE0 A;  4J9H A;  4AT1 B;  2W10 A;  4MML A;  3L2W A;  1K1Z A;  2L3S A;  1N8R U;  1RI0 A;  2F2V A;  2EAY A;  4MDW A;  1B7T A;  2O31 A;  1JQQ A;  3QYH B;  2PVO B;  1M8M A;  5KYY A;  2D9T A;  3X26 B;  2AZS A;  4M78 A;  2VV5 A;  2F2W A;  3OYB A;  3L2U A;  5LJ5 j;  4R0K A;  1VQ9 Q;  1KQS A;  2FG0 A;  4C0Z A;  4IIM A;  4C8Q A;  1M4Z A;  2K57 A;  1TSF A;  2GQI A;  4N0A A;  2SRC A;  2NLU A;  2NUZ A;  3VS0 A;  2HZY A;  1MMN A;  4OMM A;  3A8L B;  1VQ7 A;  3QKJ A;  1GRI A;  4J83 A;  4F04 B;  3NPF A;  4C92 A;  4E7I A;  4ESR A;  4IUV A;  1N9S A;  4IUT A;  3CCU Q;  4JJN K;  1TOV A;  1VQ6 T;  4M75 A;  3BW1 A;  3V8L A;  2OTJ T;  2HL3 A;  1NLP C;  1WGS A;  3NHN A;  2KXD A;  1M1K C;  2X4Y A;  1OU8 A;  3VU3 C;  2RHZ A;  5GAN g;  3CMA A;  1K76 A;  2RHX A;  5FW9 A;  4IUR A;  3OYN A;  4ZGJ B;  4YTL A;  1IB8 A;  4C5E A;  3OYD A;  1N8R C;  2D1X A;  4ELZ C;  1QQJ A;  4B6M A;  1VQN A;  2HKQ B;  2DXT A;  1JRI A;  4JZ3 A;  3CC4 T;  3MCA B;  4XU3 A;  3JRZ A;  3EFR A;  5D6Y A;  3M0S A;  3C12 A;  3MJX A;  2L3Q A;  3O8V A;  1I1J A;  2OTL Q;  2V26 A;  1OEB A;  1BI3 A;  2PUK B;  4KH0 B;  2JNG A;  3OSS C;  1G3T A;  1ACM B;  5CKE A;  1Q7Y R;  4EMK C;  2EW3 A;  3E9F A;  4QVC A;  2OI3 A;  4LE9 A;  3A8H B;  3HRU A;  2YHT A;  5FU6 B;  2XD0 A;  2CDT A;  2NWM A;  2K2V A;  4QQD A;  4L5G A;  5IH2 A;  3CXC S;  4A4K A;  2D8H A;  4BB7 A;  4A63 B;  3UF4 A;  3CPW P;  1PSE A;  2JTF A;  4M7A G;  1A0N B;  2EYZ A;  2H3E B;  3DKM A;  2LNV A;  1YIT A;  1FWZ A;  4RTU A;  4J6Y A;  1M3B A;  1K8A R;  1Z9Q A;  3LGF A;  1K73 R;  1M1G A;  1ZSZ A;  1QP3 A;  3JCM g;  2OTJ Q;  4RUG A;  3E9G A;  2DXB A;  3PMT A;  3AHU A;  2PZ1 A;  1PNJ A;  3HFN A;  4LN2 A;  3OYI A;  2KNB B;  1RAG B;  2V1Q A;  2K3B A;  1YJ9 A;  1PRL C;  3CBP A;  3QUI A;  4N4G A;  1AZG B;  2NYS A;  4M77 F;  3JCM V;  4OMQ A;  1QVF P;  1VQK T;  5DM7 R;  1G5V A;  1CKA A;  1O75 A;  1V76 A;  1WX6 A;  5IAY A;  2HEQ A;  4J9D A;  1D09 B;  3CPF A;  1K9A A;  2DFU A;  3CME T;  3CC4 Q;  4C5I A;  4LDU A;  1RAC B;  1IZ6 A;  2CUD A;  3EGX A;  3CC7 T;  2QA4 Q;  1VQ8 Q;  2BIV A;  2A08 A;  5KYX A;  2KSS A;  2YUP A;  2LTO A;  2CSQ A;  5GAN 4;  2JTE A;  1BK2 A;  1YIJ T;  2LRQ A;  1RUW A;  2L3R A;  1HK9 A;  1PWT A;  3CPW A;  1HD3 A;  3M53 A;  4BAC A;  4M78 C;  2E3I A;  2A36 A;  1W4S A;  1NBE B;  3HPW A;  3OS5 A;  4PJM A;  4C8Q C;  2HD0 A;  4LNP A;  2KY9 A;  4N0A C;  2EQU A;  3SD4 A;  4OB3 B;  3M0Q A;  4XTU A;  2BZ8 A;  2RO0 A;  4X1V A;  1VQ5 T;  1W1F A;  2KBT A;  1SHG A;  5CK9 A;  4C92 C;  1VQ4 T;  2HNI A;  4OP0 A;  4IUP A;  1K8A U;  2EGC A;  1K73 U;  1G3W A;  2R5M A;  3GIB A;  4XU1 A;  3SWN B;  4HT8 A;  4JJD A;  4M75 C;  2OJ2 A;  3I56 T;  3D7S B;  1QVF A;  1R0C B;  3CQT A;  5CKB A;  2KYB A;  2LNH B;  4HKE A;  1D1B A;  1P92 A;  3RER A;  2D8J A;  3OS0 A;  2FZK B;  3EFO A;  1JJ2 S;  5LJ3 h;  1YBY A;  3JV3 A;  2DKG A;  1Q7Y C;  1VQK Q;  3CCR A;  2KMT A;  4E7J A;  3E1S A;  2QEX A;  3MO8 A;  2AIR B;  1LCK A;  2CP0 A;  3QO3 A;  2BTT A;  1H3Z A;  1G2B A;  1YHQ T;  1SRL A;  3CC7 Q;  4EMK B;  4NL2 A;  3JCM J;  1VQO A;  4J9E A;  4JRK A;  1S72 A;  3EGU A;  1YIJ Q;  2ESW A;  3VJP A;  3CCV Q;  4ZN3 A;  5DY9 A;  3ZFJ A;  4KUL A;  4M78 E;  2X51 A;  3ASK A;  3CCS A;  1UGQ B;  4LUE A;  3OS1 A;  4C8Q E;  3JB9 H;  2QDY B;  1K8A C;  1K73 C;  2ROT A;  1AWO A;  1IGQ A;  3RIR A;  4OF1 A;  4A4G A;  4FCY A;  2DO3 A;  2AT1 B;  2RI2 A;  4PJN A;  3G4S A;  2YRV A;  1K0X A;  4M4Z A;  1VQ5 Q;  1MMD A;  1VQM A;  1WJQ A;  2ZPG B;  1M8V A;  2DL4 A;  4M75 E;  3TRE A;  3J7A F;  3ME9 A;  2L3P A;  3OBY A;  1ZSZ C;  3M59 A;  2RHI A;  3I56 Q;  1PSF A;  1NE8 A;  2X3W D;  4FT4 A;  4KUD K;  4A53 A;  3S3O A;  3EHR A;  4HVW A;  1WHH A;  1WHG A;  4XTZ A;  3CCJ Q;  4OB1 B;  2E5K A;  1I8F A;  5A0L A;  1FXX A;  2QQR A;  3RKX A;  3PTA A;  1UGV A;  2PU9 B;  1WQ7 A;  2K2M A;  3RUX A;  4XQ3 A;  3M0P A;  1Y57 A;  1SG5 A;  1K9M R;  3MP1 A;  4M7D F;  1H92 A;  2D0Q B;  1KSW A;  2XID A;  1KC8 R;  3GP8 A;  4CC7 A;  3M57 A;  2L8D A;  2QI2 A;  4AFU C;  4M78 B;  2XG8 D;  2HSP A;  2LQW A;  2FZC B;  5KYW A;  1I81 A;  3M0T A;  5GMK e;  2XMF A;  1YFN A;  5I11 A;  1VQ7 T;  1PHT A;  2DBM A;  1E6H A;  1C0M A;  5CKD A;  5HK3 A;  2KRS A;  3M56 A;  1ZA2 B;  3EG1 A;  2DF6 A;  2K5L A;  2MIO A;  3UAT A;  2KYM A;  3QJ6 A;  2FB7 A;  1YJW Q;  4F7U F;  2O9V A;  2RF0 A;  2Y90 A;  4M75 B;  3CD6 Q;  3CMA T;  1ZX6 A;  2E12 A;  2RK1 A;  3L42 A;  4FU6 A;  1NPP A;  1CSK A;  3PIP A;  1RAE B;  3R6N A;  3JCM c;  2GF7 A;  4M7D G;  1WA7 A;  4QQG A;  1AWW A;  2IPO B;  2DL7 A;  2GTO A;  2NUP A;  2ZPE B;  1VQN T;  4Z8A A;  3SFM A;  2LT1 A;  5L8R E;  2FO0 A;  2LQK A;  3OA6 A;  3JB9 D;  1M3C A;  2RQU A;  2I0N A;  2PQW A;  3H0I A;  1D3B A;  3OW2 S;  1X75 C;  3RKW A;  1K9M U;  2FRY A;  1UGR B;  1KC8 U;  5A0D A;  1WNL A;  4C5G A;  3M4G A;  4BDZ A;  5GAN 7;  3REA B; 
#chains in the Genus database with same CATH homology
 1U06 A;  2DA9 A;  2GQI A;  1VA7 A;  1YWO A;  2SRC A;  2NUZ A;  3EHQ A;  1X2K A;  3VS0 A;  1M27 C;  3UA7 A;  4OMM A;  2K79 A;  4AFZ C;  1GRI A;  3NPF A;  2EKH A;  4OMN A;  4ESR A;  1FMK A;  1U3O A;  1T3L A;  2EYW A;  4RTY A;  1QWF A;  2DLP A;  2KEA A;  2LJ3 A;  1ZUK A;  3QWX X;  2JS0 A;  2DNU A;  2A37 A;  2HCK A;  1X43 A;  1YWP A;  1GFC A;  1NLP C;  4J9G A;  3RBB B;  3NHN A;  2KXD A;  4Z89 A;  1WFW A;  1K76 A;  5FW9 A;  4K11 A;  1BBZ A;  1UDL A;  2YT6 A;  1KFZ A;  3UA6 A;  2CT3 A;  3PE0 A;  3PVL A;  5FWB A;  2DMO A;  2EQI A;  1GL5 A;  2D1X A;  4CC2 A;  2RQV A;  1I07 A;  3TSW A;  2DJQ A;  3GBQ A;  1ZUY A;  2B86 A;  4JZ3 A;  1HJD A;  4JJC A;  1PKS A;  1QWE A;  1SHF A;  1AOJ A;  3EG0 A;  5IHI A;  1ZLM A;  3M0S A;  2L3Q A;  1I1J A;  2GBQ A;  1UG1 A;  1GBQ A;  2J6F A;  1OEB A;  2LJ1 A;  1PKT A;  1ABQ A;  2L0A A;  2VKN A;  2YDL A;  3THK A;  3I5R A;  1WYX A;  3RNJ A;  4AFQ C;  2EW3 A;  4Y92 A;  2OI3 A;  4LE9 A;  3VS1 A;  2V1R A;  1UTI A;  1W70 A;  1Z9Z A;  1X27 A;  2GNC A;  2CDT A;  2NWM A;  2PNI A;  1H3H A;  1NEG A;  1TUD A;  1MV3 A;  1WI7 A;  2EGE A;  2J6K A;  4GBQ A;  2CH4 W;  1OV3 A;  5EC7 A;  1MUZ A;  5IH2 A;  1YN8 A;  3A98 A;  1KJW A;  2D8H A;  1UJ0 A;  4A63 B;  2K6D A;  2EPD A;  2HBW A;  2C0I A;  2SEM A;  3UF4 A;  1A0N B;  2EYZ A;  1E7O A;  4HCK A;  2AZV A;  3H0F A;  2J05 A;  2LX7 A;  1NYG A;  4RTU A;  3EG3 A;  1M3B A;  1SSH A;  4J9F A;  3M0U A;  1Z9Q A;  1B07 A;  2DBK A;  1IO6 A;  1JEG A;  5I22 A;  4E6R A;  1YCS B;  4RUG A;  2RQT A;  2JW4 A;  2PZ1 A;  3KFV A;  1PNJ A;  1RLP C;  2MOX A;  4J9C A;  4LN2 A;  2KNB B;  3TVT A;  3VS2 A;  2V1Q A;  2K3B A;  3FJ5 A;  2ED1 A;  1S1N A;  4AG1 C;  1PRL C;  1VYU A;  3VS4 A;  1T0H A;  1AZG B;  2DRM A;  2AK5 A;  4OMQ A;  1G83 A;  4JPB W;  1Y0M A;  1AZE A;  1VYT A;  3I5S A;  3NMZ C;  1CKA A;  1WX6 A;  2HEQ A;  1UEC A;  1YP5 A;  4J9D A;  2H8H A;  2KRO A;  1K9A A;  2CUB A;  1J3T A;  1HSQ A;  2O88 A;  2CUD A;  2KGT A;  2JMC A;  2LCS A;  4DEY A;  2OAW A;  2A08 A;  2YUP A;  2KE9 A;  2CSQ A;  4AG2 C;  2JTE A;  1NEB A;  1EFN A;  1BK2 A;  3O5Z A;  4OMO A;  1GBR A;  1BU1 A;  1RUW A;  2DYB A;  1XOV A;  1AWJ A;  1K0S A;  2ENM A;  2RNA A;  1UHC A;  2GTJ A;  4J9B A;  1PWT A;  2RN8 A;  2C0O A;  2F2X A;  1HD3 A;  2YUQ A;  4RTZ A;  2A36 A;  1MV0 B;  1NLO C;  4LNP A;  5IXF A;  4RTV A;  4JJB A;  1OPL A;  1WDX A;  2DL5 A;  3M0Q A;  2BZ8 A;  4LUD A;  2M0Y A;  4X1V A;  1M30 A;  2DE0 X;  1W1F A;  2EYY A;  2KBT A;  1GCQ A;  1K4U S;  5L23 A;  2D0N A;  1SHG A;  4ZNX A;  3VS3 A;  1ZBJ A;  1JO8 A;  5GJV B;  2LQN A;  2RPN A;  2ED0 A;  2EGC A;  2JXB A;  4JJD A;  2GGR A;  2OJ2 A;  2MCN A;  2KR3 A;  1RLQ C;  2AKK A;  4HVU A;  3CQT A;  2KYB A;  2LNH B;  1I0C A;  2D8J A;  3JV3 A;  2O2O A;  2ROL A;  2O9S A;  1N5Z A;  2VWF A;  4D8K A;  1QLY A;  2LJ0 A;  1LCK A;  2JM9 A;  1GCP A;  3NGP A;  1QCF A;  1X69 A;  2J06 A;  2BTT A;  2L2P A;  1G2B A;  2DIL A;  1JU5 C;  1TG0 A;  2DL8 A;  1SRL A;  5GJW B;  2LP5 A;  4F16 A;  3H41 A;  4J9I A;  4J9E A;  3EGU A;  4EIK A;  1T3S A;  4Z88 A;  2ESW A;  1WXB A;  3VRZ A;  1ZSG A;  2FPF A;  4HVV A;  1T0J A;  5HCK A;  1ARK A;  1PRM C;  2YUO A;  3REB B;  4LUE A;  2W0Z A;  2LZ6 B;  2EYX A;  1ZUU A;  1WXT A;  2X3X D;  2ROT A;  2C0T A;  2BZX A;  4D8D A;  4WCI A;  1AWO A;  3QWY A;  1UFF A;  1WLP B;  1KIK A;  4DEX A;  4F17 A;  2FPD A;  4GLM A;  2CT4 A;  1K0X A;  4M4Z A;  1TUC A;  2KRN A;  1WXU A;  1U5S A;  1X6B A;  2JS2 A;  2DL4 A;  4HXJ A;  4RTT A;  4CC3 A;  2PTK A;  1W6X A;  1WIE A;  2P4R A;  2L3P A;  1AWX A;  1OPK A;  1SEM A;  5IHK A;  1YNZ A;  2AKL A;  3TSZ A;  1JXM A;  3IQL A;  1GFD A;  2X3W D;  3EHR A;  4HVW A;  2IIM A;  2KRM A;  3VS5 A;  1UJY A;  2E5K A;  2CRE A;  1VYV A;  2ABL A;  2FEI A;  5FWC A;  1AD5 A;  1UGV A;  4CC4 B;  2BZY A;  2DVJ A;  3SEM A;  4JZ4 A;  2K2M A;  4RTX A;  2KT8 A;  4OML A;  1UE9 A;  1X6G A;  2A28 A;  3VRY A;  1M3A A;  1Y57 A;  2JT4 A;  3M0P A;  1H92 A;  1B3Q A;  2VVK A;  4AFS C;  1NM7 A;  1KSW A;  2HDA A;  3EG2 A;  1SPK A;  2EGA A;  2RQR A;  3ZL7 C;  4CC7 A;  1BB9 A;  1V1C A;  1OOT A;  4AFU C;  2HSP A;  5IXB A;  2LQW A;  2YUN A;  1UUE A;  3M0T A;  3ULR B;  2CH4 A;  3M0R A;  2ECZ A;  2XMF A;  2KT1 A;  5I11 A;  2RQW A;  1PHT A;  2YSQ A;  2DBM A;  1E6H A;  4IIO A;  4QT7 A;  1AEY A;  2J6O A;  2KRS A;  3EG1 A;  1JXO A;  2DF6 A;  2KXC A;  1NG2 A;  2MIO A;  3UAT A;  2KYM A;  1ABO A;  1UHF A;  5IHN A;  2K9G A;  3C0C A;  4F14 A;  2O9V A;  2RF0 A;  1GCQ C;  2DRK A;  1AVZ C;  5ECA A;  3PVQ A;  1ZX6 A;  2JMA A;  2QDL A;  3SHW A;  3U23 A;  2LMJ A;  3H0H A;  1H8K A;  2DX1 A;  2FRW A;  1CSK A;  2CSI A;  3R6N A;  2EVR A;  4KRT A;  1WA7 A;  1AWW A;  3VS7 A;  2DL3 A;  3I9Q A;  4RTW A;  2DL7 A;  2GTO A;  1CKB A;  1NYF A;  2EBP A;  4Z8A A;  2RMO A;  4ORZ A;  3LH5 A;  3I35 A;  4J9H A;  1FYN A;  2FO0 A;  4IIM A;  1M3C A;  2RQU A;  2W10 A;  4OMP A;  2I0N A;  1K1Z A;  2L3S A;  2K7A A;  2F2V A;  3VS6 A;  2J7I A;  3H0I A;  2O31 A;  1JQQ A;  1QKX A;  2FPE A;  1M8M A;  1QKW A;  2FRY A;  2AZS A;  2M51 A;  4FSS A;  1SRM A;  2F2W A;  4R0K A;  1X2Q A;  2JM8 A;  2G6F X;  2FG0 A;  1E6G A;  1RI9 A;  2DM1 A;  3REA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...