2LD6A

Solution structure of histidine phosphotransfer domain of chea
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
MMEEYLGVFVDETKEYLQNLNDTLLELEKNPEDMELINEAFRALHTLKGMAGTMGFSSMAKLCHTLENILDKARNSEIKITSDLLDKIFAGVDMITRMVDKIVSEGSDDIGENIDVFSDTIKSFASSGKEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheA
publication title The structure and dynamic properties of the complete histidine phosphotransfer domain of the chemotaxis specific histidine autokinase CheA from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 35
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2ld6A00
1TQGA 2A0BA 1OXBA 4G78A 3IQTA 1QSPA 3KYJA 1BDJB 2R25A 4PACA 1C02A 1I5NA 3U3BA 2LCHA 1YVIA 1Y6DA 4EUKB 1A0BA 1WN0A 2Q4FA 1OXKA 2LD6A 1C03A 3KYIA 3MYFA 1SR2A 2LP4A 3US6A 1FR0A 2OOCA
chains in the Genus database with same CATH superfamily
1TQGA 5FZTA 1A7DA 3O55A 3RH3A 3GORA 2H7OA 2R7OA 1R4TA 3DAGA 2CW0F 5E2QA 3KL4A 5GPGB 2L6HA 2GDCA 2HUJA 2HZ8A 1LI5A 2DYRC 2LFFA 3ZTMA 1OCRC 2R7TA 1HMOA 2MWQA 4Q7CA 5COFA 2Y3BA 4N4WA 1W2WA 3EPVA 2V26A 3ZIBA 4A4AA 2EIJC 3G4XA 3S9OA 2ZXOA 3EZIA 4EUKB 3JSZA 1YYJA 3DKAA 1BZ4A 1NU7D 4QDLA 2XLMA 3U2MA 1XWJA 4MQ9F 1C17M 3JYHA 2A1DD 3PCVA 4JCHA 4KNVA 3UMKA 2XLEA 2J9VA 4C7OB 1GQAA 3N24A 3X1OA 2HV6A 4G7OF 5CI8A 3B0VC 4O6NA 2YL0A 5COGA 4CX9A 1WTYA 3GEHA 4CS9C 3RKOF 4JTAB 2J9BA 1BR2A 4Z9JA 3U3FA 3MFNA 4PJNA 4ER9A 1CGME 2HKVA 3C62A 3LEVA 4K0DA 3T6JA 2IBFA 3FHDA 4MW8A 1YYXA 3OEOA 1OW8A 2H8AA 2P0NA 1AVOB 1Q0FA 1CGNA 1XZQA 3B29A 4ULVA 2LCHA 1VYKA 2W9YA 4DBRA 3UGPA 1VLSA 3O6XA 3VYWA 2EILC 4XLNF 4NCQA 3ZG1A 1EQ1A 4CSAC 4JURI 2WZGA 2M64A 4JEBA 3JRMO 3EG9A 2CYDA 4F4BA 2VCBA 4FWVA 5KYNA 4BG0A 5B1BC 2QLAA 2VCAA 3NKEA 4XEKA 1G4US 1FTSA 3N2ZB 1QVXA 5L0GA 2IXOA 3RW0A 4PR9A 3VM6A 2B0HA 3ASNC 4MVZA 2ZXPA 5JP7A 1TFOB 5K0IA 4XWJA 3ZC4A 4DRIB 1YARO 4IJJA 1K04A 2NUPB 2QTVA 4XTKA 3HLZA 3MYIA 1JAFA 2R7VA 4LDKA 4WGZA 2HSBA 1VLTA 4P9FA 3RVZA 2OEVA 1R5ID 2A6EF 3U3BA 3NYLA 4OINF 1Y4CA 2J9UA 2VB6A 2PFDA 3Q6MA 4OIRF 1ORYA 2X51A 3B71A 1D0ZA 2W4BA 2OG2A 5L0JA 1VK5A 2YHSA 1WGWA 4JW1A 5D91A 3BEHA 5KYYA 3EH1A 2JPUA 2KNHA 2KK1A 4U9DA 1H6GA 1BR1A 2YVKA 4LACB 2PBEA 2FFHA 1MNDA 1PD1A 3S29A 4AL0A 4CSAA 2HMQA 3EGDA 4JEAA 2EPOA 4IB4A 4CDVA 2UUIA 1FNTc 3H2UA 3C18A 3H65A 2R05A 1O87A 4YT5A 1T6UA 5L0IA 4U5BE 1OR3A 3LNRA 1FFHA 3EHMA 2QNLA 3KH2A 4ULWA 2HFIA 4J7YA 5DS5A 1YZCA 2E87A 3EGXA 1Z6AA 3UGOA 2Q9BA 2YL1A 2WVOA 3I5QA 1SYQA 3EH2A 3NRHA 4HFFB 2WZFA 3GEIA 5E3CA 1L7CA 1UFBA 2DGJA 2D5RB 4XEFA 5E33A 1YAUO 1LVKA 2YL7A 5AGFA 4NQFA 2X0CA 3T6BA 3EFOB 3VF0A 5T3WA 1N1CA 2J0XA 1MQVA 4EKWA 3ABLC 1RCPA 2L81A 3GANA 1Q0DA 3DJNB 3LEOA 4O79A 4ANJA 2NG1A 4MVMA 2R7RA 3B0UX 3QW0A 4EBKA 2OJED 3T9OA 4AX2A 2EPLX 4CDYA 2XXAA 4XPXA 2L6GA 4G0HA 4JIOA 2QY9A 2Y3DA 4E0HA 4U5FE 5HSWA 4ZLDA 2FAPB 4E0IA 2RD9A 1BDJB 2R03A 5KYXA 2D4UA 3ZDLA 1TWGA 2LIGA 3IPMO 2Y39A 3T6GB 5CI9A 3Q6NA 1ZU4A 4E17A 1NSGB 4LLEA 1RKEB 4JC7A 4X0RA 1OQCA 3HNKA 1M56C 2VH3A 2YLIA 4WABA 1E83A 1AUEA 1J8YF 3X2QC 4E7SA 3V5ZA 2R7SA 2IXPA 3DAFA 4AK9A 4C3BA 1WASA 2MYSA 3K1IA 1WWPA 1RJ9B 2O9XA 4FX5A 1H7IA 3TK0A 2LSEA 3M79A 3LS1A 1JOGA 3CQZA 1D1BA 4KNWA 5KYWB 4AE4B 2LP4A 2YLGA 3A11A 3Q7GA 4CS8A 5B3SC 2W45A 1RMVA 2YEVA 2GFHA 2A6HF 1A41A 3JSEO 3U0CA 4J30B 4YT2A 5JRAA 2GAQA 3CSKA 2R25A 4CIPA 3MLGA 4N6HA 2H7BA 1LIHA 4IARA 2YZSA 5F28E 1S7ZA 3LS0A 5KYYB 2J46A 4OIOF 5KYUB 4M63A 4LLCA 1MMNA 1V54C 4P6IC 4A2NB 1A7EA 4RDAA 4EIYA 4J32B 1Y6DA 1PV3A 4XLPF 4OIQF 1TWCA 3HTKC 4C7OA 5A6KA 1OCOC 4MVSA 2WVNA 2LQGA 1Z63A 2WVQA 2HS5A 2M4EA 2WL8A 3ZSUA 4QI0A 5JT4A 2OU6A 3L8IA 2OEXA 1Q0MA 2YQYA 3AG2C 3ZVRA 3LLIA 4YK5A 4YWQA 4KI2A 2ZD9A 3HNLA 3DWWA 4LDRA 1HMDA 1NFOA 2B0JA 5COMA 4O6MA 3AQBA 1ZHWA 2G3KA 1T01A 1VMAA 4AL1A 3ZQVA 2EPNA 3T4RA 3K66A 1TR2A 2F22A 3NMIA 4DRJB 2OKUA 2C03A 2R02A 3EZHA 4JKVA 4PK4A 1S05A 2XS1A 3GWLA 1GS9A 4MNDA 3U8PA 3W2VA 2UUHA 1HE9A 3IQ6A 1K40A 2EIKC 2PX0A 2YKZA 2BE5F 3I5PA 5EHHA 1T5OA 1C03A 2A68F 4NTFA 3M1CB 4WGYA 3DE9A 2J7PD 1NLXA 4XEVA 4EBBA 2RSEB 3NYMA 1U0BB 1M2VB 2R7UA 1JRAA 5BQGA 4C3EA 1G8XA 2AVKA 2NUPA 2XLWA 1NFNA 3NKDA 4IGGA 3TQOA 5L0CA 3UMHA 4BJ1A 3ZTZA 4K1OA 4JTCB 5DQZA 2VASA 3AG4C 3JT1A 4NTBA 3SEOA 3VRCA 5F5FA 2AP3A 4JZAA 5JSLA 1LPEA 2NUTB 3O10A 3U5SA 5AC5A 5AC4A 1CPQA 1DOWA 1OW6A 2XLDA 3H2VA 3OWTA 3C8GB 3JTLO 3CAXA 1XZPA 3DM9B 1ZYRF 3KYIA 2XLVA 2Q7RA 4OIPF 2ETSA 1TKNA 1T6IA 3DD7A 3FOOA 3K6BA 4PFOA 2R7XA 1WOLA 4G78A 4W8KA 1ZHTA 3FVYA 4W8PA 3TD7A 2CCYA 4D4NA 5DS4A 3S27A 1K05A 3DI5A 3FDQA 1QKRA 1IZMA 1HE1A 1FAPB 3QMKA 3UNGC 2LFDA 4JVSA 4U5EE 2ZXRA 2CNWA 1I5NA 1G4WR 1DOVA 1HY5A 3AGUA 3K1IC 3L0IA 3GEEA 1LKXA 3C8GD 3LNMB 5F5HA 4BEJA 4B6IA 2EPKX 5T1DB 3EFOA 2XL4A 1WN0A 4JE9A 3NMKA 3W4YA 2WZLA 4CS8C 5JVEA 2J8WA 3V5YA 1KTMA 3L34A 3MYFA 1F1MA 1V4AA 1D1AA 3CZ6A 3HNIA 4CJOA 3HJCA 3S0XA 1VTMP 4YL1A 1JR8A 3E70C 4HEAJ 2MHRA 1Q0GA 3IQTA 4U5HA 3RFYA 1E86A 1ZVZA 3WG7C 2P6VA 3F47A 1VB5A 1QZXA 2R9RB 5JUAA 2HJMA 3GM2A 4Q4ZF 4ONSA 5L0FA 3J06A 4BJ6C 2Y3GA 1RKEA 3FXHA 3GM3A 5E3AA 3SZRA 5A6BD 4U5CE 1ORSC 1MMAA 3HNJA 4MTFA 3F46A 1OKKD 2KQ9A 4I44A 4DOZA 1NU9C 4MW3A 3KKBA 3R2PA 4JJGA 4PJMA 3NMJA 4Z9IA 5FCLA 1I4YA 3JYYA 2DB4A 4JTDB 1RJ9A 1Z23A 4PJLA 3TOLA 3JRTA 4UDVA 5D92A 4YT8A 5KYWA 1QQ3A 2XSEA 4AE4A 5JLIA 4MVOA 3DMDA 4MTGA 2EIMC 3US6A 4D4XA 1FR0A 3W8HA 3VAYA 1OCZC 1YA7O 2G3VA 3U9JA 4BJ5A 4DVYP 2W4MA 3KMIA 5L0DA 5HV9A 4E7ZA 4NTAA 4PACA 1OR2A 1YA9A 3AG1C 2GA0A 2KGOA 2Q9CA 4KBLA 2QE9A 4DXWA 5DS6A 5L3VA 3UR3C 5KYUA 3TULA 1T6QA 1C02A 1D0YA 1ST6A 4PJJA 4EBJA 1G5ZA 3FAPB 3O39A 2XRHA 4MS2A 3ABMC 4YT4A 4JJFA 5BQHA 1ZHYA 2VCCA 4BJ6A 1LM3B 2VC9A 4EWCA 3IHUA 3CEXA 3AOUA 1D1CA 1CGOA 1SZIA 1QLEC 1ZW2A 2Q4FA 2Y3HA 3FOPA 1O5HA 3EJNA 1LS1A 1PCXA 3LJBA 4RD9A 3V7OA 4CS7A 2ICWG 1I4ZA 2DYSC 2EINC 1FMWA 3L1MA 4O6YA 4OD4A 1SR2A 3TJ6A 4I3MA 2IM8A 2IXNA 3K1HA 1M2OA 3RYLA 1YDIA 2AWYA 4GYTA 1OXBA 4CBEA 2J7PA 2YL3A 3AGTA 2ZPAA 2PP4A 1EI7A 3SXZA 3U8VA 4CJGA 4OD5A 1MMDA 4LDQA 2DI3A 1V55C 5CIVA 4U5DE 5A69A 3S90A 3ASOC 4CIHA 3GWNA 1O3UA 5BQIA 1TFKB 2GWWA 4H54A 4G7ZF 3JZ0A 4BPMA 3C7JA 1JMWA 1A0BA 1J8MF 4FESA 2L9JA 4I1OB 3LAYA 2KSFA 3PMRA 4IRUA 4R32A 2Q9AA 3QW1A 3G50A 4EHPA 3POVA 4L6RA 3PHF2 3LUTB 5A6AA 2Q3TA 2PX3A 5L3QA 3R7CA 5EGYA 2KC3A 3QZCA 1L3PA 1JPJA 4U9EA 1LE4A 1M2VA 2A0BA 2WB7A 3M4BA 3SYNA 5IY5C 1HW2A 2XLOA 3B9QA 2IOQA 3S28A 2IYLD 3EQLF 3KPHA 1YLMA 3C8ZA 1APCA 1YZAA 2P1AA 5TJ5E 3RQFA 1E84A 1ZW3A 3U9MA 2KW3C 2OJQA 4RBNA 3W2WA 4DVZA 4CDAA 2LK4A 4DBQA 4O7GA 2NUTA 3QVYA 3SNHA 3PDMP 1H9TA 2HMZA 3IEEA 1MMGA 3TJ5A 1TWAA 1UG7A 3MX3A 3C8GA 1NBBA 3EG9B 4MVRA 3GODA 1Z5ZA 1NG1A 2BL2A 3RQEA 1NZEA 4BEMJ 2J45A 2LD6A 2L7AA 1WATA 2NSGA 2Y69C 3DJUB 5A6JA 3AG3C 2L6FA 3G4ZA 1OW7A 1KU2A 3MBGA 1EKYA 2J0WA 3W8IA 2A69F 3SXKA 1QSPA 3C63A 2XL8A 3N0TA 2AWCA 2XL6A 4YL0A 3RQGA 1ZHZA 2HJ3A 1U6HA 3BRJA 4BJTA 3B0PA 4C3DA 4CS9A 3ECSA 4Z9HA 5JS5A 1MNEA 4FAPB 3ABKC 3AQCA 4Q5SF 1IW7F 2KYHA 3IQ5A 1LS4A 3M4CA 3RIPA 4G7HF 3WHNA 3SP1A 2XM4A 4MVUA 3HKKA 4XPYA 3FAJA 4HE8D 2ASRA 3M15A 2NSFA 3FMSA 5A6BA 4GEHA 1RXQA 1SF8A 1ZZPA 2HV7A 3NDBB 2V3CC 1AEPA 4YL3A 2I15A 2AU5A 1B68A 1OKKA 4MVQA 1YJGA 2JX0A 2BC5A 256BA 2H7VC 2XS8A 3U2LA 5T3TA 3UMIA 1GM5A 4MTOA 1HW1A 3A9CA 1ZU5A 2EPMX 2FGYA 2P61A 2XM0A 3I4UA 4BJ5C 3EGDB 4N06A 3QVZA 4I1MA 4YN0B 3QTHA 4JRZA 5DLJA 3JCUQ 4QI2A 1CPRA 2R7WA 5DVWA 2Z15A 3EHNA 1LI7A 3OA1A 2NPUA 3K33A 5BUOA 4IAOA 3K7DA 3NG1A 2G62A 2HSQA 2OQMA 4J7TA 3EGXB 1Q0KA 1SMYF 1TWHA 2CDQA 4E18A 3DM5A 3V5XA 4DRHB 2OCCC 1V74B 2YRFA 4N6CA 3WAQA 1QPUA 1T9KA 4PFPA 4IAQA 2JD3A 1YVIA 2IXMA 3NYJA 1KNYA 3WODF 5EK0A 3SXYA 1OXKA 1Z7Qc 4U5GA 1Z3IX 1PD0A 3SXMA 2QUPA 3S84A 2XXAB 1M57C 1LE2A 2I8BA 2PNOA 3Q7LA 5B3IA 1A7VA 1RKCA 4YJWA 5B1AC 1FFTC 2Q00A 3AJMA 2YLDA 3KYJA 3LESA 3RF3A 2YWAA 4H4KC 5KYXB 1OCCC 3RVYA 1E2XA 1ZHXA 1D0XA 2A0UA 2CNWD 2J9WA 1M6TA 1BR4A 1E85A 3IQCA 3LLKA 3ZWIA 4DJ9A 1FMVA 3ITFA 1H9GA 3ATPA 4LERA 4HFKB 5DQTA 3GM1A 3L8JA 4K7BA 2XLHA 1VYIA 2PF4E 5L0HA 1EA8A 4XQ1A 3DE8A 4KC9A 2TMVP 1VOMA 2R7QA 2P7VA 3DXJF 1JPNA 1ORJA 2ZXWC 4GQHA 4WJ0A 4XPWA 3TOMA 1BBHA 3DZAA 1U89A 4P9TA 2CGEA 1GGQA 2KJGA 3E9VA 4JCZA 4NY3A 4NC3A 4IWBA 3ZQYA 4ZLCA 2OOCA 2C04A
chains in the Genus database with same CATH topology
1TQGA 2A0BA 1OXBA 4G78A 3IQTA 1QSPA 3KYJA 1BDJB 2R25A 4PACA 1C02A 1I5NA 3U3BA 2LCHA 1YVIA 1Y6DA 4EUKB 1A0BA 1WN0A 2Q4FA 1OXKA 2LD6A 1C03A 3KYIA 3MYFA 1SR2A 2LP4A 3US6A 1FR0A 2OOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TQG A;  2A0B A;  1OXB A;  4G78 A;  3IQT A;  1QSP A;  3KYJ A;  1BDJ B;  2R25 A;  4PAC A;  1C02 A;  1I5N A;  3U3B A;  2LCH A;  1YVI A;  1Y6D A;  4EUK B;  1A0B A;  1WN0 A;  2Q4F A;  1OXK A;  2LD6 A;  1C03 A;  3KYI A;  3MYF A;  1SR2 A;  2LP4 A;  3US6 A;  1FR0 A;  2OOC A; 
#chains in the Genus database with same CATH topology
 1TQG A;  5FZT A;  1A7D A;  3O55 A;  3RH3 A;  3GOR A;  2H7O A;  2R7O A;  1R4T A;  3DAG A;  2CW0 F;  5E2Q A;  3KL4 A;  5GPG B;  2L6H A;  2GDC A;  2HUJ A;  2HZ8 A;  1LI5 A;  2DYR C;  2LFF A;  3ZTM A;  1OCR C;  2R7T A;  1HMO A;  2MWQ A;  4Q7C A;  5COF A;  2Y3B A;  4N4W A;  1W2W A;  3EPV A;  2V26 A;  3ZIB A;  4A4A A;  2EIJ C;  3G4X A;  3S9O A;  2ZXO A;  3EZI A;  4EUK B;  3JSZ A;  1YYJ A;  3DKA A;  1BZ4 A;  1NU7 D;  4QDL A;  2XLM A;  3U2M A;  1XWJ A;  4MQ9 F;  1C17 M;  3JYH A;  2A1D D;  3PCV A;  4JCH A;  4KNV A;  3UMK A;  2XLE A;  2J9V A;  4C7O B;  1GQA A;  3N24 A;  3X1O A;  2HV6 A;  4G7O F;  5CI8 A;  3B0V C;  4O6N A;  2YL0 A;  5COG A;  4CX9 A;  1WTY A;  3GEH A;  4CS9 C;  3RKO F;  4JTA B;  2J9B A;  1BR2 A;  4Z9J A;  3U3F A;  3MFN A;  4PJN A;  4ER9 A;  1CGM E;  2HKV A;  3C62 A;  3LEV A;  4K0D A;  3T6J A;  2IBF A;  3FHD A;  4MW8 A;  1YYX A;  3OEO A;  1OW8 A;  2H8A A;  2P0N A;  1AVO B;  1Q0F A;  1CGN A;  1XZQ A;  3B29 A;  4ULV A;  2LCH A;  1VYK A;  2W9Y A;  4DBR A;  3UGP A;  1VLS A;  3O6X A;  3VYW A;  2EIL C;  4XLN F;  4NCQ A;  3ZG1 A;  1EQ1 A;  4CSA C;  4JUR I;  2WZG A;  2M64 A;  4JEB A;  3JRM O;  3EG9 A;  2CYD A;  4F4B A;  2VCB A;  4FWV A;  5KYN A;  4BG0 A;  5B1B C;  2QLA A;  2VCA A;  3NKE A;  4XEK A;  1G4U S;  1FTS A;  3N2Z B;  1QVX A;  5L0G A;  2IXO A;  3RW0 A;  4PR9 A;  3VM6 A;  2B0H A;  3ASN C;  4MVZ A;  2ZXP A;  5JP7 A;  1TFO B;  5K0I A;  4XWJ A;  3ZC4 A;  4DRI B;  1YAR O;  4IJJ A;  1K04 A;  2NUP B;  2QTV A;  4XTK A;  3HLZ A;  3MYI A;  1JAF A;  2R7V A;  4LDK A;  4WGZ A;  2HSB A;  1VLT A;  4P9F A;  3RVZ A;  2OEV A;  1R5I D;  2A6E F;  3U3B A;  3NYL A;  4OIN F;  1Y4C A;  2J9U A;  2VB6 A;  2PFD A;  3Q6M A;  4OIR F;  1ORY A;  2X51 A;  3B71 A;  1D0Z A;  2W4B A;  2OG2 A;  5L0J A;  1VK5 A;  2YHS A;  1WGW A;  4JW1 A;  5D91 A;  3BEH A;  5KYY A;  3EH1 A;  2JPU A;  2KNH A;  2KK1 A;  4U9D A;  1H6G A;  1BR1 A;  2YVK A;  4LAC B;  2PBE A;  2FFH A;  1MND A;  1PD1 A;  3S29 A;  4AL0 A;  4CSA A;  2HMQ A;  3EGD A;  4JEA A;  2EPO A;  4IB4 A;  4CDV A;  2UUI A;  1FNT c;  3H2U A;  3C18 A;  3H65 A;  2R05 A;  1O87 A;  4YT5 A;  1T6U A;  5L0I A;  4U5B E;  1OR3 A;  3LNR A;  1FFH A;  3EHM A;  2QNL A;  3KH2 A;  4ULW A;  2HFI A;  4J7Y A;  5DS5 A;  1YZC A;  2E87 A;  3EGX A;  1Z6A A;  3UGO A;  2Q9B A;  2YL1 A;  2WVO A;  3I5Q A;  1SYQ A;  3EH2 A;  3NRH A;  4HFF B;  2WZF A;  3GEI A;  5E3C A;  1L7C A;  1UFB A;  2DGJ A;  2D5R B;  4XEF A;  5E33 A;  1YAU O;  1LVK A;  2YL7 A;  5AGF A;  4NQF A;  2X0C A;  3T6B A;  3EFO B;  3VF0 A;  5T3W A;  1N1C A;  2J0X A;  1MQV A;  4EKW A;  3ABL C;  1RCP A;  2L81 A;  3GAN A;  1Q0D A;  3DJN B;  3LEO A;  4O79 A;  4ANJ A;  2NG1 A;  4MVM A;  2R7R A;  3B0U X;  3QW0 A;  4EBK A;  2OJE D;  3T9O A;  4AX2 A;  2EPL X;  4CDY A;  2XXA A;  4XPX A;  2L6G A;  4G0H A;  4JIO A;  2QY9 A;  2Y3D A;  4E0H A;  4U5F E;  5HSW A;  4ZLD A;  2FAP B;  4E0I A;  2RD9 A;  1BDJ B;  2R03 A;  5KYX A;  2D4U A;  3ZDL A;  1TWG A;  2LIG A;  3IPM O;  2Y39 A;  3T6G B;  5CI9 A;  3Q6N A;  1ZU4 A;  4E17 A;  1NSG B;  4LLE A;  1RKE B;  4JC7 A;  4X0R A;  1OQC A;  3HNK A;  1M56 C;  2VH3 A;  2YLI A;  4WAB A;  1E83 A;  1AUE A;  1J8Y F;  3X2Q C;  4E7S A;  3V5Z A;  2R7S A;  2IXP A;  3DAF A;  4AK9 A;  4C3B A;  1WAS A;  2MYS A;  3K1I A;  1WWP A;  1RJ9 B;  2O9X A;  4FX5 A;  1H7I A;  3TK0 A;  2LSE A;  3M79 A;  3LS1 A;  1JOG A;  3CQZ A;  1D1B A;  4KNW A;  5KYW B;  4AE4 B;  2LP4 A;  2YLG A;  3A11 A;  3Q7G A;  4CS8 A;  5B3S C;  2W45 A;  1RMV A;  2YEV A;  2GFH A;  2A6H F;  1A41 A;  3JSE O;  3U0C A;  4J30 B;  4YT2 A;  5JRA A;  2GAQ A;  3CSK A;  2R25 A;  4CIP A;  3MLG A;  4N6H A;  2H7B A;  1LIH A;  4IAR A;  2YZS A;  5F28 E;  1S7Z A;  3LS0 A;  5KYY B;  2J46 A;  4OIO F;  5KYU B;  4M63 A;  4LLC A;  1MMN A;  1V54 C;  4P6I C;  4A2N B;  1A7E A;  4RDA A;  4EIY A;  4J32 B;  1Y6D A;  1PV3 A;  4XLP F;  4OIQ F;  1TWC A;  3HTK C;  4C7O A;  5A6K A;  1OCO C;  4MVS A;  2WVN A;  2LQG A;  1Z63 A;  2WVQ A;  2HS5 A;  2M4E A;  2WL8 A;  3ZSU A;  4QI0 A;  5JT4 A;  2OU6 A;  3L8I A;  2OEX A;  1Q0M A;  2YQY A;  3AG2 C;  3ZVR A;  3LLI A;  4YK5 A;  4YWQ A;  4KI2 A;  2ZD9 A;  3HNL A;  3DWW A;  4LDR A;  1HMD A;  1NFO A;  2B0J A;  5COM A;  4O6M A;  3AQB A;  1ZHW A;  2G3K A;  1T01 A;  1VMA A;  4AL1 A;  3ZQV A;  2EPN A;  3T4R A;  3K66 A;  1TR2 A;  2F22 A;  3NMI A;  4DRJ B;  2OKU A;  2C03 A;  2R02 A;  3EZH A;  4JKV A;  4PK4 A;  1S05 A;  2XS1 A;  3GWL A;  1GS9 A;  4MND A;  3U8P A;  3W2V A;  2UUH A;  1HE9 A;  3IQ6 A;  1K40 A;  2EIK C;  2PX0 A;  2YKZ A;  2BE5 F;  3I5P A;  5EHH A;  1T5O A;  1C03 A;  2A68 F;  4NTF A;  3M1C B;  4WGY A;  3DE9 A;  2J7P D;  1NLX A;  4XEV A;  4EBB A;  2RSE B;  3NYM A;  1U0B B;  1M2V B;  2R7U A;  1JRA A;  5BQG A;  4C3E A;  1G8X A;  2AVK A;  2NUP A;  2XLW A;  1NFN A;  3NKD A;  4IGG A;  3TQO A;  5L0C A;  3UMH A;  4BJ1 A;  3ZTZ A;  4K1O A;  4JTC B;  5DQZ A;  2VAS A;  3AG4 C;  3JT1 A;  4NTB A;  3SEO A;  3VRC A;  5F5F A;  2AP3 A;  4JZA A;  5JSL A;  1LPE A;  2NUT B;  3O10 A;  3U5S A;  5AC5 A;  5AC4 A;  1CPQ A;  1DOW A;  1OW6 A;  2XLD A;  3H2V A;  3OWT A;  3C8G B;  3JTL O;  3CAX A;  1XZP A;  3DM9 B;  1ZYR F;  3KYI A;  2XLV A;  2Q7R A;  4OIP F;  2ETS A;  1TKN A;  1T6I A;  3DD7 A;  3FOO A;  3K6B A;  4PFO A;  2R7X A;  1WOL A;  4G78 A;  4W8K A;  1ZHT A;  3FVY A;  4W8P A;  3TD7 A;  2CCY A;  4D4N A;  5DS4 A;  3S27 A;  1K05 A;  3DI5 A;  3FDQ A;  1QKR A;  1IZM A;  1HE1 A;  1FAP B;  3QMK A;  3UNG C;  2LFD A;  4JVS A;  4U5E E;  2ZXR A;  2CNW A;  1I5N A;  1G4W R;  1DOV A;  1HY5 A;  3AGU A;  3K1I C;  3L0I A;  3GEE A;  1LKX A;  3C8G D;  3LNM B;  5F5H A;  4BEJ A;  4B6I A;  2EPK X;  5T1D B;  3EFO A;  2XL4 A;  1WN0 A;  4JE9 A;  3NMK A;  3W4Y A;  2WZL A;  4CS8 C;  5JVE A;  2J8W A;  3V5Y A;  1KTM A;  3L34 A;  3MYF A;  1F1M A;  1V4A A;  1D1A A;  3CZ6 A;  3HNI A;  4CJO A;  3HJC A;  3S0X A;  1VTM P;  4YL1 A;  1JR8 A;  3E70 C;  4HEA J;  2MHR A;  1Q0G A;  3IQT A;  4U5H A;  3RFY A;  1E86 A;  1ZVZ A;  3WG7 C;  2P6V A;  3F47 A;  1VB5 A;  1QZX A;  2R9R B;  5JUA A;  2HJM A;  3GM2 A;  4Q4Z F;  4ONS A;  5L0F A;  3J06 A;  4BJ6 C;  2Y3G A;  1RKE A;  3FXH A;  3GM3 A;  5E3A A;  3SZR A;  5A6B D;  4U5C E;  1ORS C;  1MMA A;  3HNJ A;  4MTF A;  3F46 A;  1OKK D;  2KQ9 A;  4I44 A;  4DOZ A;  1NU9 C;  4MW3 A;  3KKB A;  3R2P A;  4JJG A;  4PJM A;  3NMJ A;  4Z9I A;  5FCL A;  1I4Y A;  3JYY A;  2DB4 A;  4JTD B;  1RJ9 A;  1Z23 A;  4PJL A;  3TOL A;  3JRT A;  4UDV A;  5D92 A;  4YT8 A;  5KYW A;  1QQ3 A;  2XSE A;  4AE4 A;  5JLI A;  4MVO A;  3DMD A;  4MTG A;  2EIM C;  3US6 A;  4D4X A;  1FR0 A;  3W8H A;  3VAY A;  1OCZ C;  1YA7 O;  2G3V A;  3U9J A;  4BJ5 A;  4DVY P;  2W4M A;  3KMI A;  5L0D A;  5HV9 A;  4E7Z A;  4NTA A;  4PAC A;  1OR2 A;  1YA9 A;  3AG1 C;  2GA0 A;  2KGO A;  2Q9C A;  4KBL A;  2QE9 A;  4DXW A;  5DS6 A;  5L3V A;  3UR3 C;  5KYU A;  3TUL A;  1T6Q A;  1C02 A;  1D0Y A;  1ST6 A;  4PJJ A;  4EBJ A;  1G5Z A;  3FAP B;  3O39 A;  2XRH A;  4MS2 A;  3ABM C;  4YT4 A;  4JJF A;  5BQH A;  1ZHY A;  2VCC A;  4BJ6 A;  1LM3 B;  2VC9 A;  4EWC A;  3IHU A;  3CEX A;  3AOU A;  1D1C A;  1CGO A;  1SZI A;  1QLE C;  1ZW2 A;  2Q4F A;  2Y3H A;  3FOP A;  1O5H A;  3EJN A;  1LS1 A;  1PCX A;  3LJB A;  4RD9 A;  3V7O A;  4CS7 A;  2ICW G;  1I4Z A;  2DYS C;  2EIN C;  1FMW A;  3L1M A;  4O6Y A;  4OD4 A;  1SR2 A;  3TJ6 A;  4I3M A;  2IM8 A;  2IXN A;  3K1H A;  1M2O A;  3RYL A;  1YDI A;  2AWY A;  4GYT A;  1OXB A;  4CBE A;  2J7P A;  2YL3 A;  3AGT A;  2ZPA A;  2PP4 A;  1EI7 A;  3SXZ A;  3U8V A;  4CJG A;  4OD5 A;  1MMD A;  4LDQ A;  2DI3 A;  1V55 C;  5CIV A;  4U5D E;  5A69 A;  3S90 A;  3ASO C;  4CIH A;  3GWN A;  1O3U A;  5BQI A;  1TFK B;  2GWW A;  4H54 A;  4G7Z F;  3JZ0 A;  4BPM A;  3C7J A;  1JMW A;  1A0B A;  1J8M F;  4FES A;  2L9J A;  4I1O B;  3LAY A;  2KSF A;  3PMR A;  4IRU A;  4R32 A;  2Q9A A;  3QW1 A;  3G50 A;  4EHP A;  3POV A;  4L6R A;  3PHF 2;  3LUT B;  5A6A A;  2Q3T A;  2PX3 A;  5L3Q A;  3R7C A;  5EGY A;  2KC3 A;  3QZC A;  1L3P A;  1JPJ A;  4U9E A;  1LE4 A;  1M2V A;  2A0B A;  2WB7 A;  3M4B A;  3SYN A;  5IY5 C;  1HW2 A;  2XLO A;  3B9Q A;  2IOQ A;  3S28 A;  2IYL D;  3EQL F;  3KPH A;  1YLM A;  3C8Z A;  1APC A;  1YZA A;  2P1A A;  5TJ5 E;  3RQF A;  1E84 A;  1ZW3 A;  3U9M A;  2KW3 C;  2OJQ A;  4RBN A;  3W2W A;  4DVZ A;  4CDA A;  2LK4 A;  4DBQ A;  4O7G A;  2NUT A;  3QVY A;  3SNH A;  3PDM P;  1H9T A;  2HMZ A;  3IEE A;  1MMG A;  3TJ5 A;  1TWA A;  1UG7 A;  3MX3 A;  3C8G A;  1NBB A;  3EG9 B;  4MVR A;  3GOD A;  1Z5Z A;  1NG1 A;  2BL2 A;  3RQE A;  1NZE A;  4BEM J;  2J45 A;  2LD6 A;  2L7A A;  1WAT A;  2NSG A;  2Y69 C;  3DJU B;  5A6J A;  3AG3 C;  2L6F A;  3G4Z A;  1OW7 A;  1KU2 A;  3MBG A;  1EKY A;  2J0W A;  3W8I A;  2A69 F;  3SXK A;  1QSP A;  3C63 A;  2XL8 A;  3N0T A;  2AWC A;  2XL6 A;  4YL0 A;  3RQG A;  1ZHZ A;  2HJ3 A;  1U6H A;  3BRJ A;  4BJT A;  3B0P A;  4C3D A;  4CS9 A;  3ECS A;  4Z9H A;  5JS5 A;  1MNE A;  4FAP B;  3ABK C;  3AQC A;  4Q5S F;  1IW7 F;  2KYH A;  3IQ5 A;  1LS4 A;  3M4C A;  3RIP A;  4G7H F;  3WHN A;  3SP1 A;  2XM4 A;  4MVU A;  3HKK A;  4XPY A;  3FAJ A;  4HE8 D;  2ASR A;  3M15 A;  2NSF A;  3FMS A;  5A6B A;  4GEH A;  1RXQ A;  1SF8 A;  1ZZP A;  2HV7 A;  3NDB B;  2V3C C;  1AEP A;  4YL3 A;  2I15 A;  2AU5 A;  1B68 A;  1OKK A;  4MVQ A;  1YJG A;  2JX0 A;  2BC5 A;  256B A;  2H7V C;  2XS8 A;  3U2L A;  5T3T A;  3UMI A;  1GM5 A;  4MTO A;  1HW1 A;  3A9C A;  1ZU5 A;  2EPM X;  2FGY A;  2P61 A;  2XM0 A;  3I4U A;  4BJ5 C;  3EGD B;  4N06 A;  3QVZ A;  4I1M A;  4YN0 B;  3QTH A;  4JRZ A;  5DLJ A;  3JCU Q;  4QI2 A;  1CPR A;  2R7W A;  5DVW A;  2Z15 A;  3EHN A;  1LI7 A;  3OA1 A;  2NPU A;  3K33 A;  5BUO A;  4IAO A;  3K7D A;  3NG1 A;  2G62 A;  2HSQ A;  2OQM A;  4J7T A;  3EGX B;  1Q0K A;  1SMY F;  1TWH A;  2CDQ A;  4E18 A;  3DM5 A;  3V5X A;  4DRH B;  2OCC C;  1V74 B;  2YRF A;  4N6C A;  3WAQ A;  1QPU A;  1T9K A;  4PFP A;  4IAQ A;  2JD3 A;  1YVI A;  2IXM A;  3NYJ A;  1KNY A;  3WOD F;  5EK0 A;  3SXY A;  1OXK A;  1Z7Q c;  4U5G A;  1Z3I X;  1PD0 A;  3SXM A;  2QUP A;  3S84 A;  2XXA B;  1M57 C;  1LE2 A;  2I8B A;  2PNO A;  3Q7L A;  5B3I A;  1A7V A;  1RKC A;  4YJW A;  5B1A C;  1FFT C;  2Q00 A;  3AJM A;  2YLD A;  3KYJ A;  3LES A;  3RF3 A;  2YWA A;  4H4K C;  5KYX B;  1OCC C;  3RVY A;  1E2X A;  1ZHX A;  1D0X A;  2A0U A;  2CNW D;  2J9W A;  1M6T A;  1BR4 A;  1E85 A;  3IQC A;  3LLK A;  3ZWI A;  4DJ9 A;  1FMV A;  3ITF A;  1H9G A;  3ATP A;  4LER A;  4HFK B;  5DQT A;  3GM1 A;  3L8J A;  4K7B A;  2XLH A;  1VYI A;  2PF4 E;  5L0H A;  1EA8 A;  4XQ1 A;  3DE8 A;  4KC9 A;  2TMV P;  1VOM A;  2R7Q A;  2P7V A;  3DXJ F;  1JPN A;  1ORJ A;  2ZXW C;  4GQH A;  4WJ0 A;  4XPW A;  3TOM A;  1BBH A;  3DZA A;  1U89 A;  4P9T A;  2CGE A;  1GGQ A;  2KJG A;  3E9V A;  4JCZ A;  4NY3 A;  4NC3 A;  4IWB A;  3ZQY A;  4ZLC A;  2OOC A;  2C04 A; 
#chains in the Genus database with same CATH homology
 1TQG A;  2A0B A;  1OXB A;  4G78 A;  3IQT A;  1QSP A;  3KYJ A;  1BDJ B;  2R25 A;  4PAC A;  1C02 A;  1I5N A;  3U3B A;  2LCH A;  1YVI A;  1Y6D A;  4EUK B;  1A0B A;  1WN0 A;  2Q4F A;  1OXK A;  2LD6 A;  1C03 A;  3KYI A;  3MYF A;  1SR2 A;  2LP4 A;  3US6 A;  1FR0 A;  2OOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...