2LDXA

Characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
331
structure length
331
Chain Sequence
b'STVKEQLIQNLVPEDKLSRCKITVVGVGDVGMACAISILLKGLADELALVDADTDKLRGEALDLQHGSLFLSTPKIVFGKDYNVSANSKLVIITAGARMVSGQTRLDLLQRNVAIMKAIVPGVIQNSPDCKIIVVTNPVDILTYVVWKISGFPVGRVIGSGCNLDSARFRYLIGEKLGVNPTSCHGWVLGEHGDSSVPIWSGVNVAGVTLKSLNPAIGTDKNKQHWKNVHKQVVEGGYEVLDMKGYTSWAIGLSVTDLARSILKNLKRVHPVTTLVKGFHGIKEEVFLSIPCVLGESGITDFVKVNMTAEEEGLLKKSADTLWNMQKNLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APO-LACTATE DEHYDROGENASE
publication title Characterization of the antigenic sites on the refined 3-A resolution structure of mouse testicular lactate dehydrogenase C4.
pubmed rcsb
source organism Mus musculus
molecule tags Oxidoreductase(choh(d)-nad(a))
total genus 80
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ldxA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2ldxA02
2Z1MA 4GH5A 1WP4A 2NU9A 3BZUA 4PFJA 4E32A 4BS9A 1B3BA 4BNWA 5IG2A 1GAEO 1PGOA 4F45A 2FY8A 1LI4A 1GY8A 3AY6A 4BO4A 2NVBA 2W4QA 1EDZA 3PEFA 4AJEA 3TN7A 2DBQA 1K6IA 4A26A 4Y6PA 1LJ8A 1TVEA 3PVZA 1ZXBA 1A9ZA 4KWIA 1I5RA 3ETDA 1A7KA 3F4BA 2GPTA 1WLYA 2HMTA 3H5NA 3TRIA 3GMSA 2XXJA 4DIBA 3DOCA 3F3SA 3MTGA 2BMAA 3WTBA 3ZHXA 4M8SA 1ISGA 4YT2A 3ZU3A 4L8VA 4IJWA 3BA1A 3IP1A 3H4VA 4YR9A 2DVMA 4TRMA 4Z0TA 2ZJ1A 3MCVA 1Q1NA 5L45A 1KEPA 3PPIA 3QVXA 4DWVA 1DRVA 1ENPA 3PLRA 3H6KA 1O9BA 4AJ4A 3Q0EA 3KEQA 3C85A 2FSSA 1UH5A 3O03A 4L76A 3DAFA 3WBFA 3PFWO 4CLOB 4AJOA 2VYVD 1UUFA 1I3KA 3HDJA 4FFRA 2QRJA 1DLJA 2E82A 1ZEMA 1KC3A 2V6GA 4UVDA 5EIOA 5ES3A 3ULKA 5CDGA 1PU2A 1EUDA 5K9ZA 1ZIDA 3LT1A 1MGOA 3MJEA 4U0JA 2VZ0A 3WLEA 4XB2A 4RF2A 3JQAD 4CLDA 1R15A 2JKVA 2HK9A 4MVJG 3IOYA 1I01A 3KXDA 3LVFO 3Q11A 4CMGA 5L7TA 2OBYA 2Q1TA 1ZK4A 2AW5A 4LCEA 4EI2A 3VZPA 2NQTA 5DBGA 3JQFC 3DWFA 1DAOA 2G1UA 1ZKMA 1CIVA 4CMEC 1NAIA 3N74A 4ONEA 1SB9A 1YJQA 4S3MA 5ENDA 1X1TA 4Z3KA 1EEHA 2ZTMA 4YAJA 1A5ZA 1FJHA 1QMGA 3JQFA 5COBA 2NU7A 4CLRA 5IXSA 2AA3A 2HO5A 4WKGA 3TDKA 3KO8A 3GGGA 3GY0A 1MC5A 3VZSA 2Y66A 3TJRA 4BNGA 1RPNA 2BGLA 1JW9B 3HWRA 2OMEA 1WNTA 4BNTA 5CP8A 2I67A 1X13A 3OH8A 4E3ZA 3AFNA 3BMOB 5T8KC 4BO3A 4JP3A 4TSKA 1AXEA 1EVIA 2ZYGA 3AOEC 3S2IA 2CF5A 1C1DA 1HZZA 2X8LA 2PKQO 1KY4A 1UXGA 3ETGA 3WIDA 3GN1A 2GASA 3B20A 2D1YA 1PL7A 2AQ8A 1V6AA 4IGFA 5A5FA 3SXPA 1T2AA 3QIVA 5T8KA 2IXBA 1XKQA 4R54A 4MKXA 4GX0A 4MOWA 4N18A 1GYPA 5DP2A 3L0DA 1PJQA 1P1RA 2JFHA 3AOEA 3FTPA 3WICA 3HN2A 1CRWG 1LSSA 1E7MA 1BGVA 3QWBA 5DZSA 3NTRA 2ZK7A 2WD7B 2CY0A 5KKCA 4JK3A 2F1KA 3QVOA 4ROSA 2XPCA 2WSBA 1O6ZA 1YB1A 3M2PA 3WNQA 1V3UA 5L4LA 4D3SA 5LDGA 4RL6A 2E49A 1DIGA 1LLUA 2HJRA 2Y0EA 4WK6A 1IPEA 1GCOA 4TRJA 4ZICA 4RPLA 4EYEA 1M76A 4RV9A 4CL8A 1G0NA 4BKOA 4CMHA 3U4IA 4KUHA 1HE3A 2OBNA 2UV8A 4YPOA 2VZ8A 1LA2A 2R2GA 2ZTUA 4H7PA 4PLCA 5ENVA 4IIUA 3GEMA 1Y8QA 4TRNA 1V0JA 1XLTA 3PGXA 1DIBA 1I33A 1R4NA 5HWSA 2GNAA 3B1FA 3V5NA 4BNZA 1GUYA 1UP7A 1LSUA 4YJDA 4GWKA 3LLSA 4XKJA 3PGJA 1JLLA 2PFGA 4INAA 5DNAA 2EV9A 3NJ4A 1P33A 4H16A 5TNXA 1O94A 4Z6KA 2GZ1A 3WX0A 2H6EA 1PQUA 2NTJA 3VPXA 3AFMA 3QQPA 3D0OA 2Q50A 1CF2O 2ZB7A 2NADA 1I3MA 1GYQA 1PJBA 4FJ1A 4P4NA 3QW2A 3D3WA 3L4BC 3T4XA 1LBEA 2Y0CA 2VNAA 1IE3A 5DOZA 3GZNB 1QLHA 4A10A 2J3JA 2DPGA 4KOAA 2X58A 5F5NA 3BAZA 4GSKA 5A9TA 4YJFB 3WNVA 4XYLA 2EEZA 2GLXA 4TWRA 4G65A 3L4BA 2PY6A 1F14A 3IMFA 1E1MA 3JV7A 1GL3A 5I7SA 5DCYA 3GUYA 5BT9A 3JTMA 3NGLA 4RPKA 1ZEJA 4BNVA 3C1AA 4FD3A 1NPYA 3SX2A 3UKOA 4BGEA 1KEWA 3TFQA 4BNUA 1XYGA 5CG1A 2ZIZA 2P9CA 4R1TA 5A3JA 3CTMA 1U4SA 1TT7A 5BNIA 5IAAA 4CQLB 1HDCA 2FHSA 3RUEA 2A94A 4L4RA 4YJHA 1DEHA 1YO6A 4WE3A 3NV9A 3NT4A 4B3JA 1F8FA 3PK0A 5JCXA 5DBFA 2VOJA 3QLJA 2HMWA 1D8AA 3DL2A 5B37A 1HDXA 1ZFNA 3IDSA 1PGPA 2EKQA 3AWDA 4FJ0A 4XGNA 4LGVA 3RKUA 4J16A 4Q3EA 5KKAA 5A04A 2D8AA 4E4YA 3SLKA 4YXFA 3NEPX 3PXXA 3K96A 1N92A 3E9QA 3PTZA 2ZATA 4B7XA 4FIZA 5T67A 1R66A 4GQAA 2QHXA 3UHAA 3DHEA 3T7EA 4GPD1 1ENYA 4J6FA 1Y81A 3KYBA 4BO0A 1GQ2A 2PK3A 1VJ1A 4J49A 1M67A 2ZYAA 1R6DA 2PZMA 4EEXA 2A35A 1Z73A 4JJFA 3KOUA 2CVZA 4P4LA 2BGKA 1YWGO 1H9AA 4Z9FA 3NTQA 3MZ0A 1K6XA 1NQOA 4HXYA 1T26A 2FPPA 2GN9A 7ADHA 4FJ2A 3QWHA 2VUUA 2DTDA 1QV7A 1RM5A 2Q4EA 3IUPA 3JQBC 3FR7A 4JBHA 4JLWA 3HZZA 1T2EA 4NBTA 4W99A 3VC7A 1NTOA 4DPKA 3ANLA 5JCJD 1ZK2A 1F06A 3Q2KA 2YYYA 3RUIA 1RKXA 1WDMA 1ADBA 3E5RA 3LT0A 4CMBA 2Y1CA 4E0BA 3X2FA 3JQBA 4ZRMA 4ZGWA 3JQEA 3OECA 2B5WA 3AJRA 1U3TA 4DLAA 1XU7A 4FGSA 3WSWA 1OC4A 4IPTA 1LX6A 4A73A 4W6ZA 1CEQA 3E18A 3WYEA 3AY7A 3EZYA 4BMNA 3I9LA 4I5DA 2VHYA 1X7GA 3ZW9A 1VL8A 2YHIA 4B3HA 3IL2A 1IB6A 3S2FA 1SOVA 5KIAA 1PJ3A 1P45A 4CUKA 4DMLA 2R00C 1DC5A 4BMSA 3TZCA 4CM3A 1Q0HA 1OFGA 2D5CA 2X9VA 1LC0A 1BG6A 3PQDA 3WGTA 3ZWAA 2BLLA 2E48A 4WNCA 3DAGA 1QORA 1FMCA 3ABIA 3AM3A 3GA0A 2R00A 2PGDA 4UREA 1PQWA 1J6UA 4K1LA 3JYPA 4JIGA 2LDBA 3PJEA 1LDGA 3GVIA 1C0PA 5FI3A 1BXGA 2GGSA 3LC2O 3D4NA 1N9GA 1NAHA 5JO0A 3LQFA 2GO1A 4BL5A 5B4VA 3F6YA 3S8MA 1JVSA 1OOEA 1TLTA 2D0IA 1U2DA 1YDWA 1MG5A 1IHXA 2PNFA 1WZEA 4BKQA 5I9NA 3GT0A 3RJ9A 4ITUA 3U4HA 2O4UX 4E21A 5KNLA 4GGOA 3DZKA 1L7DA 1N1EA 2FR1A 1CJCA 1XWFA 4O59O 4OSPA 1K2WA 5L7WA 1NHGA 3A1NA 5IDYA 4D41A 4OAQA 5CAEA 4YJGA 5CFZA 4BKUA 1YXMA 4TZKA 1JWAB 4B8ZA 4I8XA 4XWYA 1Y5MA 1B3RA 5LDHA 1A72A 3OA0A 3PIDA 3KVOA 4MDHA 1GQYA 1GZ4A 1I32A 1YKFA 3A14A 3AU9A 4BO8A 2EW8A 4D0SA 3D3WB 3SC6A 2OGUA 3CUKA 3DZFA 4YRBA 3R6DA 4NR0A 3H3JA 3OM9A 2QIOA 1UP6A 2CMDA 2Y05A 3FSRA 3K2BA 3OBBA 1LSJA 2HLPA 1SAYA 3AM5A 3FHLA 4FFNA 4NBUA 2CNBA 2IZ0A 2QQ5A 1YBMA 2OOSA 2VQ3A 2PZJA 4EZBA 5IJZA 4CR8A 3DBHA 1HDOA 4CQMD 5G4LA 4BO9A 3FI9A 3DHNA 4E2ZA 4PLPA 2X0IA 4GKVA 2C29D 2PD3A 4CM9A 3ZU2A 2GN4A 4H3VA 2YHUA 1NM5A 2VWGA 1E92A 1TT5B 1V8BA 3ORFA 3ONEA 1T2CA 2I3GA 1M75A 3CKYA 4L9RA 3RBXA 4FB5A 2DTXA 3C24A 4WLNA 2UAGA 1YOVA 4LMPA 2O2YA 1XEAA 4GWGA 5ER9A 2C5EA 5FYDA 1TI7A 5KTKA 4FC6A 1C0IA 3GOHA 4TROA 1MB4A 2AQHA 1EUZA 2X22A 3PDJA 2AG8A 3OQBA 3I9JA 1HWYA 4NJMA 4R1NA 4LW8A 4FFOA 5KVCA 4NBVA 3NDRA 4E2WA 2H63A 1UDAA 3C8MA 4J1QA 3P5SA 1GV1A 3VH2A 1BDBA 1B14A 2C7VA 5U1PA 1WZIA 4CQMB 2PTGA 4YAGA 3PJGA 4J9UE 1PJ4A 1VSVA 2O3JA 3BHMA 3FNEA 4JJIA 1E3WA 2YQ4A 4DYVA 1R16A 3RBVA 4PRKA 3ADOA 3BMCA 4BO1A 2FWMX 2VN8A 2V6MA 5C5IA 4YRDA 2O3UA 3QJ5A 4Q3CA 2JAPA 4I5FA 1ZJZA 4II2A 2C07A 5A5EA 1LLQA 2BF7A 5ADHA 3GAFA 1LEHA 4PVDA 5B4UA 3Q2IA 4DIFA 3DFZA 4CV1A 3SVTA 2QRKA 1KVRA 3OP4A 1MG0A 3FWNA 2B4TO 4TKLA 4J4BA 5JY1A 3D4OA 3VPGA 1EE2A 2NACA 1Q0QA 1HTBA 1JAXA 4E12A 3DAPA 3KEOA 1PTJA 2XOXA 4IBOA 4O63O 1J49A 2GZ2A 2W2KA 4EJ6A 4N5NA 3ZWVA 1WAMA 1ZSYA 3GG2A 2GCGA 4AJHA 1ARZA 1AHIA 2VCYA 4RGBA 2Y68A 3WQSB 2PA3A 5KJCA 4B8WA 4DQVA 4UAGA 4RF3A 3TOZA 2GZ3A 5JY6A 3GVCA 2JD2A 4D45A 4TMFA 3RSHA 4CR6A 3VH4A 1U7TA 1ORRA 1HYGA 2PZKA 3TZQA 1LDEA 4ALNA 1IY8A 3IAHA 4XIYA 1MFZA 5JMWA 4K9DA 4OM8A 2YV1A 4YB8A 3GFGA 2O23A 2IYOA 1PJ2A 4AG3A 1MXFA 1A4UA 2Y93A 3V8BA 3ZGYA 3JQAA 1P1KA 3HG7A 1PQPA 2BGMA 3DTYA 3VPSA 5TSDA 2YW9A 3WFJA 4RDIA 5H83A 1JA9A 1Z6ZA 5TJHA 2NUAA 4DA9A 3LT2A 2QZZA 2ZCUA 3AUAA 4IS3A 4QO8A 4A2CA 1WMBA 1X7HA 3H9EO 3F1LA 1N9GB 2DFDA 2NQ8A 1C0LA 3ICPA 4BB6A 3CSDA 5CG2A 5KVSA 3WMWA 1R4MA 2I65A 5G0VA 3HHPA 2PV7A 2Q1UA 3BXXA 3WLFA 4WGGA 3IP3A 2H9IA 1E3LA 9LDTA 2G76A 4I5EA 4IUYA 4OKNA 3DEYX 3WTCA 5EQDA 4YBZA 2O7QA 3MEQA 4D7AA 3KSDO 3JD4A 1BW9B 2JCVA 3H8VA 3QVWA 5IN5A 1NNUA 2FR0A 2CVQA 4WASA 1UJMA 1XR3A 3G79A 4XYEA 1NR7A 4L74A 2X0NA 5A9SB 5L40A 1PGQA 2HU2A 4UEOA 4YJGB 5JYEA 1EE9A 3ROQA 5K0ZA 4NI5A 2ET6A 4E5KA 4W7HA 4L75A 3ZN2A 2Y1GA 2PR2A 4HADA 1KOLA 2X5KO 2AG5A 3IQDB 5JDIC 1NBOA 1T24A 1U5AA 2XXBA 3JQDA 1I36A 3WIEA 4DLBA 4DYDA 3BMNA 2ZB3A 3CXRA 3PLNA 3IJPA 1RYDA 3JQ9A 4ILKA 3RBZA 5L4NA 4CODB 3T7CA 3LU1A 2X7HA 3PHHA 3L07A 1K6JA 3JQ7A 1BSVA 1TEHA 2P68A 4QX6A 4DC0A 5JDIA 3ZDFA 1ENOA 3HE3A 4YAIA 2H1SA 1ZSNA 3U09A 4WEOA 2DLDA 4J0FA 4C7KA 2OZPA 1NVMB 4KTVE 3DBHB 3AUUA 2AHRA 3E6AA 3WQRA 5IDWA 1DC3A 1ADGA 1QKIA 1RM4A 1U28A 1I30A 1HL3A 2ZJ0A 3IJRA 1VL0A 2D5AA 3GRKA 4N5MA 4NHEA 2AEMA 3DBRB 4HUJA 3JYNA 4ZQHA 2QX7A 5EL0A 4ALLA 1SPXA 1ZK3A 2VRBA 3H5RA 4BMVA 4CUJA 3UXYA 3ZI0A 3JD3A 3H9QA 2ZB8A 2WYWA 3UW3A 4J4HA 3G1UA 1W6UA 3AI1A 4PZDA 3ZNPA 4J1NA 5JMPA 3HDQA 4ZU3A 3VTFA 4LSWA 1YB4A 4YQYA 2CZCA 3GH3A 5I9MA 4GMFA 2C2XA 5FWNA 1PZFA 3DFUA 4NJMB 4TVBA 2NU8A 4RPGA 1F0YA 1EQUA 2Y1FA 5G4KB 3BTVA 1LNQA 1T1SA 4UVIA 4IGEA 1JKJA 4DIOA 1EBFA 3G0OA 4R1SA 3KTDA 1X0XA 1KEVA 1DIRA 3FF4A 5GZ3A 4I08A 5TLSA 3TQHA 5TF4A 2DTEA 2LDXA 3LT4A 2NVWA 3ICCA 4E31A 4WOJA 3FNHA 3NDIA 3BMCB 3LC1O 2V7PA 1ZXLA 3H9JA 2QRLA 4CM4A 1F17A 4LN1A 3NDJA 4R51A 5JAMA 1E3SA 8LDHA 1UZLA 2HQ1A 1RYEA 3V2HA 4JP2A 3U3XA 4D0RA 3U49A 5B4TA 5EJ2A 3W8EA 3PYLA 5TT1A 1SO8A 4Y6RA 5GY7A 3AK4A 3I9NA 3F5QA 4FC7A 2AE1A 1T2DA 5IXYA 1PSDA 5F21A 1ENZA 1DFIA 2UDPA 3EHEA 5TQVA 4CMEA 3NYWA 4MINA 5AVOA 1PS0A 5BNTA 1UXKA 5ILOA 5L51A 2J5KA 1UAYA 3S2GA 4D44A 3CPSA 1U9JA 3GGPA 3OIDA 5CDTA 4YAEA 3I1JA 4TQGA 2VTEA 5JS6A 2V6BA 5AQ1A 1NPDA 3FNFA 1JVBA 4YVFA 4G81A 1GV0A 2PLAA 3O4RA 4ZD6A 1A9YA 5MGBA 2G5CA 1BDMA 2IE0A 1ISIA 1E5LA 3KYDA 4RVFA 4XIJA 4YQZA 4RQUA 5TGDA 1WWKA 3OMLA 4QO7A 1HDYA 1VKNA 3JQGA 5C3MA 2VT2A 4QT0A 2JCXA 1WPQA 4DPLA 1R0LA 1P3DA 3ZU4A 2EXXA 4N5LA 1E7QA 3FPLA 1BXZA 3I23A 2HJSA 5EINA 4DXHA 2O3SA 3LLVA 4PG8A 3DO5A 5DBIA 2NWQA 3EW7A 4E6PA 5A4DA 2Y1OA 5C37A 2CFCA 1QYVA 3MJTA 4U8GA 4K6FA 4FSHA 4WLVA 4BNXA 4UVEA 2O4CA 5FEUA 3JQ8A 2XAAA 3DZHA 5GMOA 5JCJA 1AXGA 3RD5A 3VOSA 2NM0A 1ULSA 2G0TA 3IS3A 1KIFA 4YT8A 1NXQA 1SC6A 5J23A 3C1OA 1WW8A 5HM8A 1HE5A 2FN7A 2VTDA 3FBTA 4PLTA 3WOHA 4J43A 3TSCA 4HWKA 3RC2A 4J9VA 1GYRA 2JFFA 1Y8RB 3PYXA 1X0VA 3W1VA 4I9HA 1DXYA 4LRSB 1ML3A 2IODA 2PD6A 5AXCA 5IDQA 3GZ4A 3CE6A 4XZ3A 2YDXA 1ADCA 1CQIA 3DTTA 4JN6B 2P91A 1OZAA 1YJ8A 4NDNE 4W82A 3INRA 2O7SA 2Z95A 3JYLA 4KUGA 4EUEA 3OEWA 3GVXA 1GZ3A 4JBGA 1AGNA 1DHTA 1XGKA 4XQCA 3D4PA 3RC9A 1UDBA 2NLOA 3K2EA 2YFHA 4WLFA 3ZV3A 4CM8A 1WVGA 2EERA 4J90A 5IF3A 4EUHA 3A4VA 4LVCA 4R3WA 4RLHA 1NQTA 4MO2A 3MOIA 3GN2A 2Q4BA 3GUCA 3PRJA 3UH1A 5CPBA 1XA0A 1Y7TA 3DMYA 3WGHA 3E48A 1HYEA 1B0AA 4Z0HO 3BTSA 1IOLA 3TL2A 2HCTA 1EMDA 2DC1A 3Q6IA 3UCEA 1B2LA 1BXKA 5ITVA 1IL0A 5TIIA 4UVHA 1P1JA 1DO8A 3VH1A 2W90A 2VT3A 5EERA 5JLAA 4QUKA 1HKUA 4YA6A 4CLEA 4WCFC 3KLPX 3WB9A 4XGKA 4ESOA 1GCUA 1HLDA 2PD4A 3A28A 1KVQA 4CMCA 2RIRA 4BNMA 3HUDA 1O95A 1H9BA 1SBYA 4A5OA 5T5QA 1T4DA 1QYWA 1ZW1A 1MUUA 4F6LA 4HP8A 4PG4A 1XQ1A 4BV8A 4MVJA 1JN0A 1H2BA 3KB6A 4BNLA 4D42A 3TL3A 4WCFA 4MIEA 1LQTA 4OOEA 4WLUA 3OQ1A 5L9AA 2WD8A 4R01A 1YH3A 1I10A 1LLCA 3DR3A 4IINA 3U0BA 3JD0A 1EVYA 4PG5A 3VVCA 2CSUA 1CETA 4BVAA 5KCZA 3PZBA 3TZKA 1Y1PA 2VYNA 4OYRA 1DPGA 1HDRA 2NVUA 4E5YA 1Z45A 2X23A 4NU6A 4J2HA 4RDHA 3H65A 4W9NC 4ALKA 1PZGA 4RORA 3E5MA 2AMFA 4OOFA 1NWHA 4NH4A 1NYTA 3NKLA 1N2SA 4ALMA 4C4OA 4BGIA 4D43A 1KEUA 5JW6A 2J3IA 3EDMA 4G5HA 5THKA 3L77A 3CMCO 1V3TA 3JQCA 1KY5A 4W9NA 1EQ2A 1HSZA 1R12A 1B8UA 1E3JA 4EGFA 2DBVO 3W4KA 4KZPA 3SBOA 4IM7A 4OJNA 3TOXA 1E7RA 3W6ZA 3ROKA 9LDBA 1C1XA 3WGOA 1PS9A 1AE1A 3KHUA 3P19A 3ANMA 5CDYA 1ISMA 3KBOA 3DHYA 2FR8A 1W0CA 3GHYA 4CUZA 1N5DA 2FOIA 2QG4A 2CF6A 4LVUA 4OXNA 3K73O 3VDRA 2B4QA 5JO9A 3ZHYA 3HDHA 3ZWWA 5DOVA 3O26A 4HFMA 1VRWA 3IIEA 4FFMA 5DF1A 4CLRB 2YV3A 3RU9A 4JCOA 2AEFA 3RQSA 2GRAA 2EF1A 2OP1A 4FR5A 4GX2A 4O0LA 4M87A 4ZVVA 3WGQA 3O8QA 1S6YA 2OORA 2HMVA 1BTOA 4JROA 1ZMOA 2FZEA 3QY9A 1D3AA 3ZWYA 3VDQA 1T25A 3L6OO 3R3SA 3U9LA 4AFNA 1XSEA 4R5MA 4IS2A 1LU9A 2C54A 4KDEA 3GDFA 4WPGA 4YWJA 3GNQA 1DC4A 1NFRA 2X6TA 3STHA 4XB1A 1C1DB 3R3JA 1VLLA 1GD1O 1OC2A 1U2GA 3P7MA 1KYQA 1CDOA 4H15A 1CQJA 1H6BA 3D1LA 4M1QA 1ZJYA 4WUVA 5T64A 3WGGA 1ID1A 3KLMX 1VL6A 4NFYA 3ROMA 4WLOA 5BSHA 3VPFA 3ZNQA 4I9UA 4DL9A 2ZB4A 1PJLA 3GF4A 4WOKA 3AOGA 1HEUA 2NV6A 3K6JA 2C59A 5DCUA 1E3EA 3GK3A 1Y6JA 1YVEI 3JYOA 3RWBA 3WGYA 4NJOA 1Y9EA 5F1OA 2ZQYA 4I9NA 1PJSA 1HF3A 1ZSVA 4DBZA 4F6CA 2YY7A 2GYYA 1U5CA 3JD2A 4BO7A 3K9QO 3MWDB 3DBLA 2HDHA 4MJLA 1OAAA 4RPJA 2YQ5A 3ADPA 2GSDA 4MIOA 4OGWA 5KJ6A 1H94A 4NFSA 3CEAA 4A03A 1RJWA 3OHSX 4A7PA 1DB3A 2BFOA 1QYDA 4RJTA 3ZCXA 1ZK0A 1DOHA 3F4LA 2OO5A 1O89A 4MKRA 1JU9A 3OFSA 2Q1WA 1GFSA 5L53A 5TT0A 1U3WA 2NTVA 3MJVA 5KVVA 5A1TA 2TMGA 2X9GA 2JL1A 2XF8A 1Y8QB 3GRPA 4TKMA 4XJTA 4CMIA 3NAQA 3GVHA 2AEJA 3C3XA 1GR0A 5JAQA 1R4NB 3RFVA 3GHHA 2BFMA 4XD2A 5AOVA 4EJMA 3GPIA 5JSFA 1PWZA 4IXTA 1IUKA 1FK8A 3K31A 4AJ1A 3FCOA 1XDWA 2JJYA 1NWCA 1DDOA 4XYGA 5B12A 4BQRA 3I9MA 3V1UA 2UUOA 4DMMA 1J4AA 2GERA 4N54A 2JCYA 1D7OA 1YGYA 4B7CA 1XHLA 3M1LA 1U1IA 5CEJA 3RUDA 3TWOA 1DRWA 1GQQA 4OSOA 5CDUA 1JAYA 1HLPA 4J0EA 1A7AA 2YFQA 4D3FA 1EK6A 5JE8A 3OICA 4U5QA 2P2SA 1R37A 1LDNA 1LDMA 1S7CA 3OJLA 4C7JA 2B69A 3PWKA 1HETA 2Q2QA 1NHWA 3MWEB 3OETA 4OXYA 3LZ6A 4IJUA 2TMDA 4OQYA 3PHLA 4MVJF 3QWAA 4O1MA 4Q39A 1MP0A 4XEHA 3EVTA 4HFNA 2O50A 5C7LO 2AQKA 3WR5A 4HKTA 4IJKA 1E6UA 1XELA 4NIMA 1E7YA 3HDYA 3I5MA 4TZTA 4CMAA 3VZRA 1EK5A 4BGVA 5THQA 4R41A 4KQWA 4MKZA 4ND2A 4P4GA 5A03A 4WCDA 4J2OA 3PHIA 1AUPA 3UVEA 3UICA 4CJXA 5ITWA 2JD1A 4PIVA 4YJHB 4BNHA 3O9ZA 4X54A 4R68A 2BH9A 2F00A 3L6EA 4RF4A 3WBBA 5BSEA 1IYZA 4E5PA 1DIHA 1YE3A 4EUFA 1AHHA 2Q3EA 4J7CA 2FMUA 4IMRA 3BYZA 3U4CA 3PZRA 2GN8A 5G2OA 2IZZA 3NX4A 4Z0PA 3V2GA 1E7WA 2W2LA 4GSLA 4E5MA 4A0SA 3DDNA 3INGA 1W73A 5JAZA 1HT0A 3D5QA 4WNIA 4HFRA 3ENKA 3P2YA 2BI7A 3I6IA 4UUOA 5I7VA 3RCBA 4AVYA 4ZQFA 2BRUA 4XA8A 5FF9A 4BB5A 2GF2A 4CPDA 2VWPA 4CLOA 1DHRA 4XGIA 4IZHA 1YB5A 2G17A 1LXCA 2GD1O 3F1KA 4KMSA 1ZNQO 1LRLA 2J3KA 4NK4A 5AXAA 3GVPA 4JJGA 2Y0DA 4MP6A 5JC8A 3ZU5A 2WDZA 4OIMA 4RCVA 1ZBQA 3ENNA 3HFSA 1O8CA 4ZQBA 4CLHA 1BMDA 1Q2XA 4Q3AA 3E82A 1SEPA 4FBGA 4ID9A 4LSMA 3VKVA 4IDCA 1ONOA 1JWBB 4G2NA 4U6QA 4CV0A 1KVUA 1YQGA 2R6JA 3D5TA 3VZQA 1GPDG 1EDOA 1Z7EA 2IEBA 2EKPA 3R1IA 2ZCVA 4PGFA 5K6AC 3GLQA 4WJZA 5EQFA 4AICA 3F47A 4LK3A 1A4IA 4XRRA 2YHIB 1DFGA 2PZLA 5GZ1A 2VYVA 1K0UA 3EK2A 3BTUA 1N8KA 2DKNA 2DBZA 2VHVA 3FTNA 3NRCA 3PHGA 5K6AA 3VHRA 1Q0LA 1HXHA 2J5RA 1IZ0A 1MC4A 3D64A 3ZWMA 5I8ZA 1IULA 4CLXA 4DLLA 5A05A 5CDSA 4XQ9A 3RIHA 3CZRA 3UGKA 1HZJA 2X9NA 1YRLA 3FBGA 1QG6A 2D59A 3IUSA 5HS4A 4XYBA 3BMOA 3RC1A 1PJTA 1XG5A 3BHJA 3GPDG 3ROPA 5KJ1A 4R3NA 3UN1A 1A27A 2RCYA 4LCJA 3I4FA 1VC2A 2OFPA 4XDZA 4KUEA 2GUGA 4FQ8A 4CMKA 1LSOA 5JFOA 2BKAA 3FR8A 2O3QA 4AJIA 1BXGB 2D4AA 3OEYA 3OJ0A 5AXBA 5BSFA 1Q7CA 3I9OA 1P44A 1MV8A 3ONFA 4D79A 4IQ8A 4GI2A 1I24A 2OXIA 4AJKA 3WG9A 2DBRA 8ADHA 2RHCA 4IMPA 5EPOA 1O0SA 1FDUA 2WD7A 3OIGA 3RUCA 1KETA 3OF2A 1G0OA 4YCAA 5TS3A 5JDCC 4UUMA 2HK7A 3EC7A 1DJNA 2C20A 3VKUA 1VJ0A 1DJQA 4E33A 1NFQA 4A27A 1U3VA 1UXHA 1VJTA 3DOOA 3V1YA 1PJCA 3PQEA 3EYWA 4FFPA 4CM9D 4ZA2A 3H3FA 1NASA 2A4KA 3EGOA 2X0JA 3C7DB 5T6BA 6ADHA 1EVZA 2BD0A 3LC7O 2P5UA 2RAFA 1SB8A 1E1NA 2V65A 4QEDA 4XR9A 5JDCA 2GN6A 2IYPA 3PJDA 1M66A 3T4EA 5TC4A 3WGZA 5FI5A 2Q46A 3Q1LA 4DC1A 4E30A 2J5QA 4Y98A 4CM1A 4FCCA 1HSOA 3ETEA 2P9EA 5L95A 1MA0A 4AJ2A 4LMRA 1QYCA 1R0SA 1GPJA 4L73A 1EFLA 4DREA 1PR9A 3N7UA 2AXQA 3B1JA 3P2OA 2PH5A 1MLDA 2E6UX 1SEVA 4NBRA 3MTJA 4J7UA 4XJSA 1W4ZA 3GG9A 3ZWOA 3G17A 5BR7A 4PLFA 2RH8A 4HNHA 1I3LA 2B36A 2A92A 3QHAA 4GL4A 3AW9A 4M55A 4O5OA 1CYDA 4GBJA 3HADA 4F3YA 4BV9A 3HQ4O 1MFPA 2FRDA 1HE4A 3DZBA 4RVDA 1XQ6A 3EZLA 4KQXA 4W7IA 1YOVB 3GZNA 2VRCD 2YDYA 1YL7A 3GGOA 3MJ4A 5F1PA 1AN9A 5JAIA 1P1HA 3QSGA 4BKRA 1NX6A 4XYMA 4YJFA 2D2IA 2I3AA 1E6EA 2VUSA 3H5AA 5JXWA 3ASUA 2X86A 1M6WA 4P22A 5KJFA 5A06A 1WDKA 2J3HA 5IDXA 4P8RA 2O3RA 3TNLA 4MIYA 4R9SA 1I2BA 4ZRNA 1E77A 5JBIA 5COAA 1F12A 4HX5A 4XR4A 1UZNA 5CPFA 4EDFA 4EW6A 3I9KA 3AI3A 1PL6A 2EP7A 1R0KA 1D1TA 4RZHA 2EW2A 4FDAA 5G0UA 4CQLA 5F3RA 4AJJA 4Y6SA 1E3WB 3UOGA 5IN4A 2ZYDA 3M2TA 2IEDA 5FFFA 4CM5A 5F1KA 4UULA 3HB4X 4R16A 2B5VA 4J3FA 4E13A 4KDFA 4B7UA 1KVSA 1Z75A 4BNFA 4NG5A 1QP8A 1B15A 1ONPA 2WTBA 4J91A 4FOSA 5DN9A 1DSSG 3G3EA 3TZHA 3V2UA 1PZEA 1V3VA 3PQFA 3FD8A 5DDIP 2EGGA 2JHGA 1HE2A 2PKQP 3Q9UA 1RWBA 3H2SA 3ZNNA 3QV1A 2W2KB 4ND4A 1QRRA 4KP7A 1EVJA 4J4TA 4BNKA 1P31A 1C3VA 1UAGA 4FFLA 4GLOA 3RU7A 4R9RA 4RZIA 4D46A 5B1YA 3C7CB 4DVJA 1GEGA 1Y5RA 1Q7BA 1VM6A 2O2SA 1BHSA 4I5GA 5IFLA 3WYCA 4HNGA 2DUWA 5LCXA 2FZWA 2IRWA 5KOIA 1XU9A 3Q3CA 3TFOA 3U4DA 2NU6A 2VHWA 4CL3A 4QTZA 4RF5A 3OSUA 3OJEA 2VOEA 4IDBA 1P1FA 2Y1EA 2JFGA 3A9WA 3PFFA 1B26A 2P9GA 4DQUA 4DGSA 1ISFA 4NNJA 4B4UA 4DTIA 1I2ZA 5GZ6A 1GU7A 4YACA 4CR7A 4PG6A 4OKIA 4PLVA 4DRYA 1Z7BA 2C5AA 2VHZA 3JQAB 3RROA 3WQQA 4AJNA 2OP0A 5DULA 3U5TA 3FPCA 4OXKA 2HSDA 1VSUA 3NT5A 2OL4A 3GQVA 1LDBA 3V1TC 3KYCA 4GAEA 4FPXA 4J7XA 5KVQA 4MVJH 3RUAA 3DOJA 5JC1A 1C0KA 1ZMTA 1ZO8A 3E8XA 3CMMA 1GEEA 4HFJA 4GX1A 4WLEA 3ZH2A 1HDGO 4NMHA 1W8DA 4JX8A 1R4MB 5KWEA 4IQ0A 4PZCA 3OA2A 1U3UA 1EFKA 1P0FA 3AUTA 3ZV4A 4BNNA 1ISJA 1N1GA 4Q3NA 3VTZA 4PCVA 2Q1SA 3WWYA 3K5PA 3KRTA 4QQRA 1X7DA 1LUAA 4M54A 3DMTC 2JAHA 1G1AA 1P0CA 4HY3A 3KETA 1YBVA 2Q99A 3PP8A 4B4OA 5IZCC 2C2YA 4JQCA 3W8FA 3DC2A 4OH1A 4U7WA 4U0KA 4F46A 4QFCA 5TX7A 3DMTA 5L7YA 4BIIA 1GZ6A 2HMUA 2WEKA 4IIVA 1I8TA 3S1LA 3ZV5A 3BMNB 3VVBA 1E1LA 4PG7A 5ILGA 1UXIA 3RAJA 3RFXA 3QRWA 5IZCA 1H6CA 1K3TA 4JGBA 1UR5A 1BWSA 2Y67A 4BGUA 4CM6A 3JQ7B 3D3EA 3W6UA 1JTVA 4IDFA 3ZWNA 2Z5LA 3C7AA 3PYMA 4XDYA 1G6KA 4YT5A 3KM0A 2VUTA 5T57A 3QWIA 4CM7A 5A02A 1U7HA 3L9WA 4YRAA 4KWHA 3SC4A 4ZHSA 1QYXA 2W8ZA 4NU5A 3WSVA 4RO0A 1FDVA 1QV6A 2X5OA 3ONDA 4Q3BA 4IZIA 1RM3A 3ZWBA 2Z1NA 3INTA 1YQDA 4BO6A 3M1AA 3HN7A 1LRJA 1PR3A 2I66A 1DRUA 2GR9A 2DAPA 4UVGA 4R4JA 2WMDA 1I2CA 2O3TA 3DQPA 1L1FA 4EBFA 5HRUA 3LYLA 4MP3A 2YV2A 4IY1A 3MJSA 3E9MA 4JBIA 1DBVO 1Q7GA 3CH6A 2P4QA 4R1UA 5IZ4A 1HYHA 4J1TA 1FDTA 1TXGA 3EVNA 3F9IA 2O48X 5TRTA 1I0ZA 1M6HA 1MXHA 1JKFA 4CV3A 3DXFA 1X14A 5G0TA 4B3IA 3ST7A 4PLZA 4BOYA 4PLGA 3H9GA 2DQ4A 1YONA 1ZH8A 3NTOA 1E0DA 4NK5A 4NQZA 1TT5A 2I9PA 3CZMA 5DT9A 3RFTA 1KS9A 1L7EA 1NP3A 3E9NA 1KC1A 4QECA 5JNLA 3WXBA 4OMUA 4ALIA 1D4FA 1QLJA 4Q9NA 4URFA 1LDYA 1BVUA 2X1HA 1QXSA 1IPFA 3AI2A 4E2YA 2IXAA 2HK8A 4LISA 2CUKA 1M2WA 2NNLD 4IQGA 5MDHA 4CM4B 5CEEA 5HTOA 2OHXA 2HMSA 1VE9A 3O38A 4MPDA 2Y1DA 3JSAA 5AYVA 3K30A 4Z3DA 3HFGA 1ZCJA 3GMDA 2WYVA 3KSUA 4IDEA 4PLWA 3SLGA 4BO5A 4GLLA 3GFBA 4JNKA 5DCWA 2SCUA 4Q3DA 1SCUA 3HJAA 5DP1A 4CQMA 4K28A 4AJLA 4JXKA 4QFDA 1UZMA 4BNYA 5EESA 3ZWCA 2P4HX 2HRZA 5EMHA 1PGJA 2HAEA 1U4OA 3AY3A 4RPHA 4IJVA 3OQ6A 5COQA 3DZGA 1NQ5A 2WE7A 4MVJM 5LC1A 2B35A 4UEKA 3D7LA 2G82A 1E6WA 3GDOA 3W4IA 4R69A 2WE8A 3DBVO 3PWZA 4BKPA 4O6VA 4D3DA 1ZK1A 2WYUA 4TVOA 4E2XA 3PJFA 5H81A 5ICMA 4XQGA 1IZ9A 3MJCA 3G1TA 1YDEA 2E37A 1LQUA 3GC6A 1UXJA 3JYQA 3L4SO 4M89A 3I3OA 4GMGA 2IDZA 3MOGA 3DB2A 5C7OO 1PGNA 1E5QA 2D3TA 3ZWPA 3AUSA 2X5JO 3I83A 3UFXA 2H5LA 2ZKLA 2P5YA 3BMQA 1DC6A 4MVJP 3W4JA 1J5PA 3KUXA 1B8VA 2AQIA 3KYDB 2CDAA 1BRMA 1F8GA 1ADFA 3N58A 3JQGB 4L4XA 3E1KA 1SZJG 1LLDA 2E4AA 2HUNA 3ZHZA 5BQFA 3KYCB 4XQEA 2CDBA 1H5QA 2B4RO 1PS8A 3QWFA 3VPHA 3QP9A 1B7GO 4B4VA 1J0XO 2EJWA 5BNFA 1YBAA 4I1IA 5G0SA 2DM6A 3PIIA 1FF9A 3KZVA 5HA5A 2EJVA 1K89A 2RHRA 1WXDA 2WM3A 4RVHA 4XCVA 1P77A 3ZNOA 1O5IA 1Z74A 1CWUA 1CERA 5CEFA 3WGIA 1K5HA 3JQ8B 4W4TA 3HB5X 2QYTA 2PGLA 3GEGA 4U6SA 4IDAA 1ONNA 2C82A 3FRJA 1BVRA 5AXDA 3UCXA 1P1IA 4NBWA 1WMAA 4HBGA 4B4WA 1V35A 4BQPA 4GVXA 1PX0A 4FGWA 3COSA 3BIOA 1WDLA 2UYYA 4L0QA 2OUIA 3X2EA 1NPTO 3L6DA 2J6IA 5F5LA 2YUTA 4BUCA 2B37A 5BSGA 3NJ8A 2WJPA 4ZN6A 1ZVMA 3ITKA 4GVLA 3FWZA 4NFHA 6LDHA 2PWZA 3LF1A 4MVJD 1X15A 4Z9YA 4BO2A 4UEJA 4GKBA 3GNTA 4YEDA 2Q49A 4PN3A 5I8WA 3AU8A 4CM8B 1BW9A 1NR1A 1E1KA 1Z82A 3B6ZA 4NZ9A 3ZV6A 2B83A 4KTTE 4ND1A 3I6QA 5I7FA 2C7GA 3RASA 4PVCA 2VYND 5A9SA 4E5NA 4MP8A 4PZEA 3GR6A 4M49A 2POQX 4Z9XA 2BELA 1H2HA 2JD0A 1NVTA 3F5SA 2DUUA 2I5PO 4K26A 5HBRA 3OJFA 1GUZA 3JCZA 3RVDA 4M86A 1XIVA 2EIHA 5H82A 1EUCA 1XCBA 4DPMA 5JPIA 3Q9NA 2Q2WA 3K8ZA 1H6AA 2UVDA 4BHTA 2EKLA 3R0IA 4HV4A 1RM0A 1UDCA 4IDGA 2DT5A 4YAKA 1UP4A 3DONA 3H9UA 1GDHA 1VKOA 3IKVA 1PWXA 2NTNA 1SMKA 3EY4A 1T4BA 3ON5A 2ZTVA 4WCFB 1C14A 1H0KA 3CINA 2VWHA 3WWZA 1JKIA 4B79A 1KBZA 5I9LA 3LDHA 5TJ9A 2V6FA 4EEZA 2DU8A 4YT4A 3ZWXA 5ER6A 3HNPA 5CHEA 2Q2VA 3BHIA 5I7EA 3DBRA 3ZHBA 1NQAO 2NVUB 3LK7A 2A9FA 1Y9AA 1PIWA 2EGHA 3E03A 1GUFA 3JQ6A 4ZQGA 2VZ9A 3WJAA 1B8PA 3VH3A 1EBUA 2EG9A 2EWMA 1N7HA 3H7AA 1ZUD1 2FSVA 3BTOA 1JDJA 1SNYA 3KSZO 3SEFA 3PDUA 2C0CA 1QSGA 1H6DA 1JQBA 3TPCA 4EITA 3ANNA 4WEQA 2WWRA 1P9LA 3EMKA 7MDHA 1MX3A 4WECA 3QVSA 1E7SA 2QYSA 3A06A 5C7IO 5G4KA 1C1XB 4XX0A 5ICSA 4FOOA 4IXWA 2QZ9A 4PLYA 3F46A 2BFPA 3G49A 1PZHA 2Y99A 3UF0A 3RUFA 2YJZA 4P38A 4RQTA 3NUGA 3NGXA 3ITDA 1T1RA 4S1VA 2DPHA 3RUHA 1GADO 4FW8A 4OO3A 3WDSA 1HRDA 2I6TA 3UAGA 4N7RA 5G0WA 2VNSA 1DFHA 2JHFA 2VRCA 3VAZA 4CV2A 1ULUA 3O8QB 2VHXA 3UUWA 4BNJA 4QXMA 1VI2A 3SJUA 2FPGA 3GEDA 2EHDA 4II3A 1LC3A 3OJOA 3RI3A 4ZQEA 1A71A 2AE2A 5L4SA 2CVOA 2ZTLA 3QVTA 1PEDA 3ZW8A 4CMJA 1YL5A 2HKIA 4OQZA 3GDGA 4RVGA 4R5HA 3NT2A 2GDZA 1H93A 2FPIA 4MVJE 2IZ1A 1HDZA 5EN4A 1YS4A 4OHUA 5U9CA 3BMQB 4ZJUA 4TRRA 2NSDA 2W98A 3PI7A 5L3ZA 5U4QA 2PKRA 1SOWA 4L4SA 3LSYA 1FDSA 3W8DA 1KVTA 2RBEA 4Y8VA 4XRGA 1DIAA 2I99A 3B1KA 5KJEA 4DQXA 1T2FA 4ND5A 3U62A 2PGJA 3DZIA 3S2EA 4LRTB 1U8XX 1TB4A 2ILTA 2DFVA 1IHYA 2Q45A 3DBLB 3FNGA 3JD1A 3WYBA 3K92A 2X0RA 3ZZNA 2YZ7A 3EAGA 4IDDA 4Y67A 2BFAA 3PHJA 4GGPA 2B0JA 1DAPA 3DZJA 3IC5A 4K6CA 1I3NA 4AL4A 4DBVO 2CD9A 1FXSA 1ZZEA 2EP5A 4GX5A 2QW8A 3RJ5A 4Y9DA 2PH3A 3RKRA 3GAZA 2CDCA 2BI8A 2BHLA 1TA4A 3H2ZA 3L9XA 3TF5A 1E3IA 1X1EA 2I76A 3IKTA 4CMIB 1D1SA 4YYZA 2ZQZA 4BNIA 3QA9A 4DUPA 4FS3A 1VPDA 2VWQA 5A9RA 1GTMA 1NFFA 1ISHA 3HSKA 4RLSA 4ALJA 3RC7A 1FDWA 4YDRA 5HS6A 3EUWA 4FN4A 4MVJI 1P74A 4OL9A 4YTEA 1NVGA 4RVSA 3WJ7A 4EJ0A 1OMOA 2X4GA 1OI7A 3PWSA 4PRLA 3SJ7A 3M6IA 1EZ4A 3WS7A 2HRBA 2J8ZA 3C1TA 1U8FO 1B16A 1QR6A 3S55A 3WMXA 2FP4A 1PL8A 1KERA 1N7GA 2RH4A 3QE3A 1Y8RA 4AJPA 3FN4A 3I52A 5JYDA 1LTHR 3I4CA 3JQ9C 1YL6A 3WFIA 1LRKA 4NPCA 4RVUA 3ASVA 4QSMA 4UUNA 1YQXA 3OIFA 4UUPA 3CIFA 3TZ6A 3LF2A 5A3VA 3GNSA 2UUPA 1V9LA 4J1SA 3AM4A 1OBFO 1DLIA 2W2LD 4ND3A 3B70A 3KV3O 3UCFA 4PLHA
chains in the Genus database with same CATH superfamily
2X9LA 4GH5A 4JBLA 1R7RA 1EGQA 1RLIA 3RC3A 5KMGA 4JT2A 4PFJA 3QEOA 1B3BA 4BNWA 4RFSA 2H2FA 5IG2A 2X2FA 1PGOA 2FY8A 1YZGA 2IY8A 3RYHB 1Q15A 3VO2A 1GY8A 1TC1A 2NVBA 1QO0D 1H22A 2OG2A 5FP0A 1W29A 3G7SA 1QHIA 1TVEA 2FCRA 1ZXBA 3DZ8A 2YTZA 2XYQA 4BPBA 1A8IA 3CM0A 3EIXA 1TMYA 2MSCB 4OHKA 4QUGA 5T6MA 3OZVA 1PW5A 1A7KA 1ZESA 3F4BA 1WLYA 2BP7A 4KQEA 4AZSA 3H5NA 2DPXA 3TRIA 3GMSA 3E7XA 4MWSA 3DOCA 3IR5A 3ZHXA 2N47A 5C4IA 1NI5A 3EUEA 4M8SA 1U99A 1TYBE 3EDOA 3K5WA 4WKOA 2CXOA 3LCJA 1IK6A 3GL9A 3GNLA 4FHEA 3TAHA 2IUFA 3GJ8A 2HU5A 2NUPB 1XRRA 2QVYX 4IKEA 1LI5A 5DMXA 2Y77A 4JBNA 1OU0A 2C0QA 3DVQX 3GT7A 3NASA 1M7BA 3GA7A 3MCVA 4RHFA 3B8EA 3WWOA 3QVXA 4JB8A 4P7BA 2F17A 4QXQA 3FCYA 2XJ9A 3H6KA 3KEQA 1M1NB 2FSSA 4D8VA 3TM5A 3IAEA 2QSJA 3OKCA 2IOHA 1NW3A 3WBFA 4RTRA 3LWBA 1DTWB 3TXXA 2NP7A 1KZYC 4WACA 1RQNA 4MA5A 3RYFA 5DN6D 1GDDA 4Q7LA 1F5SA 3QLUA 4D4KA 2E82A 1AC5A 1KC3A 3OEHD 1WF6A 1O03A 5ES3A 5CDGA 2ZZMA 1XLWA 1ZICA 3R6LA 2X8WA 1AK2A 5IYZA 3B3GA 4U0JA 1WKBA 2OKGA 1J99A 3LXMA 2YXBA 4RDCA 4RZSA 5AJXA 1TYEB 2JANA 3WLEA 4CLDA 4AXBA 2HK9A 2QPTA 1TU3A 4UNQA 3AB7A 1CNEA 3LVFO 1MT3A 2QZ4A 4CETA 4AN1A 2PX6A 1GSIA 2ZTHA 3I0ZA 4RHCA 2ALJA 4ANFA 4B46A 3K32A 4EI2A 3A2KA 2HU7A 1YQTA 4EUSA 1FFAA 2CSXA 3JQFC 4HR7A 4RKRA 1R0WA 4RNDB 1DAOA 2G1UA 1P7PA 2HYIC 3BE8A 2A1TS 3DT8A 4RK6A 1LBSA 4M1EA 1CR4A 5SYAA 3JWPA 3W5IA 2BJHA 5EIFA 2XGOA 1O6CA 4Z3KA 1QIHA 2AMLA 2GJAA 3DJYA 2JA2A 3K0EA 2ZTMA 4AUNA 3B89A 1G5RA 3EQ9A 2F1JA 4IOKA 1WMEA 1GPLA 1AGRA 3D0QA 2AA3A 5CR9A 4CLRA 4FT2A 2MINA 3H2IA 4JT4A 3KO8A 1QU3A 5CLFA 3AXSA 1MC5A 2W4IA 3IEUA 2PGIA 3GMIA 2HZ7A 2Y66A 2BMJA 1MT0A 4KXXA 5SZIA 3TJRA 5JH7B 1NJ8A 1ZI9A 1P2SA 1OYYA 1WUJS 2BGLA 2YV5A 3BREA 3PE4A 1JW9B 1HZZC 1P4RA 4MUMA 4KXFB 3N2YA 1QIIA 2OMEA 1WNTA 1OX4A 5GJBA 4RD6A 1WULS 4KITB 1QQTA 1ZNWA 3OH8A 4N47A 3AFNA 4Z5XA 5BV2P 1W94A 3BMOB 2WYHA 1SKUA 1MEJA 2BGNA 2JS7A 3FX2A 5LYJB 1M34A 4GYYA 4JP3A 3SZRA 1C3XA 1EVIA 4MDFA 3VYTB 3Q8LA 5C0OE 5A4JA 2X8LA 3PRKE 3EWAA 2PKQO 3EZXA 5FV7A 4D0GA 1UXGA 4YROA 3FPAA 4DR4B 5EFZA 1SCAA 4I3HA 3V8EA 1WQ3A 1IK4A 1W52X 3QPVA 2D1YA 2DSNA 1PL7A 1AMOA 3TRHA 1HRKA 2XYHA 4AYWA 1DOZA 1BX0A 5T8KA 3I01M 3TKAA 4N18A 3VJLA 2IS6A 2H1RA 3L0DA 4DR2B 1VL1A 2JFPA 2JFHA 4D8YA 4PYRA 3D6VA 2IELA 4DDWA 3HN2A 1F20A 1U9ZA 1LSSA 1H0HA 3T1VA 1R5NA 1HFKA 4LJ7A 2RE8A 4IGKA 2PL9A 3NTRA 1I1OA 5AKKA 2CY0A 2AFHB 1R8XA 3I5AA 1CJUC 3J80A 5KHAA 3A0UA 3B2QA 1MA3A 3KV1A 4ND7A 2WSBA 1ZAYA 2QY6A 3UGTA 3TX2A 4RV5A 4V0SA 3G68A 2OKCA 3LP5A 1FOEB 3AVXA 1L9KA 2G07A 3O21A 4N0MA 1DIGA 3DCNA 3U16A 4MYTA 2HJVA 5CNMA 4BUZA 1IPEA 5CIQA 3DXYA 1UBTS 2J46A 1Y4DE 2GARA 2H54A 3EJ6A 3TI9A 3WIOA 3VMMA 3ZYZA 4RV9A 5I3CA 3W7VA 1UDWA 4B2LA 2PZBA 1G0NA 2OAQ1 3FM9A 1YUMA 4BKOA 3R9IA 4KUHA 2FJ0A 1JWLA 4Y7CA 4JLDA 1NJ5A 1V9CA 2VEDA 3CGWA 2F3QA 4PLCA 4UMFA 4URZR 5DMHA 4IIUA 1P2FA 2HQSA 2WUEA 4TRNA 2R6AA 1V0JA 4TLLB 3RK1A 1Q91A 4CF7A 5LU9A 2PV0A 2QRHA 2WTEA 2OB2A 5HWSA 3D0KA 2GNAA 5BQ5A 3HGTA 4ITVA 1RTTA 3V5NA 4QGFA 1U0TA 3ZZMA 4N0PA 4H0NA 2VF4X 2XBLA 2YWXA 2AJCA 3C6XA 3EFOB 2HWWA 3OUUA 1WB6A 3R23A 3PGJA 5EZQA 1DT3A 4M1WA 2QTMA 2ODNA 1YJAA 2JIZD 3MTQA 2MHCA 2MR6A 2XCOA 4INAA 1EB8A 2EV9A 2PRZA 3OIWA 1MIHA 1VA5A 5TNXA 1O94A 4Z6KA 1Y4UA 4ZT3A 1S8AA 3ODGA 2H6EA 2I1WA 2NTJA 4QYSA 3R09A 4OMCA 2B4KA 5ALEA 2KQUA 1HL7A 5KTTA 3TK1A 1XNJA 1I3MA 4B3RB 2ZWOA 1GYQA 1A9SA 4G0QA 3BM5A 2X0FA 3L4BC 3R3VA 4MYDA 5CA0A 1LBEA 3M5CA 3KUKA 3QVMA 3A1UA 1IE3A 1NGSA 5DOZA 1QKKA 2BCEA 3N5KA 5EG5A 2O0KA 1BHJA 3VI3B 4PO9A 3CLKA 3MRXA 1XQYA 1USVA 3T5TA 3UMBA 4DXAA 1GUDA 4XYLA 1SG6A 2EEZA 1WB5A 4J7AA 4TWRA 4G65A 2JW5A 2FEXA 3CH5A 2YH2A 4HRYA 4ZP1A 2G8LA 1GL3A 1WTAA 2IIPA 4DILA 5I7SA 1U1GA 3NBFA 1G59A 2EL9A 3GUYA 4IF6A 4F5ZA 5BT9A 1JU3A 1SU7A 2KSQA 3JTMA 3MXTA 6AT1A 3NGLA 2OQ2A 3FKJA 4HGNA 4HEA1 4FD3A 1NULA 3K6SB 2HSZA 4URVR 5FWXA 3TFQA 1K5PA 2P6MA 2QRQA 3KU4A 2DPYA 2YVQA 2ZRPA 4ZHQB 5CG1A 2O5EA 2ZIZA 5JJ5A 5A3JA 1LNSA 4GL2A 3K15A 1TT7A 5CYOA 5BNIA 5EAIA 1HA3A 3CJQA 3S5UA 3RUEA 4Y2PA 3SC2A 3V4ZA 4AIIA 5HKBA 2GTPA 3F3MA 1H69A 1GZ5A 2Z8ZA 1POWA 2JZNA 3DOUA 3ZXUB 1LQ2A 3NT4A 5KEIA 3T35A 1M7HA 1N8TA 1U9YA 3RC8A 2AN1A 2VNIA 4B6JA 3RYIA 3L8HA 1ZHOA 4AC9A 3DL2A 5JARA 1HDXA 1IN4A 3IUBA 4TYWA 4HDMB 2CK3D 2FUEA 3EYAA 4P3KA 3FMIA 2IIBA 1J00A 5KKAA 2DR2A 3WMEA 1OFUA 4E4YA 5A04A 2HXSA 2P78A 3W8NA 1U7ZA 3IBGA 3K96A 2C95A 4AQDA 3E9QA 4C05A 2IHJA 5B1HA 1EUQA 2PVCA 2ZATA 4FIZA 2BBSA 1A2OA 1XZPA 4GUDA 1C9EA 2I6FA 3DHEA 5FL3A 1ENYA 3H19A 4GXQA 5HK8A 4BVBA 2G04A 2PK3A 2PRIA 4ARSA 1VJ1A 4J49A 1OGIA 5J43A 1QH9A 3IB6A 3F6CA 2ZYAA 4IV8A 4PRYA 4Y1RA 1YS6A 3K9NA 4FQ7A 3VHXA 1YQEA 5HOEA 3E3MA 2NGRA 1D2MA 3RJTA 5IABA 2W6IA 2QL6A 2Y6UA 2J07A 3EF3A 4G9GA 2VPZA 1Y6QA 3MG9A 3VUEA 3P2JA 2FPPA 3W06A 1X8XA 4RTLA 2VUUA 3JQBC 3U3KA 4BFZA 4D3ZA 4HRAA 4EI9A 1E0KA 3HZZA 1XK7A 2NU6B 2G9NA 2EBUA 2X4LA 1CUDA 2CXTA 4HYTA 3REFA 4LJ5A 4DARA 3ANLA 1BU5A 3UJCA 2HYDA 4KHPB 1B6TA 1E9RA 4B7AA 4OFBA 5B58C 1EKXA 1RKXA 1WDMA 2VK8A 3LBYA 4DV0B 2Y1CA 5EIBD 2VPIA 4H3HB 4ZRMA 4MI6A 4ZGWA 4L8WB 1R0XA 4ZEMA 1TTPB 5ALWA 3JAWB 4DR1B 4JJ7A 4KVZA 4HNUA 1E59A 1JMVA 4X6YA 4GZ3A 4XWWA 1XU7A 1QGZA 2A5FA 3Q9LA 4MV6A 4HQ0A 5FQOA 1FTWA 3E18A 4M1KA 5BRNA 3AY7A 4ASUD 4P83A 1D2GA 1ZHFA 3HEAA 3I9LA 4MR8A 3W5DA 2FFJA 1RD4A 2C7RA 2VHYA 1X7GA 3ZW9A 3KD3A 3Q7PA 3IL2A 3H2GA 2JGMA 1YJBA 3T3PB 3OZAA 3IE0A 3OJCA 3BOSA 1CB7A 2IHZA 5I9TA 5KIAA 4CUKA 3D4LA 3UWPA 3DE6X 3ZYCA 4BE4A 1QCCA 4P2BA 2YN4A 1Z37A 1WPGA 1QBKC 4CM3A 3MGKA 1BFDA 4PFKA 2D5CA 1EHIA 1BAPA 3L1KA 1BG6A 4HB4A 1QRAA 4L4UA 4KO2S 4PIPA 1BU8A 1H0RA 4ZEXA 3IUMA 2FW0A 4LDRA 4TYPA 4P08A 3UGQA 2XI4A 1KJYA 1L0BA 1CSEE 4K1LA 1U2DC 4TL6A 4TOIA 4ZPXA 4UBKA 1FP4A 2ISCA 3C5VA 3P9XA 1SXJD 1GTJ1 5AD1A 3HP1A 3D7SA 4WY8A 2GJKA 4Z9BA 4AWBA 5CK4A 5FI3A 4ZV9A 4MUKA 3DKKA 5HGXA 2GGSA 4YRFA 1YFKA 3UXEA 4EB6A 2CBGA 4BN0A 5HIAA 2I0FA 4EG1A 1TLTA 1N2ZA 3D4IA 5KYWA 3IQHX 1MG5A 1VRCA 3E7FA 1HY3A 4JP8A 1RC1A 1WZEA 1C7EA 1YIOA 3CR7A 1GG5A 2G80A 3O4VA 4PZ0A 5EGSA 2PN1A 1UEXC 3DZKA 4E70A 4EB3A 1N1EA 1SBNE 3N2GA 3OU7A 1QF9A 3FSJX 3L1JA 4JB3A 4O59O 2CKDA 2ZDHA 2P2YA 1FTSA 4WDRA 1NHGA 4DLZA 3SQNA 5IDYA 1QYIA 4JKIA 4DDKA 3OOSA 3OHMA 3NBKA 5K0GA 1SK9A 4AUMA 3R5TA 1UBUS 4MRNA 4YJGA 4CNBA 5CAEA 1QGYA 2WJVA 3E3NA 5CFZA 1HM5A 1V5EA 1Z39A 3DL7A 3F3KA 1SBZA 2JLUA 4H7HA 1J2JA 2PU7A 2PKCA 3A0RB 3DE7X 2GUWA 4BZWA 3M9LA 3UK1A 2VHJA 1YKFA 2RGEA 1YA8A 4BO8A 4G5FA 3M3DA 2EW8A 2RGNC 4O1HA 3VMFA 2OZKA 2N42A 1AKYA 4P1ZA 3IR6A 3HABA 4Z4EA 4OQPA 4LIPD 1M34E 1CR2A 3REOA 2PS0A 4J2TA 4PR3A 3DTVA 4ZVTA 3RSZA 4RQAA 2CMDA 5AHWA 1FS6A 2Y05A 2ONCA 3AHDA 3SDSA 3ESRA 4OJQA 1FTQA 3BGVA 3K2BA 2CNWA 1LSJA 1XP5A 3OBBA 3HWSA 4AS1A 1SAYA 1NW5A 1TU4A 3AM5A 3KAPA 5DIFA 4FYJA 4EJSA 2HBRA 4EZBA 2VBFA 1RCUA 2QTZA 2BUBA 1NUQA 3QE2A 3ADBA 4A16A 1UC5B 4MK4A 2JK1A 4QSHA 5I5GA 4PYQA 1NG1A 5ALVA 2C29D 5IARA 4RYLA 3LIIA 4WA8A 3TTUA 2V7QA 3MLEA 3ZW7A 5AUPB 2DLCX 2Q3JA 2QAGB 1J56A 4H3VA 2XOEA 2VWGA 2GBLA 1RE0A 2XMQA 3LE8A 4EENA 3ONEA 4B6SA 1Z5PA 1M75A 1JDPA 1K27A 1L6IA 1ZM4A 2I3GA 3CKYA 3DT9A 3FDZB 4EA7A 1JSXA 1JFLA 3AEUB 3WRXA 1FBTA 1JLKA 3G5MA 4YMSA 3GEHA 1YOVA 4BLTA 5LLDA 4NNPA 4U7HA 4DV7B 2NTYC 4NDZA 3U1TA 1A5SB 3AG6A 1CE8B 2NN3C 2C5EA 2YVKA 1U1CA 3D6TB 2L18A 3H2JA 1KPHA 4N9WA 5FYDA 1TI7A 4ZZ3A 3LC0A 3ZKWB 5A4AA 3GOHA 1EWTA 3KKKA 1QRSA 3ECCA 3HJHA 2BHNA 2XLBA 2AUTA 1IWBB 3FFAA 3HUTA 4B80A 2Q6OA 1LW6E 4R1NA 4FFOA 2BMDA 2R8XA 3N8DA 4PY2A 3TNYA 5KVCA 4B3SB 1JAZA 2VPQA 1GV1A 2I4MA 2EFDB 4BFXA 3HY3A 1ULAA 4QHYA 4CQMB 4J9UE 4ZXFA 2FPWA 1D4AA 2C9MA 3BHMA 3V8RA 4EGSA 3DOHA 1G5PA 4QU5A 2I3ZA 4WGFA 2GM3A 4A0RA 2LP4Y 1DZIA 4X9XA 5A2GA 2Y0BA 3CWQA 3LTEA 5CM8B 3RRBA 4HTAA 1H66A 2PS3A 3L41A 4HAWA 4M37A 4RIFA 3RBVA 1L4MA 2ETXA 3ADOA 4PRKA 3TH5A 5M04A 5DE3A 2FWMX 4AKSA 2VN8A 3KR9A 4K1XA 2C3UA 1O6BA 1FRZA 1P6UA 3DMPA 2QMUA 2PUDA 4EF6A 1W0KA 3PTAA 2G70A 3SJBA 5E6SA 1M0TA 4Z7OB 4G0OA 1PTJC 1QGUB 1MX1A 1RRKA 2C07A 5A5EA 5ADHA 2FZ5A 4HDCA 4DSTA 2BISA 1TCVA 5AI8A 5AI5A 4BV3A 4DIFA 4DV4B 2QRKA 1KVRA 2FQ1A 1MG0A 3FWNA 4HJRA 4L27A 4AMBA 5IT0A 4J4BA 5JY1A 3GUUA 4MW2A 3EQ2A 4E12A 5EJGA 1BJTA 5AM4A 2XOXA 3IKLA 2GZ2A 3ZVMA 1NVBA 1V37A 2D1SA 4JODA 4LS3A 4EJ6A 1P5ZB 3GIWA 3PVSA 1G3IA 5JD5A 4L5JA 4GM4A 1IZ7A 4QRIA 1CUJA 5EXXA 3T7RA 5K20A 3GG2A 3L0YA 1XF1A 3MHPA 1R9GA 2ATIA 1C3OA 5EIAA 4LY3A 2VCYA 5BMVB 2Y68A 1OLOA 4RY8A 4BVLA 1YVRA 4FILA 4DQVA 1ZL2A 1DQRA 4MS3A 2VP3A 2WJGA 2AT1A 2R1VB 3DDZX 4LYDA 1IOZA 3GVCA 4ETIA 1C4KA 3WLOA 2VF8A 4YV2A 3KXIA 4MW7A 4EQZA 1ONSA 3P0HA 2R48A 3PNYA 4RJ2A 4H6PA 2RGYA 1HYGA 2AOUB 3BQNB 3I2FA 4XWOA 4FKBA 4AO7A 1Z2NX 1IY8A 4QWMA 1TJ3A 2EG5A 1YE8A 2G1JA 4DANA 1Y3IA 4DUZB 2IYOA 2MR5A 4A82A 3FVWA 4GPBA 3JRXA 2H07A 4GGMX 5ALMA 3V8BA 2VIIA 3ZGYA 3CNLA 5JQGF 1SBCA 3K8OE 4NARA 3RSOA 1OB5A 3HG7A 1ECCA 5IP5A 2O54A 3HYTA 3CW9A 3DTYA 3VPSA 3C7TA 5LA6B 3I42A 3WFJA 4M1ZA 5H83A 1JA9A 2CNOA 4I55A 3IP6A 4O5AA 1Q1BA 4LY9A 4FP9A 3EG5A 3LT2A 3ZGOA 4YMGA 4GBMA 4QO8A 5M3BA 3QSYA 4QT4A 3DG9A 1FFWA 3CKMA 4PU0A 1PFKA 2XX3A 3F1LA 1R88A 4DJ5X 5HIKA 5LBIA 2XVAA 2GAFA 4IKOA 1C0LA 3QFRA 4TKVB 5AK3A 1KKMA 3E1GA 5FFNA 2NZUG 2Q1UA 3R76A 3BVPA 1ABEA 2H65A 2Q41A 3ELDA 2IOQA 1MAHA 1EGVB 1VXOA 4I5EA 5JNSA 3MT8A 3C8HA 4IUYA 1OGYA 4Z2YA 4P4SA 3MEQA 1C81A 3JD4A 2CD7A 4AYTA 3H8VA 5F9HA 1KDPA 1XRPA 3CVXA 1FSGA 2JIQA 1EM8A 1NNSA 1TUIA 1GQRA 1K7SN 2YXEA 4G6ZA 3X1WA 2IYNA 4AMUA 1XR3A 1ADYA 4KIWA 5BUCA 5A9SB 2BW0A 2X0NA 5AJZA 5L40A 2N9UA 2V1UA 3TCXB 2RI0A 3AHHA 3B9RA 3O7WA 4FMDF 1KDZA 1WETA 3R20A 4NI5A 1VI5A 1UM8A 4YCBA 3T41A 2BGUA 3V00A 4E5KA 5A4IS 4GLFA 3RIYA 1QVRA 3S68A 2EL7A 4DV1B 5EKDA 1QFXA 1T24A 1U5AA 2ZU0C 5F73A 2B6NA 4NYIQ 2YRFA 4DYDA 4K6OA 1WM1A 3WYFA 4JP5A 1X7ZB 2ZITA 1BO6A 5AI6A 3WWCA 1RYDA 2VZLA 3RBZA 3I2KA 1HFJA 3JWJA 4JP1A 2ZANA 1IH8A 1RYHA 3L07A 4R1MA 3L4EA 2I8LA 4FLFA 4E88A 1TEHA 2XA2A 2FDCA 1G60A 2P68A 1SKQA 5LWQA 1JNYA 2P90A 2FWIA 2H29A 3R40A 1YI8A 3GEEA 3U09A 1KJ8A 2C2ZA 2FLVA 2ABWA 5EUCA 2IYFA 2I4RA 4TKUA 4B6OA 5C18A 3ZOZA 1R8JA 1K8QA 1FJ2A 3ISTA 2Z2YA 3K2QA 3EEBA 3KT8A 3DBHB 3AUUA 2AHRA 2HR1A 2Q4RA 3FUWA 2V9ZA 1C7ZA 1QZXA 1XAGA 1ADGA 1RM4A 1SVOA 1G8GA 4QUDA 4D9MA 4RZ2A 5EL0A 2IDKA 3CLUC 1KO8A 4MQFA 4ZQHA 1RQ2A 2UYCA 4ALLA 2XUIA 1I2DA 4PQGA 2QI9F 4CT5A 2VRBA 4PONA 4BMVA 2VF7A 1J25A 3KWLA 3H2BA 4IDQA 2HQBA 4X7BA 3JD3A 4Y2VA 4IIHA 5K8CA 5AKEA 5KX5F 1T8WA 3IE1A 5HMMA 3RHSA 2IYXA 3IHWA 6Q21A 4DM3A 5KQLA 4M6WA 4QOFA 2INGX 3PKIA 2O0MA 4MEAA 5C5CA 3ZI4A 2OR3A 2HK6A 1PBTA 1W6UA 3G1UA 3MBKA 4J4HA 4PZDA 4J1NA 1K98A 3H7IA 3ZNPA 2R6DA 5CUQA 3TLEA 4JI6B 3FIJA 4D5GA 3E0XA 1ILEA 2DE0X 1BN6A 2NV0A 3BUSA 2VI5A 4YQYA 1RPZA 2WP0A 1O87A 1UMDB 4DEXA 1E2FA 3ZX5A 4YCCA 1RHMA 2F6RA 1UQUA 2PMCA 3IVRA 4NJMB 2NU8A 2BEUB 1D6SA 1F0YA 5IVHA 1EQUA 2WQ7A 2Y1FA 4LNUA 5G4KB 2AN9A 3BTVA 1LNQA 5IM5A 1WSBA 2JIZA 5E7JA 4XX0B 4PHCA 2ZXFA 1UBRS 3W5AA 4DIOA 1EBFA 3FCXA 3T3NA 1G98A 5JTTA 1JHVA 2CHEA 3HYSA 1EX1A 3LQ2A 4I08A 3R6TA 3Q0IA 3KVNA 4LZLA 1MCZA 2VNKA 4UU1A 2HCRA 3CE9A 3K0AA 3LT4A 1J2RA 3OTWA 1AA6A 4WOJA 4EG8A 1VKRA 5FX2A 3LC1O 2G0AA 1JL3A 4R7ZA 1ZXLA 1FYVA 2ZT8A 3H9JA 3EXHB 3HU2A 4O4HF 1ANKA 3WP0A 5FEUA 4NOJA 3WNCA 8LDHA 4C3OB 1UZLA 3N87A 2QXYA 3TEMA 2HQ1A 4OHWA 1E3TA 1NE2A 5FLKA 5C46F 2WF7A 3G2QA 3U49A 4RS4A 4D0RA 3CRZA 4WZZA 1R0CA 4KV9A 5EJ2A 3W8EA 2JCBA 2W37A 1NU6A 4IVRA 4OQQA 4PO8A 4PYNA 4YAOA 4DEYA 1OFIA 1QOQB 1U6KA 3H5VA 4EIWA 4KCGA 3L40A 3UOAB 4Z4GA 2PCLA 4MEBA 1JJIA 2FW7A 3CT4A 2OC4A 4GMXA 1T2DA 4C0KA 1OPXA 3KAJA 1NVKA 2FPIB 4OBBA 5F21A 1A5BB 2X15A 4M46A 4MINA 2WIAA 1LPSA 2WJ3A 1E5DA 4OJTA 5AVOA 4AG5A 5E1MA 2UZ3A 2PXAA 1O97C 4IIXA 4RK4A 3UAWA 1DBSA 4R8KA 2KE5A 2OZLA 1U7UA 1DVRA 4E11A 2NO7A 2X3UA 1AQIA 2A86A 3EULA 4D44A 1PR0A 3GGPA 2VQFB 2V7WA 3OIDA 2I87A 2HBZA 2G7ZA 1KKLA 1OD6A 1J07A 1DPFA 2V4MA 1X6VA 3B9BA 4YAEA 5AI4A 1GM5A 2BFCA 2Q0SA 1RYFA 1Z16A 3CB4A 3R5JA 4YMWA 4XARA 3EEIA 4G81A 3QUAA 1WXGA 3I61A 2ZUSA 2CK3A 3O4RA 1QRUA 2PH7A 2QE7D 1AUOA 1A9YA 4IWYA 4WKNA 5MGBA 2G5CA 2GS9A 1BDMA 2IE0A 3AHCA 4FSDA 1UQRA 4ZT7A 1KP9A 1ISIA 2WP8J 3KYDA 1KF0A 2ACWA 1NBIA 4LKOA 2IW1A 2X3FA 4M3NA 4XIJA 5M5BA 3NCTA 1HT1E 2Z1DA 3JQGA 3ABRB 5CGQB 2Z2KA 5ERYA 2PE5A 4DPLA 3UANA 3ZJVA 4CCSA 4CNQA 3V1NA 3ZU4A 3WK6A 1C0EA 4N5LA 4BU0A 3C5EA 1J2EA 5FWAA 3OO1A 2OK7A 2YBDA 2BI4A 4L5YA 4JYZA 4ZCPA 3LLVA 4R31A 3DO5A 5B1IA 1CF9A 5DBIA 1SKAA 5K0CA 3V4LA 4DCUA 4N5IX 1O57A 2BWJA 1JG4A 4ZEOA 4YRIA 3NYIA 2DT8A 2H7CA 1FNSA 2PUVA 4FTWA 5I7WA 3TIVA 3LO5A 3M8KA 4X3CA 3W2FA 2UXBB 3CLSD 2G9ZA 2WHPB 4E1AA 4W5JA 3OCCA 1E1YA 3FYUC 4I46A 5GMOA 1OQAA 2NM0A 5CBKA 1CEEA 4OKSA 1NVFA 1KIFA 4W1SA 3KB2A 4NSNA 5J23A 1NXQA 1KARA 1SC6A 4M0FA 1WW8A 1FYDA 1EXMA 2JFBA 4IQ4A 4G5YA 5CXUA 2O8NA 3CLRC 1DAMA 2VF2A 4NOKA 4PN3A 1RVV1 2HUPA 4J43A 1FB5A 3RC2A 1GYRA 1YDMA 2HC9A 1GCAA 3OVMA 1X0VA 3W1VA 1O9HA 2BBOA 2JH8A 3L7LA 3EG9B 4PAWA 2PD6A 2HEIA 5IDQA 2FUKA 2A9QA 5CGZA 1M73E 2XB4A 3ET5A 1GARA 4XM0A 3TTWA 4I4LA 4ASUA 3LXUX 3C4JA 3MCUA 1BXRA 2GF0A 1Q0TA 4YJ3F 1F3OA 2YWCA 3DTTA 4W82A 4ESHA 1YJ8A 1TKRA 1XZBA 2QZPA 2Z95A 3FPHA 4KUGA 1TIBA 2D2VA 4TMXA 5DGCA 4MICA 5EMJA 3RRMA 1LPMA 5HDQA 1G41A 1TIKA 1QG2A 3SXJA 1TM4E 4JBGA 1AGNA 1DHTA 3K20A 3VYUB 1R8SA 3RC9A 3K2EA 2YFHA 3LY7A 4S1WA 3ZV3A 1N2IA 2Q7DA 4O02B 2EERA 1EGHA 3C3WA 1EYZA 4JOBA 4R3WA 2BSQA 1NQTA 4MO2A 1TUEA 4MV9A 1Z06A 3IV7A 5KMGB 1E8NA 2WV7A 3FHOA 4RFSB 1TPYA 3KEFA 2YZMA 1JLMA 2ZRQA 1YUNA 2BR4A 2HM7A 1HYEA 1QFZA 2IH5A 4MLDA 2HCTA 2DC1A 4LDAA 4LYJA 1TW3A 3HNOA 2XWSA 1BXKA 2ZG6A 2ZJ6A 2IZOA 5CLGA 3VH1A 1LK5A 1RAHA 1CUFA 2CB9A 1ZRSA 2H7VA 2JKZA 4ITRC 5FKJA 5EERA 5JLAA 2A67A 3DWEX 4QUKA 4ATNA 4YA6A 3ERCA 2OG1A 4WCFC 3JU3A 1P4GA 1UBKS 1X80A 4B71A 3B1WA 2BP7B 3C2QA 3GJXC 2I1VB 4L8YA 2IUTA 2R7LA 2B8WA 1WEHA 1H9BA 1M2NA 1SBYA 3FUCA 4G0XA 2CXPA 3V1MA 5LZ4A 5LMUB 4O4JF 1YR7A 1QAOA 1QYWA 4HK4A 4CKXA 2ADFA 4F6LA 1K5DA 4R0MA 4WMLA 1JN0A 3ESAA 1H3FA 4BNLA 1DBWA 1KJWA 2DHEA 4ZK2A 4GDMA 4FN5A 1RXUA 3IX7A 1TQDA 2X8JA 4R01A 4GSYA 4X94A 3DR3A 2PT7A 3T5DA 2D1RA 4UKDA 1T8PA 1RWVA 1MQAA 3ZUGA 3GFSA 3PXDA 5KCZA 4A8JC 4YUXA 1Y1PA 4V0RA 1WVMA 2NVUA 4B3FX 2HHHB 1VB3A 2IUUA 3HM9A 1AO3A 1KI9A 2R68A 2RGAA 3RYFB 3UQYS 2CNDA 3NXKA 3CNEA 2KYRA 4ALKA 4G4SO 4AF7A 1BIFA 4RH3A 1U94A 1MQ9A 3O8LA 1VB5A 3IV6A 1N2SA 3IXLA 5IYZB 4WNAB 5CYPA 1GQSA 1KEUA 3FROA 1KXJA 3EDMA 3RF6A 4EK9A 3VFDA 3CMCO 1V3TA 3ZXIA 3BBPA 4N8SA 3CURA 2J45A 4M1YA 2OXCA 1EG7A 2HA7A 4MUBA 3OZ7A 4HWRA 3KJNA 5CB0A 2PJDA 1OLUA 1B8UA 2H2WA 3DEZA 1E3JA 4KR9A 5BXYA 1EZZA 4KZPA 3VOTA 1GPBA 3OPYA 4W1PA 1WZNA 1E1QD 4IM7A 4WV3A 4ZWNA 1WD7A 2WB4A 1C1XA 3IFSA 3QI2A 1W46A 2PZEA 1PS9A 2QR5A 5HCNA 4C3ZA 5AVYA 1E79A 3ANMA 4F7WA 2CW5A 3ZVLA 3DHVA 2FR8A 1W0CA 3FLBA 1YZQA 2FOIA 2QG4A 1SU8A 4Q5IA 4LVUA 3UHOA 3BXZA 3H86A 1YHNA 4F2GA 3Q7EA 4QU0A 3E3OA 3O5AA 4LZAA 4Q7KA 3ZWWA 5J2UF 1VRWA 3FUUA 3IIEA 4FFMA 4CLRB 2MINB 4ZAXA 4F06A 2WWTA 3ELBA 5FL7D 3OCXA 2XSZD 1R5BA 1Q12A 3RFUA 5BQXA 4HEQA 3CF4A 1GRNA 2RGDA 3B6EA 3FWYA 4ZVVA 1MB0A 3WGQA 4ZOLF 1S6YA 2QTTA 2OORA 1NG9A 2V98A 5DNDA 4OP1A 5EI5A 1D3AA 1U0GA 4PCUA 4WXPA 3VDQA 5I47A 2B9VA 4CIXA 3R3SA 1X2BA 4R5MA 1M34B 2RI6A 5B3KA 1JDVA 1Q50A 3OT1A 3IAFA 2QGZA 4RZQA 2P2LA 2PL1A 2C2MA 5KHLB 3I1IA 4XFJA 1U7DA 3W9BA 2Z4TA 1C3EA 1GD1O 4LMBA 3SIXA 1PSWA 3KJXA 4YMHA 1CDOA 4QOIA 4QQFA 4M1QA 4EYKA 5T3YA 2EJCA 5HUQA 4OK5A 3K0KA 3ROMA 3VPFA 3LCMA 2O6HA 2XNSA 5F77A 1I3CA 4I9UA 5G40A 3DNPA 1P5JA 1M2HA 4DL9A 3E9YA 1H42A 2NV6A 1N34B 1JJVA 4NJOA 1XMQB 2OUKA 5F1OA 3TD6A 1N6LA 4DHWA 3LQYA 4O2RA 2GYYA 2XTJA 1U5CA 2IYZA 3A9VA 3CKKA 3K9QO 4C0SA 4F85A 2W6MA 4TYYA 2JLRA 4FXOA 5FQNA 4XQ0A 2HDHA 4K9KA 2PBRA 3MXOA 1Z17A 1G21A 1EFDN 2A9OA 4CGZA 2GSDA 4OLJA 3KQUA 5KJ6A 1ZUNA 1X70A 2IPAB 1WEKA 3P9KA 1HDEA 3D6UA 3FDJA 4IRUB 1EFRD 7YASA 3OC0A 4JI0B 2ZYWX 3OHSX 1DEAA 1DB3A 1FNDA 2AUMA 5J1TB 4MPJA 3RFFA 4QDXA 1NA5A 3QJYA 4JYBA 2R7NA 4OSEA 1O89A 1OXSC 5FI1B 1XCOA 4EY5A 10MHA 5BOVA 1LJLA 5CT8A 3CKLA 4ACAA 1O96A 5KU1A 3C3EA 3HR8A 3H5LA 3I4LA 4IWNA 3AF0A 5C1IA 3UMFA 13PKA 1D03A 4Z9AA 3ZLVA 3GRPA 4MWDA 4XJTA 3KOWA 5A1TA 2KX7A 1G7CA 2UUBB 5CMLA 2VQEB 2EC5A 1D9ZA 3C3XA 3PXUA 4FM9A 1YI0A 5LWHA 1QHHB 3HCCA 5AOVA 4UQLA 1DGQA 1A9OA 1PWZA 2J3QA 3LUCA 2YVAA 3WBKA 4AJ1A 1IUKA 5JSFA 3LUFA 2XE8A 1XDWA 3SF0A 4R71A 1KSGA 2NXJA 1H1LA 3MB5A 1LLFA 3V1UA 4FEAA 1O08A 1M54A 2KB0A 4I1RA 2JAXA 5AVWA 3MAGA 2C94A 2P1DA 3RU3A 4IO1A 1CQWA 2VPPA 2CBXA 4TX1A 4B7CA 1JDBB 4KKXB 3MK31 2O07A 1FP6A 4QARA 2ZSIA 5HBGA 2WWWA 2F1IA 3CEHA 3R3HA 4F3KA 1PW7A 3Q2OA 1GQQA 4QAJA 5CA0B 1UC9A 4QJ4A 3R75A 5THXA 1W47A 2V0NA 3CA8A 4TVKA 4J0EA 1A7AA 1OCEA 4HDRA 5DM2A 4D3FA 1IN1A 4DJTA 4K40A 2P2SA 3OJLA 1LDNA 1LDMA 2FEOA 2QRZA 2Z9CA 3SHVA 2B69A 4C7JA 4Z51A 1Z4IA 4MW9A 1N2CA 4B6GA 5IEBA 1M6VA 1WIWA 2RGNA 2WSIA 3PNKA 5CVVA 4Z7NB 1U0HC 3MTAA 4IJUA 1G5HA 5J9FA 4OQYA 4C89A 5E7IA 4CIVA 3OPVA 5ALXA 2VJLA 4ERNA 4V0ME 3T1HB 5ICEA 4HFNA 2HIHA 2NO6A 3VJMA 1ZL0A 4JL8A 4PEVA 4IJKA 4BX0A 1O2DA 4E5YA 2QN3A 4AMYA 4TUYA 2J5XA 5IUNC 5K03A 4EX7A 2VDOB 3QVJA 3P32A 5BYAA 2Y9PB 3EVDA 5IM4A 4Y9SA 4J76A 4R41A 4NEHB 4KQWA 4MKZA 4UOZA 4P4GA 5A03A 1RNLA 4K6GA 3CJRA 2A30A 3IDAA 4PGAA 4QOGA 1A1VA 4HPXB 1KFKB 4TLAA 3SC2B 3LCUA 3EEYA 5BXQC 1CRQA 4KXYA 5HF6A 1Y42X 4KWEA 1MAAA 1EJ2A 1UODA 4IH4A 1EDEA 2BH9A 4RF4A 1Q21A 4HF7A 1DIHA 3QM1A 5EKUA 4MCJA 1Z4QA 4QDJA 4TQAA 5FLYA 1ABBA 3QKSA 4GXRA 2ZSBA 2FQXA 4BZXA 2GZDA 3D7MA 3U4CA 1RACA 2XMRA 3LCRA 5AI0A 4DSZA 1KIMA 3BIXA 3N8IA 4YP0A 1GTSA 1NN3A 3F6PA 3NX4A 3AHEA 3FGNA 3VNRA 1OA1A 4DC9A 3JPYA 1Y7PA 4Y2JA 1CUUA 1ZISA 1SD2A 3DNFA 4FNMA 2YWFA 4A0SA 1YU9A 3DV0A 3EN0A 4PSCA 3CX3A 3VTKA 1SUEA 5JXGA 1HT0A 4OD0A 1EI9A 2BI7A 1Y0BA 1GOTA 2CBZA 5ETJA 1EX6A 1TW2A 4WQMA 1HR0B 5FOWA 4UUOA 3JPWA 4AWXA 4BX2A 3VHXB 4H59A 4CLOA 4BXOA 4XGIA 1SPBS 1T9AA 2O2ZA 2W0MA 1YB5A 4NXMB 3HXKA 2FPPB 4KR2A 4KMSA 3CF2A 3UJ8A 1LRLA 3HEMA 4KX3A 4YI5A 4JJGA 1N8NA 4MP6A 2HDWA 1POXA 2O2DA 1WG8A 3QYAA 4GG1A 4EW3A 3EVZA 2OD9A 4BDTA 2Z58A 3RVRA 4Z54A 3W5UA 3T1OA 2OCLA 3HBAA 4CLHA 4DWJA 3II6X 1QH8B 3R8FA 3AQ4A 4HYYA 4AN0A 4IDCA 1A8SA 2BT4A 4GD3Q 5EXEA 3L82B 2C2WA 5AUOB 1KVUA 1YQGA 3BWBA 1HE8B 1FFXB 2JJQA 4FDUA 4NICA 4C6SA 2VP4A 4X61A 3VZQA 1LNZA 2O2JA 2EKPA 3R1IA 1A9QA 3FSGD 5FA6A 5C2JB 5K6AC 1PJRA 3ABQB 4MR8B 3GRZA 4FONA 4XRRA 1F0KA 4RMGA 4BMZA 1XZ8A 1TQ8A 1DFGA 3G82C 2P0YA 3T9AA 3PFIA 3DM5A 3GLHA 4WOBA 2YNMD 3M0EA 4FBLA 1Z0JA 3PX7A 2H1HA 3O31A 4HX9A 3TJMA 4AF6A 2EP8A 3VHRA 1Q0LA 2J5RA 2VTKA 1CNFA 1Y1TA 2FWRA 4YHBA 2I03A 1ECBA 4X20A 1Y1LA 4MCHA 3ECSA 4YBRA 5CH3A 2YMLA 2ZSKA 3WGJA 2EX4A 2Q5FA 3WLLA 3CZRA 2AFIA 2FQYA 3IUSA 3SFTA 1X1QA 5EWMA 4C43A 1XG5A 5KJ1A 4EMBA 2EBWA 3S6JA 1F3LA 3I4FA 4RENA 2AXNA 3RT9A 3ZI7A 1FP4B 2IEGA 4PFSA 3VZCA 5DX8A 1FXWA 4TMYA 1XD8A 3FR8A 4TS1A 5DXFA 5SV2A 4IHQA 5LA6F 1A96A 4I66A 1RYBA 1I1HA 4UTRA 1T4CA 4OHBA 1YF3A 3T5BA 5B5SA 4L8GA 2N1MA 4IQ8A 1NV8A 2A9KA 1I24A 5KYWB 3BXEA 2AC4A 1LCIA 4DKJA 3NHPA 1AD2A 1MZVA 2FWJA 2RHCA 3HC7A 4MB6A 4JOSA 4PSVA 2A59A 5EPOA 3WFZA 4EWLA 1Q84A 2BR5A 4EGCB 3EVEA 1FDUA 1YGPA 3CVYA 2Q4TA 3COWA 4HO1X 4W1QA 3U3JA 3SQWA 5D5HA 1AB5A 1O54A 3N2GB 1KSFX 2GK6A 2OV4A 1FFGA 3BGWA 4HLCA 4UUMA 2AOVA 3EC7A 1DJNA 1VJ0A 5HMLA 1NFQA 4A27A 2JCGA 1DAFA 1UXHA 4EY4A 2GK7A 3N5CA 2MT9A 3AUXA 3DOOA 2PMBA 2CGEA 3PQEA 1BMQA 1KZ1A 2E87A 1PWEA 4ZA2A 1R5OA 4JUAA 3H3FA 1NASA 2V7GA 4IAOA 5CAEB 1VPTA 4G37A 5T6BA