2LDIA

Nmr solution structure of ziaan sub mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
b'PLKTQQMQVGGMRCAACASSIERALERLKGVAEASVTVATGRLTVTYDPKQVSEITIQERIAALGYTLAEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc-transporting ATPase
publication title Cyanobacterial metallochaperone inhibits deleterious side reactions of copper.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Hydrolase
total genus 12
structure length 71
sequence length 71
ec nomenclature ec 7.2.2.12: P-type Zn(2+) transporter.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ldiA00
3BM7A 2N4CA 1OQ3A 2AJ1A 3UDCA 4Y2KA 5B0AA 1Y9OA 2HIQA 1Q4RA 1S6UA 3DCAA 3HX9A 5B0GA 3HHLD 3TRGA 3BF4A 1N5SA 1KVIA 4A46A 2K7JA 2G9OA 3HF5A 2AW0A 5A6PA 1V3ZA 4EFAC 2K7KA 2LQ9A 4A48A 3K7RA 2LQBA 2XMTA 3DXSX 2OD4A 3KKFA 3KNGA 4ZOSA 2GV1A 4Y2MA 2QLWA 2QIFA 2XMVA 4HI1A 3WDOA 4YEAA 2QYCA 5B0DA 4OJ3A 5A6WA 1AW0A 3HFKA 1MWZA 2HLUA 1FEEA 2GGPA 2QLXA 2GFFA 1TUVA 1KQKA 1Q53A 2W4CA 2KKHA 3MZIA 5B0EA 2XMWA 2GGPB 1TZ0A 2N7YA 3TOQA 4DPOA 1OQ6A 3IWXA 1YG0A 2ZDPA 5B0FA 2AJ0A 4OJ1A 4OJHA 1N5VA 1TR0A 1MWYA 3FMBA 3QGPA 2HQIA 1FESA 4HH1A 1X0PA 3IWLA 3LO3A 3KG1A 3HHLC 3LGMA 1JWWA 5B08A 2PGCA 2OFGX 3BN7A 1S6OA 2GCFA 1Q8LA 2ASYA 2GA7A 2HFNA 1P8GA 1YJVA 2BUNA 4FNIA 3E8OA 1X8DA 2GO8A 2K1RB 3T9NA 1FVQA 2ACYA 3FGVA 3QMQA 1YJRA 2HLTA 5K9FA 2CRLA 2ZDOA 1ULRA 1SI9A 4F67A 2PD1A 5B09A 2HFOA 4U9RA 5IXUA 1TL5A 1Y3JA 2K2PA 2L3MA 2W4PA 3MCSA 1GXUA 2OKQA 1IUJA 2FTRA 1SB6A 2BBEA 1VQYA 2RMLA 2EW9A 2OAUA 2OD6A 2RU9A 4Q2MA 5KAKA 3FRYA 2XMJA 1YJUA 2RILA 2Q3PA 1YJTA 1Q8BA 4OJGA 5B0BA 1QUPA 1FVSA 1OSDA 4QOTA 1GXTA 2K1RA 1JK9B 5T7LA 1AFIA 2KYZA 4OIXA 3BB5A 5B0CA 2XMKA 2ROPA 1K0VA 1VQSA 2RSQA 3LGNA 1P6TA 2KT2A 5T7LB 2IYIA 4FNHA 2N4DA 2BYCA 1Y3KA 4HH0A 3HDSA 2AP6A 2W4DA 3I9ZA 1U7LA 4ZA1A 1OPZA 4NPOA 2ROGA 2XMUA 3TNVA 2VV5A 2BJEA 2IYGA 2LXFA 1N5TA 2OP5A 3HHLB 4HI2A 2FHMA 2FIUA 1FD8A 2JDJA 1URRA 3KG0A 3F44A 2XMMA 4Q2LA 2IFXA 2BJDA 2VH7A 4Y2IA 3CJKA 1R6YA 3BGUA 1SQEA 1TL4A 2OMOA 1CC7A 2OFHX 4YDXA 4DL0C 1AFJA 1YRXA 1FE4A 3BDEA 3BR8A 3CJKB 2ROEA 1APSA 2FB0A 3GZ7A 1FE0A 1RJJA 1LQ9A 1Y0HA 1CPZA 1X7VA 1N5QA 2KT3A 4A47A 4A4JA 3VTIA 4DN9A 4NL5A 1W2IA 1WD6A 4HL9A 5F0WA 1KVJA 1XBWA 3HHLA 5F0UA 1CC8A 2LDIA
chains in the Genus database with same CATH superfamily
2P8IA 4O44B 2GC8A 1KVIA 1KTVA 2C2NA 5LT5A 4AQYF 4F0HA 3NAHA 3IAM9 1JLFA 3PX4A 4IQXA 5DQHA 1UPMB 4WPAA 6FDRA 3FMBA 1NO8A 4FYXB 4G65A 2Q1LA 2AEMA 4RBTA 1Q79A 3CCUS 1R0CB 4JBCA 4TU8A 3MPDA 3BSAA 1N6QB 4ZCKA 4G1QA 2ZDOA 3T5LA 3LH2S 1BXNA 3OFGA 2LQ5A 5M2UA 5DM7Q 3FRYA 4V19X 3PJ9A 2MJNA 4DV3J 2FC8A 1SKUB 2COLA 3FUYA 3JSMA 4WJBA 5D0RA 1F60B 4IG0A 4L3NA 4LF4F 3FRZA 4O3OA 2KN4A 3QSIA 2NREA 4WCEQ 3G96A 2DRAA 2WRMA 1HIYA 3TEHB 2BE7D 3EYZA 4OHYA 2E66A 4CRJA 3NKYA 2JEIA 3OFFA 1HWKA 2J0WA 5LJ3Y 2QEXS 1M1GA 2JRSA 5A2QY 2QSWA 1UPPA 4FN5A 3W63A 3UFCX 1H2TZ 4AD6A 3GWCA 4IG3A 5LSRA 3WX4A 1RHKB 4IOAQ 1WHVA 5EX3A 2XMVA 2EBGA 2ZEJA 1MW7A 3O2IA 4D3GA 2MQNA 3J81j 3FSIA 3OFHA 4DR6F 2KXFA 2XBPA 5KT4A 1C2PA 2G0JA 4LF9F 2HNZA 2QA4G 4KIAA 2XCPA 1VQ5S 1J5OA 3UPFA 2HZVA 3S01A 1C4CA 2GMLA 1YDLA 3ET6B 2BACA 5T7LA 4OZ3A 2UVUA 3OTEA 3M6WA 4QIGA 2UXBJ 3WIVA 3M1VA 2XMUA 2RDIA 5K20B 4N47A 2BJ3A 2CWXA 4OQJA 4PG5A 1VJWA 4NYOA 4QWAA 2CQIA 3W9IA 2E1AA 1NJWA 2AJQA 5B0AA 1KLMB 5IC6B 2JSXA 1HNZF 2XCAA 2EFQA 2XTJP 2NXNA 1RK8A 4C0HA 3QGGA 1DZ5A 4LRDA 2YWFA 4A8XA 4N5SA 2LP4A 3ULHA 5J1PA 2ZH4A 1T8EA 2MZ1A 4OFZA 1TKZA 3ZC4A 2GVDB 4MT1A 5I3UA 3T9NA 3NNAA 1NKBA 2QMXA 4DR5J 1HNXF 3OTDA 3IR6B 5DO2A 4FDFA 1FXDA 1LOUA 2A18A 2V9KA 3MFHA 3PO5A 1FJ7A 4C2MA 3SDEB 5D4PA 3IR5B 1T7PA 2JL9A 2WSEC 3AT1B 4K4WA 1OWXA 2BJEA 4HI2A 4ELTA 3BH7B 3MMCA 2ZH2A 3R3TA 4DL0C 2VA2A 4FXVA 2PEHA 4WK1A 1LFWA 3NGRA 3A8IA 3FCWA 3PTWA 4M95A 1N0UA 2HVEA 2V69A 4LF4J 4RW7A 3GFZA 3GFXA 4USTA 2V8DA 2MZQA 1IQZA 5H9FJ 2WVCA 2V34A 2CYYA 3DFEA 2DIUA 5I42B 3TAMA 2W9AA 2D3UA 3MUVP 2JH3A 4RNHA 4R5PB 1YG0A 1RWWB 2E5JA 3CCWA 1PG5B 4WU3A 4XK8C 3JSYA 2EEYA 1SQFA 3QSYB 1NHUA 3QT6A 1LV5A 2C3UA 1RWNB 2HURA 2XG8A 3FGVA 4DJBA 5JVHQ 4O4RA 3KUHA 4RU9A 4PKDB 5DG9A 3MCSA 2WVBA 2J9DE 3OHAA 3MMBA 1S6PB 5F8MA 1XIQA 2ZNZA 2NS1B 4O3RA 1BY9A 4Q43A 4DPTA 1UJ5A 2KZZA 1M1HA 1UVNA 2N82B 4LF9J 2EPIA 1HQUA 3D68A 3G82B 1F2GA 1Q1KA 4DEZA 2VQEF 2C2OB 2VG7A 1M5OC 3DOLA 1WEXA 1VS3A 2VC1A 4NRUA 1JX4A 1WC6A 1F5CA 1SJFA 1ZA1B 3RU0A 4HT7A 3MR3A 1Q8KA 2CWKA 2R7QA 4KPCA 4LQ9A 3WDOA 1VBKA 1V6HA 4J9MA 1KOHA 3T41A 5KFAA 2R2UA 4DX8H 2VZ9A 4F2SA 3K89A 1N0VC 2CPJA 1G6BA 4NLRA 2H5JB 4CO5A 3MUMP 1UWAA 1HNZJ 2BKNA 3JQMA 3VZHA 3FBBA 3QMQA 3OW2R 5ETLA 1SQGA 1HBMA 2RRAA 1IXKA 4PWUA 3DDNA 1A9NB 1VI7A 1W26A 4PQAA 2LFVA 2RQ4A 2DVIA 1S1VB 3IWNC 1XR7A 3M9OB 5F3TA 1JIHA 1EIYB 3M2RB 4ZITA 2AGQA 1HNXJ 1K1SA 3PFEA 1JB0C 3D6MB 3KK1A 1AFJA 5E33A 1ROFA 2J9DA 1X7VA 3WBZA 5KFVA 4QW9A 2DHSA 4CLPA 1VQNS 1IM4A 4DR2F 5KFCA 1YJNS 4UOCA 1RHUB 2J7WA 1FWKA 4JI0F 3M32A 1VQ4S 3W2VA 1ZM9A 2UV8G 2ZH1A 1NCLA 2E44A 2VHGA 1LW2B 4HH1A 1N88A 3H2UB 2Y1RI 4C11B 4I2PA 1XERA 3MECA 1I6JA 4DI6A 2DNYA 1JLEB 1WHXA 2GZOA 3BGLA 4CYUA 4WIIA 2WZ1A 4MKBA 4YR0A 1VC0A 2R7TA 1HWIA 1T0TV 3EJMA 4JI1J 1ZBTA 5KFXA 3W8PA 1R27B 2IDLA 4U7UK 1VQLS 1RTJA 3BYPA 1OSDA 3Q23A 1FD2A 2EC0A 2CADA 4CQ1A 4I6WA 3U1LA 5E3QA 1TUGB 5KFYA 5HK4A 1NH8A 4RW6B 3EGVA 4CO0A 3M30A 1DRZA 4JI4F 3HMJG 3HT0A 5AE3A 5IZHA 1GAOA 4M63A 2VFSA 2IJRA 4LFAF 4ER8A 2DEIA 3CCVS 2U2FA 1ELOA 1JMTA 2WBRA 2RKIA 4J7CA 3KFWX 2BJ9A 2DNHA 2VQEJ 2HGNA 1WF0A 3T1AA 5CYMA 4TLRA 5HANA 3MAQA 2EWHA 2DB1A 3HKWA 2KXHA 3NCRA 1U2CA 3QJLA 1QVFR 2NLWA 1HQEA 2VBXA 1NPPA 2QE5A 4NLQA 3OPKA 5M2RA 2DNZA 4GC7A 1DTTA 1MN9A 3NMAA 4KR0B 1EAYC 1TKXA 2BJ8A 2WK4A 3T6JA 1RADB 2GQ2A 3FEZA 1QSYA 4WXOA 3PEJA 2JC0A 1FDDA 4YOEA 2NSCA 5A8KB 4DQSA 1EZZB 1TL3B 4YB1P 3FEXB 3CJKB 4NRTA 4YB5A 2EFNA 4Q7AA 4XDDA 3VTIA 1NDCA 1WWHA 3BS9A 2ILYA 4ZLLA 4O3QA 2HRUA 3DRRB 4C8NA 1K8AT 4HDGA 1KRPA 1RT2A 1NDLA 1F9FA 3VGVA 3DXSX 4P2SA 1WNEA 3RRHA 2QJ3A 4DR4F 2I5JA 1K0TA 1FEEA 3DDIA 2XC9A 3AQPA 2E7WA 5KFBA 1N8RT 2AGPA 4OZ5A 1SUQA 4F8RA 2BJ1A 2J0QD 3LGMA 3UN2A 3G6VA 1X9SA 1JQGA 2QMWA 4DR2J 2NZ4A 5C5JA 3MAAA 3W66A 3FBFA 3MCNA 4ZHRB 2A10A 2FGCA 8AT1B 1IBKF 2HNDA 2ALZA 1KEKA 2E7XA 3THTA 1JLGA 4F4XA 3IBWA 4ID5A 1X4FA 5F8IA 2W2NP 3PRDA 2XZTB 2BOAA 1T03A 2HEKA 2EFVA 4N76A 2BJDA 3M8YA 3I87A 2OUGA 1SQEA 3I0RB 3RRKA 3O8WA 1EB0A 1FHTA 3V4MA 2QX0A 1R0AB 4KH1B 2WOMA 1C1CA 4IKAA 2ASLA 5J2NB 2CFXA 4DR1F 3TYTA 5E3CA 1URNA 3PR5B 3DOKB 2BQ3A 1TTHB 1NK5A 3SCKE 2XWYA 4QYZJ 3QRQA 1OJ4A 1TP7A 1XN9A 2AZ3A 4CLKA 4PAAA 4JI4J 3Q2TC 5AE1A 2DR7A 4LRAA 2DO4A 3QWUA 4ZK7M 3DOMA 5KT7A 2ZZMA 2CQBA 1WSVA 1T9YA 2HFVA 4Q44A 1S1WA 3UQSA 5L39A 3BGFA 4ETXA 1VYAA 3G4SS 3LW5C 4I6AA 1RE1B 1CJTB 4FP9A 2HMIB 3HXMA 1JXLA 2ATCB 2ZH6A 4LSLB 5HLFB 4OV6A 2U1AA 4Y34A 2KYZA 4NXNJ 4JI3J 1H2VZ 4CTAA 2OEKA 4TVAB 3K59A 1BQMA 3RRGA 3CCZA 2RE1A 3R7SB 2W01A 1FRLA 1U25A 4MJKA 1OY9A 2FZCB 3M8PA 4I6YA 4TQSA 3GCWP 2R7WA 2FPHX 4F3MA 3GU0A 5A8RB 4GKKF 2ZH5A 2YKMB 2ZH3A 3HVRA 2IIHA 4ZLNA 1CJVB 1K73T 2VA3A 1TFYA 1NU4A 3GIMA 3OL8A 4JP8A 2KZMA 3W5YA 5KFOA 5GMKa 2M52A 1QAIA 4PCQA 1QE1A 1U26A 2QLXA 2ZJQQ 3LP2A 3U7JA 3VAFA 2FJDB 2FJAB 5ETOA 2FZGB 4DFKA 5RUBA 4QZVB 3HHLC 2V0NA 5C42B 4X4QA 2AYEA 4RW9B 2RHQB 1AZSA 4FXDA 4QYRA 1YJRA 4DR4J 2ZD1A 1WSRA 1VRTB 3CIZA 2F8MA 4BLGA 1I94F 1PILA 1Q8IA 4WP8A 5HBMB 1U45A 2OPPA 3CJTA 3JS9A 1CQMA 3DRPB 5HROB 4K4SA 3E3XA 4BC7A 4K0KF 1VR6A 2RDJA 4Y0FA 1ZYQA 4KQZA 2BRKA 1IBKJ 4TXSA 2J9CA 5KT3A 1RAAB 5D77A 3LQVA 1U8SA 5E0OA 3CMES 1L3UA 3P6YC 1UVJA 4NZ6A 2M9KA 4USWA 1MWQA 2K7JA 4TY8A 3H42A 4RWWA 2W9BA 4E2FB 4NLXA 2GGPA 3CCTA 4C0OC 3M8QA 1NK9A 4DR1J 3CCSS 4NLGA 1IKXA 3BKFA 3CC7S 4L6V3 1T94A 1GX6A 1U1MA 2OH2A 3TR5A 2MKHA 2H5IB 4DL3A 3DLKB 5IC4B 2OAUA 2DGVA 1DTQA 4C3MA 2X1AA 2CAJA 4HHJA 4URSA 4N8NA 1ZTWA 5LM7E 3TVYA 4ZPVR 5IT9U 3JQJA 1L3SA 4JV2A 3AXMA 4AL5A 4EWTA 5F41A 3Q8VA 4NE9C 3H59A 4C4WA 2ZHOA 2DEJA 2IVMA 4NCBA 4ALZA 4OZ0A 2N7CA 3FCHA 1Q7LB 1SPBP 3NGUA 1M5KC 1EX8A 3RBEA 1KDNA 5HVFA 4Q8FA 1ZOTA 3BSOA 2EG2A 3US5A 2G9OA 4ECYA 4I2QA 4CLZA 2VASA 1VQPS 2KT5A 3KLFA 4PG6A 2N7YA 4OJ1A 2DGTA 1XEZA 2DHGA 2QLFB 1AUSL 1SH3A 2VB6A 3S1TA 4DL5A 1UZHA 4N41A 4M5LA 4ZCMA 3MM9B 4OYXA 2NQPA 3W2WB 2RAQA 2VQFF 2DK2A 4C3LA 2IMWP 2MHNA 2CPXA 1H7XA 1VQYA 1HNVB 1YJTA 3MM5B 2D7SA 3DM2B 1KOOA 2BOPA 1AFIA 1CJKB 3NNHA 2WVDA 3MEGA 3TQEA 1VLYA 2X1BA 1OPZA 3IRXA 1ICEB 2JZ5A 2VD3A 1VRUB 2ADBA 2R4FA 1S76D 2DIVA 1I94J 4I64A 2RS8A 3DNCA 2ZNYA 2DJWA 1X9WA 4EBCA 2C3YA 2LEBA 1RWVB 5AXLA 3ZO7A 3CJ4A 2FJWA 2XS2A 3KOAA 1KN6A 3SCJE 2JWNA 2IM3A 4K4ZA 1QD1A 3RB4A 3G87A 4N7TA 3D1QA 3W7BA 1YKWA 1IBLF 3QFHA 5GMDA 2JEGA 2IPOB 3BJYA 4FNIA 3DI6A 3NGKA 4F26A 1JLCB 1TV6B 2CRLA 4B9SA 4ZS6A 2ZH8A 1IKVB 1SI9A 1PGZA 2VKRA 4BBYA 4LVOP 4Q0BA 2IDEA 3GR1A 4DOZA 3H20A 2EKNA 4M5DA 1VLOA 2MGZB 2R2RA 1UCNA 2KFZA 3V6HA 2B9XA 1HWLA 4Z37A 3WQPA 2QFIA 3SV4A 6AT1B 4J9LA 4B9TA 4MFBB 1S1TB 4OX9F 1YBUA 2BE2A 2E7VA 4I7FB 1F1BB 1TQLA 1BQNA 1VC6A 3N6NA 1UFKA 1YZ7A 2AEFA 3O5TB 3M2UB 4WXWA 5HVGA 3MEEA 2H4YB 1N5VA 1TR0A 1RDRA 1E6YA 3CGIA 3VAGA 2B6AB 3PW2A 3SXLA 5FLXU 4GVBA 2ZKUA 3H5YA 3R6GB 3VAMA 1C0TB 2ZBQA 2BMBA 5K9FA 4NZ7A 3MM8A 3UNGC 3RG6A 3EDRB 3PY8A 1V5VA 3N01A 3DMJA 2C2ZB 2DNPA 3AFGA 2DITA 4PABA 2YNIB 2JVRA 2I0XA 3OV7A 2LQ8A 3LF0A 3GYNA 1WG4A 4DN0A 1HBUA 2C2KB 3Q8UA 1IKWA 3B4MA 3JTNA 4WZQA 3J81Y 4CI0B 4X65J 2CIMA 4ZVSB 5AJ3J 3A8KA 4PG4A 1FE0A 4O3NA 3OSNA 1D9DA 2HSEB 4Y65A 1WORA 5J2QB 2UVWA 2YX7A 1T3NA 3M8ZA 3JSBA 1CQNA 2YNGB 2A0FB 2XSJA 4Y2MA 4ES2A 4R0EA 5ETSA 2CQ1A 4JB8B 5B0EA 1FESA 1OS5A 1LWCA 3TUIC 4YS2A 3PDNA 2VIHA 5KFZA 3H4DA 2H54B 4DSEA 2VJUA 3M6XA 2FJEB 3R7BB 4OV1A 1T9WA 1TL5A 3EICA 4ZVEA 1GXUA 2J9EA 4RW4B 4EU0A 2MJUA 1NK6A 2YQ0A 1TL1A 2B43A 1RLCL 5EX0A 5BR8F 4LBHA 3RAXA 4P2FA 1IBLJ 5D0HA 2IYGA 2FUG9 2ZE2A 3DGPA 4B3OB 5AXNA 1XMOJ 2GX8A 4YQWA 2LVWA 4FBUA 2MSSA 2UVVA 2RQCA 4QIEA 5CYQA 1B70B 4DHVA 2LQJA 1R89A 1Y9OA 2DNKA 5E5NA 2IA0A 1NK8A 3KDOA 5HMZA 1NXIA 3K7RA 3EPGA 3KK2A 3D5MA 2QIFA 3SFGA 1Z4UA 2RUSA 2W7AA 3E01A 5C2GA 3DU5A 1FXLA 2XWXA 3FMWA 4OX9J 1JLFB 3POTA 1NK4A 3KJVA 1EP4B 1YVFA 2VG5A 3ZTOA 1X0FA 5I4MA 3J80U 4KAIA 4DR3F 1N5YB 5IT0A 2BEFA 2Z2ZA 3WX8A 4IRDA 5CD4A 2IM2A 2LXUA 5BXIA 4YFUA 3CCJS 1T9UA 4G1QB 2D3OR 2FTRA 2EW9A 4WF9Q 3CJQA 1YGYA 1YTYA 2WW8A 4RUHA 3TVKA 5CA5A 2G2OA 2HWIA 2AJ2A 1WELA 1HYSA 3VVTA 5BYQA 5IWAJ 5F8GA 3JAMY 4OZ1A 1Z2LA 3HK2A 3J7YI 3MHYA 4F0MA 3QQCD 1WC5A 2PC6A 1ZAWA 3SQGB 2FDNA 1H74A 3IS9A 2LQ9A 4IG3B 3F0NA 1T3OA 3DLHA 4QQBA 2XZWA 4YHHJ 4DZ6A 2AJFE 3IO1A 1R8BA 4S0MA 4B9NA 3KHRA 3KMSA 5BJRA 2YQ1A 3DLBA 2HVIA 3G6XA 2BW7A 2ERRA 5KT5A 3D6HB 1X4HA 3OXFA 4EZ6A 2UXDJ 2XM3A 4OHZA 1NHKL 2HYIB 1LXNA 2WB4A 2YKNB 3BH6B 3A3OB 1KNZA 5B0BA 2XLIA 2GJIA 2NUHA 1HR0F 3GJQB 1HI0P 2UUAF 2OPRB 5T7LB 3FC9A 3W8GA 4ZKAA 2MKJA 3M1VB 3DLGB 3J81U 1HI8A 5L9NA 1NBEB 2NZCA 3VR1A 3Q0AA 1EKSA 2F3JA 3TZYA 2XGPA 3NOCA 5ETTA 3LP0A 2C2DA 3AXKA 3EUNA 4U7UD 4M5JA 4USHA 4NA2A 5BR8J 4X4PA 3TZXA 3VAIA 1F3FA 5ETQA 3SI8A 5KFMA 4X64F 2Z2MA 1Y5LB 1IKYA 3TJ9A 1H72C 5G0RA 3OTBA 2RD5C 4C9DA 2HFUA 3K8VA 2RT3A 3SEOA 3R5BA 2JVOA 4OI3A 3KLEA 1VMBA 3O44A 5HVHA 4QWBA 2R3VA 1O8BA 3N4WA 1IWAA 3W61A 4USKA 3PV8A 2QL7B 3Q83A 2IJNA 3BGRB 2WSCC 4DG1A 1J5EF 4NI2A 3G2XA 3TZZA 4EUVA 3W65A 4OZNA 4ED1A 5CD4H 1RYRA 2G2YA 3JTOA 1KQGB 3PR4A 3AD8C 3UD4P 3K5OA 4LRBA 4ES1A 5FDLA 1I5OB 4DS5A 4I67A 2CJBA 3MMCB 2ZUGA 3V6KA 1CG2A 5E41A 2N4CA 4BCAA 2P9EA 2Z57B 1VGYA 2CZVC 4L75A 3RB0A 4B3SF 2ZUAA 4CH1A 1SC4B 2E1MC 5J2PA 2HLUA 2IC3A 1IQTA 2LEPA 2NXCA 1TZ0A 4TLQA 2R7VA 4MK8A 1UVIA 1ZS6A 2DGQA 1N33F 1D9FA 3HZGA 4XAKA 4FF2A 1N56A 2F4VJ 2ZFHA 5EDWA 4ECRA 2IAJA 1D3WA 1RT3A 4FVMA 1J27A 5J2MB 3GP9A 2FHOB 3MMBB 1GXTA 4OLPA 3AJ2A 3UD5A 1K47A 1RSCA 3QGIA 3QWPA 4LF5F 2D74B 2WHOA 2CPYA 2QYGA 4X4NA 1P9YA 3F44A 1HQUB 1X9MA 4C48A 5F8NA 1S99A 3CDWA 4CNZA 2L9DA 3DLLQ 3FJ2A 2VODA 1NNDA 2OI2A 3BSCA 3KLIA 5DDRC 2B9YA 3MEDB 2UUAJ 4P74A 1JLBA 3PG9A 3AD9C 2X3GA 4DUZJ 2XNQA 2E29A 4J9OA 1R8HA 1BQXA 4DQRA 3RBXA 3LP1B 1HW8A 3VGUA 4WFXA 1TUVA 4NZ0A 1C4AA 2BE9B 3TOQA 3L7PA 2XI3A 4ELUA 1G2EA 2HVZA 4X64J 4WYWA 3KK3A 1HNWF 2KRBA 5L1LA 4ZMMA 1S9FA 1J2VA 2L3MA 5D15A 4QWCA 1S1UA 4WE1A 2CPFA 4QBUA 4OI0A 3DLEB 4HH0A 3A8EA 5KFFA 3A12A 3W5XA 5K8PA 1TL7A 1KQFB 2HVHA 1QY7A 3KK1B 3EDQB 5KFGA 4NL5A 2EC2A 3MURP 4PG8A 3IM9A 1RTZA 1RAGB 1FKOB 1RT6A 4PYAA 3MPWA 3GQCA 2LQBA 4K8RA 3I5BA 4HI1A 1IBCB 2HBQB 4RNMA 2K3IA 3M32B 3P8BB 4DR7F 2WTFA 1X4BA 4QWEA 4X62F 2BZ2A 4DL4A 2QC3A 2ZM6F 1ZAVA 4DCPB 3BN7A 4USVA 2ASYA 4KY3A 4M8LA 2KTQA 4HTJA 2M7SA 4B3SJ 4JI5F 4CYUB 2QA4S 2MDAA 3NLCA 1S77D 3TA1A 1H7WA 1Q7YT 4RJVA 4OJGA 1TKTB 1RT5A 3CSKA 1HARA 2Y1IA 1H0HB 1N33J 1RTJB 3ILLA 1RT7A 3LGNA 2B56A 4PWWA 2W2PP 1HBNA 3OSPA 2CUYA 3GG1A 4PWDA 2O1PA 2W24A 3OHBA 2CNLB 4NWBA 2FVSA 3CDAA 4JOUA 2DXDA 1RWOB 1WKLA 5U47A 1VOMA 1U6BA 3HX9A 1U48A 2CNKB 3UR0A 1FTRA 1S57A 3M2VA 2FHKA 1KVKA 5L46A 2K8GA 4ENOA 3FSYA 3PM9A 1U02A 1RB0A 2ZBPA 4RBVA 1WUUA 3D3BJ 3VWSA 3BREA 4XPEA 1S9EA 4JI6F 3I55S 2WVFA 5HP1B 3PCOB 2VKZG 4EO6A 1KQSR 3OR1A 4RNNA 1RT4A 5HL7Q 1HQEB 2M70A 4UQGA 5H1SV 3W9HA 1VK8A 4CH0S 4HHHA 3V4IB 1C0UA 1U0HA 3CCQS 2MZJA 2YPZA 3PW5A 3OJUA 4EO8A 5JVGQ 2HBZB 2CQDA 4OL8A 1DLOB 1SJ3P 2Q66A 1RA6A 3VALA 1NM2A 2QN6B 3FBCA 1Y7PA 1NZAA 3CDEA 5IV3A 2UUCF 1VBYA 3ZTRA 2HNYA 2BKOA 1TMMA 4OYMA 5DZ7A 2NYHA 4XIUA 3DHXA 3JYTA 4I56A 2FLPA 2EFGA 5HMYA 3KNGA 1PBAA 3C2PA 2RB7A 2I5JB 3AJ1A 4RNFA 4O44A 3G8SA 1FDNA 4OJHA 2M2BA 1FNMA 3IWLA 3MM7B 1RHJB 3ILJA 4F25A 2HHVA 5ETPA 4YP3A 5IQ6A 2EG1A 4ZJOA 4RBUA 4DFMA 2ZVSA 2GIRA 4UF4A 2B8QA 3O3LA 2HNDB 4C8ZA 5HQMA 1UWBA 2AX0A 2FQQB 2VDIA 4NLDA 4P2MA 1UAWA 1N6QA 1U6FA 4KB7A 2MQPA 1G1XA 2P6SA 2AWZA 2G2ZA 3VAHA 2DRDA 1JLAB 1CBKA 2CQHA 1Q95G 3ZZOA 2UP1A 3BGUA 4UZBA 4ECSA 3WHIA 2PFFB 4P9SA 2ZWPA 3C6UB 3OXLA 3MOZA 4A8MP 1X4CA 4MIAA 2LDIA 1FRMA 4DV6F 2J76E 2BW2A 1N5SA 1RWXB 3BR9A 5A6PA 2D3ZA 3NNCA 2QLWA 4F4WA 1QSLA 1OPIA 2VOOA 1YJ9S 3UDEA 4A8QA 4DV5J 3QT5A 3M7VA 3DOMB 2IRXA 1S6OA 3CJ2A 4U67Q 2BUNA 1SL0A 1W25A 3UR3C 1S1WB 4NMXA 1U1NA 1RQ0A 1ZPVA 3E51A 3MGJA 4DXLA 1FKPB 1EKRA 4YMEA 1Y3JA 1RISA 4IUFA 4F7VA 5K8MA 4F36A 4B3TJ 2FJBB 2Q3PA 3LPEA 3LWLA 2DBBA 3GCXP 3D1OA 4LJMA 2IYIA 1OO0B 4CTAB 2NPIA 5HN0A 1PAEX 4Q45A 1KLNA 2QTWA 2ZBCA 2GVZB 3ET6A 3NBPB 1DFDA 3UN3A 4X4UA 4WFZA 3Q8QB 3TUJC 1DBDA 3KLGA 1M90T 2JEJA 4PEOA 1V5IB 4FF1A 2VFRA 5JXSA 4X4OA 1HLWA 1DQ8A 4AL6A 2A1BA 2W2MP 2AW0A 3QLHB 4ILLA 1KD1T 2QFJA 4PPZA 1KLMA 3AOBA 2YWHA 3RAMA 3TJ8A 1KKHA 3PIOQ 2UUCJ 1PC5A 4O23A 3ILIA 1IVZA 3TUPA 1WI6A 2E5GA 5D78A 2M3DA 1YI2S 1NJIT 2BBEA 2E5LF 4DQIA 2LYVA 1QTMA 2V4JA 2R8JA 2XMKA 3NGTA 2G0CA 3EZOA 2DT9A 3V81B 3I0SA 4DCOB 5LL6d 1I1GA 2OPPB 4OYBA 2R7UA 2B4PA 2QL9B 3ENQA 2Y1JA 3H90A 3SDEA 2AT1B 4RPFA 1YRXA 2GMHA 5KFRA 3TJAA 2YKAA 2IY5B 3L7OA 3PO4A 1ITPA 3TZWA 4DSLA 4DUYJ 4CLTA 1RWKB 3DRYA 3H25A 3H40A 4WFAQ 5A8WA 2CJ9A 4UT4A 5IV4A 2G0IA 1RTIB 2A6MA 2W4CA 3MZIA 4OZJA 3EM1A 2LECA 2GGPB 2VF3A 2VOPA 2N3LA 3HM9A 3VGTA 4FPRA 2VFUA 2BM1A 3M8QB 2GIFA 3CD7A 1PYOB 5I42A 1BWVA 1E6VB 1FEHA 1HA1A 1FF2A 2CPIA 2B9WA 3MPVA 4KO0A 1RTHB 3HSJA 5KFHA 1UMJA 2FY8A 2HQ3A 1XMQF 3EZUA 2KFYA 3DKDA 3I9V9 2V4QA 2P2CB 1R8CA 3W62A 1S5ZA 1JLQB 4X66F 2O67A 2CKWA 2ZITA 1TAUA 3MD3A 3JTPA 3TI0A 1H73A 5DETA 4NASA 5M2PA 4PQUB 2VUGA 4M5GA 4KGMA 1Y00A 3G82A 3JB9k 1RHMB 3K8WA 4IDKA 3AB4B 2BDPA 4QR1A 3RUBL 4I2QB 4LR9A 1XQIA 4JI7J 4I69A 3GIKA 2V50A 3TEGA 1Z2ZA 1HPZA 4OYWA 5A0YA 2ALYB 3KLFB 1NJXA 4B9MA 4LRCA 5KG4A 1X8DA 4IYQA 1KC8T 1HBOB 2RRNA 1H6KX 4JV1A 4P7TA 1IUJA 1ZZFA 4ZCLA 5HMXA 4DF4A 3DYAA 3F56A 5KFJA 3RAQA 2IHR1 4E0DA 3GYXB 4RX6A 2XLKA 2C3MA 4J37A 4HEA9 5DZ6A 2E5LJ 3OLBA 1S1VA 1O6XA 3MR5A 4KGKA 3WC0A 2OHDA 2HK3A 2O01C 4WIQA 4BWJA 3UE2A 1QM9A 3GYGA 3M2RA 1FXRA 5CZVA 2P9CA 1FCAA 1ZTTA 2CQ0A 1VQMS 2QYCA 3TX0A 3ZZPA 1B3TA 5EUHA 1U1KA 5C24B 2I9SA 1MROA 1LWEB 1CS4A 1REVA 2V2VA 1FJEB 5KFIA 1NK7A 4L3KA 4W98A 2PD1A 1RYSA 3EE3A 1F6TA 4C11A 2R7OA 4Q0BB 2C28A 4OHWA 1S48A 4DZDA 2E1PA 3VVUA 4BS2A 2FLOA 4M5DB 4DPUA 3K5MA 4FKXA 2VJVA 4EK2A 4JYAF 3VGSA 1SKSA 2B51A 3I4HX 4IOCQ 1Y10A 3G86A 3GV7B 1F2HA 1N36F 3RR7A 1XMQJ 3Q8YA 2E1RA 3C16B 2CXEA 3HHEA 3VF0B 2V6AA 2OPQA 1U1RA 1H98A 1MMDA 1OMSA 5LXRA 2AJ1A 2CZ4A 4ZVRB 4X66J 2XYHB 1ZH5A 2MY7A 5B7WA 1BQNB 4K5SA 1NEEA 1WOPA 5AXMA 2QA2A 1KHWA 2HIYA 5GAEI 2B4VA 1FFGB 2ASJA 3LO3A 1M0SA 4P52A 2D3O1 4GVBB 1O0PA 5K8NA 4KV8B 3GPAA 4B9VA 5IXUA 3GJSB 4EMDA 1OSCA 4DU7A 1GK8A 3HULA 4JI2F 3CIMA 1HMVA 2V2QA 2IVFB 2OO4A 3GB0A 3QFWA 5EWFA 3CJSA 4TYAA 3MDFA 1BWEA 4DV1J 1VHIA 1HBUB 4LUBA 2FIUA 4K7QA 2IM0A 1IKWB 3T9ZA 1YHQS 1XNQF 4PXBA 2HVDA 2DR8A 5JJBA 2M0GB 3VHQA 1NRKA 3QIPB 2DNLA 4ED8A 1U6ZA 2J5AA 1T11A 5B0GA 4YY3F 5KG2A 4EI2A 1CJUB 3CJ5A 4QR2A 3TA0A 4YDDB 3KDNA 5D8HB 3G71S 1NSPA 3R2CJ 2XSJB 4AQYJ 1QJHA 4ZIVA 2XY6A 4M5IA 3ISND 4I68A 4YR3A 3CD6S 2W2OP 1UA0A 2X1FA 2XNRA 1SV5A 1BC6A 1LWCB 1U1PA 2I1RA 2BRLA 2A3JA 4DSKA 4K4UA 2R42A 1P9QC 1PSDA 1R8PA 1RGVA 5L1KA 5ADZA 2HFOA 4ZP9A 4XTTA 2ZJRQ 4USMA 4KHRA 1TL1B 4LREA 4ZHRA 2LA4A 5DRKA 5HI7A 1PKUA 3NOGA 4DDFA 3AJDA 3HHLB 3ETOA 2C2MB 4DQQA 2B9EA 3BQ2A 2I38A 2B8PA 1AA1B 3DGPB 3GZ7A 1Y0HA 2XS7A 4A47A 2Q6CA 4CNYA 4HL9A 4U6PA 4QR0A 3BYRA 3PFOA 2QT7A 3HSDA 3I0RA 2PI4A 4JYAJ 5CCLA 4K2XA 2BANB 1WC0A 1S49A 4J9PA 5J2NA 3KK2B 2VL1A 3PXGa 3CMAS 2QA1A 2L48A 3Q89A 2J0XA 3DOKA 1NPRA 4LMZA 2VG6B 1GH8A 1CULB 3ENVA 1TU0B 1X4DA 4DR6J 1F0XA 4RNOA 3L7UA 2F1FA 2PFDA 1YIJS 3SSSA 3GMGA 1NZ8A 2BXJA 4TU9A 3S6EA 4BHQA 1JK9B 1YLXA 3AY0A 2J6UA 3NRBA 3NS6A 4WFNQ 2HMIA 4F4ZA 4DL7A 4XDCA 5ETRA 2ABYA 1YZ6A 1HYSB 3SZ2A 1FJCA 1FRJA 2X7IA 2ZC4A 4ECWA 5F9LA 3TAPA 2YWWA 5F0WA 3X3UA 1AUDA 4GO5X 1Q82T 1RAJA 1FWLA 3IR7B 1L5UA 3M05A 4G3IA 1U1OA 3IS9B 4ZP6A 4WP3A 1G4CA 1CJVA 5E3PA 3GE9A 4JV0A 2UUWA 1Q5YA 3THVA 3N79A 2HHHF 2J7KA 4C8KA 3KHLA 3NS5A 4RO0A 4YY3J 4LF6F 2DGUA 4I0WA 4RWXA 4JI8F 3CCLS 1Y11A 2WVEA 2G1HA 2QGFB 3D66A 2OPSB 5KFEA 3J7A1 3ITHA 1P1LA 1N32F 1GMWA 5C42A 1YJUA 3MWBA 3Q24A 4C8LA 3UCUP 1NJZA 4RW9A 2CQ4A 3T5JA 3BPDA 1NSAA 3UO0A 4WKRA 2DY9A 4UQTA 1YBAA 2MKIA 1U7LA 4RZRA 2YXLA 1F9HA 2DR6A 4K50A 2GJ2A 3GSDA 1U1LA 2HWHA 3HVTB 4A8FA 5HBMA 4B02A 1IBMF 2CDRB 3DRPA 3LP0B 5HJYA 1VIOA 1CC8A 3ETMA 1TFWA 3CT9A 4KH0B 1YJ7A 4F50A 2YH1A 2QRRA 3BEGB 1FO1A 2YWGA 2KVIA 1RU1A 3D6FB 1MU2B 2KKHA 4UY85 2HPUA 4KFBB 2EKYA 4PZVA 5KFSA 4DUTA 5IQQA 1D0EA 1MLAA 4M5MA 2OTLS 1WF2A 5F3ZA 2KH9A 1D9AA 4CLFA 4XO0A 1QSSA 3OTCA 1RAIB 5LJ5Y 4HVZA 2MY8A 4DG1B 4NI2B 5F8LA 3KHHA 2L9WA 2YBVA 2AU0A 3DLKA 3K58A 2RJZA 1VQ6S 1RBOB 2J8SA 1FD8A 5DLFA 1KTQA 1SXLA 3PX6A 3OTOF 2VFTA 4NA1A 4DV4F 3KTQA 2Y1LB 3AD7C 3R5AA 1S6UA 3HF5A 1NK0A 4FYDA 3QYYA 2RIJA 3PKMA 5BYSA 2LDYA 2MLXA 5HO4A 2OD4A 3PX0A 2EK1A 1NUEA 5J2PB 2LMIA 2IC3B 2VONA 4DFJA 2B7BB 2O66A 2YTCA 3K57A 4Y2AA 2LU2A 2GA7A 3PHEA 2WAQD 1M5PC 3E8OA 2KXNB 1T95A 3KG4A 2OMLA 5B09A 3QT8A 1S9GA 2FD2A 3MCMA 1VBZA 1H3DA 2IAJB 3THPA 1KWMA 5DDQC 2HHHJ 3HFZB 2WCXA 3W2WA 5LSLA 2KHCA 2WSFC 3H8YA 4F04B 1WG5A 4ICLA 4ZA1A 1HNVA 3KJNB 4KGXB 2Y9HA 3MM5A 3DM2A 5DGBA 1N32J 3BO3A 1K1QA 5KFLA 1NH7A 2HS3A 3D67A 3DRSB 3LAMA 2JJ4D 5EHHA 3KLIB 1VRUA 4KSEB 1R3NA 3NS7B 4JI0J 3UNYA 2L41A 5B0FA 4PPDA 4HYKA 2RF2B 5D6GA 3CXCR 1PAUB 2GQQA 2QSFA 2ACYA 3KK3B 2R7RA 3P96A 4FKYA 5IT9Y 9RUBA 4WFBQ 2Y0SD 4F3QA 2DPIA 4Y00A 1D09B 4AXIA 1KHVA 4ZLPA 2QV6A 1TV6A 3ISZA 3HI9A 1HQ2A 1HWJA 4A8WA 4ZVFA 3KJFB 5FIIA 4YDXA 3PYDA 1U2FA 2ILZA 5D0GA 1AROP 2VPYB 3N28A 1TL7B 4CO2A 4DN9A 4LBPA 3WIUA 3OR2A 3M8RA 4EZ9A 4LFAJ 1R0BG 2XULA 5IOLA 1RT6B 3Q22A 1S1TA 2XMTA 4ZOSA 1C1BB 1FDAA 3OTOJ 3Q8PB 1QTNB 4HKQA 2JLFA 2H3EB 4DV4J 3R5JB 3EWGA 3K0JA 2F8HA 4RU2A 5CXTA 2PDAA 5CH7B 2IRYA 1LFPA 5CABA 4OZ2A 4B9LA 4DV3F 1M5VC 2YX4A 3GV8B 2M88A 3QZ7A 3ZXWA 1LWFB 1ZM3A 1Q81T 1S1XB 1RT5B 3EGZA 3LUYA 2NPFA 5F8HA 4P2XA 1LK5A 2M8DB 2JNJA 5C2CA 1RT7B 2WB1D 1RA7A 2JDJA 1HBNB 1HNIA 3SV3A 4K4YA 3P49B 4I1TA 1JKHB 2E5HA 2E9RX 5HJXA 4LFBF 1FI4A 1UFWA 2YNIA 4EYIB 1RJJA 2NSBA 3A3NB 4IOBA 1KSPA 3UVJB 3OUYB 3B78A 4P7VA 1OQ3A 2HHSA 1Q4RA 3L3CA 5CHCB 2QL5B 3FBEA 2JOQA 5C25A 1JNRB 2CPZA 1WJ9A 2GO9A 2YNHA 5J2QA 2J8AA 3C15B 5IM0B 2AJ0A 1Q78A 3CD5A 2LU1A 2X51A 3N6LA 3SCLE 2I6WA 2GAGC 4W4MA 4DS4A 3RBDA 3R5GA 1EARA 2K1RB 1TUWA 3OR1B 2MQ8A 1RT4B 1LW0B 2W4PA 4CM0A 4L76A 3T1HF 4CT8A 4IFVA 2QLJB 4MIWA 3QATA 1T02A 1U0HB 3LALA 4OIXA 2UXBF 2DRBA 4ZJQA 3TA2A 5K14A 3LTOA 4G6VB 5GAHI 2MPUA 1RUSA 3BO2A 3ZZRA 2FHMA 2DTJA 3DGVA 4LR7A 1XMBA 3H7HB 3CO0P 4NCGA 1S10A 3D6TB 2DPJA 2VICA 1OY8A 1U8WA 2YWKA 1S6QA 3D0IE 1SJRA 3HVWA 2MSTA 3NG8A 2HNYB 3PKYA 4DV7F 2BM0A 3DRXA 4B3OA 1RT1A 3IBCB 3TVZA 1V3ZA 4FS1A 5FLXY 2DNNA 3JYTB 1X31C 3GG0A 5B0DA 4W90B 1AW0A 4IR1A 1T05A 3T1YF 1FKAF 1RAEB 4F4KA 2F7VA 1D8ZA 2R8HA 3CJ8A 3BSNA 5H9EK 1OYDA 4FZVA 4YN3B 5ETMA 4F4AA 2Z2YB 5KFPA 2P5VA 4DR5F 4AUKA 3FQLA 1VQ8S 4DLGA 2VBWA 2DNRA 2AV5A 4DPWA 1EP4A 2OEMA 2QG9B 2F5GA 3G6ES 2CVEA 3MOJB 3C6TB 1N5YA 2L9NA 4FF4A 4R0JA 3C46A 2RUGA 1UWBB 5HQ8A 4MAKA 3TP2A 1RP5A 3AQOA 5EWGA 4Y2KA 5GADU 2MKKA 3QNWB 4DBQA 4Y28C 2W2QP 4ED6A 3DHWC 4K4XA 3SSRA 1WOOA 5LMUF 2K06A 4GKKJ 1MMNA 3K5NA 3MAHA 2XY5A 3QGHA 3KLHA 3I31A 2HBYB 5T41A 2PA3A 2DKOB 1EJ7L 4LFBJ 3EVWA 4M5HA 2ZZTA 4P75A 1QAYA 3OD2A 3W9JA 3R6LB 1OQ6A 3IWXA 3SQGA 3UWTA 1OIAA 1X0PA 2B4OA 2C1EB 3NGDA 2FJVA 4I4BA 2KYXA 3TANA 4ANEA 2KJVA 1FRHA 1JXEA 3VQTA 4RW8A 1SJ1A 3HJFA 4GC6A 2DR5A 2W25A 4GMKA 3E2EA 4PUOA 4DF8A 4B3RF 2AQ4A 4N56A 2PI5A 3RBZA 2NXEA 3FFIB 2AYGA 2YKNA 3ZTQA 1PCAA 2CG8A 4K0KJ 2LKZA 2NXJA 1N4LA 3T1HJ 1WOSA 2OPRA 2MQMA 1GMUA 3RGIA 3CJ0A 3KLGB 2H48B 3DLGA 3D4JA 2H9ZA 1F5AA 2DHAA 2LXIA 4URGA 2A2DA 4EGLA 4L74A 3J80Y 2BABA 4U8YA 3D7SB 2KB2A 4X4SA 3IG1A 4O4GB 3I6PA 1VQKS 3BBCA 1N48A 3MMAB 3VQSA 1Q53A 3QO9B 2ZDPA 3J7AN 4QIVA 4KC5A 4QU7A 1X60A 4KHPF 4DV7J 1FX2A 1EETB 4ZPTR 4H4KA 1VIXA 4B08A 2XI2A 2IBKA 2CQ3A 3T1YJ 1GXLA 4NA3A 3MMJA 1D1UA 1S97A 1DQAA 3N0VA 4M5NA 5ETNA 3FVYA 2V4JB 2G1DA 3BGRA 4BDPA 3I0SB 3VCDA 2HHQA 2IRUA 2XZDB 1FJGF 1R6YA 4ECVA 2KG1A 5EWEA 1JNZB 2JFDA 1U49A 4A8OA 4USIA 3SIPB 5KFQA 2GIQA 2L08A 2YVSA 5F0UA 1JJHA 4YUDA 2D9OA 3R27A 1JJ4A 4N8OA 4J91A 3F73A 3HLUA 2FGOA 1RAHB 3MM6A 2MKCA 5A8WB 4R8UA 1WDTA 4C7QA 5SUHA 5LMUJ 2AEJA 3P4UB 3B6BA 1DQ9A 4UUWA 3F41A 5KFNA 1NKEA 2ASDA 2V67A 4OYPA 1B99A 3C3LA 3B4DA 4JI1F 2KG0A 2VQFJ 3TWZA 1V3SA 4KO0B 2RU9A 4OLOA 3UDLA 3CMQA 4CLUA 3OBIA 1PJ6A 1UFLA 2DR9A 4LIWA 1SCJB 2HRTA 3D9BA 3HHNB 2DGSA 3VZIA 5G4DA 3HCXA 5GAGI 5J2MA 1NHVA 4KRWA 3R2DJ 4ECXA 2W7PA 3S7RA 1N52B 3FCVA 4B3RJ 3EZ5A 2Z56B 1FK9B 1RTDB 1BUXA 1S7IA 5DQGA 4C0BA 1WHWA 4OI2A 4IDKB 3RYLA 2CPHA 3IRWP 5A2QU 4USUA 1TAQA 3R5DA 3MEDA 1PO6A 2YKQA 2KM8C 2NCKL 1HPZB 4FYYB 1UJ4A 5A0YB 3BN4A 3ZTPA 1CEZA 1MN7A 4KT0C 3H5SA 2PSZA 3LP1A 5D4OA 3M4XA 2GO8A 1RCXB 2D9PA 2DD8S 2HZAA 3ZFVA 3I82A 4J9UE 1RXOB 2HAFA 4KYZA 3CB4A 3KUEA 3PNIA 3BV8A 1TMJA 1RWUA 4OYOA 4KHPJ 1F9EB 3HD2A 2ZH9A 3DYAB 2CPEA 2W4DA 1JJCB 1EHWA 3KUGA 1W7WA 2XHCA 2JEFA 2XMMA 4Q2LA 2IFXA 3J7ZT 1GQEA 3TQ1A 2DHHA 3DLEA 3IMQJ 1B0TA 1KVJA 4FYWB 5HMWA 4OI1A 4YR2A 4ZPBA 3U27A 2XSFA 2EBEA 1XTZA 4LSNA 4UOFA 3R1HA 1FJGJ 1SH2A 5A6WA 3LOUA 1MNEA 1X5OA 4K4TA 2DXEA 3KXDA 1FKOA 4F0KA 2OLWA 1WACA 2KVQE 4C8OA 2HFNA 2DGWA 3OT9A 2BQRA 1MROB 1CS4B 4DX7A 1REVB 3IP0A 3JSMB 3KLVA 4IG0B 3PW4A 3R5CA 1TVRA 3CCMS 4NLVA 1NDPA 3BBBA 3HZEA 1SB6A 2FVCA 1XNRF 2E5IA 4Q2MA 1WF1A 3L4BC 2HQDA 4X2BA 2ROPA 1VQSA 2B5JA 3W60A 4YB6A 3UW1A 2F9DA 3IGVA 1NJYA 1URRA 2Y3YA 1O51A 1S4FA 1TKTA 1IN0A 3D54A 2HHTA 1SJ4P 3GFHA 3OVAA 3PW7A 1W2IA 1R43A 5L1JA 2HHPA 2OPQB 2UXCF 2P9GA 4ED0A 3IGNA 4DCJB 3CCRS 4A46A 3R1LA 2VPWB 4RKUC 2R7SA 4WYLA 5HAOA 5KOWA 2HNZB 2HS4A 1AXQA 4ECUA 1XK8A 1VK3A 3GIJA 2VC0A 1J5OB 2HGMA 2VU5A 5DS7A 3BDPA 3B54A 1YJVA 1PJ5A 1FDBA 3ZZYA 1FNOA 5D4NA 4UY8T 3LA0A 2V63A 3HSZA 5D3GA 2AZ1A 3SQOP 3NEKA 2HHXA 4TNOA 3QT7A 3N6MA 2Y8WA 5KAKA 2KRRA 5HP1A 4NXNF 4JI3F 3FSXA 1FT8A 3V5RA 2PT0A 1HMVB 4DX6A 3CDUA 2C3OA 2CJAA 3P45B 1SL1A 1ZZNA 1DY3A 3V4IA 3P3DA 2V94A 4K4VA 1R8AA 2Z0GA 1EQMA 4PG7A 5CAAA 3EXYA 4UZCA 2PMWA 3PYEA 1DLOA 2J0SD 1WI8A 3UD3P 1GMVA 2MTLA 5DM6Q 2AYMA 3IM8A 1TKZB 5GVQA 3HFKA 5I3UB 5K5MA 2ZKTA 1F5BA 1MWYA 1HD1A 2PGCA 1PBUA 4LF1A 4DR3J 4H4OA 1SV5B 1WEYA 3MM7A 4LRFA 2MB0B 2OD6A 4OHVA 1VDHA 1WKJA 2MKSA 5ETKA 3ONQA 1U4BA 5DGAA 3M9NB 4ZN3A 2MQLA 2QZ8A 1UETA 5ETVA 3DDKA 3OJSA 1QAXA 1VISA 5EN1A 4GKJF 4MIBA 1FRKA 4RW7B 3V6JA 4Y2IA 3BQ1A 1PIEA 4Z7CA 2IVYA 4OHXA 1XNRJ 4OX7A 1NB2A 1QLNA 2BVZA 2W9CA 2MQOA 2UVRA 3A1YG 4Z7YA 3TAMB 3RW6A 1JLAA 4HACA 3FNNA 3IXQA 3W1YC 2DHXA 1S0MA 1R31A 3FEYB 3OL9A 2V9WA 2WBMA 4EFAC 2RRBA 2F8EX 3ELHA 3C6UA 2GV1A 3D0GE 4DPYA 4IO9Q 3MR7A 2ZZNA 1NMEB 3OVBA 3IC1A 2YNFA 3CC4S 2NR0A 3UDVA 2UXCJ 4DLEA 2AGOA 5B08A 2RU3A 4F3OA 2DO0A 2Q43A 4RUBA 4P10A 3NY0A 5KT2A 1N54B 3V6DA 1T9XA 4NEYA 4IRKA 5DG8A 3AAWB 2WONA 4F67A 2MEWA 3C19A 7FD1A 2B7CB 2YPYA 2HQGA 4Q8EA 4WZMA 2V4RA 4MKVA 2VG7B 4ZN1A 3DOLB 1FKPA 1ZAXA 1YBTA 3HDSA 3NXZA 1HR0J 2CJXB 3H5XA 2UU9F 1B7YB 4XPCA 1L3TA 4ECZA 3D28A 4J9QA 5FJ4A 4J9VA 4MMOA 4PXEA 1UKUA 2DCUB 2VDHA 4TQRA 3HPOA 3ADAC 2H4WB 2P6TA 5J1EA 5D4LA 2GVZA 1U47A 3NBPA 1FNXH 1KP6A 4U96A 1L3VA 2HFZA 1VCTA 4YEAA 2YY3A 4OJ3A 1MWZA 1WDDA 5KG7A 2XMAA 1P27B 4ZP8A 9ATCB 4EBDA 2Q6BA 3CJ3A 1F3VA 1HBMB 3AA9A 3ZZZA 3QLHA 4HHUA 1BHNA 4U7CA 4OYIA 3BGOP 1IR1A 1Q0NA 1VRQC 2GHVC 5CYJA 5E7OB 1GNKA 3C14A 1FRXA 2PEBA 3ITHB 2EVZA 4LF8F 4IFYA 1J5EJ 4C8YA 2MMYA 1TK8A 4FYVB 4O3PA 3PW0A 3KYLA 3CDBA 4X4VA 4AE5A 4UTGA 1UEKA 3EVOA 5ITHA 3RTVA 4J9KA 4HTIA 2UUBF 2AJ4A 3LPYA 2B3TB 1FE4A 4IH6A 3H2LA 5L8RC 4P72A 5KFDA 1LQ9A 3V81A 4ED7A 1KFSA 3W2VB 1S72S 1VQOS 2C22A 2HK2A 3DCAA 3HHLD 1RAOA 4ZVUB 4J5OA 3SSQA 1WHYA 4GKJJ 3I96A 3CEDA 4IR9A 1TKDA 4M94A 4ED3A 4I2PB 4FS2A 3MECB 3MCOA 3HVAA 3KWMA 4KKOA 2ZHAA 2LLZA 2V8PA 4CP5A 2MQQA 1YSJA 1RTIA 1G7CB 1FERA 1ZA2B 1ACMB 2JX2A 2DYAA 1RACB 5GAEU 1DURA 1OYEA 5BYRA 1GEHA 4KE5A 5J1NA 3M30B 4KPYA 5L1IA 1FVSA 3TW0A 1E6VA 2ZOMA 2RHSB 2W8KA 2FY1A 3K5PA 4LF7F 1RTHA 4QIWD 4D3HA 4R25A 2BKPA 4LF5J 2OGUA 4CO3A 1X4AA 3EGNA 3ENWA 3HKZD 2RKIB 3HHDA 1JLQA 2NXUA 5DG7A 4NXMF 2C42A 3M6UA 4MYTA 5CYMB 3WC2A 1S12A 2R7XA 2UU9J 3G8QA 2A2CA 2KI2A 3L95X 4M1KA 5AE2A 1GT8A 4MK9A 4PQUA 1RCOB 8ATCB 2MXYA 3GSIA 4DU8A 1DTTB 1DAXA 1TKXB 4M5KA 2B4UA 2XYPB 3X1LB 7AT1B 2BA9A 1UVLA 2F63A 3L9ZA 1HNWJ 4WTOB 2OELA 2OKQA 3GIRA 1HKAA 1S9GB 2PMZD 4WTYA 2FLNA 2PMHA 3K17A 3HSGA 4H4MA 3JXOA 1HBOA 1X4EA 4LBIA 3MPYA 5IT4A 1WTBA 1T9TA 4ZVPB 2VV5A 4ICLB 4A8YA 4X65F 3LANA 5AJ3F 1RT2B 3FZBA 3M6VA 1X5PA 2Y8YA 5KTQA 1TK5A 3W3SA 4LF8J 4ITSA 1H38A 2OSQA 3K2YA 4CT9A 2HIQA 1VC5A 1SUQB 2V2ZA 5MLCV 2V2KA 4CH7A 2ADCA 2RVJA 5DLGA 2UUBJ 3MAAB 2JLGA 4PYDA 2CG4A 2HHUA 4DR7J 3UCZP 4NLTA 4X62J 2ZBIA 1SC1B 5C7PA 1JLGB 3FQKA 1QVGR 2ZM6J 3SYZA 4RUCA 4ID5B 2QO3A 2XLJA 1VFJA 5C24A 2GHWA 4JI5J 3AH6A 2JLEA 4CO4A 1T03B 1LWEA 4Y2CA 4EEYA 1PYTA 2UZAA 3PIPQ 2WOMB 2Z30B 1C1CB 4HR2A 4NLYA 3TNVA 2LXFA 1XMOF 3MTJA 1A7GE 3D3CJ 3NGSA 1XWLA 2D41A 3TX8A 4ZVTB 1CPZA 3CD0A 4H54A 1RHQB 1BLUA 4DSJA 4LF7J 3CULA 3OR2B 3MD1A 3C66A 3MF5A 1JJ2R 4ZDNA 4P71A 1B64A 3C16A 3A13A 1HD0A 4X4TA 5H9FK 2ZOGA 2I2YA 4ZLJA 3OFEA 3WZ0A 4NXMJ 2Q79A 2PIIA 4JI6J 1R7IA 4CO1A 3NP5A 1BQMB 1BE4A 1B0PA 4K59A 1SKWA 2DH9A 5T14A 1Z1ZA 3M8PB 4OYAA 3LGHA 1CVJA 4KV8A 2EFOA 2MLYA 4FNHA 1Y3KA 2CQPA 2X3DA 5CCMA 4DWIA 4NPOA 2XO6A 5EGYA 1K9MT 5IWAF 3W64A 4IRCA 4MYUA 4WWSA 2AIRB 2C2EA 2JFKA 2KHDA 1HNIB 1G3OA 2ROEA 3OL6A 2IBOA 1VHFA 2KT3A 5HQLA 3RZAA 2E9ZA 1QE1B 4O0NA 3DC2A 3LP2B 1NDKA 1WG1A 3BPSP 3JSRA 3KJQB 3MR6A 4UOHA 4YHHF 4ZVHA 2PN6A 5C25B 1KR4A 3QIPA 5AXKA 1AZSB 1XR6A 2E9TA 3JQKA 2J6SA 2DCLA 2YNHB 2HZCA 4ELVA 1CJUA 1RHRB 1KONA 3HD1A 2ZD1B 4TKTA 1Y5NB 2GVDA 2UXDF 3T19A 4CLLA 2YKOA 4KHMA 3AODA 4IQMA 1UL3A 4CDIA 2K2PA 3G8TA 3H4BA 2GMJA 2M4MA 4NLOA 4QCLA 2E1CA 2HGLA 4IFVB 1JXVA 1WEZA 4ZP7A 3NMRA 1SJQA 3PJWA 5K14B 5JUMA 1KBRA 2V8VA 4MH8A 4ED5A 4TY8B 4MK7A 4K5RA 3ZZTA 1HWUA 3K5LA 1SC3B 2HRYA 4A4JA 4YB7A 4NCGB 2W9BB 1GTHA 2KL8A 4MKAA 3HHLA 5K8OA 1Y4ZB 4ID8A 4B17A 3PVXA 1S6QB 3BF4A 1BGXT 3UCGA 4DV6J 5L38A 3U1MA 4LQ3A 1RT1B 4ZVOB 2YWEA 4CLSA 1DHMA 1IKXB 1Q5VA 4R5PA 1DJ0A 4FF3A 1T05B 3SFUA 1K44A 1ZPWX 3FKBA 1UEUA 4X4RA 2BANA 2MHEA 3SBMA 1NAQA 6FD1A 1M5SA 2FYXA 1DTQB 2ZVIA 4QJVA 2ZC3A 1PJ7A 3PHTA 4L72B 1IM6A 3S8SA 3IAS9 5KFTA 2YH0A 2VG6A 3ZNUA 1CULA 1S6PA 3O6QA 2HQCA 4RLEA 4UOGA 2FVQA 5LMNF 1IWGA 4KJIA 1DARA 2GW8A 4J9NA 5IFMA 2HWTA 3FK4A 3ICLA 4QIFA 4FPIA 3OL7A 1KS2A 2HAIA 4JV5F 1CSJA 3OVSA 2LEAA 2FB0A 2Z4PA 4IO1A 1UVMA 2XQCA 1N5QA 2MZSA 3CO9A 2HQFA 4NX9A 1UA1A 1W2BR 3TRGA 1U2RA 3PYGA 1RLDA 4AL7A 2AD9A 2G4BA 2V8HA 3ENAA 3T5KA 3KLHB 2GS8A 2K7KA 4DL2A 4WBFA 5KFWA 3CUNA 4MKYA 5HSPA 3QJPA 3EMTA 2DNGA 2J7UA 3Q8RB 1RAFB 4OYZA 4DPOA 5A76A 2XB2D 2OSRA 4L73A 3IFEA 1GMWD 1Q8LA 2F4VF 3NWRA 3VAKA 4B9UA 2R2SA 3MEGB 1FFSB 3MI7X 4G1IA 3PRVA 4RW8B 3R97A 3IRXB 5DJBA 2RILA 1S59A 1X4GA 1QUPA 4CLWA 4PUOB 4ZPDA 5LOQA 3IN5A 2OPSA 2V5HG 2WW4A 1RWMB 2N3OA 1SIWB 5JMNA 3D1HA 4AFFA 3BDEA 4ZPWR 3OQ2A 3RW7A 4USJC 5I3PA 4DUZF 1FA0A 1NSQA 3T3FA 3HVTA 4NLSA 2ZWOA 3GR0A 4PXCA 4DSIA 4QPTA 3AB2B 3DI6B 3IG1B 1KQKA 1LW2A 2CQ2A 3EPIA 2M5YA 2VPZB 5H9EJ 2RH3A 1V3RA 4LIRA 3RJMB 2HG4A 1JLEA 1RABB 3A3PB 2RNEA 1MG7A 2DH7A 4DX5A 1LNQA 1MU2A 3GFYA 4HDHA 4KFBA 1VJQA 3A4TA 4ANCA 1T9VA 4CZCA 3UI3A 4RUAA 1SC6A 1I51B 3RB6A 4JUZA 2CJYB 4ED4A 5FD1A 3HT3A 4OX6A 4RW6A 2BE2B 2BYCA 2EK6A 4DL6A 2ROGA 3L09A 3H0PA 1LXJA 2HFSA 2XS5A 2HHWA 1WC4A 5MAOA 5SZTA 2R8IA 2CVIA 2PO4A 5LMNJ 4C6AA 4ZIWA 2GQCA 3TO8A 1NLKL 4U8VA 2BX6A 4KBIA 1XBWA 4QPXA 4TYBA 1MMLA 3MEEB 4DSFA 3BO4A 3TUZC 1E6YB 4OX8A 4FBTA 4PXDA 2VBYA 4NMLA 2RQMA 2DNQA 4JV5J 3MM6B 1VQ7S 4LR8A 4N77A 3ZZ0A 4QYZK 2DXFA 1N34F 2AX1A 4R8UB 3MM8B 1I3OB 3DMJB 3OLAA 2GCFA 3MFIA 2MZRA 1BMQB 1NSKL 1HFEL 4CLYA 1A6LA 1B4SA 4U9RA 3QZ8A 3LAKA 3AHPA 2RMLA 4ZPAA 4NCAA 2XMJA 3ISNC 1UEVA 2JC1A 3AOCA 2RSQA 4ZJLA 3DXBA 3QRPA 3ZZUA 1KFDA 5A8KA 1IJFB 5GADI 5KOXA 1TL3A 1ZM4A 4IH7A 3CJKA 4TY9A 2OMOA 2OFHX 3BR8A 2KDOA 1SL2A 3I5CA 5DDPC 5B0CA 1FRIA 3DRRA 5GAHU 2HBRB 1XR5A 1HW9A 4UUXA 1UW9A 1IR0A 2LCWA 2O3DA 2CPDA 4A48A 3Q86A 4CWBA 1RZMA 2OTJS 3JAMU 5E3RA 2FZKB 3RB3A 2BR0A 1S7HA 5KG3A 3DRSA 2QLBB 4Z2XA 2CQCA 3HO1A 2ATLA 3KG1A 4X84A 3H98A 8RUCA 1P8GA 3UN5A 1Q86T 1SKRA 3NCQA 4W92B 2KO1A 4ETZA 2RF2A 3MXHP 2BQUA 2ZE2B 3FDSA 3QAUA 1UW4A 1GFWB 3PZPA 4PRFA 1X5SA 1FX4A 2PE8A 1S0NA 3EX7B 5CYQB 1S4EA 2MLZA 4J9SA 1R0AA 1HHTP 5L9XA 3QRRA 1WTFA 4WK3A 2AYBA 2DGOA 1N36J 3MEKA 3E01B 1HI1A 1UZDA 3UDCA 2XY7A 2ACMA 4DMZA 2DNOA 2CA9A 3POTB 2JHEA 2VG5B 3KJVB 5AT1B 2LA6A 2YKPA 2XYGB 1FWPA 1NB7A 3VAJA 4LSNB 1MSWD 5E2QA 5KG5A 1BD6A 4CM2A 4TU7A 2POKA 3N5FA 2H5EA 4ILRA 2FVPA 1REGX 1C1BA 4ED2A 2YQ3A 3J7Z5 3QAEA 1CJTA 4ZVGA 4B3MF 2F9JA 2R8KA 5F9NA 4LSLA 1YRTA 3DN9A 2ZH7A 5HLFA 1TVRB 2GHPA 1N34J 2NYIA 2R9LA 2FJXA 5KG6A 3PYFA 3I32A 2KJWA 3V2UC 1S0VA 3HJVA 3BB5A 4JI2J 2M8HA 4LSZB 7FDRA 2B5JB 2VBZA 1LK7A 1YQHA 4ECQA 4NYZA 2B0GA 1LWFA 2DISA 2F4FA 1PYSB 5A8RA 2YKMA 5F8JA 1S1XA 3TAQA 1WKKA 1XNQJ 3KNAA 1RU2A 2H65B 3IA0A 1WC3A 1PC4A 1LWXA 2MKYA 3BM7A 1LKZA 3IBFB 1JKHA 3I4PA 1NPKA 3G6YA 4OI6A 1ZETA 4LT6A 2DY1A 3P5TL 3UVJA 4ILMA 3OUYA 4DV5F 3CW2C 2F40A 4QWDA 4EBEA 3H2VE 2D69A 2HQIA 3BZQA 2XHWA 2XEXA 3HHKA 4RL1A 3C15A 1Y5IB 3QJJA 3LWMA 5IM0A 3A8JA 5KFUA 4GO7X 5THWA 1ULRA 2APOA 5D3GB 2EXUA 4B3TF 3CTRA 1VRTA 2AKWB 3PJXA 5E3AA 2GAHC 1YWXA 3GJTB 2K1RA 4Y3CA 5HROA 1LW0A 2AP6A 5KG1A 2OIHA 2VH7A 4ANDA 2NUUG 1UVKA 1IKYB 2FC9A 1APSA 4UW2A 2GNKA 5G0RB 4NLWA 1YX2A 4DQPA 3QIDA 1VBXA 2FHJD 2W8LA 3GTYX 4NYPA 4J9RA 3KLEB 3BKUA 4KGZB 3T6BA 3N9UC 3P5BP 4OZLA 1YK9A 3R7NB 2Y0BB 2RQKA 2GFFA 2H51B 4WFYA 3T5HA 2C2RA 3D2WA 2OFGX 2PA8D 2C3PA 2IJFA 4TN2A 3PEHA 4H4OB 2CNNB 3N5BA 2Z8QA 1TK0A 4WP9A 3AA8A 3CE8A 4HT5A 1CLFA 2CJKA 4HLBA 1YRUA 3CCES 4O0IA 5FDLB 2R8GA 4ATNA 1RBAA 4NLPA 1R6VA 2W7OA 4A8SA 1IR2A 1P6TA 4QW8A 3R8YA 3HP6A 3RR8A 1UJ6A 3NAIA 4WU2A 1N5TA 1O5JA 3C6TA 4B3MJ 2ZJPQ 3PRBA 3GLJA 3CPWR 1U0SA 2V68A 2XGQA 2AMCB 2O5DA 4AT1B 4F4YA 3TARA 1D8YA 4ECTA 1SVDA 2Z58B 4DUYF 2KU7A 2W9CB 2R2TA 1SIZA 2K3KA 4HACB 5GAGU 3GJRB 1AYEA 1RWPB 2BJ7A 4NLUA 2UUTA 2VFVA 2FLLA 1RKIA 3FZ2A 1OY6A 1RKJA 4V19J 3NWGA 4C3KA 1HL6A 2ZBRA 1UTAA 2YNFB 5GMEA 1RT3B 3MM9A 2A6OA 3MUTP 4DFPA 3KMQA 4DV2F 4LF6J 4JI8J 2HLTA 3V6DB 1A0OB 1AT1B 2WONB 2IMOA 4A8KA 3NL0A 1CJKA 2MZTA 1XJWB 1B7FA 3U1NA 3SMZA 2F65A 3Q8SB 5HATA 3CJRA 2HKEA 4KGVB 3W5ZA 4H4KC 4BC9A 1JLBB 1M1KT 1QAJA 4GRSA 3PACA 1U09A 1LEOA 3FFIA 4OMFG 4GVLA 3U02A 2G13A 4EYHB 1IBMJ 1FFWB 4Y6IA 4U95A 2CZ9A 3M8WA 4FVCA 5J1EB 5LXYA 3G9CA 3BKTA 4J90A 3KKFA 4ERDA 3NCPA 4JI7F 4P73A 4DV0F 2EFPA 2KFNA 4FXWA 3CWJA 3QGPA 3CF5Q 5CQGA 4AYBD 5IS2A 1SH0A 4ES3A 1H2UX 4IH5A 4LFCF 1JLCA 1S1UB 4O4GA 4WE1B 3MMAA 1IKVA 3QO9A 5DQIA 1L3KA 1FVQA 2OJ3A 1SBRA 2FVRA 1RI7A 2XO7A 3C14B 2MGZA 1EETA 1Q8BA 3BQ0A 1GTEA 3KHGA 2GJFA 3QPIA 4IFYB 2AF6A 2N4DA 3GIIA 5D0EA 4CIOA 2KM8B 4P6QA 4G1PA 3EXCX 3KG0A 4CCHA 4O3SA 1RBLA 3HFVA 4MFBA 3I5AA 1QDUB 2H1YA 2HS0A 4LF2A 4I7FA 3MR2A 3H5UA 3J7YU 4NEZA 3OXGA 4F02A 3GV5B 4QU6A 1FTCA 2W1BA 4OI4A 1YJWS 3M2UA 2DH8A 3D0HE 2CNOB 2XMWA 2RS2A 5CZXA 2B6AA 4KKOB 1NKCA 3MPUB 2V8GA 3EVMA 4BWMA 1JWWA 1HHQA 2D1CA 1C0TA 1GX5A 3DU6A 1ZM2A 1Q16B 1WC1A 2CJQA 1IJEB 1VQ9S 4ZPCA 5DDOC 3CVKA 4ZCIA 4PWDB 3R9LA 4PR6A 2IM1A 1U1QA 1AB8A 1P1TA 1K0VA 4C8MA 2MYFA 3B82A 4DV2J 3I9ZA 4K2JA 3CNQP 3ZNJ1 4URQU 2OEJA 3ILOA 5KG0A 2DGXA 3GONA 2AHOB 5LSOA 3M2VB 3MTKA 1U24A 1V9OA 1M5HA 4NOHA 3O1LA 4AXJA 3CC2S 3VV2B 3EGWB 2YNGA 2RDDA 2QMUB 2HW3A 4Q5VA 1S9EB 3DLJA 2Z2LA 2ZOFA 1FK9A 1B0VA 1RTDA 2J6TA 3ZTSA 2SXLA 2I8EA 3M9MB 2EI5A 4ZVQB 1X5TA 4WKYA 1S79A 4E8UA 1C0UB 3I56S 2ZHBA 1YITS 3C8YA 3M8SA 4RW4A 2IA6A 3QBCA 2DNMA 5I3QA 4DV0J 1HHSA 2YX1A 3Q2SC 1UP1A 4V1Ak 4DPXA 1QUVA 3SCIE 2UV8A 4QOTA 3GILA 1S0OA 4MTPA 4C98A 4LFCJ 2KT2A 4H4MB 4DV1F 1EQ0A 2CQGA 2OP5A 3B8HA 3BBFA 1XC9A 4F2RA 4RR5A 2VPXB 1TL4A 1CC7A 4KTQA 4LVNP 4C97A 2X1GA 2FHJA 5KFKA 2CDQA 3AOAA 5KT6A 1WD6A 4E98A 2BV3A 1TELA
chains in the Genus database with same CATH topology
3CT9A 4O44B 2C42A 3M6UA 4F50A 4MYTA 2GC8A 2YH1A 2PC6A 5CYMB 3WC2A 1KVIA 1ZAWA 2R7XA 3SQGB 2FDNA 3G8QA 3IS9A 2A2CA 1KTVA 2KI2A 2LQ9A 2QRRA 3BEGB 1FO1A 2YWGA 3L95X 4IG3B 4M1KA 5AE2A 1GT8A 2KVIA 1T3OA 4MK9A 5LT5A 4AQYF 3DLHA 3NAHA 4PQUA 4QQBA 2XZWA 3IAM9 1JLFA 3PX4A 4IQXA 1MU2B 2KKHA 5DQHA 4UY85 2HPUA 1VQLS 4KFBB 2EKYA 2AJFE 5KFSA 3IO1A 6FDRA 1R8BA 5IQQA 2MXYA 3FMBA 1DTTB 1D0EA 1NO8A 4B9NA 3KHRA 3KMSA 5BJRA 2Q1LA 1DAXA 3DLBA 1TKXB 4RBTA 1Q79A 2HVIA 3G6XA 3CCUS 2OTLS 2ERRA 4JBCA 5KT5A 2B4UA 4TU8A 3X1LB 1X4HA 3OXFA 4EZ6A 2BA9A 3BSAA 1N6QB 1UVLA 4ZCKA 3MHYA 1WF2A 5F3ZA 2KH9A 4G1QA 2ZDOA 3T5LA 4OHZA 1D9AA 3LH2S 4XO0A 2OKQA 3OFGA 1QSSA 2HYIB 1LXNA 2LQ5A 3OTCA 5M2UA 2WB4A 2YKNB 5DM7Q 3FRYA 4V19X 1S9GB 2MJNA 5LJ5Y 2FC8A 4HVZA 2PMZD 2COLA 2MY8A 4WTYA 4DG1B 5B0BA 1KNZA 3JSMA 2FLNA 4WJBA 2PMHA 5F8LA 2XLIA 2GJIA 4H4MA 1F60B 3KHHA 4IG0A 1HBOA 4L3NA 4LF4F 2NUHA 1X4EA 3FRZA 2L9WA 3MPYA 4O3OA 1HR0F 1HI0P 2UUAF 2KN4A 2OPRB 5T7LB 2NREA 2AU0A 5IT4A 1WTBA 4WCEQ 3G96A 2DRAA 2WRMA 3DLKA 3K58A 2RJZA 2VV5A 4ZKAA 1VQ6S 2MKJA 4ICLB 4A8YA 4X65F 1FD8A 3M1VB 3DLGB 3LANA 1HI8A 5L9NA 3EYZA 5DLFA 5AJ3F 4OHYA 2E66A 3NKYA 2JEIA 1KTQA 3OFFA 1HWKA 1RT2B 1SXLA 2J0WA 3VR1A 3Q0AA 3PX6A 3OTOF 3FZBA 3M6VA 2F3JA 1X5PA 5LJ3Y 5KTQA 2XGPA 2VFTA 1TK5A 2QEXS 3W3SA 2JRSA 3LP0A 2C2DA 5A2QY 3EUNA 4NA1A 4ITSA 4DV4F 1H38A 2QSWA 4USHA 4NA2A 4FN5A 3KTQA 2OSQA 4X4PA 3UFCX 3VAIA 3K2YA 3SI8A 3R5AA 4CT9A 1H2TZ 2HIQA 1S6UA 1VC5A 5KFMA 3GWCA 4X64F 2Z2MA 1Y5LB 3HF5A 1IKYA 4IG3A 1NK0A 1SUQB 3WX4A 5LSRA 3QYYA 4FYDA 2RIJA 5MLCV 3PKMA 5BYSA 2V2KA 4CH7A 5G0RA 2ADCA 4IOAQ 2LDYA 1WHVA 3OTBA 2OD4A 5EX3A 2RD5C 5HO4A 3PX0A 2EK1A 2XMVA 4C9DA 2RVJA 5DLGA 3K8VA 2RT3A 2EBGA 3R5BA 3SEOA 2JVOA 2JLGA 4OI3A 3KLEA 5J2PB 1VMBA 2LMIA 2CG4A 2IC3B 2HHUA 1MW7A 3O2IA 4D3GA 2VONA 2MQNA 4DFJA 3O44A 3FSIA 3UCZP 3OFHA 4QWBA 2B7BB 2O66A 2YTCA 2ZBIA 4NLTA 3K57A 4Y2AA 4DR6F 2KXFA 2LU2A 2XBPA 5KT4A 1O8BA 3N4WA 1JLGB 3FQKA 1C2PA 2GA7A 3PHEA 2WAQD 1M5PC 1QVGR 3E8OA 3SYZA 2KXNB 4LF9F 4RUCA 4ID5B 2HNZA 2QA4G 4KIAA 1T95A 3PV8A 2QO3A 3KG4A 2XLJA 2XCPA 1VQ5S 2OMLA 1VFJA 2IJNA 5C24A 5B09A 1J5OA 2GHWA 3UPFA 3BGRB 1S9GA 2FD2A 3AH6A 1VBZA 1H3DA 2JLEA 4CO4A 1T03B 1LWEA 2WSCC 2IAJB 3S01A 4DG1A 3THPA 1J5EF 5DDQC 4Y2CA 1C4CA 4EEYA 2GMLA 2UZAA 4EUVA 2WCXA 3W2WA 5LSLA 4OZNA 4ED1A 2BACA 2KHCA 5T7LA 5CD4H 2WSFC 1RYRA 2UVUA 3OTEA 3H8YA 3M6WA 3JTOA 1WG5A 3PIPQ 2WOMB 4QIGA 1C1CB 4ICLA 1KQGB 3PR4A 3M1VA 4ZA1A 4NLYA 3UD4P 2XMUA 3TNVA 1HNVA 2RDIA 2LXFA 3K5OA 4ES1A 5FDLA 4DS5A 1XMOF 3MTJA 4I67A 4N47A 3MM5A 3DM2A 1A7GE 2CJBA 1XWLA 2D41A 3MMCB 4OQJA 5DGBA 4PG5A 1VJWA 2ZUGA 3TX8A 3BO3A 1CPZA 1K1QA 3CD0A 3V6KA 4H54A 5KFLA 1NH7A 4NYOA 1CG2A 2HS3A 4QWAA 5E41A 1BLUA 2CQIA 4DSJA 2E1AA 1NJWA 2N4CA 2AJQA 3DRSB 3LAMA 2JJ4D 5B0AA 1KLMB 4BCAA 3CULA 5EHHA 3OR2B 2P9EA 3MD1A 1VGYA 2JSXA 3C66A 2CZVC 1HNZF 3KLIB 3MF5A 2XCAA 1JJ2R 1VRUA 2EFQA 3RB0A 4ZDNA 4B3SF 4CH1A 1B64A 4KSEB 1RK8A 4C0HA 3QGGA 1HD0A 2E1MC 4X4TA 5J2PA 1R3NA 1DZ5A 2HLUA 2IC3A 1IQTA 2LEPA 2YWFA 2ZOGA 4A8XA 4N5SA 1TZ0A 2I2YA 2L41A 5B0FA 4PPDA 4HYKA 4TLQA 2R7VA 3OFEA 3ULHA 5J1PA 2RF2B 2ZH4A 4MK8A 3WZ0A 2Q79A 1UVIA 2DGQA 5D6GA 1N33F 1D9FA 1T8EA 2MZ1A 4OFZA 1TKZA 3ZC4A 3HZGA 4XAKA 3CXCR 4FF2A 2PIIA 2GQQA 2QSFA 5I3UA 3T9NA 1N56A 2ACYA 3KK3B 3NNAA 2ZFHA 1R7IA 1NKBA 2QMXA 5EDWA 2R7RA 3P96A 4CO1A 4ECRA 2IAJA 5IT9Y 1D3WA 3NP5A 1BQMB 1HNXF 3OTDA 3IR6B 5DO2A 4WFBQ 2Y0SD 4F3QA 1B0PA 1FXDA 2DPIA 1RT3A 4FVMA 4K59A 4Y00A 1LOUA 2A18A 2DH9A 2V9KA 5J2MB 5T14A 3MFHA 1SKWA 3PO5A 1Z1ZA 3M8PB 1FJ7A 2FHOB 3MMBB 1GXTA 4C2MA 1CVJA 3SDEB 4AXIA 4OLPA 3AJ2A 4KV8A 5D4PA 3IR5B 1KHVA 4ZLPA 2QV6A 1T7PA 1TV6A 2EFOA 2JL9A 2WSEC 4FNHA 3ISZA 3QGIA 1Y3KA 2CQPA 2D74B 3QWPA 4K4WA 4LF5F 1OWXA 3HI9A 2WHOA 5CCMA 2CPYA 4DWIA 4NPOA 2BJEA 4X4NA 5EGYA 4HI2A 1K9MT 4ELTA 1HWJA 5IWAF 3F44A 4A8WA 4IRCA 4MYUA 3MMCA 4ZVFA 1HQUB 2ZH2A 5FIIA 3R3TA 4YDXA 2C2EA 2JFKA 2KHDA 1X9MA 1HNIB 4DL0C 2VA2A 5F8NA 1S99A 2PEHA 4FXVA 4WK1A 1U2FA 1LFWA 1G3OA 2ROEA 3CDWA 4CNZA 3OL6A 2IBOA 2ILZA 2L9DA 1VHFA 3FJ2A 1AROP 3DLLQ 2VPYB 3N28A 4M95A 4CO2A 2KT3A 1N0UA 4DN9A 2VODA 3RZAA 2E9ZA 1NNDA 3OR2A 1QE1B 3M8RA 3BSCA 3DC2A 4RW7A 3LP2B 4EZ9A 3KLIA 5DDRC 1WG1A 2B9YA 3GFZA 3MEDB 1JLBA 3GFXA 2X3GA 2XULA 2V8DA 3JSRA 1RT6B 2XNQA 3MR6A 2E29A 2MZQA 3Q22A 1S1TA 1IQZA 4J9OA 2XMTA 4ZOSA 1R8HA 5H9FJ 2CYYA 1BQXA 3DFEA 4YHHF 1C1BB 4ZVHA 4DQRA 2DIUA 5I42B 3LP1B 2PN6A 5C25B 1KR4A 1HW8A 1FDAA 3QIPA 3TAMA 3Q8PB 4WFXA 1TUVA 5AXKA 2W9AA 2D3UA 1XR6A 4NZ0A 1C4AA 2JLFA 3MUVP 2E9TA 2JH3A 4RNHA 3TOQA 2DCLA 2YNHB 3L7PA 4R5PB 2J6SA 1YG0A 2HZCA 2XI3A 2E5JA 4ELVA 3CCWA 3K0JA 2F8HA 1KONA 4RU2A 5CXTA 2ZD1B 4WU3A 4XK8C 4ELUA 4TKTA 3JSYA 2PDAA 1G2EA 1NHUA 5CH7B 1Y5NB 2HVZA 2UXDF 3T19A 4WYWA 3KK3A 1HNWF 1LV5A 2IRYA 1LFPA 2C3UA 2XG8A 5JVHQ 3FGVA 4DJBA 2YKOA 4O4RA 2KRBA 4KHMA 4IQMA 5L1LA 4RU9A 1UL3A 4ZMMA 4PKDB 4B9LA 1S9FA 1J2VA 2K2PA 5DG9A 2L3MA 4DV3F 3G8TA 3H4BA 3MCSA 2GMJA 1M5VC 2YX4A 3GV8B 4QWCA 2J9DE 2M88A 3QZ7A 3OHAA 2M4MA 4NLOA 4QCLA 3MMBA 1S1UA 1LWFB 1S6PB 1ZM3A 5F8MA 4WE1A 2E1CA 2HGLA 4IFVB 2CPFA 2ZNZA 1Q81T 1S1XB 2NS1B 4O3RA 1BY9A 1RT5B 4Q43A 3EGZA 3LUYA 4QBUA 2NPFA 5F8HA 4OI0A 1LK5A 1WEZA 2M8DB 1UJ5A 4ZP7A 3DLEB 3NMRA 2KZZA 1RT7B 4HH0A 1SJQA 1UVNA 3A8EA 5KFFA 2WB1D 3PJWA 2N82B 2EPIA 5K14B 5JUMA 1HQUA 1RA7A 2JDJA 1HBNB 1HNIA 2V8VA 3SV3A 4MH8A 4ED5A 1F2GA 4K4YA 1Q1KA 3P49B 4I1TA 5K8PA 1JKHB 2E5HA 2E9RX 4DEZA 2VQEF 4TY8B 4LFBF 4MK7A 1KQFB 2VG7A 1UFWA 2YNIA 1M5OC 3DOLA 4K5RA 3ZZTA 1HWUA 2HVHA 4EYIB 1WEXA 1RJJA 1QY7A 1VS3A 2NSBA 3KK1B 2HRYA 5KFGA 3K5LA 4A4JA 4IOBA 4YB7A 2VC1A 4NCGB 4NRUA 2W9BB 1KSPA 1GTHA 4NL5A 1JX4A 3MURP 4PG8A 3OUYB 4MKAA 1F5CA 1FKOB 3HHLA 3B78A 5K8OA 4P7VA 1OQ3A 1Y4ZB 2HHSA 4ID8A 1SJFA 1Q4RA 4B17A 1RT6A 3PVXA 1S6QB 3BF4A 3L3CA 3RU0A 1BGXT 3UCGA 5CHCB 4HT7A 3MR3A 3MPWA 5L38A 3U1MA 3GQCA 2JOQA 4LQ3A 2LQBA 2R7QA 5C25A 1RT1B 3I5BA 4LQ9A 2YWEA 1JNRB 4HI1A 3WDOA 2CPZA 1V6HA 4J9MA 1DHMA 1IKXB 4R5PA 2GO9A 2YNHA 1DJ0A 4RNMA 1KOHA 5J2QA 2K3IA 2J8AA 5KFAA 3M32B 2R2UA 4DX8H 4DR7F 2WTFA 4FF3A 1X4BA 1T05B 5IM0B 4QWEA 2VZ9A 4X62F 2AJ0A 3SFUA 2BZ2A 4F2SA 1ZPWX 1Q78A 4DL4A 1UEUA 3CD5A 1N0VC 4X4RA 2LU1A 2X51A 2CPJA 3N6LA 1G6BA 2BANA 3SCLE 2MHEA 2ZM6F 4NLRA 1ZAVA 4CO5A 4DS4A 1NAQA 3MUMP 3BN7A 2ASYA 6FD1A 1M5SA 3RBDA 1DTQB 4M8LA 2KTQA 4HTJA 3VZHA 4QJVA 2M7SA 2K1RB 2ZC3A 3QMQA 4JI5F 4L72B 2QA4S 3S8SA 3IAS9 3OR1B 5KFTA 1RT4B 2YH0A 3OW2R 2MDAA 2VG6A 1LW0B 3NLCA 2W4PA 1HBMA 1S77D 1S6PA 3O6QA 2RRAA 3T1HF 3TA1A 4RLEA 4CT8A 2FVQA 1H7WA 4IFVA 1Q7YT 5LMNF 1IXKA 4MIWA 4OJGA 4KJIA 1TKTB 4PWUA 3DDNA 1A9NB 1VI7A 1RT5A 3CSKA 1DARA 1HARA 4PQAA 1T02A 2Y1IA 2GW8A 1H0HB 2RQ4A 4J9NA 3LALA 4OIXA 2UXBF 5IFMA 1RTJB 2DRBA 1RT7A 2HWTA 3TA2A 2DVIA 1S1VB 3IWNC 3LGNA 2B56A 5K14A 1XR7A 3M9OB 4G6VB 1HBNA 3ICLA 5GAHI 2MPUA 4QIFA 3BO2A 3ZZRA 3OSPA 5F3TA 1JIHA 2FHMA 3OL7A 1KS2A 2DTJA 3GG1A 4PWDA 3M2RB 2HAIA 1XMBA 2O1PA 4JV5F 2W24A 3OHBA 2AGQA 1CSJA 3OVSA 1K1SA 3PFEA 1JB0C 2LEAA 4NWBA 3KK1A 1AFJA 2FVSA 3CDAA 5E33A 1ROFA 4NCGA 2FB0A 4JOUA 2Z4PA 4IO1A 1UVMA 2J9DA