2LCSA

Yeast nbp2p sh3 domain in complex with a peptide from ste20p
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
67
structure length
67
Chain Sequence
MAIVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Peptide Binding Specificities of Src Homology 3 (SH3) Protein Domains Can Be Determined by Modulation of Local Energetics across the Binding Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase, signaling protein
molecule keywords NAP1-binding protein 2
total genus 8
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lcsA00
4J9HA 1KIKA 1GBRA 2DF6A 1HD3A 4AFZC 1BK2A 3VRZA 2DL3A 1ZUKA 4K11A 1WYXA 1M8MA 2F2WA 3C0CA 3I35A 2OAWA 2PNIA 2XMFA 4RTVA 2D0NA 3I5SA 1WIEA 2EGAA 2EPDA 2RNAA 1ZBJA 4Z88A 1T0JA 2KGTA 2JT4A 2V1QA 3I5RA 2HEQA 2I0NA 1JO8A 2JM8A 1M3CA 2LJ1A 3M0TA 1PHTA 1IO6A 2BZXA 4OMNA 3VRYA 2YUQA 2KYMA 5IXBA 1PNJA 1PKTA 3FJ5A 2ED1A 2GTJA 2MCNA 2ROTA 4ORZA 2EBPA 1NEGA 1UHCA 1M27C 2HDAA 2CSQA 4RTTA 2ESWA 2VKNA 1CKBA 5ECAA 1GBQA 1WI7A 1YNZA 4J9IA 1QCFA 2K2MA 2LJ3A 2OI3A 1JQQA 2CT3A 1ZSGA 2QDLA 3EG2A 1AZEA 4IIMA 4HVUA 2RQRA 2J7IA 2X3XD 3THKA 1WFWA 1OPKA 2FPEA 2LZ6B 1MV3A 1ZUYA 2DL8A 2CUBA 4J9CA 1ZX6A 2DL7A 1G83A 2A08A 2M0YA 1SHFA 2EGCA 2GTOA 2DYBA 3PVQA 2AZVA 1JXOA 3M0PA 2LQNA 1E7OA 3UA6A 1YP5A 2YDLA 3VS0A 4LUDA 3VS3A 1K4US 1U06A 3O5ZA 2C0TA 4AG1C 2CUDA 2J05A 2LNHB 4AFUC 3NHNA 2KRSA 2LCSA 4OMLA 2K6DA 2F2VA 2JTEA 1MV0B 1PWTA 2GNCA 2C0IA 3M0QA 2F2XA 2DILA 2OJ2A 4RTYA 2J6KA 4RTXA 2ENMA 1SRLA 5IHIA 4EIKA 2JW4A 1GFDA 2FG0A 4HXJA 5HCKA 2O9VA 1HSQA 1NLPC 5GJWB 2KRNA 3NGPA 2C0OA 2AKLA 1TG0A 1WA7A 1Y57A 4RTZA 1SSHA 1AOJA 2E5KA 2NWMA 4D8KA 1H8KA 1G2BA 2DM1A 2FPDA 4D8DA 4LN2A 4JPBW 5L23A 4QT7A 1HJDA 1GCPA 1M30A 2GGRA 2SRCA 3R6NA 1ZLMA 1M3BA 5I22A 1NG2A 2DLPA 2RQVA 1Z9QA 1X69A 4JJBA 2FPFA 2ABLA 4HCKA 3M0UA 2AZSA 1RLPC 1S1NA 3VS5A 2EYXA 2K7AA 1NM7A 3REBB 4IIOA 1W70A 4OMQA 1YCSB 2VWFA 1AEYA 1SHGA 2EYZA 1ABQA 4Y92A 2H8HA 4RUGA 1V1CA 3IQLA 2W0ZA 3VS6A 1NEBA 2J6FA 2CSIA 1N5ZA 4JJDA 2ROLA 3M0SA 2KYBA 2EYWA 2KT8A 4J9EA 2LJ0A 1M3AA 1K9AA 3REAB 1OEBA 2YUPA 2EQIA 2PZ1A 3H0HA 1AWWA 1H3HA 3LH5A 2JXBA 2ECZA 5FWBA 2DJQA 1NYFA 1UG1A 4GLMA 1UJYA 1B07A 1RUWA 1NLOC 4J9GA 1ARKA 2MIOA 1E6HA 1UFFA 1Y0MA 2VVKA 3QWYA 1MUZA 1H92A 1JXMA 3EHQA 2YT6A 2DA9A 3VS7A 3EG3A 3ULRB 4AFSC 2O2OA 4FSSA 1FYNA 2LQWA 2O88A 4GBQA 1XOVA 1OV3A 1SPKA 5I11A 1WLPB 2RQTA 2A28A 2AKKA 3TSZA 4LUEA 1VYVA 1SRMA 2L3PA 3CQTA 1JEGA 1UDLA 1A0NB 5FWCA 2W10A 2BZYA 4HVWA 3EG0A 4ESRA 1CKAA 2DVJA 2KE9A 2K79A 1E6GA 2FEIA 2DNUA 4J9DA 2EGEA 1X6GA 2JMAA 3PVLA 4JZ3A 1GCQA 1FMKA 1QKWA 2K9GA 4F16A 3I9QA 2FRWA 2CREA 5IHKA 4J9BA 1B3QA 4R0KA 4CC3A 2G6FX 3U23A 3VS4A 1AD5A 1PRMC 4OMOA 3PE0A 1NYGA 1AWXA 1TUDA 1JU5C 1T3LA 1VYTA 4ZNXA 1WXUA 4F14A 3NMZC 2DMOA 5FW9A 1K76A 1BU1A 1YWPA 4Z8AA 1UJ0A 1T0HA 1UTIA 2B86A 1K0SA 4E6RA 2V1RA 5GJVB 2BZ8A 2BTTA 1K0XA 3EG1A 2KNBB 1PKSA 1X2QA 2DRKA 1UGVA 1WX6A 2CH4W 2YUOA 3EHRA 1AWJA 3A98A 1QWFA 2FO0A 2RQWA 4AG2C 3TSWA 2MOXA 1I07A 2L2PA 4AFQC 4RTUA 2J6OA 3KFVA 3VS1A 1WXTA 1RLQC 2KEAA 3H41A 2JS2A 3UF4A 2HBWA 1WDXA 2L3QA 4WCIA 2YUNA 4DEXA 4DEYA 3SEMA 4A63B 2LX7A 3TVTA 2KR3A 4JJCA 3UA7A 1UUEA 4CC2A 5IH2A 5EC7A 1GCQC 2A36A 1OPLA 2D8JA 1Z9ZA 1X43A 1LCKA 1BBZA 2EYYA 2YSQA 2DE0X 1WXBA 1YN8A 1TUCA 2DRMA 4LNPA 2KROA 1KFZA 1I0CA 2RMOA 2O9SA 2CH4A 2L3SA 3M0RA 2DBMA 1UHFA 1I1JA 4Z89A 1X2KA 2P4RA 1RI9A 1X6BA 1CSKA 3NPFA 2DL4A 1UE9A 1PRLC 2JMCA 1QWEA 2FRYA 4KRTA 1AWOA 2RPNA 1BB9A 3ZL7C 3H0IA 2EVRA 5IHNA 2IIMA 1QLYA 2SEMA 3RBBB 3RNJA 1J3TA 4CC4B 3SHWA 1QKXA 1GRIA 1SEMA 4OMMA 2DL5A 2LMJA 1ABOA 1K1ZA 4M4ZA 1AZGB 2L0AA 2AK5A 2KXDA 2K3BA 2D1XA 2HSPA 4X1VA 2JS0A 2EW3A 2NUZA 3H0FA 3QWXX 2KBTA 1GL5A 3GBQA 2LP5A 1UECA 2O31A 2D8HA 1W1FA 1KJWA 3UATA 2CT4A 1OOTA 2J06A 5IXFA 2PTKA 1ZUUA 4JZ4A 3JV3A 2DBKA 4CC7A 1U5SA 1KSWA 1YWOA 2HCKA 2CDTA 2KRMA 2RN8A 2GBQA 2A37A 2KXCA 1VA7A 4F17A 2KT1A 2RF0A 2RQUA 4RTWA 1X27A 4HVVA 2GQIA 2ED0A 4LE9A 2EKHA 4OMPA 3EGUA 1GFCA 1T3SA 1VYUA 1EFNA 2DX1A 3VS2A 1AVZC 2M51A 1W6XA 2JM9A 1U3OA 2X3WD 4J9FA
chains in the Genus database with same CATH superfamily
4C0GA 1M90U 4AFZC 3CMAA 1BK2A 4C8QG 3WVDB 4K11A 5IT9E 1M2VB 1M8MA 3TEEA 3C0CA 2PNIA 5GANe 4M7AF 3CCLA 1Q7YR 3X28B 5D6XA 3S3OA 1WIEA 2EPDA 3EFSA 2QEXA 3CD6Q 5LJ3j 2QASA 3VJPA 1T0JA 2RD1A 2YLBA 3DKMA 2JT4A 4N0AA 1Y96B 1R0BG 3LWHA 4NOYA 3QKJA 2RHUA 3CC7T 5LJ3e 3G71Q 2CZ1B 2ZPHB 1PHTA 1VQ5A 1IO6A 5C0MA 2JN0A 3L2WA 2YUQA 1PNJA 5FRMA 1QP3A 2EBPA 1NEGA 2RK2A 2HNIA 2X35A 1CKBA 5ECAA 3G71A 1GBQA 4J9IA 1YNZA 1HK9A 3I55A 4Z02A 2YRVA 2QGFB 7AT1B 3LH0A 3SWNC 1JQQA 2CT3A 1QW1A 3EG2A 1AZEA 2J7IA 2YRDA 4DBFA 1YITA 5J3BA 1D1BA 3BW1A 5LJ5g 4BDZA 4J6YA 4MMKA 3MO8A 1QCNA 2DL7A 1QVGP 4PJOC 2GTOA 4WF2A 5KH6A 2FB7A 2QA4A 1E7OA 3CXCA 2QK0A 4N4HA 1K4US 4C5GA 1U06A 3X26B 2R5AA 4FSXA 4M78C 2E4HA 2KRSA 3KBGA 3OMCA 1WPYA 2JTEA 1VQ9A 2F2XA 1VQLT 1PD0A 3PMTA 3LYIA 3RKWA 2RHYA 3ME9A 1KHCA 5FROA 1YJWQ 1GXIE 1GFDA 3HP9A 3S3MA 4HXJA 1ACMB 4L6V5 1HSQA 1WHKA 1NLPC 1SSFA 4M7AG 5GJWB 4D6WA 1BIBA 1YHQA 4M77A 4M7AE 1SSHA 1AOJA 2E5KA 2NWMA 3OW2P 2DM1A 3CCQQ 1G3SA 4GY5A 2RI3A 4JPBW 4XU2A 5L23A 3DB4A 2GGRA 3ZFJA 4R55A 1VQ5Q 1M3BA 1BCOA 5I22A 2RQVA 3P8BB 2ABLA 2MPXC 5A0LA 4KULA 1RLPC 3VS5A 3A1PA 2EYXA 2K7AA 1LPLA 3EGDA 2RHIA 1VUBA 1PM3A 5LJ5j 2X4JA 1D0XA 3OYJA 3C4SA 1OYXA 1YCSB 1SHGA 2KMTA 5KE3A 1ABQA 1UGQB 3GLXA 3OYEA 1V1CA 3OW2S 1NEBA 4PJJA 3L2VA 1MMAA 3RUXA 2QTVA 3JCMe 4ZGJB 3CC2T 2KYBA 3X24B 2LJ0A 1M3AA 2EQJA 5D6WA 4F7UB 3FLGA 3FJPA 2XKOC 9ATCB 4M77F 1I5LA 3MEUA 2A0FB 3LH5A 4C0FA 1UEBA 3WVEB 1K73R 2P4TA 1YJ9A 3OYYA 3CC4A 5FLXE 1B07A 5CCAA 3OYIA 5FU6C 1ARKA 3GOXA 1Y0MA 2VVKA 1JXMA 2YT6A 2M16A 2DXBA 3EG3A 5CO7A 5KYWA 1U3OA 2O2OA 4FSSA 5GAOl 4E47A 3VU3C 1C6VX 1D1AA 3OS2A 3LW5E 4GBQA 2A7YA 3G4SA 1PG5B 3H9NA 4M78E 1VQLQ 1YJWA 3G6ET 2RQTA 3QO3A 3ZEHA 1SRMA 2LRQA 2L3PA 5GMKm 1UDLA 1IRXA 2B8AA 1MMGA 2EQUA 3MKDA 2BZYA 4HVWA 2DVJA 5DLQE 3TREA 4AT1B 4HT9A 4J9DA 3CCUQ 3M54A 3MEAA 1FMKA 3J81E 4F16A 3I9QA 1KQSA 5IHKA 1Y96A 1VQ8T 1B3QA 4R0KA 1Q81R 4CC3A 3U23A 3P8HA 4BI3A 3VYGA 5HK0A 1C0MA 3NMZC 1N8RC 5GAN8 4DBHA 2EIFA 5AT1B 4FU6A 1VQMA 5LJ5f 4FM4B 3CPWS 2K5FA 1WHJA 3I55T 1D09B 2BZ8A 5I21A 2BTTA 3HRUA 2CP2A 1NBEB 1D3BB 1UGVA 1M2OA 3QXEB 5GMKi 1EX4A 2RJFA 2D0QB 2O4XA 1WHHA 1OU9A 2P0PA 1I07A 2L2PA 2RHXA 4LDXA 3OMGA 1WXTA 1RLQC 5GAOq 2JS2A 4RMOA 4FL6A 1OZ3A 2CP6A 2L3QA 2LNVA 2YUNA 3NTHA 2MK5A 5GAN7 4M78B 3RKYA 1UUEA 2CP0A 5IH2A 4E7LA 3INZA 4JRPA 2A36A 3V7RA 4QVZA 1U8RA 1BBZA 1FMWA 1RABB 2EYYA 2DEQA 3OA6A 1N8RU 1TUCA 2COWA 1NPPA 3EG9A 4QVCA 1I1JA 3TCJA 4Z89A 1QCOA 2HKQB 3ER0A 2DL4A 1PRLC 2LT1A 1YHQQ 1D0YA 2KK4A 3E1SA 1AWOA 2RPNA 1BB9A 4M7DE 5IHNA 3V8KA 3RBBB 3RNJA 3GNFB 1VQKA 5CR2A 3SHWA 2NLUA 4OMMA 1N27A 5LL6S 4M4ZA 3GF5A 3RMQA 4ZGDB 2EAYA 2K3BA 4DA4A 2H3EB 2EW3A 3QWXX 3OYMA 3OB9A 3OYBA 4C8QA 1QVFA 3T9NA 4C92B 5AYFA 2O31A 4OGCA 2EQKA 4C5IA 2QA4Q 4BB7A 4C92A 3CMEA 2FVUA 2VYTA 2DBKA 1KQSS 3O8VA 1U5SA 4IURA 1IXDA 4IUVA 1YWOA 4B6MA 1VQOT 3OS1A 2VB6A 4LDYA 4DOWA 3CCQT 2RN8A 3HHTB 4IUTA 1VOMA 1V29B 1Y7XA 3QJ6A 1X27A 4HVVA 4C92E 3L1AA 4RG2A 2EKHA 3HFNA 4OMPA 1BI2A 3HL8A 4C0ZA 3H8ZA 1EFNA 3L2UA 2CP5A 3V7SA 3HRSA 4C5EA 2YLCA 2DEUA 4J9HA 2FZGB 2DF6A 1M9SA 2RO0A 2RH2A 3CMAQ 5GAN2 2IPOB 2XICA 2RI5A 2YWWA 4C92D 1WJRA 3G6EQ 2F2WA 2OAWA 2RA2A 3CCLQ 2D0NA 4QQ6A 2ZPGB 3EAEA 1OULA 5CK9A 1ZBJA 4Z88A 4PKCC 5KYYB 1KD1R 1JJ2A 4E7IA 3I5RA 1NZ9A 2OTLQ 3OYHA 3C95A 2LJ1A 5GAMe 4M7DF 3JCMh 2MAMA 2XDDA 2BZXA 3HPWA 3CCEA 4RKUE 2E1HA 3VRYA 3L2RA 1RAEB 2QEXT 5IXBA 1MMDA 4E2FB 2Y4YA 3E19A 3FJ5A 2ED1A 2GTJA 3R6OA 2MCNA 1WHLA 1UGPB 1FMVA 4JDSA 3CCSA 1M27C 2HDAA 3CCUA 4RTTA 1KC8R 2O4XB 3UWNA 1WI7A 1O9SA 1LNXA 1QCFA 4M78D 3EGXB 4M77E 4M7AA 8AT1B 4MZTA 5GAMf 1ZSGA 2KQWA 3CMEQ 2RQRA 4NL3A 2X3XD 1XJWB 3RDVA 4DBQA 4E7HA 1ZHIA 2KI7A 2RJCA 1VQ7A 3SB2A 3V8JA 1KG1A 1VQOQ 4M7DD 3OW2A 1OPKA 2LZ6B 1ZUYA 4B9WA 2CUBA 1ZX6A 3RKXA 3CCVA 2A08A 3G4SQ 1SHFA 1IGUA 2EGCA 2DYBA 1JRIA 3M0PA 4EPCA 1YP5A 2YDLA 2PUKB 1OI1A 2C0TA 4AG1C 2CUDA 4C92F 4QKUA 3CC7A 2XHCA 3NHNA 4OMLA 2F2VA 2VXFA 5LJ3f 3CCVQ 2GNCA 2C0IA 4RTYA 2OJ2A 2J6KA 1SRLA 4EIKA 2CKKA 4FT2A 2DZCA 3G6EA 2LTOA 4M75B 2KRNA 1YJNQ 1B34A 2COZA 5GANf 1TG0A 1WA7A 2GCXA 1C1AA 1H8KA 2FPDA 4FYVB 2HL5C 4OMFB 4LN2A 2QTXA 5KE2A 4QT7A 1GCPA 1M30A 1Q81C 3R6NA 3GIBA 2RHZA 1UGRB 1NG2A 3CCRA 1Z9QA 1X69A 4JJBA 2FPFA 3M0UA 4BY6C 2QEXQ 5GANh 4ELZC 2H8HA 3S3NA 3IQLA 4PJOA 3VS6A 1KD1U 5M9OA 3VKIA 1NPRA 2J6FA 2ZCFB 4MZPA 2RB6A 3M5AA 4HA8A 2EJFA 4JRIA 4BE1A 2KT8A 3OSSC 2BE9B 3RMSA 4BE2A 2DO3A 1Q86C 3CPWP 1OEBA 2BE7D 2GFAA 3CCUT 2QI2A 1H3HA 2CS7A 3J80E 3JB9H 3PGGA 3LWIA 1TWBA 2V8KA 3META 1VQKT 4PL6A 1NYFA 1KC8U 2JOYA 1RADB 1IREB 2RI2A 5HK3A 2E6ZA 1NLOC 2PVOB 4J9GA 4XU1A 1H92A 2K57A 3EHQA 1Q86R 1G3WA 3ULRB 4XQ3A 3M56A 2HL3A 1FYNA 1TH7A 2O88A 4M7AD 1W4SA 2C06A 1SPKA 5I11A 4M75E 3VYHB 2K2VA 3KUFA 2EJ9A 1JEGA 3M9QA 2Y90A 3CXCP 1A0NB 1IHVA 1XQHA 2VC8A 3EG0A 4ESRA 1CKAA 2JVVA 2KE9A 4ATOA 4C8QC 2DNUA 4XU0A 2ZAEA 2EWNA 4A4HA 2WSFE 3C94A 2K4YA 1QKWA 2PVDB 4M7DB 2OTJA 2OTJT 2CREA 4J9BA 2QYZA 3SWNA 1YHQT 5C6SA 1VIFA 3FDRA 3VS4A 1PRMC 3PE0A 1NYGA 4II1A 3DLLA 4MDXA 1JU5C 1T3LA 1VYTA 2QQBA 1WXUA 2DMOA 3URGA 1JB0E 1PCXA 2K5IA 1BU1A 1YWPA 1NE8A 3ZBDA 4M77C 4Z8AA 1S72T 1UTIA 2B86A 1VQPQ 4E6RA 4NS5A 1K0XA 4PJOF 4FW2A 1TTHB 1OX9A 4KUIA 2DTHA 1PKSA 2QGGA 1QVPA 2NUTA 4HT8A 1Y07A 2YUOA 5GMKj 3MP1A 1YITT 3CCRT 2FO0A 3TSWA 1M1FA 4RTUA 1M1KR 3KFVA 2I2LA 3CCET 5KYWB 2KEAA 1K9MR 1KQSP 1K8AC 2E3IA 1K9MU 1YCYA 1F1BB 1FX7A 2MYSA 4F7UF 2M9UA 1WDXA 2DD5A 4DEXA 1O75A 3SEMA 4A63B 2LX7A 3TVTA 2F5TX 4JUVA 4JJCA 1ZBXA 4OB2B 5EC7A 1FXXA 3QUIA 2XD0A 1LCKA 2YSQA 4RCBA 3E2UA 1WXBA 5A2QE 1HYOA 4LNPA 2KROA 2XDPA 1I0CA 2RMOA 2HAXA 2CH4A 2HKNA 3RR6A 4P5NA 1M2VA 2M02A 3CCMT 3M57A 4M77G 3HFOA 3C12A 3NPFA 2L3RA 4N4GA 1UE9A 3UDCA 3OYGA 1IB8A 1QWEA 2MWPA 1ZSZC 1G3YA 3ZL7C 3OYFA 2EVRA 3CCSQ 1QLYA 4PK4A 4M7AC 4LXCA 8ATCB 2VUBA 4XTXA 1VQKQ 1VQ6Q 3S6WA 2M1HA 5CIUA 3VUBA 2DL5A 3JCMV 4ZN3A 3A8HB 1RAHB 5GAOn 1K1ZA 3I56T 1QP2A 5DLOA 1R0CB 3LLRA 2DETA 4XAXB 2L0AA 3V7CA 1XNIA 2X9HA 2Y4XA 3MP6A 3PFSA 2KXDA 2HSPA 4EMKA 2JS0A 1MMNA 4LDUA 3CCJA 2D6FA 1M5Q1 5GAOm 3OS0A 1TS9A 4M77B 4E7KA 1EZZB 2LP5A 3JCMg 3CCMQ 3M58A 1VQNQ 1UECA 1K8AR 3F70A 1VQ7T 2CT4A 1OOTA 3OBYA 3MEWA 3PTAA 2NUPA 4MMLA 4Y28E 1NJIU 2L5QA 2LDMA 4RG8A 2H3JA 3I55Q 5CAIA 1JJ2P 1W2BP 2KRMA 5LJ5d 3OQ5A 2A37A 1VA7A 4F17A 2VV5A 2RF0A 5LJ3d 4RTWA 4E7JA 3D7SB 2GQIA 2ED0A 4LE9A 1Q82U 2CP3A 5GAMg 1XTDA 4KGVB 4ZTFA 3VS2A 1QVGS 4WTOB 1AVZC 2VXEA 2JM9A 5KYUB 4J9FA 1KIKA 4XTZA 2Z0WA 5J26A 2DXTA 4J5YA 4X9DA 3VRZA 5DM7R 2YRCA 2DL3A 1ZUKA 4OF1A 1R8OB 2DYIA 1WYXA 2AT1B 3I35A 2XMFA 4BE0A 2PVGB 4NL2A 3EFRA 3I5SA 1OZ2A 4A4EA 2EGAA 2RNAA 1WHMA 1H3ZA 4UC4A 2KGTA 5CVIA 3RESA 4B9XA 2I0NA 4PFOA 3JSCA 2L8DA 1YIJQ 3M0TA 1G5VA 4OMNA 2FL7A 5GAN4 5CKHA 2KYMA 5KYXB 3CCEQ 1BI0A 1JJ2S 1PKTA 1YJ9T 4BI8B 4ORZA 4C8QF 2CZ6B 3OYNA 1UGSB 1WJQA 2CSQA 4FYWB 1NJIR 2ESWA 1ZA2B 2VKNA 3CCMA 1I5OB 5GAMd 4J83A 2K2MA 3FIFA 1TUGB 3QYGB 4KGZB 4XK8E 4IIMA 4HVUA 4M75D 1M8VA 3THKA 4ZTJA 1VQOA 1Q81U 2RK1A 1WHGA 4KT0E 2IVWA 2RM4A 2FPEA 4PJNA 1MV3A 2DL8A 1M1KU 4HCCA 2M0YA 1VQ8A 1X75C 2V26A 3A8OB 2E65A 4X9CA 1BYMA 5KYXA 2AZVA 1JXOA 3OSVA 2CP7A 4JLGA 3VS3A 1BIAA 3A8LB 4C92G 4A53A 3MPUB 1VQ5T 4C92C 1MV0B 2K6DA 1PWTA 3M0QA 4EDUA 1VQ8Q 3A5ZB 4RTXA 1M90C 2PU9B 3MHXA 2K3XA 2JW4A 5GAN3 2COYA 5HCKA 1VQNT 5GMKl 1SF9A 3OYCA 2AKLA 1N9SA 4D8KA 3LGFA 1ZSZB 1HJDA 2DXUA 4OB3B 6AT1B 1QVFP 3DLMA 2HQXA 1K73U 3OYKA 4O6JA 1YIJA 1VQ6A 2V8JA 4HCKA 2AZSA 3RIRA 1Q7YC 1WJSA 3N5BB 1NM7A 2AHJB 3REBB 1B7TA 4IIOA 4FCYA 4A4GA 4OMQA 1ZSZA 2VWFA 1AEYA 2EYZA 2ZPIB 3SDZA 3EG9B 2HQEA 2JJ9A 2W0ZA 3CCJQ 3G1JA 4C8QE 1IZ6A 3EGXA 3H6ZA 4M7AB 1WZOA 4KGXB 4M77D 4ELYC 4M7DG 1D0ZA 3L2ZA 1Q95G 3CC4Q 4JJDA 2ROLA 1KK7A 4J6XA 3JCMP 1K9MC 2EYWA 1I8FA 5IN1A 3G7ZA 3REAB 2R5MA 1M1KC 2ATCB 2PZ1A 2R58A 3PIOA 1AWWA 2CYZB 4OGEA 2JXBA 1M90R 2A3LA 2DJQA 5KCHA 4GLMA 1UJYA 3JCMX 3MP8A 1RUWA 2LCLA 1E6HA 3FC3A 1UFFA 1MUZA 2KAFA 2DD4A 4KBMB 1I4K1 2DA9A 3EFOB 3VS7A 4BY6B 4AFSC 2KSSA 1D3BA 5D6YA 2LQWA 4OVAA 4CRIA 3CBMA 1XOVA 1OV3A 3M59A 1BI3A 5CKDA 1SG5A 2JTMA 2FZCB 2PUOB 2AKKA 3CCJT 1VQ4Q 1Q7YU 4O5VA 2W10A 1HXDA 2DJZA 4EMHA 5CKFA 4PLLA 2K79A 1E6GA 3EFOA 2FEIA 4XTWA 4C0DB 1BCMA 2FZKB 1KQ1A 1X01A 2EGEA 3PVLA 4JZ3A 1GCQA 4FT4A 1EIFA 4IUQA 2X51A 1JBMA 1YJNA 2G6FX 1AD5A 1U1SA 4OMOA 3QDRB 3CD6A 3JCMW 2X4WA 4QVDA 1TUDA 3QDFA 5FW9A 4HCZA 4N0AC 2MMPA 2M0OA 4V2SA 2XK0A 1VQPA 3TQ7P 3CC4T 1T0HA 1K0SA 5GJVB 1NJIC 3PT9A 4C8QB 2BIVA 2KNBB 4BDYA 2LQKA 2GFUA 5CQXA 1X2QA 3HTRA 4ANJA 2E70A 4X34A 2QQSA 4PLIA 5I2SA 5L8RE 1VQ7Q 1MGQA 1WX6A 2CH4W 1AWJA 4ZGEB 3A98A 2JUFA 2MOXA 3CC7Q 3FRNA 1W2BS 2J6OA 4M75C 2JTFA 3H41A 3UF4A 3JCMf 3OYLA 3CC2A 3EH2A 4VUBA 3CD6T 4WCIA 3SD4A 1R77A 2DTOA 3FB9A 2KR3A 4F7UA 3CEYA 4FYYB 4CC2A 3JB9F 1YFNA 2KVQG 4FW1A 3M53A 4DQ2A 1VQLA 4QQDA 1Z9ZA 1X43A 4OP0A 4RCCA 2DRMA 1V76A 2EFIA 3NTKA 4M7DC 3MEVA 3FEOA 3M0RA 2E3HA 1UHFA 1RAFB 5J39A 1LJOA 2P4RA 1RI9A 2CZ7B 3QBYA 3JB9J 3GP8A 4DOVA 2OX7A 3EH1A 1N8RR 4IKFA 4KRTA 4TVRA 1OX8A 2IIMA 5GAMj 2OTLA 2SEMA 4EMKB 2FHDA 1VQMT 3JRZA 3JB9D 1G3TA 1ABOA 1AZGB 1I81A 4KH0B 2AK5A 4X1VA 2D1XA 1H641 1MNEA 3H0FA 5A0GA 2KBTA 3GBQA 2GF7A 3JCMd 4JRKA 1S72Q 2XG8D 2KY9A 2QAZA 3M4YA 3GNGA 4MDWA 1K8AU 2LQ8A 1W1FA 1WQWA 1N6AA 1SKUB 3JV3A 5CKEA 1KSWA 4M78F 1LVKA 2R57A 1YI2Q 4MZMA 3RERA 1LOJA 3J7AF 2QDYB 2E6NA 3BY7A 1VIEA 2E5QA 2KT1A 2LVMA 2YHTA 3JCMc 2HMAA 3PIPA 2F1LA 4BUGA 3OS5A 1GFCA 1T3SA 1VYUA 2DX1A 5KCOA 4DBRA 3CBPA 2VGNA 2XU8A 1RL2A 2DXCA 2NUTB 2M51A 1W6XA 1YI2A 4OB1B 4ME7A 2X3WD 1GBRA 2MI6A 5LJ5h 4PNOA 1HD3A 3QPHA 2WACA 3JCMQ 1B34B 4J7IA 2RJEA 3SFMA 4QQGA 4RTVA 5HKCA 5KYUA 1PSEA 4ZN1A 3QJYA 4LDVA 2G3RA 4PJOG 4Y91A 2ZZDA 4N4IA 3SWNB 4CI0C 3CMAT 4C5HA 2DFUA 2V1QA 1IGQA 1TXQA 3A8GB 2HEQA 4XTYA 3CCST 1JO8A 4YTLA 4PJOE 2JM8A 1M3CA 3ASKA 4BACA 4LDWA 1AT1B 4XTUA 4M75F 1TSFA 3QZ5B 3I56Q 1OU8A 2ROTA 1WGSA 1UHCA 4FIBA 3MCAB 4HKEA 2DKGA 2QXFA 1P92A 1S72A 1TU0B 2LJ3A 5CQYA 3QSUA 1N9RA 1QMCA 4F7UE 3M55A 1IHWA 2OI3A 5D7UA 3BE3A 3NTIA 2QDLA 2E12A 2DIQA 1TOVA 3QHSA 4JJNK 5CKBA 5GANd 1FWZA 1K73C 3EGDB 1WFWA 3BDLA 1YI2T 3LX7A 4J9CA 3X20B 3CCVT 5KYNA 5LJ3g 1G83A 1YJNT 1BI1A 3L2QA 3UT1A 3PVQA 4KUDK 3MJXA 2YXYA 2LQNA 3CC2Q 3UA6A 3VS0A 3QIIA 4LUDA 3O5ZA 4IUPA 2L89A 2HSEB 2J05A 2LNHB 3AT1B 4AFUC 2LCSA 2BKDN 5KYYA 1M1GA 5GANg 3CPFA 4JLIA 4F7UG 5GANj 2ZPFB 2DILA 2ENMA 5IHIA 4F04B 3QYHB 2FG0A 4L59A 2O9VA 4E7ZA 3BDUA 2IG0A 1PD1A 3NGPA 4AMCA 2EQMA 2C0OA 1VQ9T 5FU7B 3I56A 2LX9A 1Y57A 4RTZA 2PQWA 3OY9A 4PJOB 1G2BA 2CZ0B 1RAIB 4A4KA 4D8DA 3G71T 4JS4A 1UB4A 2ZPBB 2SRCA 1ZLMA 2DLPA 2MF2A 2WSEE 2K5LA 1DJ7B 1S1NA 1YJWT 5GAOr 1MHNA 2AIRB 1W70A 2MWOA 4M75A 2LT4A 4Y92A 4RUGA 3QG1A 4PJMA 4IUUA 2DPPB 4M75G 5LJ5e 2WSCE 5I2MA 3JCMb 2CSIA 3CBOA 1N5ZA 1YBYA 3M0SA 3JCMJ 3PNWC 4J9EA 1Q82C 5LJ3h 1K9AA 2YUPA 2EQIA 3H0HA 4C8QD 4L5GA 1RAGB 3JB9G 2ECZA 2HQHA 5FWBA 1YJ9Q 3QZ9B 4E7SA 1UG1A 1KC8C 2F5KA 2DVEA 3GPLA 2E64A 4M7DA 1KQ2A 3HKSA 2MIOA 3TU4K 2JZ2A 3E9GA 3A8MB 3QWYA 2X4XA 1PC0A 1Q82R 2EKOA 2QG9B 1KD1C 5GAOp 4A54A 2P0KA 4J6WA 1WLPB 2A28A 3TSZA 4LUEA 1VYVA 4XU3A 1X6OA 3CQTA 1VQ4A 5FWCA 2QQAA 3L42A 2O01E 1ZA1B 4LD6A 1VQ9Q 2BUDA 1OQKA 4GLKA 1QQJA 4BI4A 3HSBA 5HY6A 4M78A 1W2BA 4FYXB 1X6GA 2JMAA 5DY9A 2EYQA 2K9GA 2FRWA 2HZYA 3CCRQ 2GQVA 2K3YA 1RI0A 2XI9A 5GAN6 2EJGA 2DIGA 1AWXA 5EG2A 4BD3A 5GMKe 3CCQA 4ZNXA 2XIDA 1MNDA 4F14A 5IAYA 4HCBA 3OBWA 1K76A 1VQMQ 2DERA 1VQPT 1UJ0A 2HBPA 2OTJQ 2HD0A 1QVGA 2DK3A 1WQ7A 2V1RA 3EG1A 3CMET 2XDBA 3V8LA 4PJOD 1BKBA 2KDSA 2ZGWA 2JNGA 2DRKA 1YITQ 1PSFA 2DTIA 3EHRA 1QWFA 4AG2C 2RQWA 5FU7C 2V8IA 2VGMA 3G4ST 4AFQC 2F69A 4R56A 3VS1A 3X25B 4PFZA 1U1TA 1KHIA 2VASA 3HRTA 2HBWA 1AHJB 3CXCS 4DEYA 3UA7A 2LC4A 4QW2A 1GCQC 4Q5WA 1OPLA 2D8JA 3DB3A 3UPUA 2DE0X 1QVFS 1YN8A 4PFPA 4JRQA 1KFZA 1Y71A 2O9SA 2L3SA 1G8XA 2DBMA 3AHUA 1X2KA 4A4FA 2X4YA 3E9FA 2OAUA 1X6BA 1CSKA 2P0QA 2D9TA 1RAAB 3OYDA 5GMKh 2LCCA 2JMCA 2FRYA 4C0DC 2ZPEB 1M4ZA 3H0IA 2OTLT 3KXTA 2DAQA 1J3TA 2P84A 4CC4B 1QKXA 1GRIA 1SEMA 1VQ6T 3VUZA 2LMJA 4EMGA 5GAN5 3Q1JA 3VV0A 3JB9I 2RJDA 4XTVA 2FYKA 2QQRA 2NUZA 2CGHA 3P8DA 5A0DA 1GL5A 2DZ9A 4J7FA 2NUPB 3WXMB 2D8HA 4OB0B 1KJWA 3UATA 5FU6B 2QQ9A 2J06A 3NFCA 5IXFA 2PTKA 1ZUUA 3OYAA 1D1CA 4EMKC 3JAME 1VQ4T 4JZ4A 3BFMA 1WNLA 3M4GA 4CC7A 4M78G 2E10A 5GAMh 2HCKA 1VQNA 4KH1B 3PMIA 2CDTA 3LGLA 4J8OA 2GBQA 2KXCA 5FRNA 2RQUA 3EGUA 3CPWA 1Q86U 2QA4T 4JS5A 3CCLT 1RACB 2NYSA 2E41A 1YIJT 4LD9K 1ZQ1A 4PJLA
chains in the Genus database with same CATH topology
4J9HA 1KIKA 1GBRA 2DF6A 1HD3A 4AFZC 1BK2A 3VRZA 2DL3A 1ZUKA 4K11A 1WYXA 1M8MA 2F2WA 3C0CA 3I35A 2OAWA 2PNIA 2XMFA 4RTVA 2D0NA 3I5SA 1WIEA 2EGAA 2EPDA 2RNAA 1ZBJA 4Z88A 1T0JA 2KGTA 2JT4A 2V1QA 3I5RA 2HEQA 2I0NA 1JO8A 2JM8A 1M3CA 2LJ1A 3M0TA 1PHTA 1IO6A 2BZXA 4OMNA 3VRYA 2YUQA 2KYMA 5IXBA 1PNJA 1PKTA 3FJ5A 2ED1A 2GTJA 2MCNA 2ROTA 4ORZA 2EBPA 1NEGA 1UHCA 1M27C 2HDAA 2CSQA 4RTTA 2ESWA 2VKNA 1CKBA 5ECAA 1GBQA 1WI7A 1YNZA 4J9IA 1QCFA 2K2MA 2LJ3A 2OI3A 1JQQA 2CT3A 1ZSGA 2QDLA 3EG2A 1AZEA 4IIMA 4HVUA 2RQRA 2J7IA 2X3XD 3THKA 1WFWA 1OPKA 2FPEA 2LZ6B 1MV3A 1ZUYA 2DL8A 2CUBA 4J9CA 1ZX6A 2DL7A 1G83A 2A08A 2M0YA 1SHFA 2EGCA 2GTOA 2DYBA 3PVQA 2AZVA 1JXOA 3M0PA 2LQNA 1E7OA 3UA6A 1YP5A 2YDLA 3VS0A 4LUDA 3VS3A 1K4US 1U06A 3O5ZA 2C0TA 4AG1C 2CUDA 2J05A 2LNHB 4AFUC 3NHNA 2KRSA 2LCSA 4OMLA 2K6DA 2F2VA 2JTEA 1MV0B 1PWTA 2GNCA 2C0IA 3M0QA 2F2XA 2DILA 2OJ2A 4RTYA 2J6KA 4RTXA 2ENMA 1SRLA 5IHIA 4EIKA 2JW4A 1GFDA 2FG0A 4HXJA 5HCKA 2O9VA 1HSQA 1NLPC 5GJWB 2KRNA 3NGPA 2C0OA 2AKLA 1TG0A 1WA7A 1Y57A 4RTZA 1SSHA 1AOJA 2E5KA 2NWMA 4D8KA 1H8KA 1G2BA 2DM1A 2FPDA 4D8DA 4LN2A 4JPBW 5L23A 4QT7A 1HJDA 1GCPA 1M30A 2GGRA 2SRCA 3R6NA 1ZLMA 1M3BA 5I22A 1NG2A 2DLPA 2RQVA 1Z9QA 1X69A 4JJBA 2FPFA 2ABLA 4HCKA 3M0UA 2AZSA 1RLPC 1S1NA 3VS5A 2EYXA 2K7AA 1NM7A 3REBB 4IIOA 1W70A 4OMQA 1YCSB 2VWFA 1AEYA 1SHGA 2EYZA 1ABQA 4Y92A 2H8HA 4RUGA 1V1CA 3IQLA 2W0ZA 3VS6A 1NEBA 2J6FA 2CSIA 1N5ZA 4JJDA 2ROLA 3M0SA 2KYBA 2EYWA 2KT8A 4J9EA 2LJ0A 1M3AA 1K9AA 3REAB 1OEBA 2YUPA 2EQIA 2PZ1A 3H0HA 1AWWA 1H3HA 3LH5A 2JXBA 2ECZA 5FWBA 2DJQA 1NYFA 1UG1A 4GLMA 1UJYA 1B07A 1RUWA 1NLOC 4J9GA 1ARKA 2MIOA 1E6HA 1UFFA 1Y0MA 2VVKA 3QWYA 1MUZA 1H92A 1JXMA 3EHQA 2YT6A 2DA9A 3VS7A 3EG3A 3ULRB 4AFSC 2O2OA 4FSSA 1FYNA 2LQWA 2O88A 4GBQA 1XOVA 1OV3A 1SPKA 5I11A 1WLPB 2RQTA 2A28A 2AKKA 3TSZA 4LUEA 1VYVA 1SRMA 2L3PA 3CQTA 1JEGA 1UDLA 1A0NB 5FWCA 2W10A 2BZYA 4HVWA 3EG0A 4ESRA 1CKAA 2DVJA 2KE9A 2K79A 1E6GA 2FEIA 2DNUA 4J9DA 2EGEA 1X6GA 2JMAA 3PVLA 4JZ3A 1GCQA 1FMKA 1QKWA 2K9GA 4F16A 3I9QA 2FRWA 2CREA 5IHKA 4J9BA 1B3QA 4R0KA 4CC3A 2G6FX 3U23A 3VS4A 1AD5A 1PRMC 4OMOA 3PE0A 1NYGA 1AWXA 1TUDA 1JU5C 1T3LA 1VYTA 4ZNXA 1WXUA 4F14A 3NMZC 2DMOA 5FW9A 1K76A 1BU1A 1YWPA 4Z8AA 1UJ0A 1T0HA 1UTIA 2B86A 1K0SA 4E6RA 2V1RA 5GJVB 2BZ8A 2BTTA 1K0XA 3EG1A 2KNBB 1PKSA 1X2QA 2DRKA 1UGVA 1WX6A 2CH4W 2YUOA 3EHRA 1AWJA 3A98A 1QWFA 2FO0A 2RQWA 4AG2C 3TSWA 2MOXA 1I07A 2L2PA 4AFQC 4RTUA 2J6OA 3KFVA 3VS1A 1WXTA 1RLQC 2KEAA 3H41A 2JS2A 3UF4A 2HBWA 1WDXA 2L3QA 4WCIA 2YUNA 4DEXA 4DEYA 3SEMA 4A63B 2LX7A 3TVTA 2KR3A 4JJCA 3UA7A 1UUEA 4CC2A 5IH2A 5EC7A 1GCQC 2A36A 1OPLA 2D8JA 1Z9ZA 1X43A 1LCKA 1BBZA 2EYYA 2YSQA 2DE0X 1WXBA 1YN8A 1TUCA 2DRMA 4LNPA 2KROA 1KFZA 1I0CA 2RMOA 2O9SA 2CH4A 2L3SA 3M0RA 2DBMA 1UHFA 1I1JA 4Z89A 1X2KA 2P4RA 1RI9A 1X6BA 1CSKA 3NPFA 2DL4A 1UE9A 1PRLC 2JMCA 1QWEA 2FRYA 4KRTA 1AWOA 2RPNA 1BB9A 3ZL7C 3H0IA 2EVRA 5IHNA 2IIMA 1QLYA 2SEMA 3RBBB 3RNJA 1J3TA 4CC4B 3SHWA 1QKXA 1GRIA 1SEMA 4OMMA 2DL5A 2LMJA 1ABOA 1K1ZA 4M4ZA 1AZGB 2L0AA 2AK5A 2KXDA 2K3BA 2D1XA 2HSPA 4X1VA 2JS0A 2EW3A 2NUZA 3H0FA 3QWXX 2KBTA 1GL5A 3GBQA 2LP5A 1UECA 2O31A 2D8HA 1W1FA 1KJWA 3UATA 2CT4A 1OOTA 2J06A 5IXFA 2PTKA 1ZUUA 4JZ4A 3JV3A 2DBKA 4CC7A 1U5SA 1KSWA 1YWOA 2HCKA 2CDTA 2KRMA 2RN8A 2GBQA 2A37A 2KXCA 1VA7A 4F17A 2KT1A 2RF0A 2RQUA 4RTWA 1X27A 4HVVA 2GQIA 2ED0A 4LE9A 2EKHA 4OMPA 3EGUA 1GFCA 1T3SA 1VYUA 1EFNA 2DX1A 3VS2A 1AVZC 2M51A 1W6XA 2JM9A 1U3OA 2X3WD 4J9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9H A;  1KIK A;  1GBR A;  2DF6 A;  1HD3 A;  4AFZ C;  1BK2 A;  3VRZ A;  2DL3 A;  1ZUK A;  4K11 A;  1WYX A;  1M8M A;  2F2W A;  3C0C A;  3I35 A;  2OAW A;  2PNI A;  2XMF A;  4RTV A;  2D0N A;  3I5S A;  1WIE A;  2EGA A;  2EPD A;  2RNA A;  1ZBJ A;  4Z88 A;  1T0J A;  2KGT A;  2JT4 A;  2V1Q A;  3I5R A;  2HEQ A;  2I0N A;  1JO8 A;  2JM8 A;  1M3C A;  2LJ1 A;  3M0T A;  1PHT A;  1IO6 A;  2BZX A;  4OMN A;  3VRY A;  2YUQ A;  2KYM A;  5IXB A;  1PNJ A;  1PKT A;  3FJ5 A;  2ED1 A;  2GTJ A;  2MCN A;  2ROT A;  4ORZ A;  2EBP A;  1NEG A;  1UHC A;  1M27 C;  2HDA A;  2CSQ A;  4RTT A;  2ESW A;  2VKN A;  1CKB A;  5ECA A;  1GBQ A;  1WI7 A;  1YNZ A;  4J9I A;  1QCF A;  2K2M A;  2LJ3 A;  2OI3 A;  1JQQ A;  2CT3 A;  1ZSG A;  2QDL A;  3EG2 A;  1AZE A;  4IIM A;  4HVU A;  2RQR A;  2J7I A;  2X3X D;  3THK A;  1WFW A;  1OPK A;  2FPE A;  2LZ6 B;  1MV3 A;  1ZUY A;  2DL8 A;  2CUB A;  4J9C A;  1ZX6 A;  2DL7 A;  1G83 A;  2A08 A;  2M0Y A;  1SHF A;  2EGC A;  2GTO A;  2DYB A;  3PVQ A;  2AZV A;  1JXO A;  3M0P A;  2LQN A;  1E7O A;  3UA6 A;  1YP5 A;  2YDL A;  3VS0 A;  4LUD A;  3VS3 A;  1K4U S;  1U06 A;  3O5Z A;  2C0T A;  4AG1 C;  2CUD A;  2J05 A;  2LNH B;  4AFU C;  3NHN A;  2KRS A;  2LCS A;  4OML A;  2K6D A;  2F2V A;  2JTE A;  1MV0 B;  1PWT A;  2GNC A;  2C0I A;  3M0Q A;  2F2X A;  2DIL A;  2OJ2 A;  4RTY A;  2J6K A;  4RTX A;  2ENM A;  1SRL A;  5IHI A;  4EIK A;  2JW4 A;  1GFD A;  2FG0 A;  4HXJ A;  5HCK A;  2O9V A;  1HSQ A;  1NLP C;  5GJW B;  2KRN A;  3NGP A;  2C0O A;  2AKL A;  1TG0 A;  1WA7 A;  1Y57 A;  4RTZ A;  1SSH A;  1AOJ A;  2E5K A;  2NWM A;  4D8K A;  1H8K A;  1G2B A;  2DM1 A;  2FPD A;  4D8D A;  4LN2 A;  4JPB W;  5L23 A;  4QT7 A;  1HJD A;  1GCP A;  1M30 A;  2GGR A;  2SRC A;  3R6N A;  1ZLM A;  1M3B A;  5I22 A;  1NG2 A;  2DLP A;  2RQV A;  1Z9Q A;  1X69 A;  4JJB A;  2FPF A;  2ABL A;  4HCK A;  3M0U A;  2AZS A;  1RLP C;  1S1N A;  3VS5 A;  2EYX A;  2K7A A;  1NM7 A;  3REB B;  4IIO A;  1W70 A;  4OMQ A;  1YCS B;  2VWF A;  1AEY A;  1SHG A;  2EYZ A;  1ABQ A;  4Y92 A;  2H8H A;  4RUG A;  1V1C A;  3IQL A;  2W0Z A;  3VS6 A;  1NEB A;  2J6F A;  2CSI A;  1N5Z A;  4JJD A;  2ROL A;  3M0S A;  2KYB A;  2EYW A;  2KT8 A;  4J9E A;  2LJ0 A;  1M3A A;  1K9A A;  3REA B;  1OEB A;  2YUP A;  2EQI A;  2PZ1 A;  3H0H A;  1AWW A;  1H3H A;  3LH5 A;  2JXB A;  2ECZ A;  5FWB A;  2DJQ A;  1NYF A;  1UG1 A;  4GLM A;  1UJY A;  1B07 A;  1RUW A;  1NLO C;  4J9G A;  1ARK A;  2MIO A;  1E6H A;  1UFF A;  1Y0M A;  2VVK A;  3QWY A;  1MUZ A;  1H92 A;  1JXM A;  3EHQ A;  2YT6 A;  2DA9 A;  3VS7 A;  3EG3 A;  3ULR B;  4AFS C;  2O2O A;  4FSS A;  1FYN A;  2LQW A;  2O88 A;  4GBQ A;  1XOV A;  1OV3 A;  1SPK A;  5I11 A;  1WLP B;  2RQT A;  2A28 A;  2AKK A;  3TSZ A;  4LUE A;  1VYV A;  1SRM A;  2L3P A;  3CQT A;  1JEG A;  1UDL A;  1A0N B;  5FWC A;  2W10 A;  2BZY A;  4HVW A;  3EG0 A;  4ESR A;  1CKA A;  2DVJ A;  2KE9 A;  2K79 A;  1E6G A;  2FEI A;  2DNU A;  4J9D A;  2EGE A;  1X6G A;  2JMA A;  3PVL A;  4JZ3 A;  1GCQ A;  1FMK A;  1QKW A;  2K9G A;  4F16 A;  3I9Q A;  2FRW A;  2CRE A;  5IHK A;  4J9B A;  1B3Q A;  4R0K A;  4CC3 A;  2G6F X;  3U23 A;  3VS4 A;  1AD5 A;  1PRM C;  4OMO A;  3PE0 A;  1NYG A;  1AWX A;  1TUD A;  1JU5 C;  1T3L A;  1VYT A;  4ZNX A;  1WXU A;  4F14 A;  3NMZ C;  2DMO A;  5FW9 A;  1K76 A;  1BU1 A;  1YWP A;  4Z8A A;  1UJ0 A;  1T0H A;  1UTI A;  2B86 A;  1K0S A;  4E6R A;  2V1R A;  5GJV B;  2BZ8 A;  2BTT A;  1K0X A;  3EG1 A;  2KNB B;  1PKS A;  1X2Q A;  2DRK A;  1UGV A;  1WX6 A;  2CH4 W;  2YUO A;  3EHR A;  1AWJ A;  3A98 A;  1QWF A;  2FO0 A;  2RQW A;  4AG2 C;  3TSW A;  2MOX A;  1I07 A;  2L2P A;  4AFQ C;  4RTU A;  2J6O A;  3KFV A;  3VS1 A;  1WXT A;  1RLQ C;  2KEA A;  3H41 A;  2JS2 A;  3UF4 A;  2HBW A;  1WDX A;  2L3Q A;  4WCI A;  2YUN A;  4DEX A;  4DEY A;  3SEM A;  4A63 B;  2LX7 A;  3TVT A;  2KR3 A;  4JJC A;  3UA7 A;  1UUE A;  4CC2 A;  5IH2 A;  5EC7 A;  1GCQ C;  2A36 A;  1OPL A;  2D8J A;  1Z9Z A;  1X43 A;  1LCK A;  1BBZ A;  2EYY A;  2YSQ A;  2DE0 X;  1WXB A;  1YN8 A;  1TUC A;  2DRM A;  4LNP A;  2KRO A;  1KFZ A;  1I0C A;  2RMO A;  2O9S A;  2CH4 A;  2L3S A;  3M0R A;  2DBM A;  1UHF A;  1I1J A;  4Z89 A;  1X2K A;  2P4R A;  1RI9 A;  1X6B A;  1CSK A;  3NPF A;  2DL4 A;  1UE9 A;  1PRL C;  2JMC A;  1QWE A;  2FRY A;  4KRT A;  1AWO A;  2RPN A;  1BB9 A;  3ZL7 C;  3H0I A;  2EVR A;  5IHN A;  2IIM A;  1QLY A;  2SEM A;  3RBB B;  3RNJ A;  1J3T A;  4CC4 B;  3SHW A;  1QKX A;  1GRI A;  1SEM A;  4OMM A;  2DL5 A;  2LMJ A;  1ABO A;  1K1Z A;  4M4Z A;  1AZG B;  2L0A A;  2AK5 A;  2KXD A;  2K3B A;  2D1X A;  2HSP A;  4X1V A;  2JS0 A;  2EW3 A;  2NUZ A;  3H0F A;  3QWX X;  2KBT A;  1GL5 A;  3GBQ A;  2LP5 A;  1UEC A;  2O31 A;  2D8H A;  1W1F A;  1KJW A;  3UAT A;  2CT4 A;  1OOT A;  2J06 A;  5IXF A;  2PTK A;  1ZUU A;  4JZ4 A;  3JV3 A;  2DBK A;  4CC7 A;  1U5S A;  1KSW A;  1YWO A;  2HCK A;  2CDT A;  2KRM A;  2RN8 A;  2GBQ A;  2A37 A;  2KXC A;  1VA7 A;  4F17 A;  2KT1 A;  2RF0 A;  2RQU A;  4RTW A;  1X27 A;  4HVV A;  2GQI A;  2ED0 A;  4LE9 A;  2EKH A;  4OMP A;  3EGU A;  1GFC A;  1T3S A;  1VYU A;  1EFN A;  2DX1 A;  3VS2 A;  1AVZ C;  2M51 A;  1W6X A;  2JM9 A;  1U3O A;  2X3W D;  4J9F A; 
#chains in the Genus database with same CATH topology
 4C0G A;  1M90 U;  4AFZ C;  3CMA A;  1BK2 A;  4C8Q G;  3WVD B;  4K11 A;  5IT9 E;  1M2V B;  1M8M A;  3TEE A;  3C0C A;  2PNI A;  5GAN e;  4M7A F;  3CCL A;  1Q7Y R;  3X28 B;  5D6X A;  3S3O A;  1WIE A;  2EPD A;  3EFS A;  2QEX A;  3CD6 Q;  5LJ3 j;  2QAS A;  3VJP A;  1T0J A;  2RD1 A;  2YLB A;  3DKM A;  2JT4 A;  4N0A A;  1Y96 B;  1R0B G;  3LWH A;  4NOY A;  3QKJ A;  2RHU A;  3CC7 T;  5LJ3 e;  3G71 Q;  2CZ1 B;  2ZPH B;  1PHT A;  1VQ5 A;  1IO6 A;  5C0M A;  2JN0 A;  3L2W A;  2YUQ A;  1PNJ A;  5FRM A;  1QP3 A;  2EBP A;  1NEG A;  2RK2 A;  2HNI A;  2X35 A;  1CKB A;  5ECA A;  3G71 A;  1GBQ A;  4J9I A;  1YNZ A;  1HK9 A;  3I55 A;  4Z02 A;  2YRV A;  2QGF B;  7AT1 B;  3LH0 A;  3SWN C;  1JQQ A;  2CT3 A;  1QW1 A;  3EG2 A;  1AZE A;  2J7I A;  2YRD A;  4DBF A;  1YIT A;  5J3B A;  1D1B A;  3BW1 A;  5LJ5 g;  4BDZ A;  4J6Y A;  4MMK A;  3MO8 A;  1QCN A;  2DL7 A;  1QVG P;  4PJO C;  2GTO A;  4WF2 A;  5KH6 A;  2FB7 A;  2QA4 A;  1E7O A;  3CXC A;  2QK0 A;  4N4H A;  1K4U S;  4C5G A;  1U06 A;  3X26 B;  2R5A A;  4FSX A;  4M78 C;  2E4H A;  2KRS A;  3KBG A;  3OMC A;  1WPY A;  2JTE A;  1VQ9 A;  2F2X A;  1VQL T;  1PD0 A;  3PMT A;  3LYI A;  3RKW A;  2RHY A;  3ME9 A;  1KHC A;  5FRO A;  1YJW Q;  1GXI E;  1GFD A;  3HP9 A;  3S3M A;  4HXJ A;  1ACM B;  4L6V 5;  1HSQ A;  1WHK A;  1NLP C;  1SSF A;  4M7A G;  5GJW B;  4D6W A;  1BIB A;  1YHQ A;  4M77 A;  4M7A E;  1SSH A;  1AOJ A;  2E5K A;  2NWM A;  3OW2 P;  2DM1 A;  3CCQ Q;  1G3S A;  4GY5 A;  2RI3 A;  4JPB W;  4XU2 A;  5L23 A;  3DB4 A;  2GGR A;  3ZFJ A;  4R55 A;  1VQ5 Q;  1M3B A;  1BCO A;  5I22 A;  2RQV A;  3P8B B;  2ABL A;  2MPX C;  5A0L A;  4KUL A;  1RLP C;  3VS5 A;  3A1P A;  2EYX A;  2K7A A;  1LPL A;  3EGD A;  2RHI A;  1VUB A;  1PM3 A;  5LJ5 j;  2X4J A;  1D0X A;  3OYJ A;  3C4S A;  1OYX A;  1YCS B;  1SHG A;  2KMT A;  5KE3 A;  1ABQ A;  1UGQ B;  3GLX A;  3OYE A;  1V1C A;  3OW2 S;  1NEB A;  4PJJ A;  3L2V A;  1MMA A;  3RUX A;  2QTV A;  3JCM e;  4ZGJ B;  3CC2 T;  2KYB A;  3X24 B;  2LJ0 A;  1M3A A;  2EQJ A;  5D6W A;  4F7U B;  3FLG A;  3FJP A;  2XKO C;  9ATC B;  4M77 F;  1I5L A;  3MEU A;  2A0F B;  3LH5 A;  4C0F A;  1UEB A;  3WVE B;  1K73 R;  2P4T A;  1YJ9 A;  3OYY A;  3CC4 A;  5FLX E;  1B07 A;  5CCA A;  3OYI A;  5FU6 C;  1ARK A;  3GOX A;  1Y0M A;  2VVK A;  1JXM A;  2YT6 A;  2M16 A;  2DXB A;  3EG3 A;  5CO7 A;  5KYW A;  1U3O A;  2O2O A;  4FSS A;  5GAO l;  4E47 A;  3VU3 C;  1C6V X;  1D1A A;  3OS2 A;  3LW5 E;  4GBQ A;  2A7Y A;  3G4S A;  1PG5 B;  3H9N A;  4M78 E;  1VQL Q;  1YJW A;  3G6E T;  2RQT A;  3QO3 A;  3ZEH A;  1SRM A;  2LRQ A;  2L3P A;  5GMK m;  1UDL A;  1IRX A;  2B8A A;  1MMG A;  2EQU A;  3MKD A;  2BZY A;  4HVW A;  2DVJ A;  5DLQ E;  3TRE A;  4AT1 B;  4HT9 A;  4J9D A;  3CCU Q;  3M54 A;  3MEA A;  1FMK A;  3J81 E;  4F16 A;  3I9Q A;  1KQS A;  5IHK A;  1Y96 A;  1VQ8 T;  1B3Q A;  4R0K A;  1Q81 R;  4CC3 A;  3U23 A;  3P8H A;  4BI3 A;  3VYG A;  5HK0 A;  1C0M A;  3NMZ C;  1N8R C;  5GAN 8;  4DBH A;  2EIF A;  5AT1 B;  4FU6 A;  1VQM A;  5LJ5 f;  4FM4 B;  3CPW S;  2K5F A;  1WHJ A;  3I55 T;  1D09 B;  2BZ8 A;  5I21 A;  2BTT A;  3HRU A;  2CP2 A;  1NBE B;  1D3B B;  1UGV A;  1M2O A;  3QXE B;  5GMK i;  1EX4 A;  2RJF A;  2D0Q B;  2O4X A;  1WHH A;  1OU9 A;  2P0P A;  1I07 A;  2L2P A;  2RHX A;  4LDX A;  3OMG A;  1WXT A;  1RLQ C;  5GAO q;  2JS2 A;  4RMO A;  4FL6 A;  1OZ3 A;  2CP6 A;  2L3Q A;  2LNV A;  2YUN A;  3NTH A;  2MK5 A;  5GAN 7;  4M78 B;  3RKY A;  1UUE A;  2CP0 A;  5IH2 A;  4E7L A;  3INZ A;  4JRP A;  2A36 A;  3V7R A;  4QVZ A;  1U8R A;  1BBZ A;  1FMW A;  1RAB B;  2EYY A;  2DEQ A;  3OA6 A;  1N8R U;  1TUC A;  2COW A;  1NPP A;  3EG9 A;  4QVC A;  1I1J A;  3TCJ A;  4Z89 A;  1QCO A;  2HKQ B;  3ER0 A;  2DL4 A;  1PRL C;  2LT1 A;  1YHQ Q;  1D0Y A;  2KK4 A;  3E1S A;  1AWO A;  2RPN A;  1BB9 A;  4M7D E;  5IHN A;  3V8K A;  3RBB B;  3RNJ A;  3GNF B;  1VQK A;  5CR2 A;  3SHW A;  2NLU A;  4OMM A;  1N27 A;  5LL6 S;  4M4Z A;  3GF5 A;  3RMQ A;  4ZGD B;  2EAY A;  2K3B A;  4DA4 A;  2H3E B;  2EW3 A;  3QWX X;  3OYM A;  3OB9 A;  3OYB A;  4C8Q A;  1QVF A;  3T9N A;  4C92 B;  5AYF A;  2O31 A;  4OGC A;  2EQK A;  4C5I A;  2QA4 Q;  4BB7 A;  4C92 A;  3CME A;  2FVU A;  2VYT A;  2DBK A;  1KQS S;  3O8V A;  1U5S A;  4IUR A;  1IXD A;  4IUV A;  1YWO A;  4B6M A;  1VQO T;  3OS1 A;  2VB6 A;  4LDY A;  4DOW A;  3CCQ T;  2RN8 A;  3HHT B;  4IUT A;  1VOM A;  1V29 B;  1Y7X A;  3QJ6 A;  1X27 A;  4HVV A;  4C92 E;  3L1A A;  4RG2 A;  2EKH A;  3HFN A;  4OMP A;  1BI2 A;  3HL8 A;  4C0Z A;  3H8Z A;  1EFN A;  3L2U A;  2CP5 A;  3V7S A;  3HRS A;  4C5E A;  2YLC A;  2DEU A;  4J9H A;  2FZG B;  2DF6 A;  1M9S A;  2RO0 A;  2RH2 A;  3CMA Q;  5GAN 2;  2IPO B;  2XIC A;  2RI5 A;  2YWW A;  4C92 D;  1WJR A;  3G6E Q;  2F2W A;  2OAW A;  2RA2 A;  3CCL Q;  2D0N A;  4QQ6 A;  2ZPG B;  3EAE A;  1OUL A;  5CK9 A;  1ZBJ A;  4Z88 A;  4PKC C;  5KYY B;  1KD1 R;  1JJ2 A;  4E7I A;  3I5R A;  1NZ9 A;  2OTL Q;  3OYH A;  3C95 A;  2LJ1 A;  5GAM e;  4M7D F;  3JCM h;  2MAM A;  2XDD A;  2BZX A;  3HPW A;  3CCE A;  4RKU E;  2E1H A;  3VRY A;  3L2R A;  1RAE B;  2QEX T;  5IXB A;  1MMD A;  4E2F B;  2Y4Y A;  3E19 A;  3FJ5 A;  2ED1 A;  2GTJ A;  3R6O A;  2MCN A;  1WHL A;  1UGP B;  1FMV A;  4JDS A;  3CCS A;  1M27 C;  2HDA A;  3CCU A;  4RTT A;  1KC8 R;  2O4X B;  3UWN A;  1WI7 A;  1O9S A;  1LNX A;  1QCF A;  4M78 D;  3EGX B;  4M77 E;  4M7A A;  8AT1 B;  4MZT A;  5GAM f;  1ZSG A;  2KQW A;  3CME Q;  2RQR A;  4NL3 A;  2X3X D;  1XJW B;  3RDV A;  4DBQ A;  4E7H A;  1ZHI A;  2KI7 A;  2RJC A;  1VQ7 A;  3SB2 A;  3V8J A;  1KG1 A;  1VQO Q;  4M7D D;  3OW2 A;  1OPK A;  2LZ6 B;  1ZUY A;  4B9W A;  2CUB A;  1ZX6 A;  3RKX A;  3CCV A;  2A08 A;  3G4S Q;  1SHF A;  1IGU A;  2EGC A;  2DYB A;  1JRI A;  3M0P A;  4EPC A;  1YP5 A;  2YDL A;  2PUK B;  1OI1 A;  2C0T A;  4AG1 C;  2CUD A;  4C92 F;  4QKU A;  3CC7 A;  2XHC A;  3NHN A;  4OML A;  2F2V A;  2VXF A;  5LJ3 f;  3CCV Q;  2GNC A;  2C0I A;  4RTY A;  2OJ2 A;  2J6K A;  1SRL A;  4EIK A;  2CKK A;  4FT2 A;  2DZC A;  3G6E A;  2LTO A;  4M75 B;  2KRN A;  1YJN Q;  1B34 A;  2COZ A;  5GAN f;  1TG0 A;  1WA7 A;  2GCX A;  1C1A A;  1H8K A;  2FPD A;  4FYV B;  2HL5 C;  4OMF B;  4LN2 A;  2QTX A;  5KE2 A;  4QT7 A;  1GCP A;  1M30 A;  1Q81 C;  3R6N A;  3GIB A;  2RHZ A;  1UGR B;  1NG2 A;  3CCR A;  1Z9Q A;  1X69 A;  4JJB A;  2FPF A;  3M0U A;  4BY6 C;  2QEX Q;  5GAN h;  4ELZ C;  2H8H A;  3S3N A;  3IQL A;  4PJO A;  3VS6 A;  1KD1 U;  5M9O A;  3VKI A;  1NPR A;  2J6F A;  2ZCF B;  4MZP A;  2RB6 A;  3M5A A;  4HA8 A;  2EJF A;  4JRI A;  4BE1 A;  2KT8 A;  3OSS C;  2BE9 B;  3RMS A;  4BE2 A;  2DO3 A;  1Q86 C;  3CPW P;  1OEB A;  2BE7 D;  2GFA A;  3CCU T;  2QI2 A;  1H3H A;  2CS7 A;  3J80 E;  3JB9 H;  3PGG A;  3LWI A;  1TWB A;  2V8K A;  3MET A;  1VQK T;  4PL6 A;  1NYF A;  1KC8 U;  2JOY A;  1RAD B;  1IRE B;  2RI2 A;  5HK3 A;  2E6Z A;  1NLO C;  2PVO B;  4J9G A;  4XU1 A;  1H92 A;  2K57 A;  3EHQ A;  1Q86 R;  1G3W A;  3ULR B;  4XQ3 A;  3M56 A;  2HL3 A;  1FYN A;  1TH7 A;  2O88 A;  4M7A D;  1W4S A;  2C06 A;  1SPK A;  5I11 A;  4M75 E;  3VYH B;  2K2V A;  3KUF A;  2EJ9 A;  1JEG A;  3M9Q A;  2Y90 A;  3CXC P;  1A0N B;  1IHV A;  1XQH A;  2VC8 A;  3EG0 A;  4ESR A;  1CKA A;  2JVV A;  2KE9 A;  4ATO A;  4C8Q C;  2DNU A;  4XU0 A;  2ZAE A;  2EWN A;  4A4H A;  2WSF E;  3C94 A;  2K4Y A;  1QKW A;  2PVD B;  4M7D B;  2OTJ A;  2OTJ T;  2CRE A;  4J9B A;  2QYZ A;  3SWN A;  1YHQ T;  5C6S A;  1VIF A;  3FDR A;  3VS4 A;  1PRM C;  3PE0 A;  1NYG A;  4II1 A;  3DLL A;  4MDX A;  1JU5 C;  1T3L A;  1VYT A;  2QQB A;  1WXU A;  2DMO A;  3URG A;  1JB0 E;  1PCX A;  2K5I A;  1BU1 A;  1YWP A;  1NE8 A;  3ZBD A;  4M77 C;  4Z8A A;  1S72 T;  1UTI A;  2B86 A;  1VQP Q;  4E6R A;  4NS5 A;  1K0X A;  4PJO F;  4FW2 A;  1TTH B;  1OX9 A;  4KUI A;  2DTH A;  1PKS A;  2QGG A;  1QVP A;  2NUT A;  4HT8 A;  1Y07 A;  2YUO A;  5GMK j;  3MP1 A;  1YIT T;  3CCR T;  2FO0 A;  3TSW A;  1M1F A;  4RTU A;  1M1K R;  3KFV A;  2I2L A;  3CCE T;  5KYW B;  2KEA A;  1K9M R;  1KQS P;  1K8A C;  2E3I A;  1K9M U;  1YCY A;  1F1B B;  1FX7 A;  2MYS A;  4F7U F;  2M9U A;  1WDX A;  2DD5 A;  4DEX A;  1O75 A;  3SEM A;  4A63 B;  2LX7 A;  3TVT A;  2F5T X;  4JUV A;  4JJC A;  1ZBX A;  4OB2 B;  5EC7 A;  1FXX A;  3QUI A;  2XD0 A;  1LCK A;  2YSQ A;  4RCB A;  3E2U A;  1WXB A;  5A2Q E;  1HYO A;  4LNP A;  2KRO A;  2XDP A;  1I0C A;  2RMO A;  2HAX A;  2CH4 A;  2HKN A;  3RR6 A;  4P5N A;  1M2V A;  2M02 A;  3CCM T;  3M57 A;  4M77 G;  3HFO A;  3C12 A;  3NPF A;  2L3R A;  4N4G A;  1UE9 A;  3UDC A;  3OYG A;  1IB8 A;  1QWE A;  2MWP A;  1ZSZ C;  1G3Y A;  3ZL7 C;  3OYF A;  2EVR A;  3CCS Q;  1QLY A;  4PK4 A;  4M7A C;  4LXC A;  8ATC B;  2VUB A;  4XTX A;  1VQK Q;  1VQ6 Q;  3S6W A;  2M1H A;  5CIU A;  3VUB A;  2DL5 A;  3JCM V;  4ZN3 A;  3A8H B;  1RAH B;  5GAO n;  1K1Z A;  3I56 T;  1QP2 A;  5DLO A;  1R0C B;  3LLR A;  2DET A;  4XAX B;  2L0A A;  3V7C A;  1XNI A;  2X9H A;  2Y4X A;  3MP6 A;  3PFS A;  2KXD A;  2HSP A;  4EMK A;  2JS0 A;  1MMN A;  4LDU A;  3CCJ A;  2D6F A;  1M5Q 1;  5GAO m;  3OS0 A;  1TS9 A;  4M77 B;  4E7K A;  1EZZ B;  2LP5 A;  3JCM g;  3CCM Q;  3M58 A;  1VQN Q;  1UEC A;  1K8A R;  3F70 A;  1VQ7 T;  2CT4 A;  1OOT A;  3OBY A;  3MEW A;  3PTA A;  2NUP A;  4MML A;  4Y28 E;  1NJI U;  2L5Q A;  2LDM A;  4RG8 A;  2H3J A;  3I55 Q;  5CAI A;  1JJ2 P;  1W2B P;  2KRM A;  5LJ5 d;  3OQ5 A;  2A37 A;  1VA7 A;  4F17 A;  2VV5 A;  2RF0 A;  5LJ3 d;  4RTW A;  4E7J A;  3D7S B;  2GQI A;  2ED0 A;  4LE9 A;  1Q82 U;  2CP3 A;  5GAM g;  1XTD A;  4KGV B;  4ZTF A;  3VS2 A;  1QVG S;  4WTO B;  1AVZ C;  2VXE A;  2JM9 A;  5KYU B;  4J9F A;  1KIK A;  4XTZ A;  2Z0W A;  5J26 A;  2DXT A;  4J5Y A;  4X9D A;  3VRZ A;  5DM7 R;  2YRC A;  2DL3 A;  1ZUK A;  4OF1 A;  1R8O B;  2DYI A;  1WYX A;  2AT1 B;  3I35 A;  2XMF A;  4BE0 A;  2PVG B;  4NL2 A;  3EFR A;  3I5S A;  1OZ2 A;  4A4E A;  2EGA A;  2RNA A;  1WHM A;  1H3Z A;  4UC4 A;  2KGT A;  5CVI A;  3RES A;  4B9X A;  2I0N A;  4PFO A;  3JSC A;  2L8D A;  1YIJ Q;  3M0T A;  1G5V A;  4OMN A;  2FL7 A;  5GAN 4;  5CKH A;  2KYM A;  5KYX B;  3CCE Q;  1BI0 A;  1JJ2 S;  1PKT A;  1YJ9 T;  4BI8 B;  4ORZ A;  4C8Q F;  2CZ6 B;  3OYN A;  1UGS B;  1WJQ A;  2CSQ A;  4FYW B;  1NJI R;  2ESW A;  1ZA2 B;  2VKN A;  3CCM A;  1I5O B;  5GAM d;  4J83 A;  2K2M A;  3FIF A;  1TUG B;  3QYG B;  4KGZ B;  4XK8 E;  4IIM A;  4HVU A;  4M75 D;  1M8V A;  3THK A;  4ZTJ A;  1VQO A;  1Q81 U;  2RK1 A;  1WHG A;  4KT0 E;  2IVW A;  2RM4 A;  2FPE A;  4PJN A;  1MV3 A;  2DL8 A;  1M1K U;  4HCC A;  2M0Y A;  1VQ8 A;  1X75 C;  2V26 A;  3A8O B;  2E65 A;  4X9C A;  1BYM A;  5KYX A;  2AZV A;  1JXO A;  3OSV A;  2CP7 A;  4JLG A;  3VS3 A;  1BIA A;  3A8L B;  4C92 G;  4A53 A;  3MPU B;  1VQ5 T;  4C92 C;  1MV0 B;  2K6D A;  1PWT A;  3M0Q A;  4EDU A;  1VQ8 Q;  3A5Z B;  4RTX A;  1M90 C;  2PU9 B;  3MHX A;  2K3X A;  2JW4 A;  5GAN 3;  2COY A;  5HCK A;  1VQN T;  5GMK l;  1SF9 A;  3OYC A;  2AKL A;  1N9S A;  4D8K A;  3LGF A;  1ZSZ B;  1HJD A;  2DXU A;  4OB3 B;  6AT1 B;  1QVF P;  3DLM A;  2HQX A;  1K73 U;  3OYK A;  4O6J A;  1YIJ A;  1VQ6 A;  2V8J A;  4HCK A;  2AZS A;  3RIR A;  1Q7Y C;  1WJS A;  3N5B B;  1NM7 A;  2AHJ B;  3REB B;  1B7T A;  4IIO A;  4FCY A;  4A4G A;  4OMQ A;  1ZSZ A;  2VWF A;  1AEY A;  2EYZ A;  2ZPI B;  3SDZ A;  3EG9 B;  2HQE A;  2JJ9 A;  2W0Z A;  3CCJ Q;  3G1J A;  4C8Q E;  1IZ6 A;  3EGX A;  3H6Z A;  4M7A B;  1WZO A;  4KGX B;  4M77 D;  4ELY C;  4M7D G;  1D0Z A;  3L2Z A;  1Q95 G;  3CC4 Q;  4JJD A;  2ROL A;  1KK7 A;  4J6X A;  3JCM P;  1K9M C;  2EYW A;  1I8F A;  5IN1 A;  3G7Z A;  3REA B;  2R5M A;  1M1K C;  2ATC B;  2PZ1 A;  2R58 A;  3PIO A;  1AWW A;  2CYZ B;  4OGE A;  2JXB A;  1M90 R;  2A3L A;  2DJQ A;  5KCH A;  4GLM A;  1UJY A;  3JCM X;  3MP8 A;  1RUW A;  2LCL A;  1E6H A;  3FC3 A;  1UFF A;  1MUZ A;  2KAF A;  2DD4 A;  4KBM B;  1I4K 1;  2DA9 A;  3EFO B;  3VS7 A;  4BY6 B;  4AFS C;  2KSS A;  1D3B A;  5D6Y A;  2LQW A;  4OVA A;  4CRI A;  3CBM A;  1XOV A;  1OV3 A;  3M59 A;  1BI3 A;  5CKD A;  1SG5 A;  2JTM A;  2FZC B;  2PUO B;  2AKK A;  3CCJ T;  1VQ4 Q;  1Q7Y U;  4O5V A;  2W10 A;  1HXD A;  2DJZ A;  4EMH A;  5CKF A;  4PLL A;  2K79 A;  1E6G A;  3EFO A;  2FEI A;  4XTW A;  4C0D B;  1BCM A;  2FZK B;  1KQ1 A;  1X01 A;  2EGE A;  3PVL A;  4JZ3 A;  1GCQ A;  4FT4 A;  1EIF A;  4IUQ A;  2X51 A;  1JBM A;  1YJN A;  2G6F X;  1AD5 A;  1U1S A;  4OMO A;  3QDR B;  3CD6 A;  3JCM W;  2X4W A;  4QVD A;  1TUD A;  3QDF A;  5FW9 A;  4HCZ A;  4N0A C;  2MMP A;  2M0O A;  4V2S A;  2XK0 A;  1VQP A;  3TQ7 P;  3CC4 T;  1T0H A;  1K0S A;  5GJV B;  1NJI C;  3PT9 A;  4C8Q B;  2BIV A;  2KNB B;  4BDY A;  2LQK A;  2GFU A;  5CQX A;  1X2Q A;  3HTR A;  4ANJ A;  2E70 A;  4X34 A;  2QQS A;  4PLI A;  5I2S A;  5L8R E;  1VQ7 Q;  1MGQ A;  1WX6 A;  2CH4 W;  1AWJ A;  4ZGE B;  3A98 A;  2JUF A;  2MOX A;  3CC7 Q;  3FRN A;  1W2B S;  2J6O A;  4M75 C;  2JTF A;  3H41 A;  3UF4 A;  3JCM f;  3OYL A;  3CC2 A;  3EH2 A;  4VUB A;  3CD6 T;  4WCI A;  3SD4 A;  1R77 A;  2DTO A;  3FB9 A;  2KR3 A;  4F7U A;  3CEY A;  4FYY B;  4CC2 A;  3JB9 F;  1YFN A;  2KVQ G;  4FW1 A;  3M53 A;  4DQ2 A;  1VQL A;  4QQD A;  1Z9Z A;  1X43 A;  4OP0 A;  4RCC A;  2DRM A;  1V76 A;  2EFI A;  3NTK A;  4M7D C;  3MEV A;  3FEO A;  3M0R A;  2E3H A;  1UHF A;  1RAF B;  5J39 A;  1LJO A;  2P4R A;  1RI9 A;  2CZ7 B;  3QBY A;  3JB9 J;  3GP8 A;  4DOV A;  2OX7 A;  3EH1 A;  1N8R R;  4IKF A;  4KRT A;  4TVR A;  1OX8 A;  2IIM A;  5GAM j;  2OTL A;  2SEM A;  4EMK B;  2FHD A;  1VQM T;  3JRZ A;  3JB9 D;  1G3T A;  1ABO A;  1AZG B;  1I81 A;  4KH0 B;  2AK5 A;  4X1V A;  2D1X A;  1H64 1;  1MNE A;  3H0F A;  5A0G A;  2KBT A;  3GBQ A;  2GF7 A;  3JCM d;  4JRK A;  1S72 Q;  2XG8 D;  2KY9 A;  2QAZ A;  3M4Y A;  3GNG A;  4MDW A;  1K8A U;  2LQ8 A;  1W1F A;  1WQW A;  1N6A A;  1SKU B;  3JV3 A;  5CKE A;  1KSW A;  4M78 F;  1LVK A;  2R57 A;  1YI2 Q;  4MZM A;  3RER A;  1LOJ A;  3J7A F;  2QDY B;  2E6N A;  3BY7 A;  1VIE A;  2E5Q A;  2KT1 A;  2LVM A;  2YHT A;  3JCM c;  2HMA A;  3PIP A;  2F1L A;  4BUG A;  3OS5 A;  1GFC A;  1T3S A;  1VYU A;  2DX1 A;  5KCO A;  4DBR A;  3CBP A;  2VGN A;  2XU8 A;  1RL2 A;  2DXC A;  2NUT B;  2M51 A;  1W6X A;  1YI2 A;  4OB1 B;  4ME7 A;  2X3W D;  1GBR A;  2MI6 A;  5LJ5 h;  4PNO A;  1HD3 A;  3QPH A;  2WAC A;  3JCM Q;  1B34 B;  4J7I A;  2RJE A;  3SFM A;  4QQG A;  4RTV A;  5HKC A;  5KYU A;  1PSE A;  4ZN1 A;  3QJY A;  4LDV A;  2G3R A;  4PJO G;  4Y91 A;  2ZZD A;  4N4I A;  3SWN B;  4CI0 C;  3CMA T;  4C5H A;  2DFU A;  2V1Q A;  1IGQ A;  1TXQ A;  3A8G B;  2HEQ A;  4XTY A;  3CCS T;  1JO8 A;  4YTL A;  4PJO E;  2JM8 A;  1M3C A;  3ASK A;  4BAC A;  4LDW A;  1AT1 B;  4XTU A;  4M75 F;  1TSF A;  3QZ5 B;  3I56 Q;  1OU8 A;  2ROT A;  1WGS A;  1UHC A;  4FIB A;  3MCA B;  4HKE A;  2DKG A;  2QXF A;  1P92 A;  1S72 A;  1TU0 B;  2LJ3 A;  5CQY A;  3QSU A;  1N9R A;  1QMC A;  4F7U E;  3M55 A;  1IHW A;  2OI3 A;  5D7U A;  3BE3 A;  3NTI A;  2QDL A;  2E12 A;  2DIQ A;  1TOV A;  3QHS A;  4JJN K;  5CKB A;  5GAN d;  1FWZ A;  1K73 C;  3EGD B;  1WFW A;  3BDL A;  1YI2 T;  3LX7 A;  4J9C A;  3X20 B;  3CCV T;  5KYN A;  5LJ3 g;  1G83 A;  1YJN T;  1BI1 A;  3L2Q A;  3UT1 A;  3PVQ A;  4KUD K;  3MJX A;  2YXY A;  2LQN A;  3CC2 Q;  3UA6 A;  3VS0 A;  3QII A;  4LUD A;  3O5Z A;  4IUP A;  2L89 A;  2HSE B;  2J05 A;  2LNH B;  3AT1 B;  4AFU C;  2LCS A;  2BKD N;  5KYY A;  1M1G A;  5GAN g;  3CPF A;  4JLI A;  4F7U G;  5GAN j;  2ZPF B;  2DIL A;  2ENM A;  5IHI A;  4F04 B;  3QYH B;  2FG0 A;  4L59 A;  2O9V A;  4E7Z A;  3BDU A;  2IG0 A;  1PD1 A;  3NGP A;  4AMC A;  2EQM A;  2C0O A;  1VQ9 T;  5FU7 B;  3I56 A;  2LX9 A;  1Y57 A;  4RTZ A;  2PQW A;  3OY9 A;  4PJO B;  1G2B A;  2CZ0 B;  1RAI B;  4A4K A;  4D8D A;  3G71 T;  4JS4 A;  1UB4 A;  2ZPB B;  2SRC A;  1ZLM A;  2DLP A;  2MF2 A;  2WSE E;  2K5L A;  1DJ7 B;  1S1N A;  1YJW T;  5GAO r;  1MHN A;  2AIR B;  1W70 A;  2MWO A;  4M75 A;  2LT4 A;  4Y92 A;  4RUG A;  3QG1 A;  4PJM A;  4IUU A;  2DPP B;  4M75 G;  5LJ5 e;  2WSC E;  5I2M A;  3JCM b;  2CSI A;  3CBO A;  1N5Z A;  1YBY A;  3M0S A;  3JCM J;  3PNW C;  4J9E A;  1Q82 C;  5LJ3 h;  1K9A A;  2YUP A;  2EQI A;  3H0H A;  4C8Q D;  4L5G A;  1RAG B;  3JB9 G;  2ECZ A;  2HQH A;  5FWB A;  1YJ9 Q;  3QZ9 B;  4E7S A;  1UG1 A;  1KC8 C;  2F5K A;  2DVE A;  3GPL A;  2E64 A;  4M7D A;  1KQ2 A;  3HKS A;  2MIO A;  3TU4 K;  2JZ2 A;  3E9G A;  3A8M B;  3QWY A;  2X4X A;  1PC0 A;  1Q82 R;  2EKO A;  2QG9 B;  1KD1 C;  5GAO p;  4A54 A;  2P0K A;  4J6W A;  1WLP B;  2A28 A;  3TSZ A;  4LUE A;  1VYV A;  4XU3 A;  1X6O A;  3CQT A;  1VQ4 A;  5FWC A;  2QQA A;  3L42 A;  2O01 E;  1ZA1 B;  4LD6 A;  1VQ9 Q;  2BUD A;  1OQK A;  4GLK A;  1QQJ A;  4BI4 A;  3HSB A;  5HY6 A;  4M78 A;  1W2B A;  4FYX B;  1X6G A;  2JMA A;  5DY9 A;  2EYQ A;  2K9G A;  2FRW A;  2HZY A;  3CCR Q;  2GQV A;  2K3Y A;  1RI0 A;  2XI9 A;  5GAN 6;  2EJG A;  2DIG A;  1AWX A;  5EG2 A;  4BD3 A;  5GMK e;  3CCQ A;  4ZNX A;  2XID A;  1MND A;  4F14 A;  5IAY A;  4HCB A;  3OBW A;  1K76 A;  1VQM Q;  2DER A;  1VQP T;  1UJ0 A;  2HBP A;  2OTJ Q;  2HD0 A;  1QVG A;  2DK3 A;  1WQ7 A;  2V1R A;  3EG1 A;  3CME T;  2XDB A;  3V8L A;  4PJO D;  1BKB A;  2KDS A;  2ZGW A;  2JNG A;  2DRK A;  1YIT Q;  1PSF A;  2DTI A;  3EHR A;  1QWF A;  4AG2 C;  2RQW A;  5FU7 C;  2V8I A;  2VGM A;  3G4S T;  4AFQ C;  2F69 A;  4R56 A;  3VS1 A;  3X25 B;  4PFZ A;  1U1T A;  1KHI A;  2VAS A;  3HRT A;  2HBW A;  1AHJ B;  3CXC S;  4DEY A;  3UA7 A;  2LC4 A;  4QW2 A;  1GCQ C;  4Q5W A;  1OPL A;  2D8J A;  3DB3 A;  3UPU A;  2DE0 X;  1QVF S;  1YN8 A;  4PFP A;  4JRQ A;  1KFZ A;  1Y71 A;  2O9S A;  2L3S A;  1G8X A;  2DBM A;  3AHU A;  1X2K A;  4A4F A;  2X4Y A;  3E9F A;  2OAU A;  1X6B A;  1CSK A;  2P0Q A;  2D9T A;  1RAA B;  3OYD A;  5GMK h;  2LCC A;  2JMC A;  2FRY A;  4C0D C;  2ZPE B;  1M4Z A;  3H0I A;  2OTL T;  3KXT A;  2DAQ A;  1J3T A;  2P84 A;  4CC4 B;  1QKX A;  1GRI A;  1SEM A;  1VQ6 T;  3VUZ A;  2LMJ A;  4EMG A;  5GAN 5;  3Q1J A;  3VV0 A;  3JB9 I;  2RJD A;  4XTV A;  2FYK A;  2QQR A;  2NUZ A;  2CGH A;  3P8D A;  5A0D A;  1GL5 A;  2DZ9 A;  4J7F A;  2NUP B;  3WXM B;  2D8H A;  4OB0 B;  1KJW A;  3UAT A;  5FU6 B;  2QQ9 A;  2J06 A;  3NFC A;  5IXF A;  2PTK A;  1ZUU A;  3OYA A;  1D1C A;  4EMK C;  3JAM E;  1VQ4 T;  4JZ4 A;  3BFM A;  1WNL A;  3M4G A;  4CC7 A;  4M78 G;  2E10 A;  5GAM h;  2HCK A;  1VQN A;  4KH1 B;  3PMI A;  2CDT A;  3LGL A;  4J8O A;  2GBQ A;  2KXC A;  5FRN A;  2RQU A;  3EGU A;  3CPW A;  1Q86 U;  2QA4 T;  4JS5 A;  3CCL T;  1RAC B;  2NYS A;  2E41 A;  1YIJ T;  4LD9 K;  1ZQ1 A;  4PJL A; 
#chains in the Genus database with same CATH homology
 4J9H A;  1KIK A;  1GBR A;  2DF6 A;  1HD3 A;  4AFZ C;  1BK2 A;  3VRZ A;  2DL3 A;  1ZUK A;  4K11 A;  1WYX A;  1M8M A;  2F2W A;  3C0C A;  3I35 A;  2OAW A;  2PNI A;  2XMF A;  4RTV A;  2D0N A;  3I5S A;  1WIE A;  2EGA A;  2EPD A;  2RNA A;  1ZBJ A;  4Z88 A;  1T0J A;  2KGT A;  2JT4 A;  2V1Q A;  3I5R A;  2HEQ A;  2I0N A;  1JO8 A;  2JM8 A;  1M3C A;  2LJ1 A;  3M0T A;  1PHT A;  1IO6 A;  2BZX A;  4OMN A;  3VRY A;  2YUQ A;  2KYM A;  5IXB A;  1PNJ A;  1PKT A;  3FJ5 A;  2ED1 A;  2GTJ A;  2MCN A;  2ROT A;  4ORZ A;  2EBP A;  1NEG A;  1UHC A;  1M27 C;  2HDA A;  2CSQ A;  4RTT A;  2ESW A;  2VKN A;  1CKB A;  5ECA A;  1GBQ A;  1WI7 A;  1YNZ A;  4J9I A;  1QCF A;  2K2M A;  2LJ3 A;  2OI3 A;  1JQQ A;  2CT3 A;  1ZSG A;  2QDL A;  3EG2 A;  1AZE A;  4IIM A;  4HVU A;  2RQR A;  2J7I A;  2X3X D;  3THK A;  1WFW A;  1OPK A;  2FPE A;  2LZ6 B;  1MV3 A;  1ZUY A;  2DL8 A;  2CUB A;  4J9C A;  1ZX6 A;  2DL7 A;  1G83 A;  2A08 A;  2M0Y A;  1SHF A;  2EGC A;  2GTO A;  2DYB A;  3PVQ A;  2AZV A;  1JXO A;  3M0P A;  2LQN A;  1E7O A;  3UA6 A;  1YP5 A;  2YDL A;  3VS0 A;  4LUD A;  3VS3 A;  1K4U S;  1U06 A;  3O5Z A;  2C0T A;  4AG1 C;  2CUD A;  2J05 A;  2LNH B;  4AFU C;  3NHN A;  2KRS A;  2LCS A;  4OML A;  2K6D A;  2F2V A;  2JTE A;  1MV0 B;  1PWT A;  2GNC A;  2C0I A;  3M0Q A;  2F2X A;  2DIL A;  2OJ2 A;  4RTY A;  2J6K A;  4RTX A;  2ENM A;  1SRL A;  5IHI A;  4EIK A;  2JW4 A;  1GFD A;  2FG0 A;  4HXJ A;  5HCK A;  2O9V A;  1HSQ A;  1NLP C;  5GJW B;  2KRN A;  3NGP A;  2C0O A;  2AKL A;  1TG0 A;  1WA7 A;  1Y57 A;  4RTZ A;  1SSH A;  1AOJ A;  2E5K A;  2NWM A;  4D8K A;  1H8K A;  1G2B A;  2DM1 A;  2FPD A;  4D8D A;  4LN2 A;  4JPB W;  5L23 A;  4QT7 A;  1HJD A;  1GCP A;  1M30 A;  2GGR A;  2SRC A;  3R6N A;  1ZLM A;  1M3B A;  5I22 A;  1NG2 A;  2DLP A;  2RQV A;  1Z9Q A;  1X69 A;  4JJB A;  2FPF A;  2ABL A;  4HCK A;  3M0U A;  2AZS A;  1RLP C;  1S1N A;  3VS5 A;  2EYX A;  2K7A A;  1NM7 A;  3REB B;  4IIO A;  1W70 A;  4OMQ A;  1YCS B;  2VWF A;  1AEY A;  1SHG A;  2EYZ A;  1ABQ A;  4Y92 A;  2H8H A;  4RUG A;  1V1C A;  3IQL A;  2W0Z A;  3VS6 A;  1NEB A;  2J6F A;  2CSI A;  1N5Z A;  4JJD A;  2ROL A;  3M0S A;  2KYB A;  2EYW A;  2KT8 A;  4J9E A;  2LJ0 A;  1M3A A;  1K9A A;  3REA B;  1OEB A;  2YUP A;  2EQI A;  2PZ1 A;  3H0H A;  1AWW A;  1H3H A;  3LH5 A;  2JXB A;  2ECZ A;  5FWB A;  2DJQ A;  1NYF A;  1UG1 A;  4GLM A;  1UJY A;  1B07 A;  1RUW A;  1NLO C;  4J9G A;  1ARK A;  2MIO A;  1E6H A;  1UFF A;  1Y0M A;  2VVK A;  3QWY A;  1MUZ A;  1H92 A;  1JXM A;  3EHQ A;  2YT6 A;  2DA9 A;  3VS7 A;  3EG3 A;  3ULR B;  4AFS C;  2O2O A;  4FSS A;  1FYN A;  2LQW A;  2O88 A;  4GBQ A;  1XOV A;  1OV3 A;  1SPK A;  5I11 A;  1WLP B;  2RQT A;  2A28 A;  2AKK A;  3TSZ A;  4LUE A;  1VYV A;  1SRM A;  2L3P A;  3CQT A;  1JEG A;  1UDL A;  1A0N B;  5FWC A;  2W10 A;  2BZY A;  4HVW A;  3EG0 A;  4ESR A;  1CKA A;  2DVJ A;  2KE9 A;  2K79 A;  1E6G A;  2FEI A;  2DNU A;  4J9D A;  2EGE A;  1X6G A;  2JMA A;  3PVL A;  4JZ3 A;  1GCQ A;  1FMK A;  1QKW A;  2K9G A;  4F16 A;  3I9Q A;  2FRW A;  2CRE A;  5IHK A;  4J9B A;  1B3Q A;  4R0K A;  4CC3 A;  2G6F X;  3U23 A;  3VS4 A;  1AD5 A;  1PRM C;  4OMO A;  3PE0 A;  1NYG A;  1AWX A;  1TUD A;  1JU5 C;  1T3L A;  1VYT A;  4ZNX A;  1WXU A;  4F14 A;  3NMZ C;  2DMO A;  5FW9 A;  1K76 A;  1BU1 A;  1YWP A;  4Z8A A;  1UJ0 A;  1T0H A;  1UTI A;  2B86 A;  1K0S A;  4E6R A;  2V1R A;  5GJV B;  2BZ8 A;  2BTT A;  1K0X A;  3EG1 A;  2KNB B;  1PKS A;  1X2Q A;  2DRK A;  1UGV A;  1WX6 A;  2CH4 W;  2YUO A;  3EHR A;  1AWJ A;  3A98 A;  1QWF A;  2FO0 A;  2RQW A;  4AG2 C;  3TSW A;  2MOX A;  1I07 A;  2L2P A;  4AFQ C;  4RTU A;  2J6O A;  3KFV A;  3VS1 A;  1WXT A;  1RLQ C;  2KEA A;  3H41 A;  2JS2 A;  3UF4 A;  2HBW A;  1WDX A;  2L3Q A;  4WCI A;  2YUN A;  4DEX A;  4DEY A;  3SEM A;  4A63 B;  2LX7 A;  3TVT A;  2KR3 A;  4JJC A;  3UA7 A;  1UUE A;  4CC2 A;  5IH2 A;  5EC7 A;  1GCQ C;  2A36 A;  1OPL A;  2D8J A;  1Z9Z A;  1X43 A;  1LCK A;  1BBZ A;  2EYY A;  2YSQ A;  2DE0 X;  1WXB A;  1YN8 A;  1TUC A;  2DRM A;  4LNP A;  2KRO A;  1KFZ A;  1I0C A;  2RMO A;  2O9S A;  2CH4 A;  2L3S A;  3M0R A;  2DBM A;  1UHF A;  1I1J A;  4Z89 A;  1X2K A;  2P4R A;  1RI9 A;  1X6B A;  1CSK A;  3NPF A;  2DL4 A;  1UE9 A;  1PRL C;  2JMC A;  1QWE A;  2FRY A;  4KRT A;  1AWO A;  2RPN A;  1BB9 A;  3ZL7 C;  3H0I A;  2EVR A;  5IHN A;  2IIM A;  1QLY A;  2SEM A;  3RBB B;  3RNJ A;  1J3T A;  4CC4 B;  3SHW A;  1QKX A;  1GRI A;  1SEM A;  4OMM A;  2DL5 A;  2LMJ A;  1ABO A;  1K1Z A;  4M4Z A;  1AZG B;  2L0A A;  2AK5 A;  2KXD A;  2K3B A;  2D1X A;  2HSP A;  4X1V A;  2JS0 A;  2EW3 A;  2NUZ A;  3H0F A;  3QWX X;  2KBT A;  1GL5 A;  3GBQ A;  2LP5 A;  1UEC A;  2O31 A;  2D8H A;  1W1F A;  1KJW A;  3UAT A;  2CT4 A;  1OOT A;  2J06 A;  5IXF A;  2PTK A;  1ZUU A;  4JZ4 A;  3JV3 A;  2DBK A;  4CC7 A;  1U5S A;  1KSW A;  1YWO A;  2HCK A;  2CDT A;  2KRM A;  2RN8 A;  2GBQ A;  2A37 A;  2KXC A;  1VA7 A;  4F17 A;  2KT1 A;  2RF0 A;  2RQU A;  4RTW A;  1X27 A;  4HVV A;  2GQI A;  2ED0 A;  4LE9 A;  2EKH A;  4OMP A;  3EGU A;  1GFC A;  1T3S A;  1VYU A;  1EFN A;  2DX1 A;  3VS2 A;  1AVZ C;  2M51 A;  1W6X A;  2JM9 A;  1U3O A;  2X3W D;  4J9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...