2LD6A

Solution structure of histidine phosphotransfer domain of chea
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
MMEEYLGVFVDETKEYLQNLNDTLLELEKNPEDMELINEAFRALHTLKGMAGTMGFSSMAKLCHTLENILDKARNSEIKITSDLLDKIFAGVDMITRMVDKIVSEGSDDIGENIDVFSDTIKSFASSGKEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and dynamic properties of the complete histidine phosphotransfer domain of the chemotaxis specific histidine autokinase CheA from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Chemotaxis protein CheA
total genus 35
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2ld6A00
2LP4A 3KYJA 3IQTA 4G78A 1QSPA 1OXBA 1BDJB 4EUKB 2LCHA 1A0BA 1Y6DA 1TQGA 2OOCA 2Q4FA 2A0BA 1C03A 3US6A 3KYIA 1C02A 3MYFA 1SR2A 3U3BA 1YVIA 1WN0A 1FR0A 1OXKA 1I5NA 2R25A 4PACA 2LD6A
chains in the Genus database with same CATH superfamily
1JPNA 4CX9A 1XZPA 2W45A 2R7OA 3NDBB 1VYIA 5F5HA 1QVXA 4ULVA 4QI2A 5FZTA 3GM2A 4C3BA 3U3FA 1G4WR 4YL0A 1OW8A 2GAQA 3EPVA 3K1IA 4U5HA 4CSAC 1YLMA 4XQ1A 3S27A 1TWGA 2LFDA 4IAOA 4OD4A 4XEVA 3C18A 3SXYA 1NFOA 5DLJA 3ATPA 2PX0A 5KYXB 4XTKA 2UUIA 2R03A 3TULA 4E0HA 3GANA 3EHMA 4O6YA 5A69A 2IXNA 2YWAA 1OKKD 3EGDA 5E2QA 4CS9A 5L3QA 3T6GB 1E86A 4J30B 4G0HA 4LACB 3BEHA 1LVKA 3M79A 4EBBA 4CIHA 3TOLA 2UUHA 3OEOA 1XWJA 2BE5F 4AK9A 2ASRA 2YRFA 4MVRA 4DBQA 2M64A 3C62A 4CS8A 2H7OA 2P61A 2KQ9A 3RH3A 3CSKA 3X1OA 2OJED 4JTDB 1ZHZA 2G62A 2V26A 5IY5C 5E33A 2J8WA 1E84A 3ASOC 2GA0A 2NSGA 3N0TA 1Q0KA 1H7IA 5DS4A 4FESA 4NTBA 2EPNA 3HJCA 3GM1A 3AG2C 3MFNA 4OD5A 1VMAA 1JPJA 4NQFA 3HNKA 3EFOA 2DYRC 4DRHB 1QZXA 1U6HA 2NG1A 4CDAA 4KC9A 2IYLD 2CCYA 2J9BA 1VK5A 3QTHA 2BL2A 3QW0A 3S29A 2XXAB 2QNLA 1Q0DA 3ZG1A 2OCCC 3S28A 3VM6A 1JRAA 2M4EA 2WVOA 2YL3A 4OIRF 3LLIA 5B3IA 4PJMA 1T6IA 3S84A 5KYNA 1G8XA 4U5FE 5BUOA 3O6XA 4FX5A 1GS9A 1YAUO 1ZU4A 4LDRA 2R9RB 1GQAA 4HE8D 1ZU5A 3S0XA 3WG7C 4A2NB 4NTFA 2WL8A 4CBEA 3DAFA 1V74B 4YT4A 2W9YA 3UGOA 3O10A 5JRAA 5L0FA 1K05A 3TQOA 1TKNA 2EIJC 2AWYA 4QI0A 5T1DB 5DS6A 1ZVZA 1EQ1A 3L8IA 3EH2A 3C8GD 2AP3A 4PFPA 1WN0A 2L9JA 1I4YA 4MVQA 3FDQA 1OR3A 2IM8A 4IWBA 1J8MF 1AVOB 5JT4A 2HMQA 1H6GA 3F47A 4J7YA 2HS5A 3B71A 2KNHA 3N2ZB 1FNTc 2YL1A 1QSPA 2KC3A 1BDJB 1EA8A 1H9GA 2HZ8A 2JX0A 3H2UA 3V5XA 4WGYA 1M6TA 5L0DA 3U5SA 3R2PA 2Y3DA 4KNVA 3B0PA 4PR9A 3AJMA 1YZCA 3NMKA 5KYWA 3KPHA 1WASA 2OOCA 3MX3A 3EJNA 1A7DA 1CGOA 3FAPB 2ZD9A 3RYLA 2V3CC 3R7CA 5EHHA 2D5RB 1ZHWA 3DD7A 4AE4B 5F5FA 3JT1A 4F4BA 1EI7A 2I8BA 1NZEA 2PF4E 1ZW2A 4JW1A 2PP4A 4EHPA 3MYFA 1NLXA 5A6JA 2YHSA 3SXZA 1PV3A 1SYQA 3AGTA 5DQTA 5HV9A 2I15A 1RJ9A 2IBFA 4JEAA 1V55C 2VH3A 3C8GB 1OW7A 4OIPF 2EPKX 3Q6MA 4PACA 4YN0B 1D0XA 1GGQA 1N1CA 4BJ5A 1LKXA 2YLIA 3O55A 3U2MA 4GQHA 1T01A 4JEBA 1RMVA 1Z6AA 2XL4A 4DOZA 3RIPA 4C3DA 1RJ9B 1Q0GA 1IZMA 2W4MA 3EGXA 1Y6DA 4MVSA 3EZIA 4MVMA 1TQGA 3N24A 5JS5A 5B3SC 1BR4A 4LERA 3LAYA 2OU6A 3AG3C 5D91A 4ZLDA 4K7BA 3VAYA 3Q7GA 3ABLC 3GWNA 4GYTA 3JZ0A 4XLNF 2VB6A 3RKOF 5BQIA 2XS8A 4ZLCA 1F1MA 2FAPB 4G7ZF 2J45A 2L7AA 3JYHA 3O39A 2L81A 5JVEA 4JKVA 1VLTA 4AL0A 2Q9CA 5K0IA 1YZAA 1TFKB 4E0IA 1FR0A 2KW3C 2IXOA 2YLDA 4O6MA 4KNWA 4DVYP 3B29A 3JSZA 2PBEA 2FGYA 2RD9A 2Y3GA 3RVZA 4ULWA 4MW3A 4A4AA 4LLCA 4JCHA 1FMVA 4YL3A 2R7TA 1V54C 1CPQA 5A6BD 2J46A 1VTMP 4JRZA 1NSGB 4MS2A 4MW8A 3RQEA 4E7ZA 1MNDA 3DJUB 5A6AA 1YA9A 2CDQA 5JP7A 4W8PA 3NG1A 2AWCA 2ZXOA 1YYJA 2Q00A 5BQGA 4EWCA 5EGYA 4U5EE 5AGFA 3A11A 1S05A 3EGXB 4CS7A 5A6BA 1FTSA 1UG7A 4YL1A 3U3BA 3PHF2 2AU5A 2HJ3A 4MNDA 4RD9A 1YYXA 3ZIBA 3ZWIA 3BRJA 1ZW3A 3I5QA 2LP4A 4JJFA 3KMIA 5KYWB 3WAQA 1Z63A 4KBLA 1TFOB 2X51A 4Q4ZF 4G7OF 1J8YF 2PX3A 4BEMJ 1CPRA 1D0YA 2LK4A 4MTGA 3U8PA 3NMJA 3W8HA 4AL1A 4PK4A 4E18A 2MWQA 4XPXA 1A7EA 3S9OA 4MVUA 2VASA 3QVZA 3JRMO 1NBBA 1D1AA 1MMGA 2Q9BA 1HE9A 4K1OA 3HKKA 5CIVA 3CZ6A 4N6CA 3H2VA 4JURI 3RQGA 1A41A 4OINF 3L34A 3V5YA 5DVWA 4N4WA 4D4XA 2P7VA 2YEVA 4I1OB 5AC5A 5L0GA 2XL6A 3K66A 4IAQA 2FFHA 4M63A 4Z9IA 4AE4A 2WVQA 1LE2A 2Q7RA 3DKAA 3G4XA 1ZZPA 4RDAA 3K33A 1O5HA 3ZSUA 3B9QA 4IARA 1LI7A 1LS4A 1SF8A 4FAPB 2VCBA 1JR8A 3C8ZA 2R05A 1ZHXA 2G3VA 3C8GA 1K40A 2NUPB 3EG9A 1SZIA 3KKBA 1ORJA 2EINC 3PMRA 3NYMA 5DQZA 2CNWD 3GWLA 3OA1A 2QUPA 3X2QC 3VF0A 4YJWA 3M4CA 4X0RA 5KYYA 1KU2A 1FFHA 1LM3B 1M57C 3E70C 2DGJA 3I4UA 3HLZA 2DB4A 4J32B 1C02A 2EPMX 2PFDA 4NC3A 3U2LA 4C3EA 4DRJB 2O9XA 4CS8C 4I3MA 2QY9A 3T6JA 3UR3C 2L6FA 5L0HA 1FMWA 3ABKC 4HFFB 1BBHA 3ASNC 3A9CA 3E9VA 3DM5A 4HEAJ 2XSEA 3G4ZA 3DAGA 3VYWA 4PJLA 3AG4C 2E87A 3LEVA 3IQTA 4G78A 1E85A 3GORA 1FAPB 4MTOA 1H9TA 4H54A 2NUTA 3LJBA 2JPUA 3AG1C 2C03A 2ICWG 3POVA 1U0BB 5GPGB 4B6IA 4ONSA 1UFBA 2LQGA 3ZQVA 3U0CA 4BJ5C 2H8AA 3FOPA 4CDYA 2NPUA 2Z15A 2KGOA 1R4TA 4JVSA 5B1BC 2P6VA 3SZRA 3V7OA 4ANJA 2C04A 1YDIA 2Y3BA 1YVIA 2OJQA 3T6BA 2W4BA 2H7VC 1L7CA 2IXPA 1OCOC 2XLOA 3JYYA 2J9VA 3L1MA 3L8JA 1PD1A 1A7VA 3DI5A 5COFA 4BPMA 2YKZA 4PJJA 3ZC4A 1MNEA 3FAJA 3M4BA 1PD0A 3EGDB 3IPMO 3RF3A 3W4YA 1IW7F 2CGEA 1TWAA 2KYHA 3H65A 2YLGA 3GEHA 3IQ5A 3OWTA 1EKYA 2WZLA 1TWCA 1ORSC 3SNHA 2QTVA 1KTMA 2OEXA 2LSEA 1OR2A 3AQCA 1L3PA 2KSFA 3UMIA 1LPEA 3FMSA 2H7BA 2YVKA 1MMNA 2PNOA 4W8KA 4U5BE 3IEEA 2HKVA 1PCXA 2KJGA 5JUAA 4XLPF 3I5PA 3SYNA 5L0CA 1WOLA 3VRCA 3SEOA 3Q7LA 3NKDA 4KI2A 2J9UA 3K1IC 3UNGC 1GM5A 2CNWA 3ZTMA 4AX2A 2Y39A 4XEKA 3ZQYA 3RFYA 4PFOA 2IXMA 4JC7A 3C63A 1JMWA 1M2VA 4JTAB 1NU9C 3EFOB 4EKWA 1APCA 2MHRA 4U9DA 1Z23A 3W2WA 3NRHA 2MYSA 2R7QA 1LS1A 2HV6A 4GEHA 1T5OA 4XPYA 4G7HF 2YL0A 3TOMA 4QDLA 2HMZA 3JSEO 3IHUA 2TMVP 4O79A 1SMYF 2Y3HA 3G50A 1S7ZA 1D1CA 1DOVA 1MMDA 1WTYA 2YQYA 4N6HA 3SXKA 4YK5A 1D0ZA 2ZXPA 2QLAA 2B0JA 2NUPA 3EG9B 3SXMA 1C17M 3FOOA 1QQ3A 1OCCC 3TK0A 1AEPA 2EIMC 4U5CE 4C7OA 1QKRA 1RKEA 3KH2A 1Q0MA 4P6IC 3U9MA 4IRUA 1T9KA 2A6HF 4Q7CA 5KYXA 3FVYA 1W2WA 5A6KA 5B1AC 1WGWA 4FWVA 2HSBA 4YT8A 4EBJA 1I4ZA 4U9EA 4BJTA 3KYJA 3UMKA 4CIPA 5CI9A 4Z9HA 4D4NA 3EZHA 3JCUQ 1MQVA 4CJOA 1Q0FA 3NKEA 2EIKC 2XLHA 1WWPA 1ZYRF 3EHNA 4RBNA 4NTAA 3U9JA 2WVNA 2ZXRA 1QPUA 3EH1A 1HW2A 2OQMA 3GEIA 2Q4FA 2A0BA 2A69F 3HTKC 1O3UA 2LIGA 3Q6NA 3QMKA 4DRIB 3RVYA 1Z3IX 4H4KC 3LNRA 1TWHA 3DXJF 2NUTB 2AVKA 3ITFA 4MTFA 4O7GA 2R7XA 4WABA 5HSWA 1VYKA 3QW1A 2KK1A 2OEVA 4EIYA 5DS5A 3MLGA 3M1CB 5FCLA 3S90A 4OIOF 1HMDA 2XLVA 4K0DA 2B0HA 2P0NA 3JTLO 4WGZA 4XPWA 4OIQF 3JRTA 3DM9B 2CW0F 1G5ZA 1U89A 1ZHYA 2F22A 3AGUA 3CEXA 4DXWA 1BR2A 1ST6A 5KYYB 3UGPA 2IOQA 2J0XA 1OCZC 4NY3A 5JSLA 1RXQA 5COGA 2XLEA 4C7OB 2ZPAA 4LDQA 4EBKA 2EPLX 3GEEA 3C7JA 2Q9AA 3LNMB 4BG0A 2WZFA 1T6QA 1JOGA 5F28E 256BA 2L6HA 1V4AA 1Z7Qc 2VCCA 2HSQA 1VOMA 1B68A 3DE8A 2ETSA 1NU7D 3U8VA 2XLWA 3RW0A 3ECSA 3ZDLA 1OCRC 2A68F 3RQFA 1NG1A 3M15A 3UMHA 1LI5A 2J9WA 3F46A 4HFKB 3WHNA 4DVZA 4EUKB 1OXKA 1OKKA 2WZGA 3MYIA 2A1DD 4U5DE 1OW6A 2DYSC 4JJGA 4XEFA 2GDCA 2GWWA 3LS0A 4CDVA 4R32A 2HUJA 5T3WA 3QZCA 3W2VA 1RCPA 1ZHTA 4I44A 1Z5ZA 3HNJA 1XZQA 3DZAA 1BZ4A 3HNIA 3LESA 3J06A 4E17A 2HFIA 5CI8A 2R02A 2RSEB 3LUTB 3W8IA 2EPOA 1A0BA 1LIHA 1MMAA 4JTCB 3PDMP 3CAXA 4JCZA 4L6RA 2Q3TA 1HMOA 1RKCA 1T6UA 4I1MA 1M2OA 1NFNA 2L6GA 1ORYA 4DJ9A 3B0VC 1C03A 3US6A 2G3KA 3DWWA 5KYUB 4JZAA 2XXAA 3GM3A 1HW1A 1CGME 2R7SA 5T3TA 4Q5SF 3WODF 2Y69C 2OG2A 3KYIA 2XRHA 3K6BA 2DI3A 3LS1A 3QVYA 5E3AA 4BEJA 2BC5A 3CQZA 3TD7A 3K1HA 1M56C 3FHDA 2XM0A 4J7TA 4P9FA 3B0UX 2R25A 4E7SA 1CGNA 3AQBA 5KYUA 5TJ5E 3ZVRA 4YWQA 5AC4A 2LD6A 2R7WA 1E83A 4UDVA 3V5ZA 3SP1A 2A6EF 2GFHA 2YL7A 3DJNB 2A0UA 2NSFA 3ABMC 4PJNA 1TR2A 2LCHA 4O6NA 1RKEB 1JAFA 4BJ6A 4BJ6C 5BQHA 4XWJA 4MVOA 2EILC 3AOUA 1DOWA 1R5ID 3GODA 4JIOA 3T4RA 3MBGA 2HV7A 4IGGA 3ZTZA 4YT2A 5JLIA 1FFTC 1YARO 5L0JA 2R7VA 5L0IA 3NMIA 3NYJA 4YT5A 3IQCA 4BJ1A 2R7RA 2CYDA 2YZSA 5COMA 4CSAA 4JE9A 1D1BA 3NYLA 1QLEC 1Y4CA 2JD3A 2LFFA 2VCAA 2J0WA 2XS1A 2P1AA 2OKUA 2XLDA 4LDKA 4MVZA 1VLSA 2X0CA 1YJGA 1LE4A 4Z9JA 2QE9A 3EQLF 1WATA 3DMDA 4LLEA 1OXBA 4WJ0A 4IJJA 4IB4A 2WB7A 1HE1A 1VB5A 2XLMA 3K7DA 2XL8A 4CS9C 2J7PD 2D4UA 1G4US 1BR1A 3KL4A 2XM4A 4ER9A 5E3CA 4N06A 4DBRA 1OQCA 4CJGA 4P9TA 2VC9A 1E2XA 3LLKA 5EK0A 2ZXWC 3IQ6A 4U5GA 4NCQA 3TJ6A 3L0IA 3T9OA 3FXHA 1SR2A 2R7UA 2J7PA 3PCVA 3TJ5A 3LEOA 5D92A 1HY5A 1M2VB 5L3VA 1I5NA 1K04A 3HNLA 4MQ9F 1YA7O 1O87A 1KNYA 2HJMA 1AUEA 3DE9A
chains in the Genus database with same CATH topology
2LP4A 3KYJA 3IQTA 4G78A 1QSPA 1OXBA 1BDJB 4EUKB 2LCHA 1A0BA 1Y6DA 1TQGA 2OOCA 2Q4FA 2A0BA 1C03A 3US6A 3KYIA 1C02A 3MYFA 1SR2A 3U3BA 1YVIA 1WN0A 1FR0A 1OXKA 1I5NA 2R25A 4PACA 2LD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP4 A;  3KYJ A;  3IQT A;  4G78 A;  1QSP A;  1OXB A;  1BDJ B;  4EUK B;  2LCH A;  1A0B A;  1Y6D A;  1TQG A;  2OOC A;  2Q4F A;  2A0B A;  1C03 A;  3US6 A;  3KYI A;  1C02 A;  3MYF A;  1SR2 A;  3U3B A;  1YVI A;  1WN0 A;  1FR0 A;  1OXK A;  1I5N A;  2R25 A;  4PAC A;  2LD6 A; 
#chains in the Genus database with same CATH topology
 1JPN A;  4CX9 A;  1XZP A;  2W45 A;  2R7O A;  3NDB B;  1VYI A;  5F5H A;  1QVX A;  4ULV A;  4QI2 A;  5FZT A;  3GM2 A;  4C3B A;  3U3F A;  1G4W R;  4YL0 A;  1OW8 A;  2GAQ A;  3EPV A;  3K1I A;  4U5H A;  4CSA C;  1YLM A;  4XQ1 A;  3S27 A;  1TWG A;  2LFD A;  4IAO A;  4OD4 A;  4XEV A;  3C18 A;  3SXY A;  1NFO A;  5DLJ A;  3ATP A;  2PX0 A;  5KYX B;  4XTK A;  2UUI A;  2R03 A;  3TUL A;  4E0H A;  3GAN A;  3EHM A;  4O6Y A;  5A69 A;  2IXN A;  2YWA A;  1OKK D;  3EGD A;  5E2Q A;  4CS9 A;  5L3Q A;  3T6G B;  1E86 A;  4J30 B;  4G0H A;  4LAC B;  3BEH A;  1LVK A;  3M79 A;  4EBB A;  4CIH A;  3TOL A;  2UUH A;  3OEO A;  1XWJ A;  2BE5 F;  4AK9 A;  2ASR A;  2YRF A;  4MVR A;  4DBQ A;  2M64 A;  3C62 A;  4CS8 A;  2H7O A;  2P61 A;  2KQ9 A;  3RH3 A;  3CSK A;  3X1O A;  2OJE D;  4JTD B;  1ZHZ A;  2G62 A;  2V26 A;  5IY5 C;  5E33 A;  2J8W A;  1E84 A;  3ASO C;  2GA0 A;  2NSG A;  3N0T A;  1Q0K A;  1H7I A;  5DS4 A;  4FES A;  4NTB A;  2EPN A;  3HJC A;  3GM1 A;  3AG2 C;  3MFN A;  4OD5 A;  1VMA A;  1JPJ A;  4NQF A;  3HNK A;  3EFO A;  2DYR C;  4DRH B;  1QZX A;  1U6H A;  2NG1 A;  4CDA A;  4KC9 A;  2IYL D;  2CCY A;  2J9B A;  1VK5 A;  3QTH A;  2BL2 A;  3QW0 A;  3S29 A;  2XXA B;  2QNL A;  1Q0D A;  3ZG1 A;  2OCC C;  3S28 A;  3VM6 A;  1JRA A;  2M4E A;  2WVO A;  2YL3 A;  4OIR F;  3LLI A;  5B3I A;  4PJM A;  1T6I A;  3S84 A;  5KYN A;  1G8X A;  4U5F E;  5BUO A;  3O6X A;  4FX5 A;  1GS9 A;  1YAU O;  1ZU4 A;  4LDR A;  2R9R B;  1GQA A;  4HE8 D;  1ZU5 A;  3S0X A;  3WG7 C;  4A2N B;  4NTF A;  2WL8 A;  4CBE A;  3DAF A;  1V74 B;  4YT4 A;  2W9Y A;  3UGO A;  3O10 A;  5JRA A;  5L0F A;  1K05 A;  3TQO A;  1TKN A;  2EIJ C;  2AWY A;  4QI0 A;  5T1D B;  5DS6 A;  1ZVZ A;  1EQ1 A;  3L8I A;  3EH2 A;  3C8G D;  2AP3 A;  4PFP A;  1WN0 A;  2L9J A;  1I4Y A;  4MVQ A;  3FDQ A;  1OR3 A;  2IM8 A;  4IWB A;  1J8M F;  1AVO B;  5JT4 A;  2HMQ A;  1H6G A;  3F47 A;  4J7Y A;  2HS5 A;  3B71 A;  2KNH A;  3N2Z B;  1FNT c;  2YL1 A;  1QSP A;  2KC3 A;  1BDJ B;  1EA8 A;  1H9G A;  2HZ8 A;  2JX0 A;  3H2U A;  3V5X A;  4WGY A;  1M6T A;  5L0D A;  3U5S A;  3R2P A;  2Y3D A;  4KNV A;  3B0P A;  4PR9 A;  3AJM A;  1YZC A;  3NMK A;  5KYW A;  3KPH A;  1WAS A;  2OOC A;  3MX3 A;  3EJN A;  1A7D A;  1CGO A;  3FAP B;  2ZD9 A;  3RYL A;  2V3C C;  3R7C A;  5EHH A;  2D5R B;  1ZHW A;  3DD7 A;  4AE4 B;  5F5F A;  3JT1 A;  4F4B A;  1EI7 A;  2I8B A;  1NZE A;  2PF4 E;  1ZW2 A;  4JW1 A;  2PP4 A;  4EHP A;  3MYF A;  1NLX A;  5A6J A;  2YHS A;  3SXZ A;  1PV3 A;  1SYQ A;  3AGT A;  5DQT A;  5HV9 A;  2I15 A;  1RJ9 A;  2IBF A;  4JEA A;  1V55 C;  2VH3 A;  3C8G B;  1OW7 A;  4OIP F;  2EPK X;  3Q6M A;  4PAC A;  4YN0 B;  1D0X A;  1GGQ A;  1N1C A;  4BJ5 A;  1LKX A;  2YLI A;  3O55 A;  3U2M A;  4GQH A;  1T01 A;  4JEB A;  1RMV A;  1Z6A A;  2XL4 A;  4DOZ A;  3RIP A;  4C3D A;  1RJ9 B;  1Q0G A;  1IZM A;  2W4M A;  3EGX A;  1Y6D A;  4MVS A;  3EZI A;  4MVM A;  1TQG A;  3N24 A;  5JS5 A;  5B3S C;  1BR4 A;  4LER A;  3LAY A;  2OU6 A;  3AG3 C;  5D91 A;  4ZLD A;  4K7B A;  3VAY A;  3Q7G A;  3ABL C;  3GWN A;  4GYT A;  3JZ0 A;  4XLN F;  2VB6 A;  3RKO F;  5BQI A;  2XS8 A;  4ZLC A;  1F1M A;  2FAP B;  4G7Z F;  2J45 A;  2L7A A;  3JYH A;  3O39 A;  2L81 A;  5JVE A;  4JKV A;  1VLT A;  4AL0 A;  2Q9C A;  5K0I A;  1YZA A;  1TFK B;  4E0I A;  1FR0 A;  2KW3 C;  2IXO A;  2YLD A;  4O6M A;  4KNW A;  4DVY P;  3B29 A;  3JSZ A;  2PBE A;  2FGY A;  2RD9 A;  2Y3G A;  3RVZ A;  4ULW A;  4MW3 A;  4A4A A;  4LLC A;  4JCH A;  1FMV A;  4YL3 A;  2R7T A;  1V54 C;  1CPQ A;  5A6B D;  2J46 A;  1VTM P;  4JRZ A;  1NSG B;  4MS2 A;  4MW8 A;  3RQE A;  4E7Z A;  1MND A;  3DJU B;  5A6A A;  1YA9 A;  2CDQ A;  5JP7 A;  4W8P A;  3NG1 A;  2AWC A;  2ZXO A;  1YYJ A;  2Q00 A;  5BQG A;  4EWC A;  5EGY A;  4U5E E;  5AGF A;  3A11 A;  1S05 A;  3EGX B;  4CS7 A;  5A6B A;  1FTS A;  1UG7 A;  4YL1 A;  3U3B A;  3PHF 2;  2AU5 A;  2HJ3 A;  4MND A;  4RD9 A;  1YYX A;  3ZIB A;  3ZWI A;  3BRJ A;  1ZW3 A;  3I5Q A;  2LP4 A;  4JJF A;  3KMI A;  5KYW B;  3WAQ A;  1Z63 A;  4KBL A;  1TFO B;  2X51 A;  4Q4Z F;  4G7O F;  1J8Y F;  2PX3 A;  4BEM J;  1CPR A;  1D0Y A;  2LK4 A;  4MTG A;  3U8P A;  3NMJ A;  3W8H A;  4AL1 A;  4PK4 A;  4E18 A;  2MWQ A;  4XPX A;  1A7E A;  3S9O A;  4MVU A;  2VAS A;  3QVZ A;  3JRM O;  1NBB A;  1D1A A;  1MMG A;  2Q9B A;  1HE9 A;  4K1O A;  3HKK A;  5CIV A;  3CZ6 A;  4N6C A;  3H2V A;  4JUR I;  3RQG A;  1A41 A;  4OIN F;  3L34 A;  3V5Y A;  5DVW A;  4N4W A;  4D4X A;  2P7V A;  2YEV A;  4I1O B;  5AC5 A;  5L0G A;  2XL6 A;  3K66 A;  4IAQ A;  2FFH A;  4M63 A;  4Z9I A;  4AE4 A;  2WVQ A;  1LE2 A;  2Q7R A;  3DKA A;  3G4X A;  1ZZP A;  4RDA A;  3K33 A;  1O5H A;  3ZSU A;  3B9Q A;  4IAR A;  1LI7 A;  1LS4 A;  1SF8 A;  4FAP B;  2VCB A;  1JR8 A;  3C8Z A;  2R05 A;  1ZHX A;  2G3V A;  3C8G A;  1K40 A;  2NUP B;  3EG9 A;  1SZI A;  3KKB A;  1ORJ A;  2EIN C;  3PMR A;  3NYM A;  5DQZ A;  2CNW D;  3GWL A;  3OA1 A;  2QUP A;  3X2Q C;  3VF0 A;  4YJW A;  3M4C A;  4X0R A;  5KYY A;  1KU2 A;  1FFH A;  1LM3 B;  1M57 C;  3E70 C;  2DGJ A;  3I4U A;  3HLZ A;  2DB4 A;  4J32 B;  1C02 A;  2EPM X;  2PFD A;  4NC3 A;  3U2L A;  4C3E A;  4DRJ B;  2O9X A;  4CS8 C;  4I3M A;  2QY9 A;  3T6J A;  3UR3 C;  2L6F A;  5L0H A;  1FMW A;  3ABK C;  4HFF B;  1BBH A;  3ASN C;  3A9C A;  3E9V A;  3DM5 A;  4HEA J;  2XSE A;  3G4Z A;  3DAG A;  3VYW A;  4PJL A;  3AG4 C;  2E87 A;  3LEV A;  3IQT A;  4G78 A;  1E85 A;  3GOR A;  1FAP B;  4MTO A;  1H9T A;  4H54 A;  2NUT A;  3LJB A;  2JPU A;  3AG1 C;  2C03 A;  2ICW G;  3POV A;  1U0B B;  5GPG B;  4B6I A;  4ONS A;  1UFB A;  2LQG A;  3ZQV A;  3U0C A;  4BJ5 C;  2H8A A;  3FOP A;  4CDY A;  2NPU A;  2Z15 A;  2KGO A;  1R4T A;  4JVS A;  5B1B C;  2P6V A;  3SZR A;  3V7O A;  4ANJ A;  2C04 A;  1YDI A;  2Y3B A;  1YVI A;  2OJQ A;  3T6B A;  2W4B A;  2H7V C;  1L7C A;  2IXP A;  1OCO C;  2XLO A;  3JYY A;  2J9V A;  3L1M A;  3L8J A;  1PD1 A;  1A7V A;  3DI5 A;  5COF A;  4BPM A;  2YKZ A;  4PJJ A;  3ZC4 A;  1MNE A;  3FAJ A;  3M4B A;  1PD0 A;  3EGD B;  3IPM O;  3RF3 A;  3W4Y A;  1IW7 F;  2CGE A;  1TWA A;  2KYH A;  3H65 A;  2YLG A;  3GEH A;  3IQ5 A;  3OWT A;  1EKY A;  2WZL A;  1TWC A;  1ORS C;  3SNH A;  2QTV A;  1KTM A;  2OEX A;  2LSE A;  1OR2 A;  3AQC A;  1L3P A;  2KSF A;  3UMI A;  1LPE A;  3FMS A;  2H7B A;  2YVK A;  1MMN A;  2PNO A;  4W8K A;  4U5B E;  3IEE A;  2HKV A;  1PCX A;  2KJG A;  5JUA A;  4XLP F;  3I5P A;  3SYN A;  5L0C A;  1WOL A;  3VRC A;  3SEO A;  3Q7L A;  3NKD A;  4KI2 A;  2J9U A;  3K1I C;  3UNG C;  1GM5 A;  2CNW A;  3ZTM A;  4AX2 A;  2Y39 A;  4XEK A;  3ZQY A;  3RFY A;  4PFO A;  2IXM A;  4JC7 A;  3C63 A;  1JMW A;  1M2V A;  4JTA B;  1NU9 C;  3EFO B;  4EKW A;  1APC A;  2MHR A;  4U9D A;  1Z23 A;  3W2W A;  3NRH A;  2MYS A;  2R7Q A;  1LS1 A;  2HV6 A;  4GEH A;  1T5O A;  4XPY A;  4G7H F;  2YL0 A;  3TOM A;  4QDL A;  2HMZ A;  3JSE O;  3IHU A;  2TMV P;  4O79 A;  1SMY F;  2Y3H A;  3G50 A;  1S7Z A;  1D1C A;  1DOV A;  1MMD A;  1WTY A;  2YQY A;  4N6H A;  3SXK A;  4YK5 A;  1D0Z A;  2ZXP A;  2QLA A;  2B0J A;  2NUP A;  3EG9 B;  3SXM A;  1C17 M;  3FOO A;  1QQ3 A;  1OCC C;  3TK0 A;  1AEP A;  2EIM C;  4U5C E;  4C7O A;  1QKR A;  1RKE A;  3KH2 A;  1Q0M A;  4P6I C;  3U9M A;  4IRU A;  1T9K A;  2A6H F;  4Q7C A;  5KYX A;  3FVY A;  1W2W A;  5A6K A;  5B1A C;  1WGW A;  4FWV A;  2HSB A;  4YT8 A;  4EBJ A;  1I4Z A;  4U9E A;  4BJT A;  3KYJ A;  3UMK A;  4CIP A;  5CI9 A;  4Z9H A;  4D4N A;  3EZH A;  3JCU Q;  1MQV A;  4CJO A;  1Q0F A;  3NKE A;  2EIK C;  2XLH A;  1WWP A;  1ZYR F;  3EHN A;  4RBN A;  4NTA A;  3U9J A;  2WVN A;  2ZXR A;  1QPU A;  3EH1 A;  1HW2 A;  2OQM A;  3GEI A;  2Q4F A;  2A0B A;  2A69 F;  3HTK C;  1O3U A;  2LIG A;  3Q6N A;  3QMK A;  4DRI B;  3RVY A;  1Z3I X;  4H4K C;  3LNR A;  1TWH A;  3DXJ F;  2NUT B;  2AVK A;  3ITF A;  4MTF A;  4O7G A;  2R7X A;  4WAB A;  5HSW A;  1VYK A;  3QW1 A;  2KK1 A;  2OEV A;  4EIY A;  5DS5 A;  3MLG A;  3M1C B;  5FCL A;  3S90 A;  4OIO F;  1HMD A;  2XLV A;  4K0D A;  2B0H A;  2P0N A;  3JTL O;  4WGZ A;  4XPW A;  4OIQ F;  3JRT A;  3DM9 B;  2CW0 F;  1G5Z A;  1U89 A;  1ZHY A;  2F22 A;  3AGU A;  3CEX A;  4DXW A;  1BR2 A;  1ST6 A;  5KYY B;  3UGP A;  2IOQ A;  2J0X A;  1OCZ C;  4NY3 A;  5JSL A;  1RXQ A;  5COG A;  2XLE A;  4C7O B;  2ZPA A;  4LDQ A;  4EBK A;  2EPL X;  3GEE A;  3C7J A;  2Q9A A;  3LNM B;  4BG0 A;  2WZF A;  1T6Q A;  1JOG A;  5F28 E;  256B A;  2L6H A;  1V4A A;  1Z7Q c;  2VCC A;  2HSQ A;  1VOM A;  1B68 A;  3DE8 A;  2ETS A;  1NU7 D;  3U8V A;  2XLW A;  3RW0 A;  3ECS A;  3ZDL A;  1OCR C;  2A68 F;  3RQF A;  1NG1 A;  3M15 A;  3UMH A;  1LI5 A;  2J9W A;  3F46 A;  4HFK B;  3WHN A;  4DVZ A;  4EUK B;  1OXK A;  1OKK A;  2WZG A;  3MYI A;  2A1D D;  4U5D E;  1OW6 A;  2DYS C;  4JJG A;  4XEF A;  2GDC A;  2GWW A;  3LS0 A;  4CDV A;  4R32 A;  2HUJ A;  5T3W A;  3QZC A;  3W2V A;  1RCP A;  1ZHT A;  4I44 A;  1Z5Z A;  3HNJ A;  1XZQ A;  3DZA A;  1BZ4 A;  3HNI A;  3LES A;  3J06 A;  4E17 A;  2HFI A;  5CI8 A;  2R02 A;  2RSE B;  3LUT B;  3W8I A;  2EPO A;  1A0B A;  1LIH A;  1MMA A;  4JTC B;  3PDM P;  3CAX A;  4JCZ A;  4L6R A;  2Q3T A;  1HMO A;  1RKC A;  1T6U A;  4I1M A;  1M2O A;  1NFN A;  2L6G A;  1ORY A;  4DJ9 A;  3B0V C;  1C03 A;  3US6 A;  2G3K A;  3DWW A;  5KYU B;  4JZA A;  2XXA A;  3GM3 A;  1HW1 A;  1CGM E;  2R7S A;  5T3T A;  4Q5S F;  3WOD F;  2Y69 C;  2OG2 A;  3KYI A;  2XRH A;  3K6B A;  2DI3 A;  3LS1 A;  3QVY A;  5E3A A;  4BEJ A;  2BC5 A;  3CQZ A;  3TD7 A;  3K1H A;  1M56 C;  3FHD A;  2XM0 A;  4J7T A;  4P9F A;  3B0U X;  2R25 A;  4E7S A;  1CGN A;  3AQB A;  5KYU A;  5TJ5 E;  3ZVR A;  4YWQ A;  5AC4 A;  2LD6 A;  2R7W A;  1E83 A;  4UDV A;  3V5Z A;  3SP1 A;  2A6E F;  2GFH A;  2YL7 A;  3DJN B;  2A0U A;  2NSF A;  3ABM C;  4PJN A;  1TR2 A;  2LCH A;  4O6N A;  1RKE B;  1JAF A;  4BJ6 A;  4BJ6 C;  5BQH A;  4XWJ A;  4MVO A;  2EIL C;  3AOU A;  1DOW A;  1R5I D;  3GOD A;  4JIO A;  3T4R A;  3MBG A;  2HV7 A;  4IGG A;  3ZTZ A;  4YT2 A;  5JLI A;  1FFT C;  1YAR O;  5L0J A;  2R7V A;  5L0I A;  3NMI A;  3NYJ A;  4YT5 A;  3IQC A;  4BJ1 A;  2R7R A;  2CYD A;  2YZS A;  5COM A;  4CSA A;  4JE9 A;  1D1B A;  3NYL A;  1QLE C;  1Y4C A;  2JD3 A;  2LFF A;  2VCA A;  2J0W A;  2XS1 A;  2P1A A;  2OKU A;  2XLD A;  4LDK A;  4MVZ A;  1VLS A;  2X0C A;  1YJG A;  1LE4 A;  4Z9J A;  2QE9 A;  3EQL F;  1WAT A;  3DMD A;  4LLE A;  1OXB A;  4WJ0 A;  4IJJ A;  4IB4 A;  2WB7 A;  1HE1 A;  1VB5 A;  2XLM A;  3K7D A;  2XL8 A;  4CS9 C;  2J7P D;  2D4U A;  1G4U S;  1BR1 A;  3KL4 A;  2XM4 A;  4ER9 A;  5E3C A;  4N06 A;  4DBR A;  1OQC A;  4CJG A;  4P9T A;  2VC9 A;  1E2X A;  3LLK A;  5EK0 A;  2ZXW C;  3IQ6 A;  4U5G A;  4NCQ A;  3TJ6 A;  3L0I A;  3T9O A;  3FXH A;  1SR2 A;  2R7U A;  2J7P A;  3PCV A;  3TJ5 A;  3LEO A;  5D92 A;  1HY5 A;  1M2V B;  5L3V A;  1I5N A;  1K04 A;  3HNL A;  4MQ9 F;  1YA7 O;  1O87 A;  1KNY A;  2HJM A;  1AUE A;  3DE9 A; 
#chains in the Genus database with same CATH homology
 2LP4 A;  3KYJ A;  3IQT A;  4G78 A;  1QSP A;  1OXB A;  1BDJ B;  4EUK B;  2LCH A;  1A0B A;  1Y6D A;  1TQG A;  2OOC A;  2Q4F A;  2A0B A;  1C03 A;  3US6 A;  3KYI A;  1C02 A;  3MYF A;  1SR2 A;  3U3B A;  1YVI A;  1WN0 A;  1FR0 A;  1OXK A;  1I5N A;  2R25 A;  4PAC A;  2LD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...