2LD6A

Solution structure of histidine phosphotransfer domain of chea
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
b'MMEEYLGVFVDETKEYLQNLNDTLLELEKNPEDMELINEAFRALHTLKGMAGTMGFSSMAKLCHTLENILDKARNSEIKITSDLLDKIFAGVDMITRMVDKIVSEGSDDIGENIDVFSDTIKSFASSGKEKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheA
publication title The structure and dynamic properties of the complete histidine phosphotransfer domain of the chemotaxis specific histidine autokinase CheA from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 35
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2ld6A00
3U3BA 1BDJB 2A0BA 2Q4FA 1QSPA 1I5NA 1A0BA 1OXKA 1OXBA 4PACA 3KYIA 1SR2A 1Y6DA 2LD6A 2OOCA 1YVIA 3KYJA 4EUKB 2LCHA 1C02A 1FR0A 3IQTA 1WN0A 1TQGA 2LP4A 3US6A 1C03A 4G78A 3MYFA 2R25A
chains in the Genus database with same CATH superfamily
2Y39A 4CIHA 4GQHA 1Q0MA 1QKRA 4MVQA 4XQ1A 4Q5SF 4OIRF 5EHHA 4C7OB 4MW8A 1VMAA 3ATPA 1D0ZA 4DVZA 5KYWA 3FVYA 1AVOB 1A7EA 3GM1A 3Q6NA 4FX5A 1XZPA 4JRZA 3A11A 1A41A 3X1OA 3K1IC 3VF0A 1E83A 4JTCB 5T3WA 1VB5A 2MWQA 4PR9A 1IW7F 1XZQA 2J9UA 2J46A 1VOMA 4IB4A 5T3TA 2EPNA 3EH2A 3H2VA 2CNWD 5IY5C 1B68A 1N1CA 3W8IA 1WN0A 2Y3GA 4EBJA 1GM5A 2V26A 2LP4A 2PX0A 4JW1A 2W4BA 4A2NB 1LVKA 1S05A 4PJLA 4U5FE 1TWAA 4E7SA 1EQ1A 3K66A 1TFOB 4J30B 2KK1A 3NYJA 4YN0B 2KYHA 3RYLA 5A69A 2YL1A 3C62A 1OKKA 3EZHA 3W2WA 2GDCA 3DE9A 3OA1A 3PCVA 4FAPB 4XLNF 1H6GA 2HUJA 3L8JA 4DOZA 4IRUA 3NYMA 1G4US 3CQZA 1BBHA 3N24A 4XTKA 3VRCA 1Y6DA 3RQEA 4I1OB 1D1BA 3NDBB 1YYXA 1D0YA 4DBQA 4CDYA 5L3QA 1E2XA 2O9XA 2XSEA 3SXMA 4NTFA 2C04A 4EUKB 2XXAA 1TWGA 3C8GA 1APCA 3O55A 4JEAA 3TJ6A 2EPLX 3JYYA 2CDQA 3AG4C 4W8KA 1HMDA 3GANA 1OCZC 2J0XA 3R7CA 3U2LA 3U5SA 2B0JA 1I4YA 3TJ5A 1T01A 2ZXPA 3LS1A 5BUOA 2NUPA 2R25A 3ZC4A 1VLSA 1HE1A 3HNLA 5GPGB 4DJ9A 1OCOC 3ASOC 1VYIA 3S9OA 5JSLA 3S90A 2YZSA 3LEVA 4I3MA 2XLVA 4MVSA 3EFOB 4NTAA 2R7QA 4U9EA 2DGJA 4JJFA 3TOMA 4LERA 3AGUA 2OOCA 5E33A 2OJED 2ZXOA 2R7UA 3HKKA 4FWVA 2BE5F 1T6QA 2OKUA 3M1CB 1FTSA 1HE9A 4BJ1A 1V54C 2R7RA 1L7CA 5BQGA 5L0DA 3EGDA 3M79A 4LLCA 2LCHA 1YZAA 1QZXA 4WGZA 1IZMA 5JP7A 3RQGA 5JT4A 5KYYB 3B0UX 1FR0A 3FOPA 2Q7RA 5KYUB 2KJGA 2IYLD 2VH3A 4D4XA 4NC3A 3MYFA 1T9KA 5CI8A 1SF8A 1LM3B 2HJ3A 4MTFA 4ER9A 1YARO 1E84A 4AE4B 3F46A 4O7GA 3W8HA 3KPHA 3JTLO 4U5CE 1XWJA 2Q9CA 1WOLA 1A0BA 2Y3DA 1RKEB 3G4XA 3BRJA 4C3DA 3NMKA 3AGTA 4H54A 1TR2A 3HNIA 4JURI 3B71A 1YLMA 1TFKB 4AK9A 2IOQA 4ULWA 4CS7A 2EILC 3B0VC 3KKBA 1FAPB 2XL6A 1VK5A 2YVKA 3GWNA 1T6IA 4N6HA 4J7TA 1ST6A 4XPWA 1ZHZA 4EKWA 4GEHA 5L0GA 2R7OA 3AOUA 4W8PA 3GWLA 2QUPA 2DYRC 4AL0A 3SXZA 4IWBA 2CGEA 1M56C 3VYWA 5KYNA 1RJ9B 2R7VA 1PCXA 2IM8A 2XRHA 4CIPA 5JLIA 4CSAC 2P7VA 2YLGA 4E7ZA 3S29A 4J32B 2FGYA 3QW0A 4OIQF 3J06A 4CSAA 4N06A 3NRHA 2R7TA 5DQTA 1M57C 2GFHA 2J7PA 3TK0A 2VC9A 3QMKA 4JZAA 3EHMA 4EBBA 2EPMX 2LD6A 1BR1A 3ASNC 4MTGA 3US6A 1K04A 5T1DB 2HSQA 4KNVA 3MFNA 3JRTA 3B29A 2XL4A 4MW3A 2J9BA 4K0DA 1O3UA 2RD9A 3S84A 2P61A 1V74B 3L8IA 2KGOA 3RFYA 4XEKA 3IHUA 1T5OA 3NMIA 5E3AA 2Q9AA 3GORA 4U9DA 5F28E 4BJ5A 4CDVA 1BR4A 1LIHA 4H4KC 2L6GA 3UMHA 3DXJF 5A6BD 3K7DA 4D4NA 3DJNB 4YWQA 3IEEA 3U3BA 3T6JA 4K7BA 2IXNA 1YYJA 3M4CA 3EG9A 5KYXA 1K40A 2NSFA 1YZCA 2OCCC 4YT5A 1ZHYA 4CJOA 2J8WA 1BR2A 2X51A 2RSEB 4N6CA 2CCYA 2LIGA 3RW0A 3SNHA 4E17A 2LQGA 2OU6A 3FMSA 4DXWA 4RDAA 2G3KA 2XLOA 3KYJA 4BJ5C 1F1MA 4YT2A 1YA7O 2A68F 4PJNA 3AG2C 4Z9IA 3OWTA 1C02A 4U5BE 4M63A 2R02A 3AJMA 1D1AA 3R2PA 5DQZA 4BEMJ 2V3CC 2Y3BA 1SMYF 2BC5A 3LS0A 2J9WA 5L0CA 4U5EE 3MBGA 3MYIA 2ICWG 4R32A 2OEVA 5AGFA 256BA 3GEIA 3NYLA 1LKXA 4QDLA 3ZDLA 5KYXB 3PDMP 1VTMP 5KYWB 4ULVA 1DOWA 4ANJA 1LE2A 2HFIA 1A7DA 3T6BA 1I5NA 2UUHA 3ZTMA 4KNWA 3A9CA 3UNGC 1OW6A 1YDIA 4G7HF 3GEHA 4KC9A 3T4RA 2A6EF 1A7VA 3V5XA 3EGXA 2Q00A 1FNTc 1HW1A 1CGOA 5COMA 4ZLCA 3TD7A 1J8YF 3AQCA 5F5HA 3LNMB 3IQTA 4JCHA 3JT1A 1U89A 2XS8A 4XLPF 2GAQA 1TQGA 2QE9A 3JSZA 3OEOA 3W2VA 2MYSA 4EIYA 3PMRA 4LDRA 5F5FA 5E2QA 4DVYP 1R4TA 4I1MA 4J7YA 3WHNA 4NQFA 4UDVA 3NKDA 1MMNA 4OD4A 1ZYRF 2NUTA 1U6HA 4DBRA 1K05A 4C3BA 4E18A 2QTVA 5DVWA 2AP3A 1QSPA 3Q7GA 3UMKA 1NG1A 3G4ZA 3GM2A 3JRMO 4XEVA 2C03A 1JOGA 1D1CA 1DOVA 2Y3HA 2XXAB 3ECSA 3JYHA 3C8GB 3DD7A 1NU7D 2PX3A 3C18A 3CAXA 1LPEA 1YVIA 3T9OA 1TWCA 1ZHTA 3ABKC 2XLWA 5L0FA 1W2WA 1ZVZA 3HNJA 2YKZA 4P9TA 3M4BA 2YL3A 2E87A 1PD1A 4Z9HA 3W4YA 4YT8A 3JCUQ 2CNWA 2WZFA 5DS6A 1CGME 1KTMA 3H65A 2NUPB 2WZGA 4CBEA 1U0BB 5B1BC 3JZ0A 1YA9A 2HMQA 4O6NA 4BJ6A 3TULA 1O87A 2OEXA 1GQAA 1ZHWA 2HV7A 2XM0A 2FAPB 2QNLA 4HEAJ 2NSGA 2ZXWC 5JVEA 2Q4FA 1NLXA 4PFPA 3S27A 1ORJA 3I4UA 2VCAA 3QTHA 1SYQA 2VASA 1Z5ZA 2HMZA 3DMDA 3SEOA 3EGDB 4F4BA 3H2UA 4QI0A 1PD0A 2EIMC 3IQCA 3IPMO 1RCPA 5A6JA 2W4MA 1EKYA 2P1AA 4JEBA 3FHDA 2AWCA 3N0TA 4N4WA 4BJ6C 3WG7C 5BQHA 2FFHA 3G50A 1JMWA 1WWPA 1NBBA 3V7OA 1LI7A 2LK4A 2XLMA 2OJQA 1NFOA 4JIOA 4LDKA 4RBNA 2XM4A 2HKVA 1RXQA 3K33A 2G62A 4O6YA 5COFA 1WTYA 3LLIA 3NMJA 2CYDA 5BQIA 3ZTZA 2WVQA 3NG1A 1OR3A 4G78A 4G7OF 4GYTA 2Z15A 4JE9A 4CDAA 1OW7A 1M2VA 2A6HF 2ETSA 2GWWA 3CSKA 3SXYA 1JR8A 5FZTA 4IAOA 3AQBA 4QI2A 2A0UA 3L0IA 3C8ZA 3WODF 2D5RB 4XPYA 1OXKA 4HFFB 5EGYA 4JVSA 3SZRA 4L6RA 3ZVRA 4A4AA 2OG2A 3EPVA 1NZEA 1ZW3A 2KSFA 4AL1A 1WASA 3F47A 2L6FA 1G4WR 4WABA 2AWYA 1QPUA 4O6MA 3U2MA 3DE8A 2PP4A 3LJBA 2GA0A 4MVUA 3QVZA 3FAPB 3RF3A 2BL2A 4PJMA 1Z7Qc 3UGPA 3ZQYA 3E9VA 4JCZA 1LS1A 2B0HA 1ORSC 5JUAA 1VYKA 4YJWA 5FCLA 1KNYA 4OIOF 2Q9BA 1M6TA 1QLEC 1BZ4A 3RQFA 3WAQA 2H7VC 4MS2A 1V4AA 2HZ8A 3EQLF 5HV9A 1OKKD 1MNDA 1D0XA 1OCCC 3KMIA 2R7XA 2LFDA 4OD5A 3ITFA 4YT4A 4U5HA 2A69F 3M15A 3Q6MA 3S0XA 2L9JA 2PBEA 4WGYA 3L1MA 4WJ0A 3V5ZA 1NSGB 3EZIA 4OIPF 2I8BA 1EA8A 3QW1A 4C7OA 1MMDA 3JSEO 1MMGA 3DZAA 2YEVA 2WB7A 2P6VA 1L3PA 5D92A 4JKVA 1MMAA 4FESA 4HE8D 3DM9B 3C8GD 4I44A 3CZ6A 2EPKX 3AG3C 2JD3A 4JTAB 4YL3A 3TQOA 5CIVA 3C63A 4Q4ZF 3DKAA 4MVRA 3O10A 4EWCA 3L34A 3O6XA 1LS4A 1KU2A 3Q7LA 1TWHA 2A1DD 2YLIA 3EG9B 4NTBA 3RVYA 3MX3A 2XL8A 2DYSC 5DLJA 1C17M 3UR3C 5B1AC 1FFHA 4LLEA 1M2OA 1J8MF 3K6BA 2AU5A 1ZZPA 4IGGA 5K0IA 1JPNA 1RKCA 2DI3A 2W45A 3AG1C 1QVXA 1YAUO 3PHF2 1OXBA 4PACA 1FMVA 3SP1A 3U8PA 5L0HA 2P0NA 2WVOA 2LSEA 4BPMA 1LE4A 2VCCA 3QZCA 3SXKA 5DS4A 1E85A 2ZD9A 3GODA 2Y69C 3VM6A 4C3EA 3DAGA 2AVKA 3RKOF 2MHRA 2HJMA 3RIPA 3U0CA 4JC7A 3UGOA 3DAFA 1Q0GA 3BEHA 2KC3A 4G0HA 3MLGA 1LI5A 1ORYA 3ABMC 4Z9JA 1ZU4A 1I4ZA 2YL7A 3X2QC 5A6BA 2UUIA 2DB4A 2IBFA 4DRHB 2IXMA 3VAYA 1H7IA 1HW2A 2WZLA 2VB6A 1BDJB 2W9YA 1Z6AA 3EGXB 3B9QA 2L81A 2YRFA 1O5HA 2PF4E 3HTKC 3U9JA 4CS9A 2M4EA 4PFOA 3IQ6A 4NY3A 1Q0FA 3C7JA 2R9RB 4MTOA 3EFOA 1FFTC 2HSBA 3KH2A 2EIKC 4KBLA 4P6IC 1G8XA 4U5DE 3RVZA 2EIJC 4MQ9F 2ASRA 5L3VA 2NUTB 2HV6A 1OCRC 2ZXRA 2JX0A 4XPXA 5B3IA 2R7WA 1V55C 3U3FA 1S7ZA 4NCQA 3LUTB 1JAFA 5KYYA 1Z63A 3HJCA 1Z3IX 1CPQA 5KYUA 4KI2A 4YK5A 4CS9C 3ZWIA 1Y4CA 1HMOA 2J0WA 3GM3A 2TMVP 4G7ZF 2OQMA 2A0BA 2XLEA 2IXPA 2JPUA 3N2ZB 3SYNA 4ZLDA 4Q7CA 2J7PD 2J9VA 2PFDA 3TOLA 1GGQA 2R05A 1R5ID 3O39A 4AE4A 4BG0A 2EPOA 3ZSUA 2X0CA 1UFBA 3FOOA 3I5PA 2YL0A 2KW3C 2VCBA 2YLDA 1RKEA 3U8VA 4EBKA 3DJUB 2LFFA 5HSWA 2M64A 3HLZA 4EHPA 4DRJB 3LESA 4JTDB 1Q0KA 1GS9A 4MVOA 2ZPAA 3GEEA 2J45A 2WL8A 2R03A 2QY9A 1G5ZA 2H8AA 4IARA 3RH3A 2KQ9A 4CS8A 2L6HA 3ABLC 1UG7A 4U5GA 4CX9A 1YJGA 2D4UA 3LLKA 1RMVA 3FAJA 2CW0F 4PK4A 4K1OA 2PNOA 1EI7A 1RJ9A 1WATA 3B0PA 4YL1A 5L0IA 5DS5A 4LACB 4E0IA 1MNEA 5CI9A 2YQYA 2F22A 4MVZA 4PJJA 1E86A 3POVA 3DM5A 1AUEA 1JRAA 1FMWA 1VLTA 2I15A 1ZW2A 4IAQA 3ZIBA 1NFNA 1QQ3A 4X0RA 1ZHXA 4O79A 3K1HA 4CS8C 3CEXA 1H9GA 4HFKB 5JRAA 2XLDA 4CJGA 2WVNA 1M2VB 2H7OA 4DRIB 3EH1A 5COGA 3NKEA 2IXOA 3LAYA 1CPRA 2G3VA 3KL4A 4JJGA 3FDQA 3EHNA 1PV3A 4MNDA 1AEPA 1Q0DA 1ZU5A 2H7BA 2L7AA 4P9FA 4RD9A 3UMIA 4BEJA 5AC5A 5A6AA 2XS1A 3FXHA 2QLAA 3DWWA 4LDQA 1Z23A 3U9MA 5AC4A 5JS5A 4B6IA 1WGWA 3EJNA 4IJJA 5D91A 1OR2A 5TJ5E 2KNHA 4XEFA 3DI5A 1JPJA 4AX2A 4XWJA 4BJTA 3T6GB 3LEOA 1TKNA 4OINF 1SZIA 1MQVA 2Q3TA 1SR2A 3KYIA 4E0HA 1CGNA 2EINC 1NU9C 1T6UA 2YWAA 2HS5A 3S28A 3ZQVA 2YHSA 3V5YA 3LNRA 5EK0A 5B3SC 2R7SA 3QVYA 4ONSA 3I5QA 5E3CA 3ZG1A 2NPUA 5L0JA 1H9TA 1HY5A 3K1IA 3HNKA 1OW8A 4YL0A 1C03A 1OQCA 3IQ5A 5A6KA 2NG1A 4MVMA 3E70C 2XLHA
chains in the Genus database with same CATH topology
3U3BA 1BDJB 2A0BA 2Q4FA 1QSPA 1I5NA 1A0BA 1OXKA 1OXBA 4PACA 3KYIA 1SR2A 1Y6DA 2LD6A 2OOCA 1YVIA 3KYJA 4EUKB 2LCHA 1C02A 1FR0A 3IQTA 1WN0A 1TQGA 2LP4A 3US6A 1C03A 4G78A 3MYFA 2R25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3B A;  1BDJ B;  2A0B A;  2Q4F A;  1QSP A;  1I5N A;  1A0B A;  1OXK A;  1OXB A;  4PAC A;  3KYI A;  1SR2 A;  1Y6D A;  2LD6 A;  2OOC A;  1YVI A;  3KYJ A;  4EUK B;  2LCH A;  1C02 A;  1FR0 A;  3IQT A;  1WN0 A;  1TQG A;  2LP4 A;  3US6 A;  1C03 A;  4G78 A;  3MYF A;  2R25 A; 
#chains in the Genus database with same CATH topology
 2Y39 A;  4CIH A;  4GQH A;  1Q0M A;  1QKR A;  4MVQ A;  4XQ1 A;  4Q5S F;  4OIR F;  5EHH A;  4C7O B;  4MW8 A;  1VMA A;  3ATP A;  1D0Z A;  4DVZ A;  5KYW A;  3FVY A;  1AVO B;  1A7E A;  3GM1 A;  3Q6N A;  4FX5 A;  1XZP A;  4JRZ A;  3A11 A;  1A41 A;  3X1O A;  3K1I C;  3VF0 A;  1E83 A;  4JTC B;  5T3W A;  1VB5 A;  2MWQ A;  4PR9 A;  1IW7 F;  1XZQ A;  2J9U A;  2J46 A;  1VOM A;  4IB4 A;  5T3T A;  2EPN A;  3EH2 A;  3H2V A;  2CNW D;  5IY5 C;  1B68 A;  1N1C A;  3W8I A;  1WN0 A;  2Y3G A;  4EBJ A;  1GM5 A;  2V26 A;  2LP4 A;  2PX0 A;  4JW1 A;  2W4B A;  4A2N B;  1LVK A;  1S05 A;  4PJL A;  4U5F E;  1TWA A;  4E7S A;  1EQ1 A;  3K66 A;  1TFO B;  4J30 B;  2KK1 A;  3NYJ A;  4YN0 B;  2KYH A;  3RYL A;  5A69 A;  2YL1 A;  3C62 A;  1OKK A;  3EZH A;  3W2W A;  2GDC A;  3DE9 A;  3OA1 A;  3PCV A;  4FAP B;  4XLN F;  1H6G A;  2HUJ A;  3L8J A;  4DOZ A;  4IRU A;  3NYM A;  1G4U S;  3CQZ A;  1BBH A;  3N24 A;  4XTK A;  3VRC A;  1Y6D A;  3RQE A;  4I1O B;  1D1B A;  3NDB B;  1YYX A;  1D0Y A;  4DBQ A;  4CDY A;  5L3Q A;  1E2X A;  2O9X A;  2XSE A;  3SXM A;  4NTF A;  2C04 A;  4EUK B;  2XXA A;  1TWG A;  3C8G A;  1APC A;  3O55 A;  4JEA A;  3TJ6 A;  2EPL X;  3JYY A;  2CDQ A;  3AG4 C;  4W8K A;  1HMD A;  3GAN A;  1OCZ C;  2J0X A;  3R7C A;  3U2L A;  3U5S A;  2B0J A;  1I4Y A;  3TJ5 A;  1T01 A;  2ZXP A;  3LS1 A;  5BUO A;  2NUP A;  2R25 A;  3ZC4 A;  1VLS A;  1HE1 A;  3HNL A;  5GPG B;  4DJ9 A;  1OCO C;  3ASO C;  1VYI A;  3S9O A;  5JSL A;  3S90 A;  2YZS A;  3LEV A;  4I3M A;  2XLV A;  4MVS A;  3EFO B;  4NTA A;  2R7Q A;  4U9E A;  2DGJ A;  4JJF A;  3TOM A;  4LER A;  3AGU A;  2OOC A;  5E33 A;  2OJE D;  2ZXO A;  2R7U A;  3HKK A;  4FWV A;  2BE5 F;  1T6Q A;  2OKU A;  3M1C B;  1FTS A;  1HE9 A;  4BJ1 A;  1V54 C;  2R7R A;  1L7C A;  5BQG A;  5L0D A;  3EGD A;  3M79 A;  4LLC A;  2LCH A;  1YZA A;  1QZX A;  4WGZ A;  1IZM A;  5JP7 A;  3RQG A;  5JT4 A;  5KYY B;  3B0U X;  1FR0 A;  3FOP A;  2Q7R A;  5KYU B;  2KJG A;  2IYL D;  2VH3 A;  4D4X A;  4NC3 A;  3MYF A;  1T9K A;  5CI8 A;  1SF8 A;  1LM3 B;  2HJ3 A;  4MTF A;  4ER9 A;  1YAR O;  1E84 A;  4AE4 B;  3F46 A;  4O7G A;  3W8H A;  3KPH A;  3JTL O;  4U5C E;  1XWJ A;  2Q9C A;  1WOL A;  1A0B A;  2Y3D A;  1RKE B;  3G4X A;  3BRJ A;  4C3D A;  3NMK A;  3AGT A;  4H54 A;  1TR2 A;  3HNI A;  4JUR I;  3B71 A;  1YLM A;  1TFK B;  4AK9 A;  2IOQ A;  4ULW A;  4CS7 A;  2EIL C;  3B0V C;  3KKB A;  1FAP B;  2XL6 A;  1VK5 A;  2YVK A;  3GWN A;  1T6I A;  4N6H A;  4J7T A;  1ST6 A;  4XPW A;  1ZHZ A;  4EKW A;  4GEH A;  5L0G A;  2R7O A;  3AOU A;  4W8P A;  3GWL A;  2QUP A;  2DYR C;  4AL0 A;  3SXZ A;  4IWB A;  2CGE A;  1M56 C;  3VYW A;  5KYN A;  1RJ9 B;  2R7V A;  1PCX A;  2IM8 A;  2XRH A;  4CIP A;  5JLI A;  4CSA C;  2P7V A;  2YLG A;  4E7Z A;  3S29 A;  4J32 B;  2FGY A;  3QW0 A;  4OIQ F;  3J06 A;  4CSA A;  4N06 A;  3NRH A;  2R7T A;  5DQT A;  1M57 C;  2GFH A;  2J7P A;  3TK0 A;  2VC9 A;  3QMK A;  4JZA A;  3EHM A;  4EBB A;  2EPM X;  2LD6 A;  1BR1 A;  3ASN C;  4MTG A;  3US6 A;  1K04 A;  5T1D B;  2HSQ A;  4KNV A;  3MFN A;  3JRT A;  3B29 A;  2XL4 A;  4MW3 A;  2J9B A;  4K0D A;  1O3U A;  2RD9 A;  3S84 A;  2P61 A;  1V74 B;  3L8I A;  2KGO A;  3RFY A;  4XEK A;  3IHU A;  1T5O A;  3NMI A;  5E3A A;  2Q9A A;  3GOR A;  4U9D A;  5F28 E;  4BJ5 A;  4CDV A;  1BR4 A;  1LIH A;  4H4K C;  2L6G A;  3UMH A;  3DXJ F;  5A6B D;  3K7D A;  4D4N A;  3DJN B;  4YWQ A;  3IEE A;  3U3B A;  3T6J A;  4K7B A;  2IXN A;  1YYJ A;  3M4C A;  3EG9 A;  5KYX A;  1K40 A;  2NSF A;  1YZC A;  2OCC C;  4YT5 A;  1ZHY A;  4CJO A;  2J8W A;  1BR2 A;  2X51 A;  2RSE B;  4N6C A;  2CCY A;  2LIG A;  3RW0 A;  3SNH A;  4E17 A;  2LQG A;  2OU6 A;  3FMS A;  4DXW A;  4RDA A;  2G3K A;  2XLO A;  3KYJ A;  4BJ5 C;  1F1M A;  4YT2 A;  1YA7 O;  2A68 F;  4PJN A;  3AG2 C;  4Z9I A;  3OWT A;  1C02 A;  4U5B E;  4M63 A;  2R02 A;  3AJM A;  1D1A A;  3R2P A;  5DQZ A;  4BEM J;  2V3C C;  2Y3B A;  1SMY F;  2BC5 A;  3LS0 A;  2J9W A;  5L0C A;  4U5E E;  3MBG A;  3MYI A;  2ICW G;  4R32 A;  2OEV A;  5AGF A;  256B A;  3GEI A;  3NYL A;  1LKX A;  4QDL A;  3ZDL A;  5KYX B;  3PDM P;  1VTM P;  5KYW B;  4ULV A;  1DOW A;  4ANJ A;  1LE2 A;  2HFI A;  1A7D A;  3T6B A;  1I5N A;  2UUH A;  3ZTM A;  4KNW A;  3A9C A;  3UNG C;  1OW6 A;  1YDI A;  4G7H F;  3GEH A;  4KC9 A;  3T4R A;  2A6E F;  1A7V A;  3V5X A;  3EGX A;  2Q00 A;  1FNT c;  1HW1 A;  1CGO A;  5COM A;  4ZLC A;  3TD7 A;  1J8Y F;  3AQC A;  5F5H A;  3LNM B;  3IQT A;  4JCH A;  3JT1 A;  1U89 A;  2XS8 A;  4XLP F;  2GAQ A;  1TQG A;  2QE9 A;  3JSZ A;  3OEO A;  3W2V A;  2MYS A;  4EIY A;  3PMR A;  4LDR A;  5F5F A;  5E2Q A;  4DVY P;  1R4T A;  4I1M A;  4J7Y A;  3WHN A;  4NQF A;  4UDV A;  3NKD A;  1MMN A;  4OD4 A;  1ZYR F;  2NUT A;  1U6H A;  4DBR A;  1K05 A;  4C3B A;  4E18 A;  2QTV A;  5DVW A;  2AP3 A;  1QSP A;  3Q7G A;  3UMK A;  1NG1 A;  3G4Z A;  3GM2 A;  3JRM O;  4XEV A;  2C03 A;  1JOG A;  1D1C A;  1DOV A;  2Y3H A;  2XXA B;  3ECS A;  3JYH A;  3C8G B;  3DD7 A;  1NU7 D;  2PX3 A;  3C18 A;  3CAX A;  1LPE A;  1YVI A;  3T9O A;  1TWC A;  1ZHT A;  3ABK C;  2XLW A;  5L0F A;  1W2W A;  1ZVZ A;  3HNJ A;  2YKZ A;  4P9T A;  3M4B A;  2YL3 A;  2E87 A;  1PD1 A;  4Z9H A;  3W4Y A;  4YT8 A;  3JCU Q;  2CNW A;  2WZF A;  5DS6 A;  1CGM E;  1KTM A;  3H65 A;  2NUP B;  2WZG A;  4CBE A;  1U0B B;  5B1B C;  3JZ0 A;  1YA9 A;  2HMQ A;  4O6N A;  4BJ6 A;  3TUL A;  1O87 A;  2OEX A;  1GQA A;  1ZHW A;  2HV7 A;  2XM0 A;  2FAP B;  2QNL A;  4HEA J;  2NSG A;  2ZXW C;  5JVE A;  2Q4F A;  1NLX A;  4PFP A;  3S27 A;  1ORJ A;  3I4U A;  2VCA A;  3QTH A;  1SYQ A;  2VAS A;  1Z5Z A;  2HMZ A;  3DMD A;  3SEO A;  3EGD B;  4F4B A;  3H2U A;  4QI0 A;  1PD0 A;  2EIM C;  3IQC A;  3IPM O;  1RCP A;  5A6J A;  2W4M A;  1EKY A;  2P1A A;  4JEB A;  3FHD A;  2AWC A;  3N0T A;  4N4W A;  4BJ6 C;  3WG7 C;  5BQH A;  2FFH A;  3G50 A;  1JMW A;  1WWP A;  1NBB A;  3V7O A;  1LI7 A;  2LK4 A;  2XLM A;  2OJQ A;  1NFO A;  4JIO A;  4LDK A;  4RBN A;  2XM4 A;  2HKV A;  1RXQ A;  3K33 A;  2G62 A;  4O6Y A;  5COF A;  1WTY A;  3LLI A;  3NMJ A;  2CYD A;  5BQI A;  3ZTZ A;  2WVQ A;  3NG1 A;  1OR3 A;  4G78 A;  4G7O F;  4GYT A;  2Z15 A;  4JE9 A;  4CDA A;  1OW7 A;  1M2V A;  2A6H F;  2ETS A;  2GWW A;  3CSK A;  3SXY A;  1JR8 A;  5FZT A;  4IAO A;  3AQB A;  4QI2 A;  2A0U A;  3L0I A;  3C8Z A;  3WOD F;  2D5R B;  4XPY A;  1OXK A;  4HFF B;  5EGY A;  4JVS A;  3SZR A;  4L6R A;  3ZVR A;  4A4A A;  2OG2 A;  3EPV A;  1NZE A;  1ZW3 A;  2KSF A;  4AL1 A;  1WAS A;  3F47 A;  2L6F A;  1G4W R;  4WAB A;  2AWY A;  1QPU A;  4O6M A;  3U2M A;  3DE8 A;  2PP4 A;  3LJB A;  2GA0 A;  4MVU A;  3QVZ A;  3FAP B;  3RF3 A;  2BL2 A;  4PJM A;  1Z7Q c;  3UGP A;  3ZQY A;  3E9V A;  4JCZ A;  1LS1 A;  2B0H A;  1ORS C;  5JUA A;  1VYK A;  4YJW A;  5FCL A;  1KNY A;  4OIO F;  2Q9B A;  1M6T A;  1QLE C;  1BZ4 A;  3RQF A;  3WAQ A;  2H7V C;  4MS2 A;  1V4A A;  2HZ8 A;  3EQL F;  5HV9 A;  1OKK D;  1MND A;  1D0X A;  1OCC C;  3KMI A;  2R7X A;  2LFD A;  4OD5 A;  3ITF A;  4YT4 A;  4U5H A;  2A69 F;  3M15 A;  3Q6M A;  3S0X A;  2L9J A;  2PBE A;  4WGY A;  3L1M A;  4WJ0 A;  3V5Z A;  1NSG B;  3EZI A;  4OIP F;  2I8B A;  1EA8 A;  3QW1 A;  4C7O A;  1MMD A;  3JSE O;  1MMG A;  3DZA A;  2YEV A;  2WB7 A;  2P6V A;  1L3P A;  5D92 A;  4JKV A;  1MMA A;  4FES A;  4HE8 D;  3DM9 B;  3C8G D;  4I44 A;  3CZ6 A;  2EPK X;  3AG3 C;  2JD3 A;  4JTA B;  4YL3 A;  3TQO A;  5CIV A;  3C63 A;  4Q4Z F;  3DKA A;  4MVR A;  3O10 A;  4EWC A;  3L34 A;  3O6X A;  1LS4 A;  1KU2 A;  3Q7L A;  1TWH A;  2A1D D;  2YLI A;  3EG9 B;  4NTB A;  3RVY A;  3MX3 A;  2XL8 A;  2DYS C;  5DLJ A;  1C17 M;  3UR3 C;  5B1A C;  1FFH A;  4LLE A;  1M2O A;  1J8M F;  3K6B A;  2AU5 A;  1ZZP A;  4IGG A;  5K0I A;  1JPN A;  1RKC A;  2DI3 A;  2W45 A;  3AG1 C;  1QVX A;  1YAU O;  3PHF 2;  1OXB A;  4PAC A;  1FMV A;  3SP1 A;  3U8P A;  5L0H A;  2P0N A;  2WVO A;  2LSE A;  4BPM A;  1LE4 A;  2VCC A;  3QZC A;  3SXK A;  5DS4 A;  1E85 A;  2ZD9 A;  3GOD A;  2Y69 C;  3VM6 A;  4C3E A;  3DAG A;  2AVK A;  3RKO F;  2MHR A;  2HJM A;  3RIP A;  3U0C A;  4JC7 A;  3UGO A;  3DAF A;  1Q0G A;  3BEH A;  2KC3 A;  4G0H A;  3MLG A;  1LI5 A;  1ORY A;  3ABM C;  4Z9J A;  1ZU4 A;  1I4Z A;  2YL7 A;  3X2Q C;  5A6B A;  2UUI A;  2DB4 A;  2IBF A;  4DRH B;  2IXM A;  3VAY A;  1H7I A;  1HW2 A;  2WZL A;  2VB6 A;  1BDJ B;  2W9Y A;  1Z6A A;  3EGX B;  3B9Q A;  2L81 A;  2YRF A;  1O5H A;  2PF4 E;  3HTK C;  3U9J A;  4CS9 A;  2M4E A;  4PFO A;  3IQ6 A;  4NY3 A;  1Q0F A;  3C7J A;  2R9R B;  4MTO A;  3EFO A;  1FFT C;  2HSB A;  3KH2 A;  2EIK C;  4KBL A;  4P6I C;  1G8X A;  4U5D E;  3RVZ A;  2EIJ C;  4MQ9 F;  2ASR A;  5L3V A;  2NUT B;  2HV6 A;  1OCR C;  2ZXR A;  2JX0 A;  4XPX A;  5B3I A;  2R7W A;  1V55 C;  3U3F A;  1S7Z A;  4NCQ A;  3LUT B;  1JAF A;  5KYY A;  1Z63 A;  3HJC A;  1Z3I X;  1CPQ A;  5KYU A;  4KI2 A;  4YK5 A;  4CS9 C;  3ZWI A;  1Y4C A;  1HMO A;  2J0W A;  3GM3 A;  2TMV P;  4G7Z F;  2OQM A;  2A0B A;  2XLE A;  2IXP A;  2JPU A;  3N2Z B;  3SYN A;  4ZLD A;  4Q7C A;  2J7P D;  2J9V A;  2PFD A;  3TOL A;  1GGQ A;  2R05 A;  1R5I D;  3O39 A;  4AE4 A;  4BG0 A;  2EPO A;  3ZSU A;  2X0C A;  1UFB A;  3FOO A;  3I5P A;  2YL0 A;  2KW3 C;  2VCB A;  2YLD A;  1RKE A;  3U8V A;  4EBK A;  3DJU B;  2LFF A;  5HSW A;  2M64 A;  3HLZ A;  4EHP A;  4DRJ B;  3LES A;  4JTD B;  1Q0K A;  1GS9 A;  4MVO A;  2ZPA A;  3GEE A;  2J45 A;  2WL8 A;  2R03 A;  2QY9 A;  1G5Z A;  2H8A A;  4IAR A;  3RH3 A;  2KQ9 A;  4CS8 A;  2L6H A;  3ABL C;  1UG7 A;  4U5G A;  4CX9 A;  1YJG A;  2D4U A;  3LLK A;  1RMV A;  3FAJ A;  2CW0 F;  4PK4 A;  4K1O A;  2PNO A;  1EI7 A;  1RJ9 A;  1WAT A;  3B0P A;  4YL1 A;  5L0I A;  5DS5 A;  4LAC B;  4E0I A;  1MNE A;  5CI9 A;  2YQY A;  2F22 A;  4MVZ A;  4PJJ A;  1E86 A;  3POV A;  3DM5 A;  1AUE A;  1JRA A;  1FMW A;  1VLT A;  2I15 A;  1ZW2 A;  4IAQ A;  3ZIB A;  1NFN A;  1QQ3 A;  4X0R A;  1ZHX A;  4O79 A;  3K1H A;  4CS8 C;  3CEX A;  1H9G A;  4HFK B;  5JRA A;  2XLD A;  4CJG A;  2WVN A;  1M2V B;  2H7O A;  4DRI B;  3EH1 A;  5COG A;  3NKE A;  2IXO A;  3LAY A;  1CPR A;  2G3V A;  3KL4 A;  4JJG A;  3FDQ A;  3EHN A;  1PV3 A;  4MND A;  1AEP A;  1Q0D A;  1ZU5 A;  2H7B A;  2L7A A;  4P9F A;  4RD9 A;  3UMI A;  4BEJ A;  5AC5 A;  5A6A A;  2XS1 A;  3FXH A;  2QLA A;  3DWW A;  4LDQ A;  1Z23 A;  3U9M A;  5AC4 A;  5JS5 A;  4B6I A;  1WGW A;  3EJN A;  4IJJ A;  5D91 A;  1OR2 A;  5TJ5 E;  2KNH A;  4XEF A;  3DI5 A;  1JPJ A;  4AX2 A;  4XWJ A;  4BJT A;  3T6G B;  3LEO A;  1TKN A;  4OIN F;  1SZI A;  1MQV A;  2Q3T A;  1SR2 A;  3KYI A;  4E0H A;  1CGN A;  2EIN C;  1NU9 C;  1T6U A;  2YWA A;  2HS5 A;  3S28 A;  3ZQV A;  2YHS A;  3V5Y A;  3LNR A;  5EK0 A;  5B3S C;  2R7S A;  3QVY A;  4ONS A;  3I5Q A;  5E3C A;  3ZG1 A;  2NPU A;  5L0J A;  1H9T A;  1HY5 A;  3K1I A;  3HNK A;  1OW8 A;  4YL0 A;  1C03 A;  1OQC A;  3IQ5 A;  5A6K A;  2NG1 A;  4MVM A;  3E70 C;  2XLH A; 
#chains in the Genus database with same CATH homology
 3U3B A;  1BDJ B;  2A0B A;  2Q4F A;  1QSP A;  1I5N A;  1A0B A;  1OXK A;  1OXB A;  4PAC A;  3KYI A;  1SR2 A;  1Y6D A;  2LD6 A;  2OOC A;  1YVI A;  3KYJ A;  4EUK B;  2LCH A;  1C02 A;  1FR0 A;  3IQT A;  1WN0 A;  1TQG A;  2LP4 A;  3US6 A;  1C03 A;  4G78 A;  3MYF A;  2R25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...