2LDIA

Nmr solution structure of ziaan sub mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
PLKTQQMQVGGMRCAACASSIERALERLKGVAEASVTVATGRLTVTYDPKQVSEITIQERIAALGYTLAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc-transporting ATPase
publication title Cyanobacterial metallochaperone inhibits deleterious side reactions of copper.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Hydrolase
total genus 12
structure length 71
sequence length 71
ec nomenclature ec 7.2.2.12: P-type Zn(2+) transporter.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ldiA00
3GZ7A 3KKFA 1KVJA 2XMVA 2RU9A 3KG0A 3KG1A 1VQSA 2LDIA 1QUPA 1X0PA 2IYGA 1K0VA 5F0UA 2FB0A 1N5QA 1S6OA 4OJGA 4Q2MA 1SI9A 2LQ9A 3DCAA 1YJVA 2RSQA 2XMWA 4HI2A 3I9ZA 3BR8A 2N4DA 3LO3A 3CJKA 1U7LA 2EW9A 2ASYA 2GV1A 2KYZA 1FE4A 1FVSA 1N5TA 5B0EA 5B0AA 2GCFA 2N7YA 4Y2MA 1YJUA 4A48A 5IXUA 1FEEA 1Q4RA 1SQEA 1Q8BA 3HHLD 4A47A 1Y3JA 2BJEA 4YEAA 4NPOA 4OJ1A 3BB5A 5A6PA 3HF5A 2KT3A 2RILA 3MZIA 4DL0C 1AFJA 2OFGX 3LGNA 4NL5A 1N5VA 2IFXA 3WDOA 1TR0A 3HX9A 4DPOA 5B09A 2QLWA 5T7LA 1LQ9A 3KNGA 1APSA 1AFIA 1N5SA 3FMBA 1X8DA 3E8OA 1SB6A 3UDCA 5F0WA 1FE0A 2K2PA 2BBEA 2GGPA 2AW0A 1WD6A 2Q3PA 2RMLA 3QMQA 3VTIA 3TOQA 2GO8A 1Q8LA 1KVIA 3BM7A 4OJHA 1S6UA 3QGPA 1TUVA 2OKQA 2QYCA 4OIXA 1FVQA 2L3MA 2ROPA 5B0BA 3HHLB 2BJDA 3TNVA 1Y3KA 1W2IA 2PGCA 4YDXA 4HH0A 2QIFA 3IWXA 1TL4A 3F44A 4HI1A 2KT2A 2HLTA 2FIUA 3BGUA 1FD8A 2KKHA 1JWWA 4OJ3A 1TL5A 2PD1A 3DXSX 2K7JA 2GFFA 2XMTA 3MCSA 2JDJA 2HLUA 2K1RA 2XMKA 2OD6A 1FESA 1RJJA 1V3ZA 3HFKA 3BF4A 4Y2IA 1YJRA 1Y0HA 4Q2LA 3BN7A 5KAKA 2XMUA 3CJKB 2VH7A 4HL9A 3FGVA 2W4PA 4QOTA 5A6WA 2CRLA 2K7KA 2ROGA 2W4DA 3TRGA 1R6YA 4A46A 3BDEA 2BUNA 1Q53A 2LXFA 2XMJA 1YJTA 2OAUA 4DN9A 2AJ0A 1KQKA 2ZDOA 1CPZA 1GXUA 3IWLA 4U9RA 1URRA 2W4CA 4HH1A 5T7LB 4A4JA 2HIQA 2LQBA 4FNIA 2N4CA 1OQ3A 5B0FA 2OMOA 1P8GA 2GGPB 1P6TA 1OPZA 2G9OA 2OD4A 3FRYA 3K7RA 1TZ0A 1IUJA 1GXTA 1MWYA 2ACYA 2FHMA 2XMMA 1AW0A 3HDSA 2QLXA 4ZOSA 4F67A 1YG0A 3T9NA 2HFOA 1Y9OA 4EFAC 1OQ6A 1CC8A 1XBWA 2HQIA 4ZA1A 5B0CA 2OFHX 1ULRA 1X7VA 1YRXA 2ZDPA 3HHLC 4Y2KA 2IYIA 5B08A 1VQYA 2FTRA 3HHLA 3LGMA 1MWZA 1CC7A 1JK9B 2OP5A 1OSDA 4FNHA 5B0DA 2AJ1A 2VV5A 2BYCA 5K9FA 5B0GA 2GA7A 2K1RB 2ROEA 2HFNA 2AP6A
chains in the Genus database with same CATH superfamily
2HRTA 3A8EA 4TY9A 2AF6A 1R7IA 2FC8A 2GV1A 3E2EA 2JNJA 1FDDA 2Y8YA 4EEYA 4QIVA 4CCHA 3R7BB 2QLJB 2MY8A 5ADZA 1TKZB 3T1YF 1IJEB 3BGRA 2BBEA 3QMQA 5JVGQ 2MHEA 3AA9A 4H4MB 1QDUB 1HNZF 1U48A 2JC1A 3M8SA 4NXMF 2J76E 2ZM6J 2O67A 3J80Y 2W1BA 4GVBB 2HNYA 4CIOA 1YBUA 3VF0B 1X5OA 5ETOA 4CNYA 2VIHA 5D0GA 1URRA 1XMQF 2ZD1B 3SSSA 2RKIB 1TVRA 2YNFA 2RB7A 3M8WA 3UE2A 4FVMA 2HZCA 1D9FA 2E5LF 4PWUA 2V50A 1UEUA 4Q7AA 1MU2A 1S1UB 2KJVA 3D1QA 2M5YA 3OTCA 1SJ3P 2F5GA 2MHNA 4QW9A 7FD1A 4UQGA 2QMUB 2A18A 1TUGB 3TJ8A 2XSJA 4A48A 2GVZA 2MQQA 2ZITA 4H4OB 2EK6A 2KT3A 2HQDA 2H65B 3OL8A 4OI4A 1RT7B 4GO5X 2DO0A 3ZTQA 4RW6A 1S9FA 1QAXA 5KG6A 3VV2B 1V5VA 4FYDA 2IDEA 2C2NA 3AOBA 3BSOA 5KAKA 4B9SA 5K8OA 4X64J 3FK4A 2AD9A 4IDKA 1CLFA 1K47A 2K7KA 4MYTA 2C22A 1HPZA 1I3OB 2DNRA 1UL3A 4DR1F 1HNIB 2FY1A 4B3RF 1N6QA 4HEA9 2HFOA 1G1XA 1Y5IB 2AZ1A 4NLRA 3PRVA 1XJWB 2C3YA 2QGFB 4Y65A 3ENWA 2BM1A 2NSCA 1H7XA 3GMGA 3FCHA 3QGIA 2VG5B 5KFWA 2RIJA 3FDSA 1VOMA 3IAM9 3ULHA 3WX4A 5B0AA 1FT8A 4NASA 5HAOA 4IQXA 1O5JA 3RB4A 5L9NA 3MM7B 3QATA 5F0WA 2PA3A 2QE5A 5C25A 1VJQA 4NXNJ 3PW5A 3G6ES 4I6AA 2VU5A 2UUAJ 1MG7A 3FEXB 2B51A 4X2BA 1UVLA 4HACA 3O44A 3P4UB 5L9XA 4DV3F 2YBVA 3D68A 3JTNA 1JLGB 2IM3A 3PJ9A 2EKNA 5KFMA 4LFBF 4FYXB 4C0BA 1FXDA 3FGVA 3TA2A 4C11A 3W5XA 4W92B 1QAIA 4KGXB 4ECYA 1ZTWA 1DQAA 4IFVA 1PYSB 2ZWPA 2XLJA 2W4CA 5F41A 4BBYA 3U1MA 4OYXA 1SJ1A 2NUUG 5KFIA 2LU2A 5C24B 1VI7A 7AT1B 3T1YJ 1FRXA 2OFHX 3UDVA 1RHQB 2LXUA 2VICA 3V81A 4LVOP 4M95A 4K7QA 1X9SA 2V34A 4LIRA 2E44A 4C3LA 2CPFA 4WXWA 3BJYA 4DSKA 1GEHA 3P45B 1RXOB 4USUA 2HRUA 1A7GE 5A6PA 2FLPA 2MKSA 1JWWA 3R9LA 2B0GA 2YWWA 1XMQJ 3A3PB 4NCGB 3AODA 1N52B 2W9BA 3J81U 3CTRA 1RB0A 2FVRA 2K1RA 1IKVA 2B3TB 2E5LJ 3GYXB 4ANEA 5FLXY 2CXEA 2AGOA 1CJKA 3VQSA 2F1FA 3M4XA 1S79A 4KQZA 1FTCA 4N7TA 2FJXA 4DN9A 2R2UA 2I5JA 2JZ5A 2HMIA 2A0FB 2BJ9A 4TYBA 2MJNA 3M8QA 3A8IA 2Y8WA 1H2UX 5HBMB 4P6QA 1HI0P 1NZ8A 4J9NA 1NSAA 4NLOA 4M5JA 5F3TA 5KFOA 2FGCA 1YJ9S 2RQCA 4ECUA 5EX0A 2IRYA 4LBHA 4KH1B 4I6YA 1P1LA 4CLFA 4CLUA 2AJ4A 1RT6A 2HQCA 3MPDA 2XZTB 2ZC3A 3TR5A 4UQTA 1KWMA 1ZPWX 3TZYA 5J1PA 3UVJB 5GAEI 2AGPA 4CZCA 2HHUA 4NI2A 2BOPA 2LMIA 3H5YA 2GO8A 4X4RA 3CPWR 1BMQB 3NCRA 4USTA 3ZTSA 3I5CA 4DR1J 2QL7B 4WU2A 4B3RJ 3U27A 2XCAA 2FIUA 4FYVB 5EGYA 3OJSA 3LP2B 4QZVB 4WU3A 4P73A 4XPEA 1PIEA 2WVCA 4ZHRA 2FZCB 2KDOA 3R5BA 3IBWA 3FFIA 1IM4A 5AT1B 3LWMA 3HSJA 2I2YA 1REGX 1SL2A 2U1AA 1S4EA 5CA5A 2W7AA 2O66A 2UXCJ 5D6GA 2ZJPQ 4FNHA 1C1BA 3C3LA 3SIPB 3DYAA 2HBYB 2HHPA 1UWBA 1FRKA 1TKDA 2E7WA 3VCDA 1I5OB 3O3LA 4K4XA 3CJKA 4RNFA 1Q4RA 4BCAA 2XCPA 2D3O1 2ILZA 5DDRC 4JV0A 1UW9A 4C8OA 4ZVSB 2R2TA 1B7YB 2VG7B 2ZKUA 4ECVA 1T8EA 3MEDB 4NZ0A 4L3NA 2YX4A 2PSZA 4MKAA 3CMAS 3MM6A 4PWDB 3RU0A 2XS5A 1U0HB 2R9LA 4O3RA 2OAUA 1X60A 1SCJB 2B4PA 2V8GA 1ELOA 4HYKA 1FNOA 5GADU 1YIJS 2IJNA 3K7RA 3THPA 5M2UA 1JXEA 2QLXA 3NNHA 3O1LA 4M5HA 3T19A 4O0IA 3CDWA 4UF4A 4ZN3A 2J6TA 1RTIB 3AQPA 3BKTA 4DV2F 1LWXA 3I5BA 3K57A 5KFUA 1IBMJ 1TAUA 1NEEA 1PSDA 2K3KA 4YR0A 1V6HA 4M63A 4USHA 4DQSA 1AZSB 1VRQC 3TANA 1VC0A 3MMAA 4DCOB 1NK4A 3NY0A 2CDQA 3HMJG 2HK2A 3O8WA 5B7WA 2DB1A 3VZHA 4DI6A 1HBNB 5HMXA 2BV3A 4IOCQ 1K44A 2Q43A 2XMTA 4ANCA 2RDDA 3CB4A 5DLGA 3J7A1 5KFAA 9ATCB 3DLHA 3QT7A 3M1VA 3CUNA 1URNA 2O3DA 4CLPA 2XMJA 2JEIA 1GX5A 5E3CA 2XMAA 5DGAA 2IA6A 1VGYA 3CNQP 1JLQA 3M6UA 1LEOA 4ZN1A 1FERA 2V63A 1U2FA 2UV8A 4QIFA 1FFGB 2XEXA 2D9OA 3LAKA 4DEZA 3MCMA 3KHGA 4DUZF 4F02A 4UZBA 1ITPA 3V4MA 1VR6A 2NREA 3BSNA 4ELTA 4OV6A 2VFUA 5CYQA 2KZMA 1QD1A 2JX2A 1FVSA 4Y2MA 4F0MA 3D6HB 2DKOB 1S1XB 2RD5C 1RZMA 4NOHA 1HD0A 3MR6A 3WQPA 4CI0B 1VLOA 1SB6A 3OVSA 2YXLA 1OIAA 2A3JA 1FKPB 3D0GE 2EI5A 1DZ5A 3AXMA 1RHRB 1HYSA 4NX9A 3T3FA 1FESA 1F3FA 2PMHA 4A8QA 1N32J 1JNRB 3HVTA 3DLLQ 1HW8A 1DRZA 3EE3A 5H1SV 3RBEA 2CQGA 4ECZA 2R8IA 3T9ZA 4RUBA 2CQ1A 3IXQA 3CCUS 3A8KA 1UZHA 2UUTA 4EBCA 2A10A 4B9NA 1RHKB 2ZDPA 3R8YA 3M8PB 4J91A 3W62A 3ZTOA 1NMEB 3W5YA 3RTVA 2XBPA 4GKJF 1KQSR 1X4EA 3LP0A 1RK8A 4XPCA 2XYGB 4B9MA 1DTTA 1S1WB 2RNEA 3M9MB 1ROFA 4ZP8A 1NJXA 8ATCB 2EKYA 4FZVA 2HKEA 4XAKA 4WJBA 2B8QA 4HH0A 4BS2A 3BGUA 3OXLA 1WG1A 5ETMA 4AQYJ 2HWTA 4J9RA 4NLYA 1LXNA 4YMEA 4UT4A 4YB1P 4EK2A 2V2ZA 1GNKA 2I6WA 2IHR1 4W90B 3PIOQ 2E5HA 3X1LB 2PI5A 1F9HA 5IT4A 5MLCV 4ER8A 1HQEB 3JTOA 2QTWA 3AQOA 2OPRB 2MDAA 4K5RA 4F4WA 4I6WA 4V1Ak 2LP4A 3CJ3A 5J1EB 3CULA 1BWEA 1B99A 3KG0A 4IO9Q 3BO4A 2V94A 3OFEA 1TL7B 1HBOB 1FE4A 1RWWB 3JAMY 2KVIA 3PW4A 4RU9A 4NA1A 3W63A 4DPXA 5J2QB 1R8HA 1EX8A 4QU7A 2GZOA 3M30B 3WIUA 2Z30B 1TUVA 5JMNA 2KN4A 4ZVQB 1YTYA 2VF3A 2K8GA 3I0SA 1N5YB 1MMNA 4RR5A 1QUVA 2J6UA 5DQHA 3JSMA 2VONA 5CD4H 3HFKA 2DH8A 2XM3A 4H4KC 1KP6A 4J9LA 4DV0F 3RW7A 3ZNJ1 5LMUF 1YZ6A 3H42A 3KJNB 2QSWA 3W9JA 3PZPA 5K5MA 1QVFR 4F26A 2LQBA 2A2DA 5DM6Q 3CJQA 2H48B 1JQGA 1U26A 1UA0A 2FJEB 4XTTA 2ZE2B 4RUAA 3KHHA 2HPUA 2N7CA 1FJEB 1YJNS 5JUMA 4Q45A 5U47A 1H73A 3J81j 3NAHA 1DFDA 1NO8A 1CSJA 3CMES 2CNOB 2EW9A 3QSYB 3NOCA 5GAGI 2JRSA 1M5OC 1WELA 2OPQA 1QJHA 2R8GA 2IY5B 1N5SA 1GMWD 1IVZA 4OYZA 1HR0F 1EP4A 3M2RB 1D1UA 1NNDA 3AT1B 3EGVA 3LAMA 4HDGA 1VDHA 1IKYA 6FD1A 1WF2A 2F65A 5K14B 2ZH4A 2BE2A 1HNXF 4Q43A 2FDNA 3FQLA 5KT5A 4JI8J 2Q1LA 2G0CA 2H4YB 1J5OB 2CWKA 2ZH8A 5G4DA 5LSOA 2V68A 5BYRA 3QJLA 1GTEA 5FIIA 4LF8J 3DOKB 4URSA 4NZ6A 3LA0A 3FRYA 2BW2A 2XTJP 4WTYA 2MPUA 2HBQB 3BYRA 3DLGB 1ULRA 1YDLA 1REVA 1CVJA 4M5GA 3CCLS 1NXIA 4F3OA 3FRZA 1IR0A 3C15B 4DFMA 2VA2A 1F60B 2MKJA 3JTPA 1X0PA 2M52A 2EC0A 2XY7A 3Q2TC 2X51A 3I9ZA 2EXUA 4EUVA 2FUG9 3ADAC 1Z4UA 3PO5A 2HK3A 2KM8C 2Y1LB 2AEFA 1D8ZA 4PG4A 2KT5A 5KFJA 1L3VA 3SSRA 2BJDA 2DGOA 2LVWA 1HNVB 2XWYA 3ENQA 3FCVA 4Y2CA 2Y1RI 3BGFA 3HI9A 3O6QA 1T0TV 3T1HJ 1ZYQA 4I7FA 2BRKA 1BQMA 3ZC4A 2GIQA 2LEAA 2QZ8A 1WKJA 1OYEA 3WC0A 4FPIA 3QLHB 4KKOA 4FN5A 1S0VA 1VLYA 3R1HA 3U7JA 3V2UC 1U49A 5EUHA 1OQ3A 1UWAA 3GCWP 2NSBA 2EEYA 3EGNA 1NB7A 2GHPA 2RRAA 3N6NA 3GIMA 2GO9A 2MQNA 1VC6A 3TUPA 5IT0A 1BQNA 1RYRA 4NA2A 3FC9A 3B78A 4G3IA 5CQGA 4DCJB 1S9GA 2J9CA 4LRCA 2DH9A 3OD2A 3GYGA 4KO0A 2CQBA 3QT5A 2CPYA 1QSSA 4OL8A 2HGMA 1N5VA 1DTQB 3PFOA 4ES1A 3I87A 2CG4A 1OMSA 4F8RA 4PRFA 3DLEA 1N34J 4P2XA 2YNGB 1E6VA 1G2EA 2R7SA 3KJFB 4HTJA 4OHXA 3MR7A 2HAFA 3KNAA 4WKYA 2J8SA 2M88A 4MFBA 3ZNUA 2WAQD 1Y00A 3AD8C 2HNZB 1R6YA 2OEJA 2JOQA 4YB7A 3THTA 5AXLA 4ED0A 4F25A 3ETOA 4IG0B 3J81Y 3NAIA 3TW0A 1HR0J 2Z57B 2R7VA 5CH7B 3FQKA 3UR3C 1VHIA 4YS2A 4U6PA 1N33F 2R7UA 3P8BB 1VRUB 2D7SA 1HNXJ 4L6V3 4ZK7M 2Z56B 3DRXA 4NEYA 3C8YA 5L1IA 2QLWA 2FPHX 2MQ8A 1CS4A 2C1EB 5IV4A 3SYZA 3D66A 4BDPA 3KWMA 2B9WA 2N82B 3UPFA 4RWWA 4ZPTR 5BR8J 2OPPA 2OHDA 2P2CB 4KY3A 3MHYA 1TK0A 1Y7PA 1BC6A 4P10A 1TMJA 2PI4A 4ZITA 1CJUB 1RT3A 4ZIWA 3WIVA 2J0WA 3MMBB 2VODA 1P6TA 4USJC 1RWVB 4JI2F 1GXTA 1ZS6A 2VJVA 2DGSA 3PM9A 4OYPA 4F67A 3BSCA 2QA4G 3NGTA 2ADCA 3HHLA 3QWUA 3KLEB 2ROEA 3J7ZT 4DDFA 3HZGA 3OT9A 3Q8YA 5KG5A 2LQ9A 4DR2F 1U7LA 2MLYA 5G0RB 2BVZA 2ALYB 3KDNA 2QSFA 5KFYA 2OPSA 3H5UA 2R7WA 5ITHA 4WZQA 4MT1A 5HN0A 1L3SA 1QSYA 2D3ZA 2XHWA 3I96A 3TAMB 1KSPA 2HHWA 2BE9B 3CC4S 3IS9B 1W2BR 2UU9F 3DHXA 3QWPA 2W24A 2VG6A 3PJXA 3CJTA 2QL5B 3R6LB 2JDJA 4U96A 4X66J 1YX2A 1NDKA 4LSNA 2P9GA 3I4HX 1L3UA 2XYHB 3BYPA 1K1QA 2EK1A 4FXDA 2UVVA 3OLBA 3A4TA 1RYSA 4IFYA 1LW2A 2XS7A 4CO0A 4NLWA 3MUVP 4A8XA 2MGZB 3EYZA 4MKYA 2GIRA 1U1OA 2E66A 2MZRA 2CYYA 3AFGA 2YY3A 3N9UC 2IVFB 1LOUA 3CDAA 2WVDA 5DQGA 4IG3A 3DRSB 1SXLA 1IJFB 4J37A 4ES3A 4O0NA 3MM9B 5F8MA 3UCZP 3HP6A 4KR0B 5C2CA 3MCOA 3M9NB 2KYXA 2VPWB 4U7UK 2LA4A 1Q82T 1UP1A 5KT6A 2V9KA 3IO1A 3D6MB 4FYYB 1X4DA 1RTJB 5BYSA 1SV5A 3TARA 5D3GA 3UCUP 4ILLA 3TP2A 4HLBA 2ZVIA 1HKAA 1RQ0A 4WWSA 1LV5A 4NMXA 1HWLA 4RW7A 2YWFA 3DM2B 3C6UA 4LR9A 3OL7A 3VZIA 3DRPA 3HHEA 3B4MA 4U9RA 2IVYA 2CJQA 2XO6A 5A76A 4HR2A 3F73A 4LMZA 3MM5B 1CEZA 1KTVA 3B6BA 5FJ4A 1WSVA 3QIPA 3KK1B 3TAQA 3GONA 3LGHA 4ED4A 1J2VA 5A8KB 5HJYA 1U6FA 2F3JA 1MROA 2HVDA 5AE3A 2E1MC 3Q8QB 3B8HA 1FXRA 3K5NA 3OR1A 4DV6J 1I94F 5IT9U 1RAHB 1JJ2R 2DISA 1GAOA 1MMDA 3QRPA 3KLIA 3C66A 3UWTA 1BUXA 1HBUB 3L7OA 2KB2A 3GP9A 4KFBB 1JJ4A 4PXDA 4WP9A 2BJ7A 2JLFA 4B3MF 5K8PA 1IKWB 4USWA 2DGUA 3OR2B 4R0EA 4B3OA 3GIRA 1LW0B 1ZPVA 3BPSP 5KT2A 2PD1A 1F5AA 1X4FA 1WC1A 3R2CJ 2UZAA 2NXCA 3VGTA 2OTJS 2HW3A 1FNMA 2E9TA 5FDLB 5D77A 4OI3A 2L41A 3R5JB 1R0AA 4DR2J 3JB9k 4K8RA 2EFOA 2CJYB 3SFGA 2OH2A 1RDRA 4N8NA 5AXMA 5D4LA 4TY8A 1OQ6A 4G1QB 1R0BG 3W61A 4F3MA 2YKNB 2FZGB 4TU7A 1RISA 1DBDA 2UU9J 2BACA 1S0NA 1VQPS 4I56A 1Q8IA 4YP3A 2UUBF 1T3OA 2OI2A 3EM1A 1U8SA 4ZJQA 2E1AA 1LWEA 3RR8A 1RT5A 1IQZA 2EFPA 5GMKa 1SJ4P 2HNDB 4CM0A 1UTAA 4ZVUB 4ZP7A 3NBPB 1NPKA 5L38A 5I42A 4N47A 3AB4B 5DJBA 3RUBL 4RO0A 4FBTA 2GC8A 4URQU 2QO3A 4YHHJ 1XK8A 4PQUB 1TQLA 1QM9A 4KRWA 2XNRA 2G2OA 4YB5A 4JI4F 4TYAA 1PKUA 4M1KA 1SKRA 1NSPA 2QRRA 3SCJE 2KM8B 2PEBA 3OVBA 3LH2S 4N56A 2KRBA 3UR0A 3JXOA 1CC8A 1VS3A 3J80U 3T5KA 1N8RT 3GSIA 3KLFA 1JKHA 4JB8B 3EVMA 4FXVA 3ZO7A 4M5IA 2E1CA 2WZ1A 3ENVA 4B9VA 4TLQA 1KHVA 1K1SA 1U24A 1JLBB 3MUMP 2CPXA 1UVKA 1YBTA 4M5LA 4KT0C 2V4JB 4NA3A 1LWCA 2NUHA 2AJ2A 2PA8D 2ATCB 2QLFB 5D4PA 4A8SA 5CYJA 2FLLA 5EX3A 1AYEA 4U67Q 1WI8A 5B0BA 2E5GA 1TKTA 4YN3B 1PJ6A 4RW4B 3LPEA 1IBKF 3QYYA 3ET6B 1TVRB 2YNFB 2HRYA 3M2VB 3BS9A 1NSKL 3DLKA 2W2PP 3ZTRA 3CO9A 5DDPC 3R5CA 1TL1A 4DR6F 2GAHC 1RT2B 1J5EF 2HAIA 3OL6A 1LK5A 1OY6A 3UW1A 2VFRA 2V8VA 1SVDA 4B3SF 5CXTA 1WEYA 5J2PB 1UW4A 4DU8A 3H90A 4F7VA 4TU9A 4B3MJ 3SXLA 1NDLA 5B0GA 4IUFA 3W2WB 6FDRA 1RKJA 5KFVA 4IH5A 4JV2A 4OMFG 1JIHA 2FJDB 2I1RA 1SIZA 3MEGB 4ILMA 1XWLA 2KU7A 4AE5A 4DG1B 1IKXB 4Q8FA 5CZVA 1KLNA 3DMJA 3TYTA 3RYLA 3I5AA 3P5BP 2B6AB 4NCBA 2JH3A 2ILYA 3KYLA 3HULA 2WONB 3OUYB 3AOAA 2G0IA 2JWNA 4NYPA 2FQQB 3PCOB 4Q2LA 4K0KF 3M6WA 2F63A 4HL9A 2L48A 2UVUA 5HANA 3UD5A 1LNQA 1WC5A 1QSLA 2B9EA 1PJ5A 2QMWA 5DLFA 1V3RA 1HW9A 3NGKA 4WF9Q 3CD7A 3EPIA 2IJFA 3A3NB 2NXJA 4A8FA 1RWXB 4R5PB 3IM8A 3LGMA 4H4MA 5E0OA 2XMVA 4RJVA 3Q0AA 4MKVA 1GXLA 3ILOA 1FFSB 1N5QA 4GVBA 3PW2A 2E1RA 2OTLS 4M5NA 1OJ4A 2AIRB 4ZVEA 3D5MA 3FSIA 4DV4F 4HVZA 1S6PB 4DV1F 4JI4J 3W2VB 2PN6A 4I2QB 3MUTP 2ZD1A 1C0TB 4KHPJ 4X62F 2D9PA 5F8NA 2RKIA 2ABYA 2UXBJ 1H2VZ 3N79A 4C8YA 2FHKA 1S1UA 4OYOA 2HS4A 1L5UA 1UJ6A 2MQPA 4FF2A 3JSRA 1LWFB 4P2FA 4BC9A 5HQLA 4H4OA 2DEIA 1BXNA 4PXBA 4DR4F 1X4CA 4NRTA 2ZKTA 1AW0A 2V2QA 4ZOSA 2UVRA 1RT7A 5GAGU 4LF7F 4HHUA 2EBGA 1ZM2A 2OSRA 4UW2A 2O5DA 1RCOB 1IXKA 1TK5A 3FVYA 5BXIA 3I9V9 3M7VA 3D0IE 3CEDA 3M8YA 2DITA 1IBLF 1IBKJ 4P75A 3N5FA 2EVZA 2AYBA 3BQ1A 2NCKL 4BHQA 1IKVB 5E41A 3WDOA 3D2WA 3GU0A 2G2YA 3DI6B 3C14B 1HWIA 3EICA 1HNIA 4DR6J 1WHYA 1WHXA 3Q83A 4CLTA 2HHSA 4WPAA 4ZVOB 3MPVA 3U1NA 4C2MA 2ZH6A 4B3SJ 4FF3A 3MAHA 3D0HE 2CJKA 2ZOGA 3PJWA 2B9XA 4DSIA 3KLHB 4OZ0A 4LF6F 2KXNB 4O3SA 2VG5A 3QFHA 1KLMB 1WWHA 4P71A 3QAEA 3MM7A 5AJ3F 4DR5F 3H4BA 3UO0A 1WSRA 1YZ7A 2GHWA 2XQCA 4UTGA 2FLNA 1HHSA 4JI6F 1FJGF 4PPDA 3FBCA 1TAQA 1WI6A 3ZZPA 3DOLB 3G86A 3NP5A 4DOZA 1DAXA 3D67A 1N36J 3VAKA 4S0MA 4CH1A 1JLGA 4C0HA 5HJXA 5EWFA 3HZEA 3R7NB 5KOWA 3MM8B 2KFZA 1NRKA 5F3ZA 2ZVSA 3CT9A 2MKIA 2MLZA 4ICLA 2VOPA 3DKDA 5C24A 3EGZA 1M5KC 3EGWB 4TU8A 5MAOA 2HURA 2CZ9A 1IWGA 3K89A 3GPAA 2BRLA 3PR4A 3FZBA 1CULB 3MMJA 3KK2B 2JC0A 1PC4A 1GFWB 2VH7A 4RNHA 3NGSA 2UXDF 2J0QD 3DRRB 1NSQA 3QGGA 2HFZA 3FKBA 2LA6A 1XNRJ 1F5CA 5I3UB 3IAS9 4NCGA 1RBLA 5IWAF 2OGUA 2DR5A 3SQOP 3JYTB 2DHGA 3L7UA 2AZ3A 4LSZB 1RT4B 4ZLNA 4C48A 1RUSA 4DSEA 1NJYA 2LXIA 4OJ1A 3F56A 5KFDA 4ZCLA 2G4BA 3DOMB 5M2RA 2E9ZA 1X8DA 1PCAA 4XO0A 5HBMA 1H72C 1HWKA 2PMWA 4Z7CA 4KHMA 4QIEA 5HROB 2CJ9A 3MEKA 2KG0A 3NMRA 1F6TA 2ASDA 4CM2A 3R5AA 1YJRA 4X84A 5ETRA 2L9NA 3CIMA 4K5SA 1Z2ZA 2ZUGA 2KFNA 2ZHAA 4LF4F 1XR7A 2ZBPA 2MSTA 3ZZRA 4DQRA 3SZ2A 2HIQA 1TL3B 3KK3B 3FNNA 3UVJA 2CWXA 2MSSA 3R2DJ 4JI3J 5F8LA 2ZBRA 3BH7B 4ZVTB 3TEHB 4EYHB 3KKFA 3LP2A 2F8MA 2KHDA 3VGVA 2BZ2A 1QUPA 4NWBA 2XB2D 4JI0F 4FPRA 4NRUA 5F8HA 5IXUA 2OELA 2NXNA 2MEWA 5E3PA 3UD3P 2BKNA 4YR3A 3GJSB 3BM7A 4YR2A 2YNHB 1F5BA 2POKA 4JI6J 1FJGJ 4LF5J 2GHVC 4LSLB 1VHFA 5DRKA 1C1CB 1U02A 3BDEA 1FDNA 4DSFA 3R97A 1D8YA 1LKZA 2VASA 1FJCA 4CH0S 2OMOA 5HK4A 2BM0A 2GIFA 3ZZYA 2YKQA 2VG7A 2GVDB 5LOQA 2RE1A 1ZZNA 1RAGB 2P6TA 2GNKA 2LQ5A 3D7SB 4WTOB 3KTQA 3MEDA 4B08A 4FF1A 2W25A 3PX6A 2I0XA 3KG1A 4KJIA 2Q66A 2IDLA 2DH7A 3PY8A 1S6OA 3WX8A 4PWDA 2R7TA 4K2XA 2B4UA 3PACA 1U0HA 2HFVA 3GFZA 2NXUA 4XK8C 3BEGB 2VKZG 4LBPA 3HVWA 4RW9B 2R42A 2XC9A 4LRFA 2VBYA 2UXDJ 3PYFA 4F0KA 4L3KA 2WSFC 4JI5J 1ACMB 2D3OR 1LFWA 2XYPB 1RLDA 5IT9Y 3IFEA 1RTIA 1YRTA 3NMAA 1FXLA 1P27B 3GYNA 3ZZOA 1PYTA 3N01A 2B8PA 3TO8A 3BGLA 4KAIA 1Q16B 1AZSA 1FKOB 1S1VB 3DHWC 1T3NA 2PDAA 4GRSA 1YWXA 5AE1A 3FZ2A 3NCPA 2Y0SD 1TKXB 3PW7A 3VGUA 1T7PA 5DG7A 3DDKA 2C3PA 1RAJA 1NU4A 1HBNA 1GMWA 3H7HB 4LRBA 1M90T 1H38A 3JQMA 3EXYA 4QWCA 2DPIA 3QNWB 5T14A 4QYZJ 3SFUA 4X65J 3GFXA 4LF4J 1U6ZA 3FMWA 2DIUA 4QU6A 4M5DB 3VTIA 2NPIA 4RBUA 4WK3A 4ECTA 1BWVA 1U1KA 5KOXA 3QAUA 3EUNA 4OI1A 4TNOA 1FDAA 5A2QY 4TQSA 2AU0A 1UJ4A 3UN3A 1Q5YA 4EO6A 3CMQA 2KO1A 3FEYB 3HM9A 4OZJA 4JI0J 2IPOB 4ANDA 3ITHB 2C3UA 1S1XA 3HXMA 5CYMB 4C8LA 3I6PA 4ES2A 3CCSS 1X7VA 1FKPA 3GG0A 3RB3A 2HVEA 1JK9B 1S9EB 1EETB 1T9YA 1TTHB 4DL6A 3NG8A 4FKXA 1JJHA 3UDLA 1HNWF 2VA3A 1SQFA 1YJVA 2DNLA 4MK9A 3BR8A 1RA6A 5KFBA 1RWNB 5I4MA 3L95X 2XS2A 4MH8A 2WW8A 1WOPA 1S57A 4K4TA 4RNMA 2Q3PA 2WSCC 3SI8A 3R5DA 3GV8B 4WK1A 1RBAA 1CBKA 3M8PA 4LF9J 2HYIB 1K0TA 3NS6A 1XC9A 1RTZA 2MZTA 4AUKA 3BBBA 3BGOP 4A46A 3CCVS 1KS2A 1S1WA 4RLEA 4X4VA 4JV5J 1G7CB 3G8QA 4GVLA 2ZNZA 3K5LA 1HL6A 3QT6A 4FS2A 1C2PA 2DEJA 2Q79A 1ZAWA 2MKYA 3MAAB 2FJBB 1LXJA 3HT0A 4P2SA 4CO1A 4IOBA 1WDTA 2RHQB 4CWBA 2RSQA 4RW8B 1SPBP 3OTBA 1NHVA 3FBEA 2W9CA 4PWWA 3RGIA 2MQMA 2E5JA 1JLAB 3EXCX 1FA0A 3KNGA 3NGUA 4CRJA 5L1KA 1HQEA 2RMLA 3MEEB 1XR5A 2MLXA 2FHOB 3NKYA 5DDQC 3QJPA 4DZDA 2KT2A 2IC3B 3TVYA 3OTDA 1KNZA 3UQSA 2ZJRQ 2BJ8A 1Q86T 2UUCF 2I9SA 5J1EA 3K58A 1NK9A 2XMUA 6AT1B 4P74A 3V4IB 3ONQA 1Z2LA 3D1OA 4LRAA 1TL7A 1HBOA 3T5LA 2VKRA 1RHMB 4PCQA 1VCTA 4ZCIA 2AQ4A 5J2QA 1RAEB 4K4YA 4ZVFA 3HDSA 2C3OA 3M30A 1QY7A 2J7KA 5KG3A 3NGRA 3V6KA 1WG5A 2FTRA 4USVA 2PMZD 4ERDA 2EFNA 1N5YA 4YOEA 2AP6A 1CJTB 4F4KA 1R0CB 2XWXA 3IRXB 3ILLA 2KYZA 2V8DA 3ETMA 2ZH1A 3NWGA 2AJQA 3BO2A 4O3OA 2C3MA 2ZH3A 3KXDA 2JFDA 1F9EB 2G0JA 2AKWB 1BD6A 1FF2A 3BREA 2ZE2A 3K5OA 1JLEB 2RS8A 3MOZA 1WTFA 3AD9C 2IJRA 1TL5A 4DJBA 2CA9A 4AL6A 5A0YA 2LEBA 1U25A 1SJQA 5HLFB 2Y9HA 2D74B 1HNWJ 3THVA 2ZH2A 1P9QC 3N6MA 3PNIA 1U2RA 1K9MT 3G8SA 1HNZJ 4KC5A 1FWKA 4NXMJ 1MWYA 2MQLA 2J9EA 3DU6A 5LSLA 4PKDB 3M2UB 1IN0A 3C46A 3C6TB 5K14A 1ZAXA 1RWKB 2B4VA 1MWQA 4KGKA 4PABA 2DNOA 2VUGA 1DARA 2IRUA 1PILA 4PG6A 1NJZA 1J5OA 1WG4A 3WC2A 2V8HA 2ZBIA 4EMDA 2AMCB 2CJBA 1RA7A 4MJKA 3DOKA 1TR0A 1X9WA 1TU0B 2MKCA 4C7QA 1RABB 3KUHA 4I2PB 4X4NA 2ZEJA 2OEMA 3DLGA 3F44A 3HD1A 2MZJA 1HI8A 1WKKA 3NNAA 1T05B 3OXGA 3GJQB 3C15A 2IVMA 2KFYA 1YSJA 4M5MA 5SUHA 5H9FJ 3F41A 4YY3F 3CD0A 2F8HA 3BDPA 1NK8A 1LFPA 4X4PA 1HD1A 2PIIA 1KDNA 4MIAA 1MNEA 1GH8A 4P7TA 3PVXA 2C28A 4USIA 2C2RA 2ZH7A 2H3EB 2YPYA 3QZ8A 4FKYA 4C3KA 1EQMA 2X7IA 3CJ2A 3BPDA 3C16B 4NYOA 1CC7A 1HNVA 2YKMB 1E6YB 1AROP 1RE1B 4PG7A 1JLCB 1LK7A 1P1TA 3I4PA 2QFJA 4LIWA 4CLSA 1FI4A 4ZVPB 1N5TA 3H2UB 3ISND 1RGVA 3QLHA 1BY9A 2HG4A 4DL0C 3W5ZA 2SXLA 1WF0A 4WYLA 2HBZB 4CLWA 1AUDA 2PGCA 4QWDA 2HWHA 3G96A 3JSYA 5K8NA 1KD1T 4OX9F 3S1TA 2NYHA 3DDIA 2RF2B 8RUCA 3Q2SC 2W8LA 3TQ1A 3DRYA 3G9CA 3WZ0A 4U8VA 2KTQA 1HQ2A 1YJTA 4HKQA 4A8OA 4PAAA 3OL9A 4DL7A 4DQQA 1VISA 4FNIA 4NLDA 1DTQA 1RLCL 3OV7A 4DV3J 5ETKA 3JS9A 2B5JB 2PE8A 2VFSA 4LFBJ 2Y0BB 4K4UA 2YNGA 2VV5A 3GIJA 2GA7A 1UKUA 4X4OA 4M5KA 4F4AA 4I67A 3KUGA 1H2TZ 5F8GA 4I69A 1S59A 1WDDA 3TJAA 4ELUA 2VC0A 4ZJLA 3H8YA 3HF5A 3AAWB 1AXQA 3A3OB 4OV1A 4QCLA 5KG0A 4X4QA 2GS8A 3DGPB 1FK9B 4IG0A 3MOJB 4C6AA 1HHTP 4LRDA 5JJBA 4OJ3A 3RAMA 2ASLA 1H3DA 4DUTA 3QSIA 3I31A 1VRUA 4AT1B 5KFLA 4MAKA 2H1YA 3K0JA 5KFCA 3DGVA 2YKPA 1TV6B 3KJVB 2KHCA 1T11A 3SV3A 2R7OA 1OPZA 2X3DA 1HQUB 2IM2A 1UAWA 2M7SA 4UY85 2XSFA 2HS0A 3IN5A 1N48A 2M9KA 3R27A 5D0HA 1W26A 4O44B 4TQRA 2MZ1A 1M1KT 5L46A 3FUYA 1HIYA 3M8ZA 3PR5B 3KUEA 1CJUA 3T6BA 1PYOB 2DNHA 1XN9A 2BMBA 3FCWA 2ERRA 3CSKA 3MMBA 3ISZA 2I38A 3L9ZA 3EZUA 4HI1A 1UJ5A 5E3AA 3CCZA 3P5TL 3KLEA 1KR4A 1RWUA 2QFIA 3SQGB 4ZCKA 3G6XA 1A9NB 3TQEA 3PHTA 3SSQA 2HWIA 5SZTA 4ZDNA 5G0RA 4DX7A 2BQRA 3PKMA 1U1RA 3TX8A 1T9XA 4G1IA 4JI1F 4DZ6A 4TVAB 2V8PA 3TAMA 1VRTB 2VHGA 4ZA1A 3CJ4A 3IS9A 4MTPA 5B0DA 4OYAA 3X3UA 3GZ7A 2XZWA 1U1PA 3AY0A 4FXWA 3M32B 5F0UA 5LMNF 3PYEA 4OX9J 1UETA 4C97A 4IO1A 4KIAA 1JJCB 1HBMB 5F8IA 2YQ3A 2FHJD 1A0OB 1ZBTA 2X1BA 3CE8A 1U47A 2MGZA 3UNYA 2DXDA 3QRRA 2M2BA 1KVIA 2RDIA 4O23A 2VPZB 3BR9A 2YNIB 4CLKA 1W2IA 4KE5A 1JXLA 2XLIA 3DRSA 5H9EJ 2KZZA 3MCNA 2C2MB 3MM9A 1RJJA 1WJ9A 4TY8B 3OBIA 3GFYA 3KDOA 4KH0B 1T03A 2OJ3A 1X5SA 4OZ5A 1IM6A 1F2HA 2DNPA 4GC6A 3ZZUA 1RTJA 2HIYA 1TZ0A 4QQBA 5AXKA 4OI6A 4CLYA 4E0DA 3RR7A 4Y6IA 3V6HA 2V67A 1YRXA 3BBFA 2ASJA 4M94A 2IM0A 5K9FA 3CD6S 5ETVA 5J2MB 3IRWP 2DHAA 1FHTA 1C4AA 2AEMA 4KB7A 3IA0A 2AEJA 3NL0A 4KTQA 3DM2A 1EHWA 4RNNA 2XGPA 4DWIA 1KHWA 3ZXWA 2ZM6F 2J7UA 3H2VE 3IR7B 2FJVA 1IQTA 1M1GA 4DPOA 3L4BC 4K4SA 3I55S 3MM5A 4DV2J 3M9OB 2OKQA 3KK1A 5A8KA 4KV8B 4EGLA 3KG4A 4RKUC 2IBOA 4DV5F 3R5GA 3BO3A 2A2CA 4C3MA 1ICEB 9RUBA 5RUBA 4K50A 2P6SA 4ECWA 5A6WA 4LQ3A 4Q0BB 1HBUA 1FX2A 5M2PA 5T7LB 4QR2A 4KFBA 2ATLA 5KT4A 5KTQA 1KBRA 2XY5A 1IUJA 3CO0P 1H74A 4EFAC 3OSPA 2NQPA 1IKWA 3ZZZA 1S76D 3OR2A 3CJ8A 5DGBA 3MDFA 1LW0A 3VR1A 4OFZA 2K06A 2ADBA 4DPUA 3E01B 1QE1B 4JI7F 5C5JA 5L8RC 1B0TA 4U7UD 1T9UA 4ZPBA 1WORA 1U0SA 2VOOA 1RU2A 2W01A 2JEJA 3O5TB 2WRMA 3Q8VA 4U95A 2FLOA 3HX9A 2RH3A 2NXEA 4DUZJ 3DLBA 2R7XA 4FP9A 3CJ0A 4JI1J 3NS5A 4G1QA 4EI2A 4LVNP 1F0XA 2YKNA 4OYWA 1S4FA 2VB6A 2NLWA 5KFNA 2RJZA 4ETXA 4ZJOA 4ZPAA 2YX7A 1T9TA 3FSYA 1NDCA 2ZBCA 1ZM3A 5LMNJ 3FBFA 1VFJA 2GQ2A 3I0RB 5D4NA 1QTMA 2R7QA 3DXBA 2N4CA 5GAHI 2GQQA 4CO3A 4RUCA 3GR1A 3W7BA 3R6GB 2WB4A 1S7IA 1F2GA 1VBYA 1S6QB 4PYDA 2BXJA 5C42B 3DN9A 2HNDA 3V6DB 4O4GB 1S0OA 1XR6A 3NBPA 4ZVGA 1YITS 4UOFA 4ED5A 3VAGA 4NXNF 3M6VA 1PO6A 1TFWA 4V19J 1C0UB 2UUAF 4F50A 3POTB 1HFEL 4PQUA 1C4CA 3HLUA 4A47A 2LQJA 4R8UB 1HA1A 5H9EK 2DY9A 3FEZA 4QPTA 2XZDB 5HMZA 4OZ1A 4GKJJ 4N8OA 2WOMB 2WHOA 1VQ4S 4P7VA 1QAJA 1XMOF 2XMKA 2F4FA 3R1LA 4WCEQ 3PKYA 2NZCA 2DJWA 2BEFA 1RT1B 3OPKA 3CC2S 4CO5A 1JLBA 1NBEB 3MPYA 2MMYA 5AE2A 2V4JA 1HI1A 4D3GA 4DUYF 1Q7YT 1U09A 4LUBA 1B7FA 3GQCA 2IM1A 1UFWA 2IAJB 2X1GA 1KKHA 2P5VA 2CG8A 1SH2A 5D0RA 1GQEA 1WTBA 4DSLA 4RW4A 1EJ7L 3MI7X 1FFWB 4L73A 4HTIA 2HVZA 4DV5J 4E98A 1V9OA 5K8MA 3ET6A 2DNZA 1RTDB 1RI7A 1M5SA 3LO3A 1SC4B 1GMUA 2GCFA 3M2VA 5D8HB 5KT3A 5CD4A 4PR6A 1RT2A 3E8OA 2E7VA 2QT7A 1Q8LA 2D3UA 2HSEB 2KI2A 3CDUA 2H4WB 5J2PA 3GILA 4CYUB 2WBRA 1Y11A 3SCIE 2NS1B 3B4DA 3W2WA 3ZZ0A 1Y0HA 4LBIA 4NE9C 2N3LA 3S01A 7FDRA 4ED2A 2G1DA 2KH9A 1SUQB 4KSEB 1RU1A 2ROGA 3W1YC 4JI7J 4FVCA 1R89A 3MEGA 5CHCB 2W2OP 2JLGA 2IRXA 3NGDA 2VD3A 4DR3F 4CQ1A 4DG1A 1IKXA 4DN0A 4DS4A 1P8GA 4OI2A 1HMVB 4DMZA 4I68A 4YFUA 1Y9OA 4JOUA 2IYIA 4DV0J 2B6AA 1YGYA 5LMUJ 1TP7A 5IM0B 1T9WA 1VYAA 2WONA 3HSDA 3OUYA 2BDPA 2QG9B 1NK5A 4PUOB 4GKKF 4QWBA 4HI2A 2XMWA 1YJUA 4MKBA 2CAJA 1ZA2B 4R0JA 2BJEA 1S97A 2J9DA 2EG2A 2Y1JA 1FRJA 4IQMA 5HSPA 1FE0A 1VMBA 2HQFA 3MAQA 3JSBA 2NZ4A 1FVQA 2XO7A 4N5SA 2XI3A 1Y3KA 3MPUB 1AUSL 4R5PA 4ZS6A 4WFYA 2P9CA 1QTNB 1FRIA 2UXCF 3W66A 2WB1D 4LFAF 3NCQA 3D54A 4ZPVR 3TZWA 1FNXH 4WFZA 5HQ8A 3IWLA 4ED1A 1S6PA 2QC3A 3W2VA 4C8NA 2V4RA 4I2QA 4G65A 3TI0A 2XMMA 2FHMA 1C0TA 1B0PA 3T9NA 3TUJC 5CCMA 1OS5A 4UUWA 4I4BA 2FD2A 2YVSA 3NNCA 3D4JA 1FWPA 1VQSA 3U02A 5KFRA 2R8HA 1AT1B 1M5HA 1NH8A 1DURA 4ICLB 1XMOJ 2HZVA 1NPPA 2QX0A 4RX6A 4RL1A 3LP1B 1WC6A 1SL1A 3G2XA 3MECB 1DJ0A 1NZAA 1LWFA 3GLJA 3PG9A 2M8DB 5DM7Q 1S1TB 3UDEA 3OTOF 2Z4PA 4O3QA 1S77D 2MJUA 3QO9B 1GX6A 4DUYJ 4O4RA 3MMCB 2M3DA 2W7PA 2HLUA 5THWA 2CQ3A 2MXYA 1W7WA 1Q79A 1WEZA 3IC1A 4ZPCA 4XDCA 1O51A 3SDEB 3CD5A 4ZVRB 3RZAA 3G6VA 2ACMA 3OHBA 1IBMF 1D9AA 3VVTA 3D1HA 1RKIA 5DQIA 1R31A 3PRBA 2GW8A 1D3WA 1ZM4A 2DO4A 2ZHBA 3DI6A 2M8HA 3C14A 3ICLA 1X31C 4F0HA 3UN5A 2CZ4A 4QYRA 4OZLA 1B3TA 3EJMA 4C9DA 3OXFA 1PBUA 3SMZA 1DLOB 4Y0FA 1B64A 3B54A 3GG1A 3PXGa 2LDYA 3KLHA 2NR0A 2KJWA 3H40A 4OLOA 5KG1A 3RW6A 2CQDA 5DDOC 4IRDA 2ASYA 1U2CA 3BKFA 4EU0A 4DSJA 2KXHA 2CQ0A 3GCXP 2H5EA 5EWEA 4X4SA 1F3VA 1KLMA 4YQWA 1OYDA 1TUWA 1AFIA 2EPIA 2ZZMA 5CAAA 3GIIA 4DR3J 2DTJA 3T5JA 1Y4ZB 5HMWA 1DHMA 2RQKA 5HO4A 3K5MA 1S5ZA 4RWXA 3MCSA 2U2FA 3ELHA 3DOLA 1D0EA 3IBCB 4PQAA 2CJXB 4O3NA 5A8WB 4X4TA 4LF1A 4GKKJ 4ID5A 5GAEU 3MM8A 4Z7YA 1SKWA 1ZH5A 4Y00A 4PG5A 5KG2A 3S7RA 2VC1A 3L3CA 1RTHB 3KLGB 3C2PA 5KFEA 2W7OA 5HP1B 2ZZNA 1WHVA 3CW2C 5KFFA 3OW2R 1CULA 3KK2A 5LSRA 4Y3CA 2QV6A 4IH7A 4LFAJ 3J7YI 3LWLA 2BKOA 4LR8A 3BB5A 3DRRA 4L75A 1N32F 1JXVA 2L08A 3G82A 3UNGC 2AW0A 1N33J 1JLFB 4I64A 4ENOA 1WUUA 4XDDA 2CNLB 4DV7F 5I3UA 2UVWA 3PYGA 4HDHA 3G4SS 1V3SA 4QR1A 2DR9A 2K7JA 1UPMB 2CQ4A 2J5AA 2HHHF 4ZP6A 3JYTA 2C2EA 3NEKA 3PIPQ 4ECRA 2CKWA 1ZTTA 1RT4A 3UN2A 2MYFA 4CH7A 3IG1B 4NLUA 1X4AA 2R3VA 3DOMA 2GGPB 1SL0A 3G71S 4UZCA 1X0FA 1MN9A 2M70A 1KN6A 4GO7X 4A8YA 3OTOJ 4ZPDA 2XI2A 5HROA 4P72A 4Q44A 1UFKA 3UD4P 4PZVA 3W8GA 3OVAA 4Z2XA 4OLPA 4AQYF 3TWZA 2YPZA 4JI2J 1VIOA 1SQEA 2FVCA 4YEAA 4NPOA 1K73T 4CTAB 1U6BA 1TL3A 3KK3A 4K4VA 3H0PA 1RAAB 3NWRA 4F2RA 4YDXA 5A8RB 4G1PA 2Z2LA 3VVUA 2EFGA 2A6MA 3CWJA 5HVGA 5I3PA 2GQCA 2QMXA 3AJDA 3N0VA 4RBVA 3MWBA 1ZZFA 2QA1A 1NPRA 5B0FA 5J2NB 4RBTA 5A2QU 1IBCB 4QIGA 2R2RA 2P8IA 1XBWA 2YNHA 4MMOA 2AX0A 2MY7A 4QWEA 3NOGA 4N77A 5KT7A 1GTHA 4LSLA 1VQ5S 2B7CB 4IR1A 5B0EA 2WK4A 1C1CA 4U7CA 3ENAA 4CDIA 4I1TA 4L72B 1HARA 1KFDA 3RRHA 3LW5C 2BANB 2BJ3A 3TNVA 3GE9A 2GVDA 1CJVA 2L9WA 1Q78A 4W4MA 2ZH5A 3DLJA 1FRLA 3DXSX 2AYGA 2R8JA 2E5IA 4DS5A 3PX0A 1NKEA 5E33A 2CUYA 4ATNA 1S10A 3MXHP 4C0OC 3MPWA 4CT9A 4QOTA 1EZZB 4GC7A 2DY1A 2GAGC 4RW9A 3BGRB 1UVMA 1HLWA 5E2QA 4DHVA 3EMTA 4Q8EA 4WIQA 1I51B 3HHNB 3VAMA 2ZWOA 2BYCA 5L39A 4DV7J 2HNYB 3DU5A 3P3DA 3AH6A 1UPPA 3H5SA 2FB0A 2HBRB 1DQ8A 2HHHJ 1IR2A 2N7YA 1X5TA 4TLRA 4JI8F 2LU1A 1AFJA 2HHXA 1VIXA 4JBCA 1FKOA 1S1VA 1RWMB 4L76A 1I94J 4PXCA 1SQGA 4LF8F 1TKXA 2CPHA 1XNQF 5DZ6A 1VQ8S 2WCXA 4LQ9A 1BHNA 4WKRA 3E3XA 5HVHA 1MU2B 1H6KX 4WE1A 3TZXA 1MMLA 3BF4A 2RUGA 2H51B 1OPIA 3TAPA 2XSJB 2XULA 1VQKS 2GVZB 5F9LA 3B82A 1NB2A 1D09B 4DBQA 1A6LA 5DO2A 3T5HA 4UUXA 1I6JA 2CZVC 2Z2YB 3AD7C 1V5IB 2DIVA 4M5DA 4RW6B 3CCES 4AL7A 2J0SD 3Q8PB 2W9CB 4A8WA 2F7VA 1SJRA 1MWZA 3V5RA 4LFCF 5KFHA 2B56A 5DETA 1O6XA 2RU9A 3CIZA 2F4VF 3CDEA 3VGSA 3Q8UA 4IDKB 4KGMA 3A8JA 1EARA 3PYDA 3HD2A 1CQMA 1HPZB 3PRDA 1RADB 2DXFA 3T1HF 4NZ7A 1RWPB 3ITHA 3FMBA 1MW7A 5CYMA 2FVQA 1JMTA 1N6QB 3L7PA 1NK6A 3MR5A 5D78A 4OIXA 3MR3A 2UUBJ 2RU3A 5LM7E 2QN6B 4AL5A 1VQ9S 2Q6CA 1S9EA 4DLEA 1EETA 4N76A 1TKZA 1VQ7S 1AB8A 2F9JA 4LR7A 1T9VA 3VHQA 2K3IA 2ZNYA 2YX1A 3NXZA 4WFBQ 1SJFA 3D28A 2COLA 4TKTA 3AB2B 2LXFA 2DHXA 4ZCMA 2CQCA 1R6VA 1WOSA 4HHJA 4WP8A 2DRDA 4EZ6A 2W2MP 2IBKA 5C25B 4C8ZA 4ED6A 4N41A 1UEKA 2ACYA 2GX8A 2JEFA 3H4DA 1KEKA 3H98A 5LXRA 2I8EA 5EWGA 2BKPA 4HACB 1S72S 3QQCD 4DQPA 1EKRA 2ZHOA 1N34F 3TJ9A 2DYAA 1Q1KA 4Y28C 4C11B 3RJMB 3HO1A 1SBRA 2FJWA 2CPIA 4JUZA 1Q0NA 4B9TA 5LXYA 2E9RX 4IFVB 4BC7A 5EN1A 3QBCA 2OFGX 5A0YB 3UFCX 1SIWB 4RUHA 4Q5VA 1R3NA 4F2SA 1RWOB 4K59A 3TX0A 2DR8A 3IR5B 3V81B 1HHQA 3A1YG 1G6BA 1FTRA 1FD8A 5KFQA 3MAAA 2V5HG 3UCGA 1Y5LB 4LT6A 5GAHU 3J7Z5 3BBCA 1NUEA 1QAYA 2CNNB 4CLLA 2DT9A 3MURP 2EG1A 4C4WA 1S12A 2RS2A 3W9IA 4RW8A 4UOHA 3HJVA 2R7RA 1GMVA 3D3BJ 1JLAA 4Y34A 4NEZA 2YH1A 2GMJA 1R8BA 3MEEA 3CC7S 2W9BB 1T95A 2XGQA 3CJ5A 4NLPA 3KMSA 2IC3A 2K1RB 2HFNA 2FYXA 1N88A 1XNQJ 4OYMA 2NPFA 1U45A 1EQ0A 4B9UA 2D69A 4LF2A 1CJKB 3MGJA 5BR8F 3KMQA 3V4IA 3TEGA 1J5EJ 1B4SA 5IV3A 2I5JB 3KOAA 1XIQA 4QWAA 2HMIB 2BJ1A 4RNOA 3M8QB 3GIKA 3NRBA 3PW0A 3MD1A 1Q5VA 2HFSA 3CDBA 3Q8RB 1EKSA 5GVQA 4F4XA 3PDNA 1TL4A 2H5IB 3AHPA 4WFNQ 2HLTA 2J8AA 3EPGA 3BKUA 4DLGA 2XNQA 1MN7A 1V3ZA 3MTKA 4Y2IA 4LFCJ 3BN7A 1CJTA 3PEHA 5E3RA 3WBZA 1UCNA 1RT6B 3IRXA 2F4VJ 1VQ6S 2ZOMA 2PO4A 2AJ0A 4G6VB 3DFEA 4NI2B 1WKLA 4M8LA 2MB0B 3IBFB 3S6EA 2OD4A 3NS7B 3DC2A 5EHHA 4DFKA 4FS1A 3OLAA 3Q22A 4JYAF 2E29A 4K0KJ 5KG4A 3LUYA 1JLEA 2LCWA 3ZTPA 3EZOA 5C2GA 4OYBA 2FGOA 1S99A 2DCUB 2LLZA 1RAIB 4ZHRB 5KFSA 3PFEA 4JV1A 1K0VA 2DBBA 3FFIB 5HLFA 3D6FB 1NDPA 4WFXA 4OZNA 2DRBA 3W65A 4WIIA 1NKBA 5KFGA 4ZP9A 3TZZA 1L3TA 4X66F 2DR7A 3S8SA 4ZPWR 3FBBA 2BA9A 4NLVA 3HCXA 1APSA 3TUZC 4NMLA 4ED3A 3QZ7A 4BWMA 1XQIA 2A1BA 4B9LA 1C1BB 3M2UA 3DYAB 2FC9A 5KFKA 4KHRA 2VFTA 1UWBB 2X3GA 5IOLA 3BN4A 4CO4A 3C6TA 2FZKB 3HJFA 4CP5A 1M0SA 4DV4J 2CQ2A 3CCMS 4DV1J 3CJKB 1KQGB 3HHDA 4A8KA 4FF4A 1GT8A 4QBUA 4X62J 4OX7A 4DCPB 3CCTA 1PBAA 3E51A 2FY8A 4DFJA 1UZDA 3GTYX 1AA1B 1YI2S 4I2PA 4ILRA 1G3OA 3MM6B 1NKCA 5LT5A 2FHJA 2LYVA 3M6XA 1I1GA 5I3QA 1T05A 1PAUB 4DPYA 4ZVHA 1OO0B 3JQKA 4DR4J 4ECXA 2JFKA 2PEHA 4FYWB 3LTOA 2DNNA 4DR7F 4LF7J 3LANA 2MQOA 1SKUB 1WACA 3R7SB 2BE7D 2Z2MA 4Y2AA 1HWJA 1VQLS 1S6UA 2QYCA 4EBEA 2HQ3A 1MLAA 3MTJA 2AYEA 5IFMA 3U1LA 3C16A 1IBLJ 1RAFB 5HVFA 2BQUA 2XY6A 2YKMA 1E6YA 4J9QA 2CPDA 4J90A 1JLCA 1WHWA 4P2MA 2B7BB 2IMOA 1S49A 2Z0GA 2RQ4A 3MMAB 3TVZA 4DV6F 1WEXA 1U1QA 2KXFA 3BSAA 1U1NA 2KVQE 4DU7A 3KHRA 3SCLE 1KOHA 2Z2ZA 2B9YA 4LF6J 1VQYA 1TELA 2F40A 4KPCA 4OX8A 3I82A 2LFVA 4OQJA 2ZUAA 3ZZTA 4JP8A 3IMQJ 2RF2A 2YWGA 3K8WA 3M1VB 5AJ3J 4DR5J 2VDHA 4OHVA 2CDRB 3US5A 1JX4A 1KONA 4UOCA 2OUGA 2V2VA 1ZOTA 2AYMA 3IWNC 2LECA 3H2LA 2F8EX 3TA1A 1XEZA 4NLTA 3GFHA 3KHLA 1WNEA 1JLQB 4ZLLA 2YQ0A 2V69A 3QFWA 1X5PA 1L3KA 1UA1A 2B5JA 3PHEA 2IA0A 2WVBA 3M8RA 5FD1A 3Q86A 4URGA 1OWXA 4JYAJ 5IZHA 4IRCA 4DXLA 2DHSA 5CYQB 4QJVA 4K2JA 3GJTB 2HHTA 5HI7A 1NK0A 5ETTA 2G9OA 1TK8A 2BOAA 3DGPA 4EO8A 1FK9A 1YG0A 4F04B 2DCLA 4KGZB 3RBZA 1PAEX 3HHLC 2RQMA 1HYSB 2E1PA 1NAQA 2DNYA 4DL3A 2VDIA 3OFHA 3MFHA 4O3PA 3HVTB 3LQVA 4F36A 2DGXA 1KC8T 2RHSB 3VAFA 4AXJA 4MIWA 1YQHA 2JLEA 3MZIA 1VJWA 3ILIA 3LGNA 2IFXA 3OSNA 1CG2A 1TV6A 4YHHF 3KJVA 4MIBA 5E7OB 5IWAJ 2JEGA 3TOQA 4DX8H 1HQUA 3WHIA 1T03B 4OJHA 2Y1IA 1RCXB 4E2FB 4H54A 3HT3A 2GMHA 3LP0B 1R43A 5KFXA 1DTTB 2CPZA 1W25A 4PPZA 2C2KB 2UP1A 2WTFA 4O44A 4CT8A 1ZA1B 4ZKAA 2W2QP 3PEJA 5AXNA 1U4BA 4OZ2A 3VAHA 1S48A 3BQ0A 4DR7J 3LPYA 4EWTA 1SH3A 3J7YU 4ZLPA 1UMJA 2HQIA 2GJFA 5B0CA 3RB0A 1NLKL 1OSDA 3N28A 2NYIA 1TFYA 3L09A 4WZMA 4IYQA 3C19A 3HK2A 3SQGA 4CLZA 5KG7A 3GWCA 1FEEA 1X4GA 4B02A 2XLKA 3H20A 3ZFVA 1D9DA 2V9WA 2DNQA 3SEOA 1VRTA 2ROPA 2YWHA 4DF4A 2QLBB 1NJIT 3AXKA 2J6SA 2DK2A 2D1CA 1XMBA 5DG8A 2W9AA 2CQIA 4C98A 5KFPA 1M5VC 3P96A 2G13A 4E8UA 3M32A 5GMDA 1ZAVA 3DDNA 2W4PA 2CQPA 1HBMA 3SBMA 3GB0A 3MD3A 4B3TF 2JHEA 4L74A 4J7CA 3H5XA 5KFZA 4Y2KA 2YNIA 3I0SB 2FJAB 2DGVA 3JSMB 4P52A 5CCLA 3W9HA 2CIMA 3AJ1A 1QVGR 1YRUA 5D15A 2BW7A 1IR1A 4A8MP 2PFDA 1Y3JA 3I56S 5LJ5Y 3UI3A 4NL5A 2OSQA 3HSZA 3LF0A 5IQ6A 2C2ZB 2H9ZA 4PEOA 1SC3B 2C42A 3P49B 5IC4B 4P9SA 2YWEA 4QIWD 2C2OB 2DNKA 4PXEA 1RP5A 4NLXA 2CPEA 4DPTA 4XIUA 1HWUA 1N56A 2VL1A 2QA4S 4OYIA 1K8AT 5J2MA 2DRAA 2VFVA 1RACB 4BWJA 3EDQB 2W4DA 2YQ1A 1BE4A 4ALZA 3GV5B 3LOUA 4MYUA 2OPQB 2W8KA 2HGNA 4BLGA 4LREA 2CFXA 2WVFA 1EP4B 4AYBD 1M1HA 2EC2A 1IKYB 2BE2B 4KV8A 1UFLA 3PV8A 4KHPF 1PGZA 2UXBF 3PO4A 1VBXA 2PC6A 4Q2MA 1SI9A 2OPRA 1PJ7A 4U8YA 2G2ZA 4Q0BA 3EVOA 1NH7A 1BLUA 5T7LA 1VK3A 2V0NA 1FRMA 3UDCA 2YH0A 4EBDA 2CVEA 2AWZA 1N0UA 4QPXA 2VPYB 2W2NP 1REVB 3BH6B 3OTEA 2EFQA 1RHUB 3QT8A 2RVJA 3N6LA 2HQGA 5DS7A 3E01A 3T41A 1VC5A 1QE1A 2JL9A 2R4FA 2Q6BA 3PTWA 1R8AA 5JXSA 4QYZK 1FD2A 1YLXA 2XHCA 4F4YA 4ZMMA 2EBEA 4AFFA 4ITSA 5CZXA 2DR6A 4DX5A 2XG8A 2JVRA 3OHAA 3D6TB 1N54B 5DG9A 4TN2A 2PFFB 1BGXT 2ZFHA 1Q8KA 4I7FB 1BQMB 4AXIA 2GMLA 3SCKE 2IYGA 3HPOA 4KKOB 1VQNS 2AX1A 3W3SA 2UV8G 1FWLA 3I0RA 4RZRA 2APOA 3M05A 4HHHA 1FO1A 1IWAA 3BZQA 2KG1A 3G6YA 1PC5A 2OIHA 4DL2A 2IMWP 4B3TJ 1BQNB 2J0XA 1YK9A 1S6QA 2HVHA 5T41A 1FDBA 5C42A 3OJUA 2DPJA 2H5JB 3V6DA 4O4GA 2G1HA 4B17A 4KGVB 3KLVA 3PX4A 2ZBQA 1S9GB 3R3TA 1KQFB 4WXOA 3CGIA 1C0UA 3ILJA 4WFAQ 3M2RA 5E5NA 3POTA 4KO0B 2CRLA 3EZ5A 2ZDOA 1N36F 1H7WA 3K8VA 3FJ2A 1GXUA 4R8UA 3H25A 3CCWA 5J1NA 2ALZA 3AJ2A 2CJAA 1FEHA 3HVRA 1YKWA 3DLEB 4C8MA 3GR0A 1QLNA 1E6VB 3IGNA 5B08A 2BX6A 4V19X 2JSXA 2WOMA 8AT1B 1FJ7A 4TXSA 4MFBB 5HMYA 3CVKA 3N5BA 3BQ2A 4LJMA 2V2KA 1RT1A 2FVSA 3H59A 4MK8A 5ETSA 4DQIA 2RILA 2WVEA 3I32A 2GJIA 5L1JA 2IIHA 4J5OA 4KYZA 2LKZA 4KBIA 1DY3A 1B70B 3NLCA 2AV5A 3GJRB 5LJ3Y 2IAJA 3K17A 1XNRF 3CJRA 1NCLA 2LEPA 2MKKA 5ETQA 4NLSA 1NHKL 1S0MA 1RTDA 3HVAA 2Z58B 3K2YA 3IM9A 4DL4A 3IGVA 5LL6d 1RBOB 3EX7B 2BR0A 3GV7B 1R8PA 3W60A 1CS4B 5DZ7A 2UUCJ 4OHZA 4OI0A 1F9FA 2OPPB 2OEKA 5HQMA 3CCJS 2O1PA 4W98A 2MKHA 4J9KA 3AA8A 3TUIC 4CYUA 3OFFA 3CF5Q 2V4QA 1NJWA 1R27B 1EIYB 2HVIA 1U1MA 3RG6A 4DX6A 1P9YA 3RB6A 2N4DA 3O2IA 1O0PA 2O01C 1SH0A 3ISNC 1SUQA 2QL9B 4ZIVA 3SV4A 1UEVA 1RT3B 4YUDA 5FLXU 3Q8SB 4K4WA 5B09A 2RRBA 2B43A 2K2PA 2YKOA 4FDFA 1HMVA 2VPXB 2OMLA 2L3MA 1Q95G 3HHLB 4F4ZA 2CNKB 3JQJA 1FRHA 2R2SA 5ETNA 2HFUA 4JI3F 3P6YC 5IM0A 3QJJA 1JNZB 3QPIA 2VQEF 3HFVA 4PUOA 3RRGA 2OPSB 2BUNA 1Q53A 2DNGA 1B0VA 1YVFA 4A4JA 4NCAA 1TMMA 1JB0C 1PG5B 2WW4A 2VQFF 5D4OA 1OY8A 2A6OA 4R25A 2KRRA 4HT7A 2HNZA 2VG6B 1EB0A 2E7XA 2VJUA 4LSNB 3TVKA 5GADI 1OY9A 2CQHA 2AT1B 3VAIA 2HS3A 4IFYB 1LW2B 2V6AA 1Q8BA 4LF5F 1UVJA 2LQ8A 2QA2A 4J9PA 5F9NA 1WD6A 2CADA 1XERA 4J9SA 4ETZA 3QGPA 4Z37A 5C7PA 3CCRS 1KFSA 4I0WA 4C8KA 5EDWA 4IG3B 1G4CA 1N4LA 4ID5B 2KKHA 1Z1ZA 3MF5A 2OD6A 4PG8A 4NYZA 2JVOA 3HKZD 2WSEC 3OFGA 2Z8QA 1O8BA 2VZ9A 1MSWD 3F0NA 4ED7A 3EWGA 1YJ7A 3LP1A 3OQ2A 2WBMA 1CPZA 3RAQA 5F8JA 1SV5B 2GJ2A 4HH1A 4WBFA 3MECA 5D3GB 2M0GB 4ID8A 1RAOA 4YDDB 1FCAA 1S1TA 5JVHQ 3VAJA 3RBDA 5HATA 3W64A 4EZ9A 2QJ3A 3QO9A 2J7WA 4RW7B 2JJ4D 4YY3J 4OHYA 1VQMS 2EWHA 3MMCA 4JI5F 3G82B 3C6UB 4J9VA 2DVIA 2HHQA 2ZOFA 1SC1B 5H9FK 1H98A 2RDJA 3SDEA 2L9DA 3DRPB 1WC0A 2AHOB 2BQ3A 4ELVA 3DNCA 1F1BB 5IQQA 1KVKA 1VBKA 3QIPB 2DGQA 4DFPA 2VBWA 1YBAA 2EFVA 1WF1A 5L1LA 1SKSA 2N3OA 2VBXA 2QIFA 3D9BA 4WP3A 1MROB 4MK7A 1NK7A 3TA0A 3OR1B 3N4WA 1DLOA 4ECSA 4IOAQ 2DD8S 3KLIB 1ZETA 3TRGA 4NLQA 2YKAA 5E3QA 4EYIB 4CO2A 4HT5A 4KPYA 3HKWA 4OZ3A 1X9MA 1VK8A 4B3OB 1T94A 4X65F 3RBXA 2AJ1A 1BQXA 1T02A 3EVWA 5IS2A 1Y5NB 1VBZA 2VBZA 3DCAA 4F3QA 1Q7LB 1R0AB 3IP0A 5A8WA 2VQEJ 3QIDA 1KTQA 3BV8A 2R8KA 1LQ9A 1N0VC 2ZZTA 2H54B 3D3CJ 2J9DE 4OHWA 5BYQA 2VQFJ 1X4HA 2HEKA 3Q24A 1H0HB 3IWXA 5D0EA 4RPFA 2HHVA 2AJFE 1RTHA 3KLGA 1EAYC 2GFFA 5HP1A 4USMA 2RT3A 3J7AN 4QR0A 3T6JA 4CNZA 2BABA 3G87A 3CXCR 3CJSA 1KOOA 1LWEB 3IR6B 4DPWA 1KQKA 1SC6A 4IRKA 3VALA 1RT5B 1FKAF 4ECQA 3FSXA 2AGQA 1Q81T 2DNMA 2Y3YA 2YTCA 1JLFA 4OX6A 4RU2A 2OLWA 5ETLA 5I42B 3MR2A 1U1LA 1Y10A 3A13A 1KVJA 1RHJB 2MZQA 4D3HA 2LDIA 1S7HA 4OJGA 4WYWA 2DXEA 1CJVB 4LF9F 3HHLD 2YWKA 4ZLJA 2DHHA 3T1AA 3IG1A 4H4KA 3W8PA 2GGPA 5IC6B 4J9MA 1VQOS 2UUWA 1M5PC 3LALA 5KFTA 3QGHA 2QEXS 4K4ZA 4JV5F 3KLFB 1JKHB 4GMKA 3MFIA 2X1AA 3VWSA 4IH6A 4X4UA 1YJWS 1OSCA 2HGLA 4J9UE 2M4MA 2P9EA 1YHQS 1NM2A 1LWCB 5HL7Q 5GMEA 4CTAA 3VQTA 2ZJQQ 3AOCA 1CQNA 3HSGA 4FBUA 1NHUA 1TKTB 4IKAA 5FDLA 2OP5A 3G8TA 1WOOA 4DL5A 5A8RA 2DGTA 3HHKA 4X64F 1UVIA 2CPJA 1RSCA 3RAXA 4PYAA 5CABA 2MZSA 3DLKB 3HFZB 2MTLA 1TL1B 1DQ9A 3KJQB 1X4BA 3EDRB 4WE1B 1WC4A 3KFWX 4USKA 2KL8A 2PT0A 1GK8A 3GSDA 2OO4A 1ZM9A 3Q23A 5J2NA 2C2DA 1U8WA 1WC3A 2FVPA 2RAQA 4AD6A 5K20B 4ED8A 4YB6A 3V6JA 4UY8T 2CVIA 1UVNA 4QW8A 4UOGA 3K59A 1R8CA 3RRKA 1KRPA 5BJRA 4IR9A 3Q89A 2F9DA 3K5PA 4NLGA 2B4OA 1J27A 2ZH9A 4DF8A 5ETPA 3DMJB 3JAMU 2D41A 4J9OA 2QYGA 3QRQA 1XTZA 2BANA 1FX4A 2DGWA 2RRNA 2ZC4A 2RUSA 2X1FA 3CCQS 3A12A 2HZAA
chains in the Genus database with same CATH topology
5AE3A 2E1MC 1N88A 3Q8QB 1UKUA 3B8HA 1FXRA 3K5NA 4X4OA 2NPFA 3OR1A 1U45A 1I94F 4I67A 3A8EA 1H2TZ 5F8GA 4I69A 4B9UA 4TY9A 2AF6A 3MGJA 5BR8F 1JJ2R 2DISA 1R7IA 3KMQA 2FC8A 3V4IA 1GAOA 1MMDA 2GV1A 4ELUA 3E2EA 3KLIA 2VC0A 2I5JB 3KOAA 3C66A 1FDDA 3UWTA 1HBUB 3L7OA 2KB2A 4QWAA 4EEYA 3H8YA 4KFBB 4QIVA 4CCHA 2HMIB 3HF5A 2MY8A 3AAWB 5ADZA 4RNOA 3M8QB 1AXQA 1TKZB 3GIKA 3T1YF 3NRBA 4OV1A 3PW0A 5KG0A 1JJ4A 3MD1A 4PXDA 4QCLA 1IJEB 3BGRA 4X4QA 2JLFA 2BBEA 3QMQA 1FK9B 3CDBA 4B3MF 5K8PA 3Q8RB 4IG0A 5JVGQ 1IKWB 2MHEA 5GVQA 3MOJB 2DGUA 3AA9A 3OR2B 4R0EA 4F4XA 4B3OA 4H4MB 3PDNA 1LW0B 1TL4A 3AHPA 4WFNQ 2HLTA 2J8AA 1HNZF 1ZPVA 1U48A 3EPGA 1HHTP 5JJBA 2JC1A 5KT2A 4OJ3A 4DLGA 2PD1A 3M8SA 2XNQA 3RAMA 1F5AA 4NXMF 2J76E 2ASLA 1X4FA 2O67A 3J80Y 1H3DA 1V3ZA 3MTKA 4Y2IA 2UZAA 3I31A 2HNYA 1VRUA 3BN7A 5KFLA 3PEHA 4MAKA 5E3RA 4CIOA 3WBZA 1RT6B 3K0JA 3IRXA 3VF0B 1VQ6S 2OTJS 2HW3A 1FNMA 2ZOMA 2E9TA 5FDLB 5KFCA 5D77A 4OI3A 2PO4A 2AJ0A 4G6VB 2L41A 1X5OA 4CNYA 1R0AA 3DFEA 2YKPA 1URRA 3JB9k 2EFOA 1TV6B 3KJVB 2KHCA 3SFGA 1XMQF 2OH2A 1RDRA 4N8NA 2ZD1B 3SV3A 4M8LA 2MB0B 2R7OA 1OPZA 3S6EA 1HQUB 2OD4A 3SSSA 5AXMA 2IM2A 2RKIB 3DC2A 5EHHA 4DFKA 1TVRA 4FS1A 5D4LA 2YNFA 3OLAA 2RB7A 4TY8A 1UAWA 2M7SA 3Q22A 1OQ6A 4JYAF 3UE2A 2E29A 4G1QB 4FVMA 2HZCA 5KG4A 1D9FA 2E5LF 3LUYA 4UY85 4F3MA 1JLEA 2YKNB 4PWUA 2LCWA 2XSFA 2HS0A 1UEUA 4TU7A 3IN5A 1RISA 1DBDA 1N48A 2FGOA 1S99A 2DCUB 4Q7AA 1MU2A 2LLZA 1S1UB 2KJVA 2M9KA 3D1QA 2BACA 2M5YA 4ZHRB 3OTCA 1S0NA 1SJ3P 1VQPS 4I56A 1Q8IA 5KFSA 4YP3A 2UUBF 3PFEA 4JV1A 1T3OA 2DBBA 3R27A 1K0VA 2MHNA 3FFIB 4QW9A 5HLFA 7FD1A 4UQGA 4O44B 4TQRA 2A18A 2MZ1A 4WFXA 2DRBA 4OZNA 1M1KT 2XSJA 1U8SA 4WIIA 4A48A 2E1AA 2MQQA 1NKBA 1LWEA 2ZITA 4ZP9A 5KFGA 1L3TA 4X66F 4H4OB 3S8SA 2DR7A 2EK6A 3RR8A 2KT3A 4ZPWR 2BA9A 3PR5B 4NLVA 1RT5A 3T6BA 1APSA 2DNHA 1XN9A 3TUZC 4NMLA 3OL8A 2ERRA 1IQZA 3CSKA 3MMBA 3ISZA 4OI4A 1RT7B 4ED3A 3QZ7A 2EFPA 4GO5X 2DO0A 4BWMA 2I38A 5GMKa 2A1BA 4RW6A 1SJ4P 2HNDB 3EZUA 4B9LA 4ZP7A 4HI1A 1C1BB 1QAXA 1UJ5A 3NBPB 5L38A 5I42A 5E3AA 3M2UA 3DYAB 2FC9A 3AB4B 3CCZA 3P5TL 4N47A 5KG6A 5KFKA 4KHRA 2VFTA 1UWBB 5DJBA 3KLEA 2X3GA 3BN4A 1KR4A 1RWUA 4CO4A 3C6TA 3HJFA 4FYDA 1M0SA 3SQGB 2CQ2A 4ZCKA 4FBTA 2GC8A 3CCMS 3BSOA 5KAKA 4URQU 3G6XA 1A9NB 2QO3A 1KQGB 3HHDA 3CJKB 4A8KA 5K8OA 4B9SA 4FF4A 3SSQA 1XK8A 2HWIA 4PQUB 1TQLA 2AD9A 4IDKA 1QM9A 1CLFA 2K7KA 4KRWA 5SZTA 4MYTA 2XNRA 1GT8A 4QBUA 4ZDNA 4YB5A 5G0RA 2C22A 4JI4F 1HPZA 4OX7A 4TYAA 2BQRA 4M1KA 3PKMA 2DNRA 1U1RA 1SKRA 3TX8A 1UL3A 3CCTA 4G1IA 4JI1F 2QRRA 3SCJE 2KM8B 3OVBA 3E51A 4DR1F 1HNIB 2FY1A 3LH2S 3TAMA 4B3RF 4N56A 4DFJA 1VRTB 1N6QA 4HEA9 2KRBA 3UR0A 2HFOA 1G1XA 1YI2S 1CC8A 1Y5IB 1VS3A 4ZA1A 3T5KA 3CJ4A 4I2PA 4NLRA 3IS9A 4ILRA 4MTPA 1G3OA 2C3YA 5B0DA 1N8RT 3MM6B 3X3UA 3GZ7A 2XZWA 5LT5A 1U1PA 2FHJA 4Y65A 3KLFA 2LYVA 3ENWA 1JKHA 1NKCA 3M6XA 1I1GA 5I3QA 2BM1A 2NSCA 1T05A 1H7XA 4FXVA 3GMGA 3AY0A 4FXWA 2E1CA 3FCHA 3ENVA 3M32B 4ZVHA 5F0UA 5LMNF 4B9VA 4TLQA 1KHVA 1OO0B 3QGIA 2VG5B 5KFWA 1K1SA 2RIJA 1UETA 3FDSA 1U24A 1VOMA 2JFKA 1JLBB 2PEHA 4IO1A 4KIAA 4C97A 2CPXA 3IAM9 3ULHA 3MUMP 3WX4A 1UVKA 1FT8A 5B0AA 1HBMB 4IQXA 5F8IA 2YQ3A 2DNNA 1O5JA 3RB4A 5L9NA 4DR7F 3MM7B 4KT0C 2V4JB 4NA3A 3LANA 1LWCA 2MQOA 2FHJD 1ZBTA 2X1BA 2NUHA 3CE8A 1U47A 2PA8D 1WACA 2MGZA 5F0WA 5D4PA 2PA3A 2Z2MA 4Y2AA 2QE5A 5C25A 2M2BA 3PW5A 1HWJA 4A8SA 5CYJA 3G6ES 1KVIA 2RDIA 4O23A 4I6AA 1VQLS 1S6UA 2VPZB 2QYCA 5EX3A 2FLLA 3BR9A 1WI8A 5B0BA 2HQ3A 2YNIB 4U67Q 4EBEA 3MTJA 3FEXB 2B51A 4X2BA 1W2IA 2E5GA 4KE5A 1JXLA 2AYEA 5IFMA 1TKTA 1UVLA 3U1LA 2XLIA 3DRSA 4RW4B 3O44A 5H9EJ 5L9XA 4DV3F 2YKMA 2XY6A 2BQUA 2KZZA 1E6YA 4J9QA 3JTNA 3MM9A 2CPDA 1RJJA 1JLGB 1JLCA 2IM3A 3QYYA 1WHWA 1IBKF 2B7BB 2IMOA 1TVRB 5KFMA 4LFBF 2YNFB 4TY8B 3OBIA 3GFYA 1S49A 4C0BA 1FXDA 3FGVA 3TA2A 2Z0GA 4C11A 1T03A 2OJ3A 2HRYA 1X5SA 2RQ4A 3M2VB 3BS9A 4OZ5A 3MMAB 4W92B 3TVZA 3DLKA 4ECYA 1ZTWA 1QAIA 1DQAA 4DV6F 3CO9A 5DDPC 1WEXA 2DNPA 3R5CA 4IFVA 1U1QA 1TL1A 4DR6F 2KXFA 2XLJA 2W4CA 4GC6A 3BSAA 1U1NA 5F41A 1RT2B 3ZZUA 4BBYA 3U1MA 3KHRA 3SCLE 1RTJA 1J5EF 2HAIA 3OL6A 1LK5A 1SJ1A 1TZ0A 2NUUG 5AXKA 2LU2A 2VFRA 4OI6A 4QQBA 5KFIA 2V8VA 3UW1A 4E0DA 3RR7A 4Y6IA 5C24B 1KOHA 1VI7A 3V6HA 4B3SF 5CXTA 1FRXA 2B9YA 1WEYA 5J2PB 1UW4A 2OFHX 1YRXA 4TU9A 2LXUA 1VQYA 3SXLA 3V81A 4LVOP 2F40A 4M95A 2ASJA 4OX8A 4M94A 2IM0A 5K9FA 3I82A 5B0GA 4IUFA 4OQJA 3W2WB 3CD6S 5J2MB 3IRWP 1X9SA 3ZZTA 6FDRA 2DHAA 1RKJA 1FHTA 1C4AA 2RF2A 2YWGA 4KB7A 4LIRA 5KFVA 3IA0A 2E44A 3K8WA 3M1VB 3NL0A 4KTQA 3DM2A 4IH5A 4C3LA 4RNNA 2CPFA 2XGPA 4WXWA 4JV2A 4OMFG 1JIHA 2FJDB 3BJYA 4OHVA 2I1RA 4DWIA 1SIZA 1KHWA 3MEGB 3US5A 1JX4A 4DSKA 1KONA 2ZM6F 4UOCA 4ILMA 1XWLA 2HRUA 2J7UA 3H2VE 1ZOTA 2KU7A 2AYMA 3IWNC 1A7GE 3IR7B 5A6PA 2FJVA 4AE5A 1IQTA 4DG1B 1IKXB 3H2LA 2LECA 2F8EX 3TA1A 4Q8FA 4DPOA 4K4SA 2FLPA 2MKSA 1JWWA 1XEZA 5CZVA 4NLTA 3GFHA 2B0GA 3I55S 3KHLA 1JLQB 1KLNA 1WNEA 3MM5A 3M9OB 3DMJA 1X5PA 3TYTA 1L3KA 1UA1A 2OKQA 3KK1A 3RYLA 2B5JA 3I5AA 3PHEA 4NCGB 2IA0A 3M8RA 5A8KA 2B6AB 4NCBA 2JH3A 5FD1A 4URGA 1N52B 4KV8B 4EGLA 3KG4A 4RKUC 2ILYA 1OWXA 2W9BA 2IBOA 3KYLA 4DV5F 3BO3A 3CTRA 2A2CA 5IZHA 2FVRA 2K1RA 4C3MA 2WONB 3OUYB 1IKVA 4IRCA 2B3TB 2JWNA 3GYXB 4NYPA 4Q2LA 4K0KF 4K50A 3M6WA 2DHSA 5CYQB 5FLXY 4HL9A 2AGOA 2P6SA 2L48A 3VQSA 4QJVA 4ECWA 2UVUA 2F1FA 3M4XA 5A6WA 1S79A 4KQZA 1FTCA 2FJXA 4LQ3A 4DN9A 2R2UA 4Q0BB 2I5JA 1QSLA 2JZ5A 1HBUA 5M2PA 5T7LB 4QR2A 4KFBA 2HMIA 2HHTA 4TYBA 5HI7A 2MJNA 3M8QA 2QMWA 2ATLA 5KT4A 5KTQA 5DLFA 1NK0A 2G9OA 1V3RA 2XY5A 1HW9A 3NGKA 1TK8A 1IUJA 1H2UX 3CD7A 5HBMB 4WF9Q 3EPIA 4P6QA 3DGPA 4EO8A 1FK9A 1YG0A 2IJFA 4EFAC 3OSPA 2DCLA 2NQPA 1IKWA 3ZZZA 4A8FA 1HI0P 3HHLC 4R5PB 1S76D 3OR2A 3LGMA 5DGBA 4J9NA 4H4MA 3MDFA 1LW0A 2RQMA 4NLOA 1HYSB 3VR1A 5F3TA 4OFZA 5E0OA 1NAQA 2FGCA 5KFOA 1YJ9S 2XMVA 2RQCA 3Q0AA 2ADBA 2DNYA 3E01B 1GXLA 4DL3A 3OFHA 1QE1B 4ECUA 4JI7F 5EX0A 2IRYA 1N5QA 5C5JA 4I6YA 3PW2A 3MFHA 5L8RC 1P1LA 4O3PA 2E1RA 2OTLS 3HVTB 3LQVA 1B0TA 2DGXA 2AJ4A 1KC8T 4ZVEA 1RT6A 3D5MA 4ZPBA 3FSIA 2ZC3A 3TR5A 4UQTA 3VAFA 4DV4F 4AXJA 2VOOA 1ZPWX 4MIWA 1YQHA 2JLEA 2JEJA 4HVZA 3O5TB 3MZIA 2WRMA 1S6PB 1VJWA 3LGNA 4DV1F 2IFXA 5J1PA 1CG2A 2FLOA 2RH3A 1TV6A 3HX9A 3W2VB 5GAEI 4YHHF 2PN6A 3KJVA 4I2QB 4MIBA 5E7OB 4CZCA 2AGPA 2HHUA 3MUTP 2JEGA 2ZD1A 1C0TB 2BOPA 2LMIA 3TOQA 2GO8A 1HQUA 4DX8H 4X4RA 4X62F 2D9PA 3H5YA 4FP9A 3CPWR 2RKIA 3CJ0A 3NCRA 4OJHA 1T03B 2Y1IA 3NS5A 3I5CA 2ABYA 4G1QA 4WU2A 3U27A 2XCAA 2FIUA 5EGYA 3OJSA 4LVNP 3LP2B 1F0XA 4QZVB 2YKNA 4H54A 1H2VZ 4WU3A 3N79A 3HT3A 4C8YA 4XPEA 2GMHA 1S4FA 2FHKA 3LP0B 2VB6A 1R43A 1S1UA 2NLWA 5KFXA 5KFNA 1DTTB 2CPZA 4ZHRA 1W25A 4PPZA 2HS4A 2KDOA 2RJZA 3R5BA 4ETXA 2UP1A 3IBWA 4ZPAA 2YX7A 1L5UA 3FFIA 1IM4A 1UJ6A 3FSYA 2MQPA 2ZBCA 1ZM3A 4O44A 2WTFA 4FF2A 4CT8A 3LWMA 3JSRA 2I2YA 1VFJA 2GQ2A 1LWFB 4ZKAA 3I0RB 4BC9A 1SL2A 3PEJA 5D4NA 4H4OA 5AXNA 1U4BA 1QTMA 2R7QA 2U1AA 3DXBA 2N4CA 5GAHI 3VAHA 4PXBA 4DR4F 2GQQA 1S48A 4CO3A 3GR1A 4RUCA 1X4CA 3W7BA 5CA5A 2W7AA 3BQ0A 4NRTA 2ZKTA 3LPYA 1AW0A 2WB4A 1F2GA 2O66A 4ZOSA 1SH3A 1S6QB 4EWTA 1VBYA