2LE9A

Ragec2-s100a13 tetrameric complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
b'LEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Interaction of S100A13 with Receptor for Advanced Glycation End products (RAGE) C2 domain
rcsb
source organism Homo sapiens
molecule tags Membrane protein/metal binding protein
total genus 14
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2le9A00
5EC1B 4PJHB 1MEXL 3QEHA 1WBYA 4CVZA 5C0AD 1LP9F 5BJTB 1BVKA 4JFFB 2X1WL 4JN2B 5AUMB 4HWBL 4IHOA 1RJZA 4OI9A 2YD5A 4DQOH 1MQKL 3VXNB 2PNDA 5DFVC 4CVWA 2B1HH 2P8PB 2F19H 2PYFA 3DVGB 2OQJB 4XPBH 2IAMD 4AYFA 2EDQA 2DN7A 1JVKA 3UAJD 2NY7H 4AY0A 3Q6GH 3TN0C 1LO4L 2F8XC 4I0PA 4HCRL 4LHJB 3RVTC 1KCRH 3CXDH 3LPGA 4JM2B 1BJ1H 1WZ1L 1FC2D 3H9SA 3LVEA 3QUYA 1GZQA 2YMXH 3BZEB 4U1KA 2QEJA 2JK5B 2BY0A 2YD2A 2ZCLH 2BSTB 3CPLB 3VJ6A 1CGXA 1T20B 4ELMA 2NY6C 1DVFA 3PIQB 3W5MA 4MX7B 5IBTH 4NN5C 3V6FB 1OTSD 4LHQB 4MDJA 5GGVY 3CVHB 1QFWM 4OD2B 3BEVB 4LLVB 5M7QA 2PCPB 1S9XB 2YPLE 4PJGB 4GKNB 5GJTH 2X4OA 2X4TB 3RVVD 3IDNA 3QG6A 2VXUL 4C56B 3TBYA 5FUZL 3HHRB 3SDXB 1F90L 5AYUL 1HZHL 1RHFA 2QQQA 3MMEB 4LQFL 3BSZH 3FCTB 2AKRB 4G7VL 3IF1B 4UQ3B 3RGVC 5B38B 1A6WH 2DJ4A 2GCYA 4N0YH 1I7ZA 3SPVB 2LV4A 2FJHB 4LRIC 3NCBB 1Z3GH 1CGSL 4ZNEA 2ESVB 4LEOB 1CU4L 2IMNA 2UUDH 1U3HB 3ILQD 1K8IB 3MLVL 4KHXL 4DGIH 1KPVB 5MI0B 4XI5C 1G84A 4EDXB 4M9OA 5E8PB 4JY5H 4OZHB 4ONFL 1YA5A 4FQ1L 4XPFL 1X4ZA 2O5YH 1NUDA 3VRIB 4LQ1A 3V95A 4CW1B 5J13C 4QRTA 5BV7C 3RZWA 3QZWB 1GGUA 3F62A 1C5DA 3WN5A 2ERJB 1S7UA 1MLCA 2Z8SA 5K9KB 4GRMB 3EAKA 4HKJA 2DLIA 1JV5A 2G9HB 3OKLA 4Q6IC 3WFCH 3NAAH 3CFJB 5DMIL 4KGLA 1KB5A 4FFZH 1ED3A 2VXSL 5E95B 2IAMC 1EFXD 2PR4L 5DJ8A 1J86A 3V5KB 2W92A 1BZ7B 2DQIL 4P2QA 2E6QA 5L0QB 3BISA 4NRZA 3ZE0E 5C0BD 3EZ8A 3UYOD 4DZBA 2O5ZH 3BYTA 2OR8A 3C5ZA 4NQCA 4J6RL 5D71H 4JKPH 3WE6A 2ICWA 5CBAB 2ADIA 3BE1H 4KAQH 1M71B 1G7MB 5FF6A 2DM7A 1KEGL 5EO0B 1UZ6F 3NCEB 1KN4H 4D9LH 5JQHC 4L3CA 3GK8L 4KJPD 2ZG3A 1R5IB 5HGBA 4HUKB 3DXAA 5F9DC 1OTSC 5DJZA 5DGQA 3IAQA 1JFQL 4YUEL 2VLJE 2XRAL 4Y1AE 2X42A 5L7XH 4P5KA 1CFSA 1GOHA 3TNMA 1W72H 4XNZB 3RVVC 3V8OA 2G5BB 5GGTL 4DGVH 2OMNA 3ARDD 4P9HC 4TPRH 3L3OA 2J88L 3P30L 4PJEF 4OLVH 2ZJSL 4KRLB 3C9NB 5DVNA 3VXUA 3ARVA 4OM0L 5DJXB 5DRNA 1MCPL 2FB4L 1I1AB 1OPGH 3RFZC 5IIEA 3BP7B 3FQWA 2BX5A 4JKMA 1RIHL 5FYJD 1PZ5B 1S7RA 3ILQC 1FO0L 5FYJU 3QJHA 1FJ1B 4NZRL 3WL9A 1NJ9A 4ZSOB 1S7VB 5JPNB 1U8NA 3DI2B 1T5XB 3LHPL 1P9MC 4O2CB 5FKAB 5D6CA 3BP4B 4F7TB 4OI7A 5B39A 3AROA 1CVSC 3HFML 3KYMA 2AABL 4JM2F 1QBBA 3H2WA 32C2B 3O4LA 1J12A 3G08B 4DFIA 2HWZH 2BSRB 4U7MA 4PJXE 3FT3B 4GAGL 2HN7A 2R2HB 2BNRE 4FMKA 4WWKB 5HYJD 1DL7L 1NLBL 2D7TH 1DQQB 4KRPD 4PJGF 3MRJB 3ARGA 3C60B 2DYPA 4FQHB 4G6FD 2J4WL 3OGCA 1CDHA 3I02B 3Q3GB 3SDXF 3O81A 1YNTB 5DQDL 3HMWL 4IJ3B 2VLRE 5DUML 5EU7C 1CBVH 4JB9H 4KJPC 1I3VA 2ADJB 4NO3A 3MXVL 4RSVA 1FZMB 3EOBA 4KMLB 4JHZA 4NKIL 5D2NE 1QVOB 4I9WE 4X6BB 1RJYA 3OB8A 4NT6A 4WEMB 2XNAB 1S9KC 4ZUUB 1CICB 2GTWA 4N1HB 5E8DH 5F6HI 5HHNA 4K7FB 2MNUA 3ARDC 5D6DA 2OZ4L 1HXMA 3QUZC 5MEOA 4GJTB 3BPOC 3O2WL 4H20L 2ZOKA 4OZHF 1MJ7H 4GAJL 5K33A 1MFEH 4UI2A 4A6YL 2FIKA 4XPTL 1R0AL 3OKEB 4OD3H 2FYYA 3UZVB 1JPFB 2OBGA 3VFSB 1NSNL 3MJ9H 3PP4H 1H0DA 1V05A 3OTTA 4HGWA 3X3GH 3WFDH 4Z7NE 2OR9L 4Y2DD 1IM9B 4XXDA 2DL9A 2QTEA 3A6CL 3U7AA 2VDOL 4R0LB 4F3FA 2P42B 2IFFH 4OF0A 3KJ4C 4EZMA 4LVNC 2FD6L 3TT1L 1P7QA 4X7DC 3QFJB 1S8DA 5CAYB 5CCKH 3VI3E 2IANA 4PJAA 3QEQB 2ADGA 3FQUB 3F7QA 3H9SE 4QYOB 1UZ8B 1F2QA 2YZ8A 3P0VH 5FM8A 2IALA 5FO7B 1MELA 1GHFL 3L3IA 4TVPE 1K4DA 4AIXA 4UAOC 5I1GL 9CGTA 4HBQA 3QULA 4GRLD 3VXPB 1D6EA 1YN7B 4FXGB 1MHPH 2J8HA 4Z0BH 4JDVA 5FO8A 1KXQE 4BM7A 2EYRA 4S1QH 4R96A 2DQUH 5D93B 4KI5F 3UPRB 1L4IA 5KG9A 4XZUA 1Q72H 2FSEA 3RIFK 1FDLH 3FB8A 2BOCA 3IDIA 2ZKHH 3RP1A 4K7PH 5F9JA 4LKXB 3BVNA 4ZUSB 5DK2B 4CU8A 2WP3T 4U6VH 4I3SL 3VFMB 1VGEH 1FL5B 2VDRL 1ZAGA 4G6JH 3SJVB 4DK6A 2LE9A 2KQMA 1JWUA 1OB1B 3BDBA 4IRSB 5CD5D 5DMGD 5FV1L 2WBJA 3UTQB 3M07A 4JO2H 3ULVE 3QCVL 4PJ8B 1CD8A 2APWA 3I75A 4Q9QH 4XCNB 1OM3L 3MLYH 3KLAA 4BZYA 2X4UB 1OLLA 4XVSH 3W0WB 3ABZA 4Y2DC 4DUXA 2XFXA 4Y4KD 1GGCL 3MODL 5IK3B 5E8EA 3UTTA 1EAPB 4LCWA 2QADB 5JXAH 2VISA 1T3FA 2F54A 4P2QE 1RK0A 1NEZG 2DL2A 3BOVA 2JLLA 4OZFH 3KS0J 4NQCE 1KLGA 4WI9A 5C08A 4K94H 2VXTH 1N3NA 5I8OL 3FO2B 4OT1L 4G7YL 5I71C 1YC7A 5I1EH 4NQSB 4JREC 1FGNL 4Z7UF 1NCWH 1IC7L 4ODXA 3DXAE 1DFBL 4J3TA 2VL5A 2E9IA 1DP0A 1WT5A 2DLGA 4GRLC 1CD1A 1QFWL 3GSNA 4MD4B 1F4XL 4HH9A 2X1OA 1NGPH 3K80A 4DTGH 1J8HA 4P5MA 4PRAA 4FN0A 1UWXK 3CFBB 3W39B 3S5LA 3WS3A 1KCUH 4XMKH 3R0MA 1MNUL 5TFSL 2RCSL 1JZ2A 3HZYA 5I9QB 3HNSH 1K5NB 3RWCA 1A6TB 5FK9A 1A3RH 2D0GA 2F9BT 1EHLH 1J5OH 3T3ME 4ORGB 3MRQB 5EUKA 2AJXL 2X05A 3MROA 4ZO9A 3WEXA 5E4EC 1ZWIB 5CD5C 3DTXB 4ZAKB 1RPQA 4GS7B 1KTKE 4FTVD 2M26A 3NIFF 3RDTA 4LASL 2X89A 3E3QE 4HJJL 4HIIB 1T7XA 2MQCA 2BHYA 4OZGA 1PYWA 2DIJA 3X11B 2AK4D 4FNLH 1A4KA 3HRPA 1RZGB 1S7WA 4KUCD 1J05A 3O4LE 3C5SA 2X5PA 2GFBB 4J4PD 4BSWB 1L7TH 4Y4KC 4TVPH 2NY1D 3VWJD 3IJSA 3Q48A 1FIGH 4M3JA 3R1GL 1OOAA 3PQYA 5DEZA 4M61A 1NCDL 4DVBA 1T2XA 5JNYB 4XRCB 5T3ZD 4OGXL 3B9KD 1U58A 3HPLA 1P5UA 1NCBL 3VRJA 3TA3B 1E4KC 4WO4B 4C83B 4RGNC 1EEUA 1IGML 3RWGA 4HK3N 1F6AA 1J1OH 3HG1D 2E7LC 1WVZA 3NZ8B 1D9KA 1D5BA 2W0FA 4N9GB 2KDGA 3PWPA 4PUBL 4LVHB 4NKDB 4EI6B 4GW4B 3CD4A 3RWDA 5FKPB 5EUOB 2VSCA 1J1XL 4JVUA 3O3BB 5TE4H 3T0VA 3ZZ1A 4NM4H 5GRXG 4Y5XB 4M62H 3UDWA 4NNPL 3WMSA 1F4YH 5MEPB 3H7BA 3ULVH 1X7QA 3RBSA 3BKCH 1YEJH 3PWJA 4RMRA 3WSQH 1MFBH 3QCUH 2G60L 2HFFB 3AB0B 1X5LA 4N0FB 4OCYH 1MFCL 4I2XA 5C0DB 5H94A 2O5XH 3K4AA 3R06A 2D9CA 1DCLA 1IAII 4JR9H 2XG5A 1AY1L 1KCVH 3HNTH 5GGVL 1HEZB 3SBWC 1T6VN 1INEH 3O2DL 2YBRB 3LD8B 4UT9L 3P0GB 1FLRL 3RNQA 3T0EA 2I24N 2AI0H 5ALCL 2IANE 4PJAE 4RMQA 1YJDL 1JRHI 4PLOB 5B3NA 1A6VH 4LCYB 1CFQB 1UADC 4XPHH 4V2BA 1LK3L 1MCOH 3OL2A 5I15H 2AEPH 3QH3B 4YFLF 3P3YA 4U1JA 5I1LA 1I9EA 1MI5A 2NY1C 3VWJC 3MZTA 1FG9C 5KSAD 3QIWB 2DM3A 1R3HA 2JCCE 4OTXL 5F7DA 3HE7D 1W0YT 3ZE1F 4QTHB 3NFSL 1RIVH 5JIKA 4F37F 2Y72A 1BVZA 2BVPB 3QAZB 3NA4A 1KJ2A 1ZT1A 4G8EA 1EO8H 1T1WB 1JPGB 5E6IB 1TLKA 1WFNA 2FL5B 1S7TA 4NQUA 4WCYH 1DQLH 4LSDA 5FYKD 5H37G 3WDHA 3PDOA 3MV9D 3QQ9D 2KZ1B 4Y5VA 3L5WA 1DBKL 1KTDA 3GSVA 5LVEA 5M95B 2VQ1A 2PW1B 1CLZL 3VGBA 2XKNA 3ZE2E 3FMGL 4HJGB 4KK5C 1UB5B 2DQJH 5IR1A 1Q0XL 2EKSA 2YD4A 5F7MC 2VDNL 3K1DA 5HGAA 2R29L 5E5RB 1Z6JT 4HIEB 4NJ9L 1FNFA 4TUKH 4YHPA 4YXLH 3IFPA 4ALAH 4NNXA 4P9ML 5T1MB 2MCPH 4Q97A 1L0YA 2OR7A 4MA8L 4FQJH 4QGTA 1F2XK 1JTPA 5IJVA 5I73B 3MPCA 3KR3H 2DLFH 2GT9A 3CNKA 4LDOB 2FR4B 4FMFA 4BZ2H 3UTTE 4JEGB 1VGKB 1U92B 4LCWE 3STZA 3SDCB 2ATPB 2F54E 5AZ2H 1LEIA 4XC3H 1MJUH 2CUIA 2ATKA 3WFZA 2R0WL 4WEBL 1UH2A 2CJUL 3MLZL 3RUGF 3UYRL 4LAQH 3IGAA 3T0AA 1E28B 5GHWL 3T77B 4XCFL 1WEJL 5HYSB 2WINB 4R2GC 5FYLD 5DJCB 5KSAC 4I77L 5LGKA 5KS9F 3NTCH 5F8RC 3HE7C 4L9LA 5KZCB 1DDHA 1MH5B 2DBJA 1GGIL 2RJMA 2DQEH 4OKVA 4NM8H 1J8HE 3RAJL 1FNEB 5T1KD 5DA0B 3QFDA 3RWHB 3MRHA 3L3DA 1I85C 4MGXA 3IS0X 3QQ9C 3OJ2C 3O6FD 3O9WB 2EDLA 3EYQD 3U7YL 3NGBC 2X4QA 3NPSC 4KMTL 1IGJA 4LSPL 1RU9H 4M7KL 3FN9A 3ZYJA 5I1KL 2QQNH 1WZMA 4RRPA 3BZFB 3BJ91 1QFOA 4JHAL 4EOWL 3B8SA 2R2CA 3OKMB 1G7LB 2QHRL 1AKJD 1FH5L 4RX4D 5IHUH 4LRNL 1N5YH 3DO7B 4PBWD 5J1TC 4HIJB 5ESAB 4F8QA 4OZGE 3IVKA 3WJLC 3ARFB 5CMAB 1MJ8L 3U30C 5F6IB 4ODVL 2X9XA 4N8CH 3WD5L 4CMMA 3FOLB 4KJYA 3MOBL 4YFLI 3U6RA 2K3TA 2YWYA 3C09B 4HHAA 2UWEB 4WI8A 4KKBD 1AGCA 3PQYE 1F97A 3GSRA 3KYOB 3P77A 5DTFA 3ET9F 2EZ0D 1JNLH 4QHNB 1DEEB 2E7CA 3TZVD 1QPPA 1RZ7L 4DFHA 3BW9A 4JY4A 3HS0A 1BQHB 1WJ3A 2FEDD 4EUPG 2VLJD 5D7IA 1RZFL 4DN4L 3LKOA 3UEZA 4CMHB 1ITBB 1P4LA 1QRKA 4YBLC 1HHHB 2NW2B 1X5JA 3LKNA 4OV5B 4KKLD 4DZ8B 2EO1A 4EN3B 4ZUTB 1OL0A 1GVIA 4O51A 1IM3B 3DBXA 1CIDA 4XHJD 3GMNA 4PJFB 2FJGB 1IAIH 4GOSA 1A0QL 4L3EE 1T03L 4FRWA 4J3VA 5D7JD 2NW3A 3O11B 3QHZL 4ODSL 4JHBA 3H7LA 5DS8B 1IKFH 2Z91B 2ZUVA 2DIBA 1YMMA 4MJ6A 3UJTH 4OJFH 5E99L 4ZFGL 4YWGH 4JPVH 1QNZL 3W5NA 2DQGH 5E2UH 1JRHH 4PJDB 1UFUA 2AEIT 3O6FC 4DGYH 3BPLB 5CLTA 1SEQH 2GK0A 3EYQC 1BP3B 4O4YH 1UYWL 2FECL 3LRGA 4XAWH 5EU3A 3BN3B 4Z7QE 1JWSB 4ONHB 5EOTA 4I2XE 2VDML 1GCFA 4GG6A 4G8GE 4TNWK 3QEGL 4LFHG 4D9QD 3BRDA 4FP8H 4BSVB 1MUJA 4E0RB 1IQDB 1QA9A 5AZEL 4GKOA 3Q1SH 2VUYA 4QRRA 1OAKH 1NFIA 3K46A 4WI3A 1QKZH 4LPCA 1OD7A 3TFKD 4B7LA 3S7GA 5KBNC 2ARJA 5D2LB 3O6KL 3BYYA 1FFQA 1TIUA 3D5OF 2SEBA 1CFTA 2BNRD 4WW1A 5DFWH 1ZLUH 5J8OA 1MWAL 4LIQL 4ZS7L 2XWJB 5EIIB 2GY5A 3ROOB 3MJ8B 4WJ5A 4GG6F 3K7UA 5FGCB 4HCRA 4OLUH 4DVRL 1WIUA 1MI5E 3BPCB 3CLFH 3QZWG 4NWUL 5HHVH 1LO3L 4DN3H 5KANI 1XGQB 2VLRD 2X09A 3GSNH 5DURD 4QO1A 4ACPA 3C6LC 5D7LD 2OTWA 1M4KA 4YHIB 3T8XB 3DECA 4D8PA 3TZVC 4WUUE 1DN0A 4XPGL 4J1UA 1F58L 4I48B 3NA9H 1VKXA 5DT1H 5CUSL 2H9GA 5IB2B 1DUZA 1WLHA 1MAML 4F7CB 1BD2A 1LNUB 4M8QB 5C0EA 3H3KA 4HDIB 1JF6A 2QJDA 4P2RB 4CGTA 4WU7B 5JIIA 3LEYH 3IRZA 5ESQB 5D1QA 4XHJC 1LE9A 4OCMC 5SX5K 3IETA 2RB8A 2W91A 2MSPA 1NAKH 4LLWB 4U1MA 4PJ5A 1SJHA 3FT4B 1SJEB 1CCZA 4PG2C 2VC2L 3ZKND 2XZAH 1T2QH 3WNNA 5LQBL 1KCKA 1UM5L 3PABB 5J89A 3KPMA 1VADB 3MRKA 1JPTL 1VENA 1XR9B 3AUVA 2AJUL 4RGMC 5DHVH 1BVLA 5F93C 5J6HA 4JO3H 1WAAA 3OAUH 5L8JB 1YZZA 4M43H 2DQCH 4JAMB 1J0JA 2F53B 4D0CA 1H3PH 1R3KB 4OAWA 1RFDH 4X6CA 3JXAA 1MVFA 2NY0D 2B2XL 3OR6A 1RZKH 3C5JB 2F58L 1B4JH 2R2EB 3PP3H 3VWKA 4BQBA 4NWTH 2CDFA 2NXYD 5GIRB 3H9SD 3I2CL 3QUYD 3NH7H 3TFKC 2EC9T 4V1DE 3OAZK 1KGCE 1IGTB 1ZOXA 5EO9A 2YPKB 1MREL 4M7JH 2D3VA 1DVFD 5IF0A 3UBXA 5D1XB 4N8PA 4TVPD 1FLTX 4KQ3L 4RFOL 4PS4H 5HHQA 3WIIL 5EU6A 2E7BA 3DYMA 4RWHA 4X6DB 1AD9A 1TJHL 3PF2A 2OLDA 2V7HA 1UKQA 4GSDL 2K1MA 3OV6A 4K8RD 4WDIA 2R1YB 4PJFF 4PV8B 3WHE1 4M1GH 2CIKB 1MHCA 1S7SB 2X70B 1KTLB 5D2NC 3L6FB 3O0RL 4OZ4B 1IVLA 1G0XA 2GITA 3OQ3B 3IB4A 1T1ZB 1YEFH 2DBLL 1HHJB 2V5TA 2XXCB 3LQMA 5JA8B 3IDUA 2CPCA 3F8UB 5GGTA 1JIBA 1SEBB 5I8KH 1IAOB 4YXHL 1UKTA 4QXTB 3V0VB 3FO1B 2OXHA 1E4XH 5CWSA 1F8TH 1I8KA 2FH6A 3LH2L 4AH2A 4J8RB 4OCNC 1FZKA 3IDGB 1YY8A 1P1ZA 3ZKNC 3MV7A 5A2KH 1MCRA 3EYVB 1Y6MR 4ZDHA 3PXHA 1ZLVK 3V5HB 4P5TA 1FO0A 5E9DB 2R39A 2BVOA 5BV7L 5EULV 1X5FA 4P2QD 1OQOA 4X5XA 4HUVB 3TYFB 3GNML 4YIQA 4ORZC 2NY0C 4HXBL 5DUBB 1U9KA 1NCCL 3N06B 4I0PC 4FA8A 3C5ZD 4LEXL 4OCWL 4HBCL 4UTAL 2NXYC 3M8OH 3QUYC 5CP3A 1JNHA 5FUOH 2HT2D 8FABA 1DUYA 3MBEB 2RBLA 5HGHA 4CDHA 4OLXH 4J7RA 1DVFC 5GGUA 1VACB 4QY8A 4X4YA 1KJ2H 1HI6B 2Q8AH 4KZEL 5BXFB 3DXAD 3MOAL 3S96B 3B9EA 2JB5L 3KXFE 3OJMB 1MVUA 2L7UA 3LQAH 3C8DA 5D7IE 1T66D 2HJKA 3B9VA 5TQ2L 1IZKA 3W82A 4DKFL 3IJYB 4FFVD 4D3CL 5EG6C 3PWLB 1MCBA 4K8RC 2FX7H 1HHIA 1LILA 4KTDL 1IFHH 1WZKA 3T0BA 4KK8C 1WV7T 3SDDB 3DV4A 3A6BL 1GJIA 5C0CB 3S4SB 3TWCL 4LCUA 1WWWX 3VXUD 2P8LB 3HR6A 5DJAB 5EFIA 1YNKH 5FCUH 2XTJD 4P9HL 5F7EH 2BNQA 3GMLB 4G3YL 1YMME 3ZO0A 4ZTOL 3ARBA 3V0WL 4OF8A 1EZVY 3EJJX 1XF1A 2WUCH 2E7HA 4BH8B 3E6FB 5E2VL 3NFPB 1NUFA 3O3EB 4OGZA 5AWNL 1XIWD 5I8EA 5IVZB 1DN2A 2OZ4A 2Y36H 1R5VA 2DQFB 4QRUA 1TCRA 3HZMB 5KSUA 3F7VB 1AGBA 1WCBB 1RQ5A 4A6YA 5DJ2A 2VE6B 1K2DA 1TDQA 3VD7A 2CKBH 2A6JB 3DX9B 5C7XH 4QRRE 3K81A 1QBLH 4YH6A 3WN5C 1JHLL 4OV6F 2ZSWB 4MNGB 5IW6A 1FAIH 2CRYA 4PGCA 3TBTB 5IBUG 4N68A 1A7BA 2A74A 3SKMB 1BEYH 4OLWL 2XKUA 5SV3A 3W9EB 2JB6A 5TF1L 1HH6B 3HI5H 2VOTA 5TQ0L 3CFDA 3FOMB 1H15A 2C3WA 2DYPD 1BX2A 2NY4D 3C5ZC 4HFWA 2GAZB 3MV8B 1U8KA 4HIXH 1EEYA 2A38A 3PHQB 5EZIH 4NGHL 1EV2E 2VYRE 2ZNWA 5DJ6B 3X3FL 2CR3A 5FGBA 2I5YL 5C9JB 3KG5A 4Z7VB 5A3ID 2ITCA 4YR6A 3QPXH 3HE6A 3IU4L 4P2OB 1N59A 1P7HL 5FV2A 1AQDB 3MRGA 4GG8B 2VL4A 2HLAA 4MAYA 4G8FB 4CADB 1KSRA 4X9GA 1FRGL 5ESVB 3KDMB 1QPXA 4EIZC 4CAGA 2BXYA 1N8ZB 4WW2A 7FABH 1FZJB 3X17A 3L3GA 3INUL 2GQHA 4UQ2B 1NDMA 2P47B 4PJ5E 2J5LB 1MFAL 3WUWA 1G9NH 1MY7A 5IMMA 4FQQB 2XTJC 4FQIH 1A7QL 4RMWA 5SV4A 5FOBA 4DAGL 1MCQA 4HWUA 3RTQD 4WFED 2RIKA 4OB5H 1WAAE 4BK5A 1D6VL 4BYHA 3KPNB 2VWEE 4KROB 2NXZD 2XI9A 4WW2F 2AXGA 4W6YB 3T2OA 4ZTPH 1P7QD 3MCKB 4X6CE 1KJ3H 3QIUA 4IIQA 4PJBB 1EMTL 2Z92B 4KI5D 5INDB 3GBNH 3W9DA 2RAMA 2KZWA 5HHOB 2F5BH 1N6QH 1IMHC 4Z95H 4XMPL 1YDPA 3V6ZB 5BJTA 4JFFA 5AUMA 1E6OL 3ARGC 4YDVA 1Y18B 4YFDB 2NY4C 3QDJB 4R26L 3PL6B 4JN1L 1JWMB 3AREB 4PJ7A 4LPUA 5LAXA 1A6AB 2P8PA 2OQJA 5F1NB 1N6UA 3MACL 3QG7H 1FFOA 5A3IC 3JWOL 1ZE3C 4XNXH 1JGVL 1ZT4A 1MHEB 3BRFA 3M45A 3FN0L 5A2JH 4QWWC 3H8NA 4LHUB 4ONOA 1ZLUK 3SKJH 3BZEA 2ZOLA 1CD0A 5J7CC 2BSTA 3CPLA 3MLWL 1KENH 1P5VA 3DIFA 3P9WB 4KQ4L 4PJ7F 5D6DC 1FAKT 3PIQA 3ZDXE 1EFQA 4MX7A 3NBNA 2WBJD 5HYQB 1A1OA 2J3SA 3EJYD 3V0AC 4OD2A 3BEVA 2BDNH 4P3CH 2PCPA 5KANG 1DANU 1S9XA 5IB5B 1KCLA 4KHTL 2YPVL 3MV7E 4R7NA 2MMXA 4C56A 5ICYB 3RVUD 3RZCB 1K6QL 2CIIB 3ARSA 5CSGA 3MMEA 4LSVL 3ULSA 3FCTA 2AKRA 4G9FB 4J3OC 4LCWD 3S37H 2NXZC 3IF1A 5B38A 4PRPB 1QRNB 4Y4HA 4U1IB 2FJHA 4EQ3A 2BC4A 3QXAB 4OI8A 2C4XA 2P5EE 4WIQA 1N2RB 1XGTA 3QDGE 4PB0H 4QRPB 1IEBB 2ESVA 5C08D 5LCVH 1R3LB 4Y4FA 2R69H 4MA3B 4GLRI 1ZEAL 1K8IA 1RJLB 4K7PY 4UOJA 3UTZB 4Z7VF 1DBMH 4KI5C 4MJ4A 1BFTA 1IGFH 3H6JA 4FZEL 4EDXA 4PG9B 1BHGA 2WBKA 4P23A 1S3KL 3MNWB 1O7SA 4FQXA 1YNLH 5ID0B 4HF5L 5I0DA 1XFPA 1LP9E 4WGVB 2PYEA 4JHWH 5K9KA 5BZWA 3ZDYE 3UTSB 2G9HA 3SE4A 3CFJA 5C2UB 3QDMB 2MPAL 5F7FA 3TGXA 1BZ7A 2N7BA 1QOKA 4E41E 5J6GB 5IHBA 3MJ7B 4PJ9B 3IJHB 1FZOB 5F96L 5TE7L 1QSFE 2BNQE 5CBAA 4YGVB 1M71A 1G7MA 5CEYA 5ACZB 2NZIA 4PFEA 3GI9L 5HI5D 1F45A 4KHXH 2A6KA 2EDFA 1F6LL 2ITDB 2PN5A 4IRJB 4YK4B 5T3XD 3QXTA 2AEQH 3LN5A 4YQXH 2WBJC 1LEGA 4WTZG 4PGDB 3EJYC 4O5LH 2X89D 5E1HB 1ODAA 4W4OA 5BRZE 4MA7L 2XY2A 2EO9A 2IH3B 3DHMA 3ESVF 5BO1L 2DWEA 1FE8H 3T3PE 1CZ8H 1RK1B 2VZ1A 3BJLA 3D0LB 4PRBB 3RVUC 3DMMB 4IOFD 5E56A 2OTUA 4LDLB 3VH8B 4E5XB 1KIRA 1KN2H 2OJEB 3B9DA 3EYSL 3O8XA 4LGPB 3PQYD 4I18A 3THMH 2Y06H 4QHKJ 5ADOH 1OY3B 4K3EL 5DJXA 1HH9B 3TO4B 5JHDB 5KTEL 1X4XA 1I1AA 3E8UH 1RY7B 1KIPB 3ELAT 4JO1H 3DURB 1LO0H 1WIOA 3ZSSA 1U2CA 5GGSY 4WV1B 4PJCE 4A2LA 3LEXA 1PZ5A 5E7BA 2EEAA 4WRLA 5GRUH 2ZCHL 1FJ1A 5TDOB 4ZSOA 1D9KD 1S7VA 4AMKH 5JPNA 1J0KA 1KFAH 3PWPD 4G6KL 1JFQH 4YUEH 43CAB 1WWBX 5I1HH 4H1LG 4F7TA 4F37K 1WWCA 3L1OH 1WT5C 1MHHB 1FGVL 2C3GA 1T1XB 1AGFB 1JP5A 1WTLA 4JFPA 32C2A 4G8IA 3GKWL 4FG6C 2DWDA 1GC1H 2ZJSH 3ORJA 3GSQB 3FT3A 4CU7A 2R2HA 4XPAL 2CDGB 5HYSG 1NDGB 4JDTH 2ZSVB 4MNQA 4WWKA 3D3VE 5JR1L 4X4ME 3MRJA 1AGDA 3N85H 4RGOL 5F9WB 3T1FA 3FQTB 1JCKA 1NL0L 2AGJH 3FQNB 3BWAB 2DRUA 3VXOB 2DKUA 3Q3GA 3KPSB 1QFWI 1URLA 1YNTA 1I8IB 3PGFH 3WFEH 5HI5C 4HS3B 2APTA 3U2SB 1UZ6E 3KPRD 2ADJA 1F3DJ 3HB3C 1MPAH 1FZMA 1K4CB 2BSED 3RDTC 1YYML 3T0ED 3GGWB 3CDGA 1G9MH 2Y07H 3SHSA 2XNAA 4JFEB 1A3LH 4LSSH 4ZUUA 1CICA 3TIDA 5CP3H 4PJIB 3IDMB 5D7SH 1PKQB 4X8JA 4K7FA 2VITA 1FNGA 1KLUA 1KIQB 3EIFA 1EEZB 4QHLB 4IOFC 4DQOL 5F3BB 3SKUD 1MI5D 2BY2A 4BKLB 1B0GA 4OM1H 3RWEB 2B1HL 4CU6A 4XPBL 5GRVK 3WIHA 2NY7L 4PJHE 3QQ3B 3Q6GL 4KZDH 1S9YA 3HUJB 4JFFE 5IVNA 4GRWB 4ZXBB 3LRHA 3U46B 1CR9H 1KCRL 4U2YA 3CXDL 5CS7A 1N0XH 4Z0XB 2ZUWA 4ERSH 5B8CB 2YMXL 3IXAA 3O41B 1D9KC 5HPMB 3DWTA 4H5SB 2ORBH 5DVMA 1A1NA 3VDAA 2VZ3A 5IBTL 3LKPA 2V2WB 3QEQA 5GGSB 3FQUA 1A9EA 2VR4A 3IT8D 2GJ6A 4LLQB 3L7EB 2D7OA 3CFIC 2DQDH 3K8LA 1P7KA 4U3XA 5GJTL 1C5BH 2OZ4H 3GIVB 5JO5B 3UDWC 3EDFA 4NZTH 3ZKXC 5FO7A 1KEMH 1JMXA 2H32B 3OSKA 2P24B 1EBAA 1R0AH 3RL1A 5HGDB 3BSZL 1F4WH 3MFGB 4GUPB 2A6IA 1XAUA 4GLRH 5KVGH 3RU8H 1I3GL 1A6WL 3GDBA 4N0YL 3EDDA 3ZHDA 4C56E 1NPUA 1R3IH 4F8TA 3SDXE 4TUJB 5C3LD 5ECJE 1ZHKB 4MHHI 1B6DA 5HXMA 3S3JA 2FZ3A 4DGIL 5EBGA 3OKKA 2H3NB 4XC1H 3CK0H 3T0EC 4OF6A 4LKXA 4JY5L 4BH7B 1RUAH 3BH8B 3IFNH 4ODTH 5GRZA 2O5YL 5DK2A 4HW6A 3NIGF 5DD3H 4QXGH 1UACH 2ESVE 2ED7A 4XP6H 4LLDB 3CFEB 1V8HA 3BDXA 4IRSA 1X5YA 3WFCL 4RMTA 4MD0A 1HHGB 4XBEL 3NAAL 1ZA6A 1YYLL 4FFZL 4OD1H 4HK0B 5GS0H 4PJ8A 3NACH 1HNFA 3BFOA 4QLRA 3T4AB 2Y23A 5I17B 1PY9A 4XCNA 2YHGA 1IBGL 3MRNA 2BCKA 2V5YA 5IP4A 5DJYB 2O5ZL 3H3PH 1AO7A 5J1AA 5D71L 3BIKB 2AP2A 1S5HA 4JKPL 3BE1L 3TV3H 4R4ND 1AXSB 4KAQL 5IK3A 3LQAC 1KN4L 2LAAA 3U9UA 4D9LL 4XH2A 3BKYH 2X7LA 5FIEA 4Y5VC 2JF1A 4Y19B 1PFCA 2R1WB 4P4RB 3VXMB 2J12B 1OAZH 4L8CB 5HHMB 4M7ZC 5L7XL 1Q38A 4TOYH 2IADB 1W72L 3FRPG 4CNIB 3C6SB 3FO2A 5DI8B 4DGVL 5ITFA 1Q9LB 4TPRL 2A9MH 3OAYK 4HEME 4OLVL 1D5MA 5E08H 1E27A 5ISZA 2F8VA 4I0KA 2AERT 1NFDB 3PV7A 3VXSB 5GSVB 4MD4A 2BVEA 3KYNB 4MNHA 1OPGL 5J57B 3ZL4H 3GUTA 2DB8A 5JDSB 4YBQD 2VZOA 3KS0H 2P8MB 1ONQA 4L3AA 4QOKB 4NPYB 3IU3A 1NGXB 5E8OA 1FCGA 2WWKO 3QO0A 4X99B 3ZHLA 2APVA 4X4XA 4HLZG 1A6TA 5I74C 4MCZB 4BSJA 3RGVB 3NCFB 3DVIA 1MWAA 5I8OH 1H3VA 2YA2A 4L5FH 1NH6A 2HWZL 4ZSOE 5EO1B 1PW3A 2AJ3B 4ZFFB 1YPZA 3MNZB 3FONB 3WFHB 1HILB 4L9LC 1FFPA 4PY7B 3X11A 2D7TL 3MGOB 4WFFD 4Q7DA 4NRXB 1VESA 5C0AB 1RVFH 1IKNA 1TNNA 5J1SC 3G6AB 1YMMD 2P49B 2HG5B 4P0DA 5K9OA 4Q6IB 3PWUA 3CVHH 4XXCA 1DJSA 4TSBH 1T0NB 1NAMB 1UG9A 5TDPB 1CBVL 4JB9L 1S9VB 3AXLB 5JXEA 2IAMB 5K9JH 1RUQH 2VLMD 3E6HB 5JNYA 3WNOA 1MCCA 2CK2A 4OFYD 3TA3A 4WO4A 1OP5H 2AJXH 4R8WH 4Z77B 1J18A 2WUBH 3T09A 1QACA 3FN3A 5E8DL 3BGMA 1G9NC 3ES6B 1Y0LA 3OKNB 4NKDA 4GW5A 3DX8B 4UU9B 4MXVE 4NN7B 3EDJA 4HJJH 1QSED 2E5EA 4LPYA 4GW4A 3O4OC 1MJ7L 2IJ0C 5EUOA 1MFEL 1XCQB 1I7TB 3BD4A 1IGYA 2ARJQ 3P9MB 4OD3L 4Y5XA 2JJSA 3MJ9L 4NFDA 1G7PA 1RZ8A 2WK2A 4JFHD 4N5UA 5GZOD 5MEPA 3NCMA 3WFDL 3X3GL 4GAYB 3TH4T 5DVOA 4DKAA 4NHCH 3OF6A 4TTDD 1PVHA 3QYCA 1KACB 3K4ZA 4QKXB 2IFFL 5K9QI 4Z7OF 1Z0MA 3QO1A 4OKDA 4TTGA 5CCKL 5C0DA 1J9CT 4ZPVB 5I1DB 3LPWA 2LTQB 3T65B 1AD0A 4FABH 4KVCH 2CDEB 2Z93A 1MJJB 2R4RH 2CUHA 4N90D 2FEEL 5J12C 1BD2D 2GSIB 2YBRA 2MWCA 3P0VL 1CI5A 1RZJC 4R97B 4RZCA 2BMKB 3BQUD 1J1XH 4UIMA 3ZTNH 3O3DB 1BLNB 1BOGA 5D1QD 1XF2A 3QEQE 2JJUA 4XGZB 4HQQH 2X1XR 4BK4A 2Q3AA 3EJZD 1MHPL 3QH3A 4Z0BL 4M6MH 3BN9D 1D5ZA 5CZXC 3B6SA 5L88L 3BZDA 2BFVH 2LVEA 2FLRT 3ZT5A 5K59F 3BH9B 4S1QL 4LNRB 3CJJA 2DQUL 1F11A 3VFOA 2A77H 1EFXB 4Z7WA 4CVXB 1UEMA 1RHHB 3I6KA 4CDGC 2VNCA 2VB5A 2RR3A 1FDLL 2RFXA 2ZKHL 2AJSH 4K7PL 1ND0B 3S4SG 5C0BB 1BMGA 3FB6B 1JPGA 3PWNA 5E6IA 1MIEH 3CFCH 4U6VL 3VWKD 1VGEL 4G6JL 2H8PA 2XICA 4I4WA 1L6XA 1IT9H 2Y5EA 3HR5B 3VD3A 5A2IH 2NZ9D 5KOMC 2B1AH 5LBSH 4U1NB 4M1DH 1QUNA 4JO2L 2B0SH 4Z7WF 5DJDB 4G43B 4HJGA 2WZPD 3OXRB 2O61B 4L8BB 3MJGX 1Q1JH 1ZVSB 4Q9QL 3MLYL 5EU6D 1VEMA 3SJVE 2I9LB 3REVB 3CMOH 5GSRB 1VFBB 5IWLA 3KPTA 1MRDH 3T2NH 3ARDB 4OTXH 1RMFH 3BPOB 5JXAL 1BF2A 5DMYA 5KSVB 4GKZA 3OG6B 4I1NB 5IOPB 5CHNB 3UJIH 2FWOA 4PRIA 3W0WE 4ZOEA 5MENA 1C16B 3U0TB 3QI9A 3DV6A 1XR8B 4K94L 5EZLB 4PTUB 2VXTL 3FQRB 1U92A 4NQED 1VB9A 2OK0H 2ATPA 1UC6A 5DQJB 5I1EL 2IFGA 1NCWL 2X4RB 4XNMB 4NOBA 5D1QC 1WIPA 2R0LH 4LVNB 3DSNA 1YY9C 2X4PB 1E28A 4OQTH 4HG4J 2YZ1A 2R29H 4NN6C 1NGPL 2NR6D 1JK8B 2NY3C 3BN9C 4DTGL 2WINA 2BK8A 3BGFB 3NMEA 5DJCA 5TE6H 2OL3B 5I1JH 4UNVA 2HJLA 4X80H 1KCUL 4XMKL 2EE6A 4QXWA 2FJFA 3MA7B 1ZVYA 2DLEA 3ZE1E 2JE8A 4KRPB 5TH2B 4XVJH 2EC8A 2AJZB 1A3RL 4G6FB 1EHLL 4UV4H 3S88H 1J5OL 1N26A 1J0YA 4H0IA 3VWKC 4QTIH 1I4FA 3RY6A 3WIHH 2BP3A 5KOVC 1O5DT 3QPQD 3S36H 1KIUA 3UYRH 4CN6A 1MQ8A 3F12A 4W81A 3ZKMD 3NN8A 2AEWA 5DGRA 3ZKSD 1Z5LA 2A83B 1P4BH 5C0IA 4N8VA 3TBWB 3BZFA 4FNLL 2LU4A 4DEPC 3D48R 5KSBB 5DRZA 3EFFB 1L7TL 1UQSA 4ZOBA 1FIGL 3HI6H 1KPUB 5C6PB 3DUSB 1YPZE 1GGIH 1ZHLB 3BESR 4LCCA 1UVQA 5GGRY 2YA0A 5E8NB 2WANA 3FZUC 5CMAA 4NBXB 4NQVA 2F74B 5IQ9B 1PEZA 2DQTH 3FOLA 3RVXD 3ARBD 2Z35A 4JRYA 4MJ5B 4RAUB 1J1OL 4ETQB 4Y2DB 2UWEA 3BIBX 1KTRL 3OJDB 4ODWB 3KYOA 2VO5A 5LGJB 4UZGA 5IFHL 4EDWH 3QIBA 1CGVA 1GC1C 2BRQA 3QJFB 4MQ7B 1KG0B 4EXKA 1QR1B 5H2BA 1BQHA 1NMAH 2BHZA 4NM4L 4NRYB 4U6TA 4O00A 2QHRH 2NR6C 4PRHD 8CGTA 1HHHA 2NW2A 3RWFB 4EI5D 1F4YL 4LHUG 5HYFA 3KPLB 1ORQA 4EN3A 5I2IB 1FL3B 4YHLH 2KH2B 3ULVL 4XVTH 4P4KD 2J6EH 1IM3A 4P5TC 3BKCL 4XTRC 1YEJL 3H42H 3VG9B 4K3JH 4JREB 3WSQL 1MFBL 2AV1B 2FJGA 4K71B 3QCUL 5EUOE 2XV6B 2Q76A 5J06A 2GIYA 4OCYL 1BQUA 4HMEA 2DJSA 4GRLB 4U05A 3I6LE 5EU4A 2Z91A 4L4TA 1XF5B 2QV2A 1JZ8A 2O5XL 4YHKH 1H8OA 3LS4H 5BVPH 4JQIL 2W9EH 4JR9L 5KN5A 4PJDA 1ZKAA 1KCVL 4RQQA 2WSKA 3HNTL 3I6GB 1ORSB 2R0ZH 3QPQC 1INEL 5IMOB 3SE9L 5HY9A 3BEWB 4MA1C 4TNVK 1OSPH 1JWSA 2AI0L 3HE6D 5EDXA 4PRNB 4OFDA 5I75B 1A6VL 4XPHL 3FQXB 2YS4A 1F02I 1CFVH 1MCOL 4OUUA 2AEPL 4U0RC 5I15L 4MAYD 5E4IA 1N5AA 2CO6B 5MEQB 3DROB 3CGTA 1FV1B 3K2UH 4E42A 2ICCA 1BJ8A 4AENA 2XWJA 3MLSH 3QQ4A 1PGRB 2R9HD 5DEGB 1RIVL 1CL7H 4ZFGH 4KJQD 5F7NC 2HFEA 3BPCA 1EO8L 3ARBC 4Z78B 1SYVA 5FM5M 4FXKA 2CGRH 3JUYA 3DX6B 4Y4KB 4WCYL 2W07A 5B3JF 1DQLL 43C9B 4YDLB 1VFOA 5GGRB 1BAFH 1B4RA 3T8XA 4PTTB 1LO5B 2ADFH 1JNNH 3QUMB 4JFXB 3LPFA 4I48A 1SY6H 3WHXB 2DQJL 5IB2A 1NGQH 3QIUD 2I25N 4F7CA 4JY6A 1LNUA 3KHQA 4RNRB 3MGTA 3GO1H 5DO2D 1JGEA 1W0VB 2D7PA 4CJ1A 3F7YB 1FVCB 2H26A 5ESQA 2DD8H 4TUKL 4YXLL 2Q3ZA 4UT6H 2MCPL 3HAEB 3VU2A 2D4FA 3KNBB 4PR5A 4FQJL 5KSBF 5CIPB 1MF2H 1VADA 3GMMB 3T2QA 4KRMB 2HH0H 2DLFL 3GMOA 3KR3L 3O3AB 3P73A 5J56B 2CLVB 1HYSD 4LLAA 4BZ2L 4WHDA 3EDEA 1WTGT 4JAMA 3P4OB 5FGBC 5AZ2L 4XC3L 1MJUL 1HOCA 2VDLL 3VH8G 3GJFK 3HE6C 1KT2A 1J87A 1U8QA 4LAQL 3H9HB 4HV8B 1MAMH 3FT2A 3KPPB 4PGEB 5GS0C 1TNMA 5GIRA 4MAYC 2FX8L 2AJYH 5IG7B 1T89A 1SYSB 2EDRA 2Y5TB 2EDNA 3HMXH 5H35B 1QFHA 4FTVB 4WW2C 3PGCA 5D1XA 3NTCL 3CZFB 6FABH 2P44B 1OGTA 2R9HC 4X6DA 2DQEL 1A2YA 1UM5H 4KJQC 3AVEA 2AK4B 4NM8L 4WVRA 4HX1A 3T0XA 2VLKD 3RPIB 4MS8D 4UV7L 3L5JA 5DJ0B 3SN6N 5BZDA 2YUVA 4XCYB 4MDIB 5FA4B 4RAVB 2NY1B 3U7WL 2R1YA 3VWJB 2CIKA 1S7SA 1TPXC 3TBSA 5MHSE 5TGBB 2W38A 4K3DH 3IS1X 5FB8B 4Y4HD 3B9KB 4OZ4A 1RU9L 1UM6L 3VXQA 1NC4D 4L4VA 2H6PB 5IFJA 1T1ZA 2QQNL 1HHJA 3QIUC 4IIQC 4M5YH 3RNKB 1BFSA 1HHKB 3HG1B 4Y4FD 2VAAA 5DO2C 3BIAX 1CXEA 5HVFB 1Y6KR 1FHGA 3ISWA 1RZIA 2NTFB 3FO1A 5IHUL 1D5IH 1N5YL 4P23D 1U95B 3EYFB 4J8RA 4FQXD 4HPOH 4X9BA 1WBXA 3HPJA 3D25A 4AM0A 5JOPE 4DUWA 1M7IA 2PYED 4N8CL 3DSFH 3KYAA 4C55A 3V5HA 5ANMB 2D03H 3DJ9A 3WJJA 2NNAA 1TETH 3C08H 4YPGB 3ALWA 4HS6B 4C4KT 1JNLL 4HUVA 2VDPH 1DBJH 2A9NL 3U82B 5LJYH 2EICA 1Q9WB 4K07A 1OCWH 3GB7B 3SKOB 4OZIA 1T04B 2UWEE 5C8JB 4RFNB 5ENWA 5IVXB 5SWQA 1BFOA 4ZG1A 1VFMA 1ERNA 1BQLH 2OJZH 1VACA 1XGUA 1HI6A 1TZGH 2YC1A 3H0TB 5I30L 2AXHA 4NKOB 4UB0H 1IAIL 3MRLA 4YC2B 1VEPA 1IGIH 4NO0A 4ELKA 2WQRA 4IS6B 2VSDA 3HI1B 3SCMD 1IKFL 4UDUB 1PQZB 4MS8C 3UJTL 4OJFL 3PWLA 4Q0XH 4YWGL 1HSAB 2MHAB 4JPVL 4N0CD 3SDAD 2DQGL 1U6AH 1JRHL 1PG7W 4PJFE 4S10A 5KSAB 3SDDA 4DGYL 3O8XD 1H8SA 1A22B 1SEQL 3GNMH 5C0CA 4O4YL 1V3JA 3SQOH 3HE7B 4XAWL 1BIIB 1W8NA 4KTEH 4Y4HC 3W11C 3MRRA 4OCWH 2AXFA 3GMLA 4L4TE 1FSKC 3EGSA 3VGEA 3CFKB 4X7CC 1TJIH 4PJDE 3NFPA 3Q1SL 2A73B 1H3TA 1OAKL 4Y4FC 1QKZL 5T5FH 2ENSA 5CJ8A 2C1PB 2DQFA 3T1WA 5MI0C 3RHWF 3V79C 2JB5H 2Q8BH 4NDMB 1JYXA 3NGBB 3VRLF 1U91B 3F7VA 4P23C 1MLBB 3NPSB 4W70A 1A6ZA 4FQXC 4FFYH 4JPWH 5TQ2H 5C0FB 3TO2A 2A6JA 3VGGA 1DQDH 2ERJC 5EIQA 4V2CB 3X12B 4AQOA 4OLUL 5C3TA 1R3JB 1S9WA 1SBSH 1UKSA 1TZIB 5D2LE 3CLFL 3TH3T 3TBTA 3SE4C 5HHVL 2YUXA 1IL1B 3SKMA 2AS5M 1PSKH 4DN3L 3X13B 3BGAA 1JGDB 3GSNL 3RPKA 1TVHA 4MNQD 5L0QC 4RISH 1TENA 1FPTH 5DC4B 1ROWA 4U7SA 2Q86A 5FGCE 5L2KA 3U30B 3NA9L 1AP2A 5DT1L 3C87A 4FQLH 4NKMB 1KBGH 5ID1A 3S3PA 4HKXB 5DJ6A 3U4BH 1MCFA 2M8XA 3KPOA 4XNQB 4U6YA 5C9JA 3DI3B 1A7OH 3LEYL 4HS8H 4U6HB 3NIDE 2P5WD 4Y16D 3FFDB 1NAKL 4M1CD 5IGXL 1FG2B 4LLUB 2FHBA 3QEUA 1CG9B 1X5KA 4W4OC 4GG8A 1FVEB 3G5XB 4HFUH 2XZAL 4G8FA 1T2QL 3UTPE 4YHYB 4BFBD 2YA1A 2W0LA 1NEZB 4YBLB 5EOCJ 4YDJB 4F7EB 4JO3L 3OAUL 3O8XC 2DQCL 4UQ2A 4I18C 3AGVA 5EC2B 3ULUL 3JTSA 1H3PL 5HD8D 1I1AC 4FQQA 3QHFH 1RFDL 2LAGB 2D9QB 1RZKL 3WHE0 3OPZH 3I9GL 4FS0A 1MOEA 1B4JL 3CSYB 5T1KB 4NWTL 3G6JB 1A5FH 5FEBA 3NH7L 1I7UB 3FFCD 3ETBF 3ZTJG 2F53E 5IB1B 5T1LA 5EA0H 3O6FB 3KLSA 4M7JL 2BVYA 2KPNA 2QHLA 3Q0HA 4MLSA 4PS4L 5L9DH 4WFGE 2GJ6D 1WBZB 5CILH 3DUUA 5HHPA 3L3KB 2C7UA 1CT8A 2DM4A 2Z92A 2XYCA 4JVWA 1MCJA 1N64H 5HHOA 2J8UA 4M1GL 5EPMB 2CXGA 3RKPA 4JDZB 4WWKC 5J3HD 1T2JA 5I16A 2V2TA 1ZS8B 4X6DE 2IH1A 2BY3A 5SWSA 3V7AG 3J7HA 5TDNA 1LE5B 1JWMA 5F9OH 1ZVHA 4N0RA 1YEFL 1YN6A 5AYQA 3SQBA 5F1NA 2HRPH 4F2MB 5I8KL 4ZYKA 1T21B 2YWZA 4HZLB 5DD6B 1E4XL 4MZ3A 1OW0A 2GJZB 1I1CA 1F8TL 4JFOA 3Q6FB 3TZVB 5BS0A 4WHYG 1CICC 1MFDH 1AFVH 1EXUB 3GSWA 4IOIB 3KPQB 2A0LD 4HKBA 2HJFB 1UJ3B 1K9TA 4XMPH 5DK0B 3LRSB 4XNUL 4KWUA 2ZUQC 3OKDA 5HD8C 4MSWB 5D7JB 5JHLH 1UH4A 4JN1H 1X5AA 3VFUB 1GSMA 5BMFH 1T5WB 2BRRL 3TESA 4ZQKB 1AO7D 4YZFE 5ICYA 2B39A 2ENYA 4LCIL 3MACH 4PRDB 1T1YA 1WFUA 2HT3D 4NQDD 5E9DE 2CIIA 3M8OL 5DD5H 5KAQF 5FUOL 3UYPA 3VMOA 3GMQB 2X6MA 4PIRF 5D5MB 4PPTA 4OLXL 1JGLH 1WFTA 5JW5B 5FFLA 2WW8A 4PRPA 1KJ2L 3JV6B 4OCXH 2Q8AL 1G7HA 3QXAA 4J3XA 2YPLA 1B9ZA 4GMSH 2GSGB 3LQAL 4QRPA 5I0ZA 2PTUA 1CS6A 1JNJA 3DVNA 1RJLA 2R1XB 1ZA3B 3EO0B 2X41A 3UTZA 1VA9A 2GK2A 4AIOA 4TRPH 2FX7L 1EK3A 4HKZA 4MXQD 3MNWA 5INCB 5ISZD 2BNRB 4EBQL 1IAKB 4DK3A 1YNKL 5FCUL 3AS1A 2XPGB 1NBZB 5F7EL 5DEFB 2YD1A 3V4UL 4KGJA 3FO0H 2MJWA 1CVRA 2WUCL 5E00A 4LSVH 4ODUB 3MRCB 3QDMA 2EE3A 4J2XA 4HJ0D 5C0CE 3BMWA 4N8VG 2VLRB 2ARWA 2C1OB 3MJ7A 4MLIA 5DURB 2A6DA 5D7LB 2Y9RT 1ZSDA 5CP7A 3DETD 3DRQB 4KPHH 4DOHB 1XMWA 5EBLA 2UYLB 4ZFOB 3MX0A 4NO2B 4HUXB 2CKBL 5ACZA 1BZ9B 5C7XL 3WKMH 1QBLL 4IRJA 3LQZB 4IRSC 1I75A 2A0LC 1FAIL 1S3KH 1AH1A 1BEYL 2VZUA 4PJ8C 2W65A 5BQ7B 3ARXA 1DQMH 3HI5L 1YMHA 4XP1H 2UZXB 5ERWA 3K8KA 2IH3A 3QEHB 3M1BB 1WBYB 4CVZB 1X4YA 3TVMD 3L3HA 1BVKB 2I07A 4W4NA 1U8PA 4MNGE 3DMMA 4IHOB 1RJZB 4HIXL 2P43B 5LKNA 5EZIL 4E5XA 1S78D 5E2WH 1UH3A 4D9RD 1U0QA 1OGAA 2PYFB 5F96H 3TO4A 4F7PB 3EOAB 3QPXL 4HC1A 3MRBA 3ZE0F 1GRWA 3MV8E 1EGJH 2C3VA 2VTFA 3VFTA 1A4JB 1BM3H 5J0BA 2NXYB 3H9SB 3QUYB 4U1KB 3UMTA 3LKRA 5GGQH 43CAA 3VJ6B 4MXQC 4LL9A 7FABL 4ELMB 3MRMB 3BAEH 1DVFB 4MA7H 1Z9LA 2E3VA 3U9PH 4WFHD 1G9NL 1AGFA 5EU5A 4S0TD 5IEKA 1A6PA 4FQIL 4WTWA 1SQ2N 4WENB 2XZZA 3JVGA 1OF2B 2QQKH 4OB5L 1NDGA 3TBYB 4TVSa 2ZSVA 5CJXA 4HJ0C 4ZOAA 3TN0D 4XCCH 3FQTA 4KDTA 3DETC 4JQXA 2COQA 3CX2A 4ZTPL 3VXOA 2GCYB 2IF7A 1I7ZB 5IEHA 1KJ3L 1U3YA 5CEZE 1Z9OA 1KC5H 1YEKH 2NY6D 4AIZA 1WK0A 4KJWC 3GBNL 4KUZH 5CBEA 3QDHA 4M5ZL 1FGVH 3GGWA 2F5BL 3QUXA 1N6QL 4Z95L 3BKJH 4U3HA 3D39A 4X9FA 5GPRA 1Q94B 4PJBE 4X5WB 2R8SH 3UZQA 3A67H 3IDMA 3B43A 4P48A 4OZFA 4HUUB 1IKNC 1ZHBA 5F3BA 1AR2A 2YD9A 4HKJB 4BKLA 3OKLB 4ZS6C 4XXCC 3Q5YA 5HHOE 3W2DH 4PJXF 1EX0A 1JUFA 3QG7L 1KB5B 4H88H 1ED3B 5JXEC 1YECH 5ADPH 3HUJA 3MUGB 2EH8H 4LSTH 1F3DH 5F72S 1HDMA 4P2QB 5KVFH 3QDJE 3TA3C 4WO4C 4MD5A 3EKCA 5DC9B 3SKJL 3C5ZB 4Z0XA 1UCTA 3IKCB 4S1SH 3WE6B 3D85A 4S2SB 2ADIB 3O41A 4BZ1L 5HPMA 4H5SA 1KENL 5FF6B 1RUMH 4LSRH 1W0WA 4XI5D 4LVHC 4PJEB 5HBBA 4L3CB 4MXWH 1AC6A 1WICA 3EUUA 5GGSA 5BOZG 5HGBB 2MQ3A 3DXAB 5BS0E 1C5CH 2BDNL 3L7EA 4P3CL 2IBZY 4TNWF 1OP3H 4U1HB 4FFWD 4Y5XC 2JJSC 5HGGS 5JO5A 4QEGA 4P5KB 2D4DA 5B4MC 3OR7A 1CFSB 3I50H 4HWNA 1PG7L 3UTOA 1F3RB 2P24A 4DJMA 1I3RA 1EAJA 2QSQA 4C58B 2YN3A 4EUPB 2DI9A 1A9BA 4W68A 3S37L 1TXKA 4D0DA 3CZJA 1B6UA 3VXUB 4H8WH 3ARRA 4PP1D 4ZD3H 4PRID 2XTJB 5MEND 4NUGL 3DARA 4LVEA 4PB0L 3QI9D 1HSBA 1XZ0B 5LCVL 4Z7NF 2PUQT 5F70A 3CC5B 2R69L 3U36A 4G9FE 1XIWB 2EIZB 3LD8C 2KQNA 1S7RB 1DBML 4HXAH 4UNUA 3UJJH 5BCAA 4PRPE 1DE4B 1IGFL 1QRNE 15C8H 4RWYH 4BH7A 1ETZB 1YNLL 3V6OE 5FUCC 4QRPE 3DYOA 5B39B 5CZKA 2VIRB 4WHTA 4JHWL 3KYMB 4LPTA 3CLEH 3CFEA 3H3BC 4YNYA 4Q74A 4ODBD 4ELMF 5IM7A 3CDFA 5TJWK 2FEEI 1I3GH 3T4AA 1G6RL 3QB7C 1KJVA 4PYHA 2HN7B 5MHSD 1IC1A 5GRYA 3UTSE 5DJYA 3V4VH 2WQ8A 3S6CA 2DYPB 2ZUSA 2NY4B 1AXSA 2OCFD 4NC2B 1U8HA 1WITA 5E6IC 3L5HA 3QDME 2ZG2A 4POYA 5EB9A 5IW1B 2OX5A 3JWNC 2WLZA 5JORB 2AEQL 5AG9A 4YQXL 2R1WA 3U1SH 4O5LL 3EDKA 3EOBB 1U8JA 5CEZH 4JKWA 5D96C 4NT6B 4FFWC 5F7WC 2B4CH 4CNIA 3Q5TA 4XBEH 3C6SA 1FE8L 3JTTA 1Q9LA 1CZ8L 1YYLH 4Y5YA 1UWGH 5IWLC 4C59B 5HHNB 4Y2OA 4DW2H 4IMLA 1HXMB 1KN2L 4AEHH 4PY8I 1G7JB 5MEOB 3RGHA 1IBGH 5L2JB 2L4OA 3THML 2Y06L 2I9TB 5ADOL 1M7XA 1OT1A 3ULVF 5IV2B 3E8UL 2FIKB 4PP1C 4JO1L 5JDSA 2FYYB 1P4IH 1LO0L 4TULH 5E2JA 5I73C 4H26A 3QI9C 3HAEG 2P8MA 1H0DB 2OP4H 4OLZH 5E1AA 5IFAH 3KVQA 4JRYD 5GRUL 4YDIH 5JPMB 2G2RA 3G5ZB 3NPZB 3RTQB 4O9HH 5D70H 3MLTA 4MYWB 1OGAE 5JHDE 4AMKL 1KFAL 5CLWA 4OIBA 5I1HL 2NXZB 4RA3A 3QIBD 4RMVA 3L1OL 3UP1A 3BI9X 1P7QB 1HQ4A 3MRPA 3DX7A 4NNYA 5ALBH 3QUZD 2IQAA 3V4PH 1GC1L 2G75B 2X9YA 1TTFA 3GSUA 4U6XA 4ZFFA 2IALB 1SHMA 4JDTL 5C09D 3FONA 1IGCH 3L3IB 1KELH 1ZXQA 4AEFA 4PY7A 3MGOA 2XZCH 1QLEH 3HTLX 3V2AR 3VG0H 3N85L 4WU5A 3V6BR 1N7MH 1MRCH 2AGJL 4PREA 2EYSB 1D6EB 4L4TD 3G6AA 4WHCA 2HG5A 3ECBA 3PGFL 3WBDA 4JDVB 3WFEL 4YXKH 1NAMA 5TDPA 3RY6C 4AT6B 1B0RA 1S9VA 3AXLA 2EYRB 3E6HA 1OWRM 5I8CB 1MPAL 4LSUH 1UWEH 4R96B 3AAZA 3P11H 1YEDB 3PHOB 3BPNC 5KG9B 1G9ML 4X0KA 4XZUB 2FSEB 2Y07L 3L95B 4MJ2A 2BOCB 3IDIB 3KPSE 4Z77A 1A3LL 4LSSL 1BFVH 1D3CA 5F9JB 3BVNB 1TJGH 2Y4SA 5D7SL 3T3MF 2BSSA 3ES6A 3OKNA 1LEKA 2X10A 3DX8A 5AAMA 1JWUB 4OM1L 1LWRA 3VFNB 3H9ZA 5I6XC 2WBJB 5C0JA 1UENA 4LCCC 3D39E 3P9MA 2BERA 4KZDL 4PJIE 1NANI 1PKQE 2Z8RA 3I75B 3QNYB 3RA7H 4GAYA 1CR9L 4HPYH 1ADQH 1N0XL 5I66A 4HAFA 3C09C 2Y1VA 4ERSL 1L7IH 4DUVA 2XFXB 4W6XB 4Z7UB 2ORBL 1O7VA 1QG3A 4LCWB 3HUJE 2OSLA 3MFFA 4JGMA 4GRWE 3QIBC 1T3FB 2NX5D 1RK0B 3TCLA 3BHBA 3EO1B 2CLRB 1IC4H 2CLZA 2CDEA 3K1KC 2DQDL 5IMKA 1CGWA 1QBMH 3HA0A 4CMHC 1J7VR 1C5BL 5C08B 4Z9KB 2GSIA 3RY5A 1GH7A 4NZTL 1LO2H 2BMKA 1KEML 4EN3C 2B7DT 4DKDC 3O3DA 1BLNA 1F4WL 5EN2A 4WY7H 5EIVA 1U3JA 2VL5B 1A7RH 1PY4A 3PGDB 3RU8L 5KVGL 2D7QA 1REIA 3VI4E 1CD1B 3CX5K 3GSNB 4HH9B 4GQPH 1FFNA 4G9DA 1HQRB 3WS6A 1BZQK 3RX8A 1R3IL 4JFDD 1A7PH 4P5MB 3SGEH 4PRAB 4LNRA 2AK1H 2VR9A 1P53A 3VXRD 3BPLC 1RHHA 3S5LB 3WS3B 2HVJA 5LWYH 4XC1L 3HZYB 3B83A 3CK0L 5BVJA 4UDTA 3KAAA 1RUAL 4ODTL 3IFNL 3RWCB 5DD3L 4QXGL 1UACL 4Y88A 3RIAF 2B5IB 4LOUC 4XP6L 3WLBA 5EUKB 2JCCA 3HR5A 3MROB 4HC1H 4NZDA 4OD1L 1IRAY 1J1PH 3FTGB 2DTMH 1I1YB 3BUYA 4HT1H 5GS0L 1J8KA 2O61A 3NACL 3QQNA 4NP4H 4PJAF 2R4SH 5A16B 2XY1A 3JWOC 3VA6A 5L88H 2DS4A 1NUGA 4W6WB 3REVA 3H3PL 4Q9CA 2ICWI 2IBBA 5GSRA 4PLNC 1S7WB 4P59L 3L7FA 5CSZA 1WFOA 3TV3L 2FNBA 5C07A 2RGSA 4ZMAT 1EUTA 4BFGA 3LV3B 3IJSB 1ES0A 5SWZD 3BKYL 1OAQH 1C8PA 4TSCH 1E4WH 1F3JA 5CHNA 4YHNB 4R9HA 2FBJH 5KAQG 5GRWA 5DZNA 1JYNA 1OAZL 4QRQA 3U0TA 1KYOK 5IBUB 4L4VD 2PO6A 3HPLB 3GM0A 3VRJB 5IMLB 4PTUA 2E9BA 3FQRA 4TOYL 2EDKA 4NJAH 3RWGB 2ZZUT 1F6AB 2XZQH 1CDJA 4U4BA 4N9OB 1UA6H 2FX9H 1D9KB 1D5BB 2R23A 2W0FB 2A9ML 3PWPB 2HKHH 1MCIA 2H2SC 3VXME 5E08L 3ZE2F 3OMZA 5HHME 3GI8H 5ICZA 1JK8A 3ZL4L 3MUHL 4P2CG 1UXSA 3PNWA 4P57A 2IMMA 2EH7H 3ZKXB 5E6ZA 3H7BB 1CGUA 3RHWK 1JMZA 1PZUB 4N1CA 1CFNB 1X7QB 4WTXA 1NFDE 1YUHA 3PWJB 3MA7A 3QRGH 1R6VA 5I1CH 2NCMA 5TH2A 2C4FU 4RGND 1X44A 2Y7QB 4YPJA 3QNXB 4RBPH 1OWWA 2LABA 2VXQH 4KK9C 3WXWH 1S7XA 4M03A 2Q7YA 1ULVA 5GS2D 3HC4H 1FORH 2APBA 4MMZC 3B3IB 4L5FL 3R06B 5BOPA 5DMKB 1T89C 3OB0H 4I5BA 4PLKC 3KPRB 4GRWH 4NBYB 3SOBH 1OAUH 3D0VA 4FOMA 4P3DA 5D1XC 4UBDD 1JE6A 1IJ9A 3T0EB 5ITBH 3IDJB 4ZPTB 3D1MC 1QEWB 1A8JH 1TITA 4NO0D 1RVFL 3PDDA 3MRIB 2IPUG 2XIDA 3D9AH 5EZJA 1H3UA 4U1JB 5I1LB 3CVHL 4HH8A 4TSBL 1MI5B 3DUSA 3MOQA 1XF4A 2E8YA 3BP6B 3QISA 5K9JL 1RUQL 5E8NA 1CE1H 1WUNT 5A1AA 5F7DB 5IQ9A 2CH8A 1V5JA 1T7WA 3N1MC 4R8WL 4L8SA 1DQJB 3CDCA 3F6LA 4G5ZH 4D2NA 4MJ5A 3OZ9H 1ZT1B 2WUBL 4G8EB 5F71A 5IBLD 4LBEA 4JRXA 4X9IA 1NANH 3RWIB 1TZHA 3LDBC 4PLJD 5DHVA 4M02A 1FFRA 4Y5VB 3L5WB 1KTDB 4MQ7A 4N0UB 2VQ1B 2Z31A 1MCWW 1NC2D 2NLJA 3DOSA 4DWHA 1LVEA 1W8OA 4LLMB 1OSZA 4NQXA 2EKSB 3KPLA 2JJTC 5I2IA 1FL3A 5HGAB 2X44D 4NHCL 2UUDK 3WJJC 2AV1A 4XBGA 3B5HA 1JZ5A 3IFPB 5E5MA 3RUGB 4F80A 5IB3B 4OZGF 4QGYA 5I1AA 5CSBA 4KH2A 3MYJB 1BF8A 5L2KD 1FYTD 2YD6A 4FABL 4KVCL 4NSKB 2R4RL 4EXPX 5IJVB 3I6GA 1ORSA 5IFHH 5IQ7H 5LXGH 5ETUA 3MO1A 1I7RA 4XAKD 1CDIA 3L9RA 3BEWA 1JZ4A 3STZB 5KS9B 4L3EA 3ZTNL 4UBDC 1XH3A 4KK5D 1WCQA 4PRNA 1ZGLP 4HQQL 4J23A 5I74B 3EFDH 2YR3A 4GQ9L 4NYLB 4M6ML 2Y6SD 2K7PA 4BFEA 3GHEH 1EEQA 2BFVL 1AI1H 1TTGA 2EIBA 5CEXA 3SDDC 2A77L 2J1KA 1CE6A 4LNVA 4EVNA 1Z0NA 4G8GA 4L9LB 2AJSL 4YX2H 2XN9D 4OUOA 1K3IA 2V9TA 4JQIH 1KPRB 4X7FC 1IILE 1X5IA 4ODHH 1MIEL 2PW2B 3CFCL 3DX6A 5F7HA 5IBLC 3RL2A 2ICES 3SE9H 1EBPA 3CH1A 3QFDB 5GGRA 4TSAL 1IT9L 5HPOA 3MRHB 3PHSA 3O6LH 4PLJC 4KROD 5T1LD 2B1AL 4OZFG 5LBSL 4L29B 4M1DL 3QUMA 4JFXA 1MCWM 3MLRL 2B0SL 1L0QA 1IAMA 4Z7QF 5C0BE 1VDGA 1Q1JL 3D2UB 2P48B 1CXFA 3DLQR 3TYGH 4GKSB 4R2GD 3LKQA 2QL1A 4RNRA 3CMOL 2CSPA 1W0VA 5IROA 4H8WC 1MRDL 3T2NL 5KVEH 3QA3A 2Q6WB 2ZPKH 1RMFL 3V52H 3BRGC 3O4OB 4WUUA 2APXA 2QSCH 2HA1A 1NMCC 3UJIL 3KNBA 5CIPA 5SWSD 3SGKA 4UOW0 5C07E 1AGEB 3RRQA 2CLVA 5FYKU 4KJYB 1ZHNA 2G5RA 2H41A 1KCSH 1S5IL 2VABA 1RUKH 1U41A 3P4OA 3U6RB 2OK0L 1AGCB 3X14A 1HK6A 3PV6A 4Z8FH 3GSRB 3P77B 2R0LL 2YK1H 1NGWA 3R8BB 3QWRD 4PGEA 4OQTL 1NAMH 5BS0D 2NPLX 4LF3A 3I3BA 1HYRC 4JY4B 3UXFA 3VE0B 1OTUD 1QLFB 5FYJE 2Y6SC 5D7IB 5FOJA 1SYSA 3BMVA 1DBBH 3LKOB 5CZVH 3O2VH 5T33H 4ZFZA 2Y5TA 1NFKA 1P4LB 1QBAA 5TE6L 3LKNB 5I1JL 5JOFB 3QNZA 3GIZL 4X80L 1QQDB 3CZFA 5FHBH 2BJMH 1NGYA 4O51B 4CVUA 4I3GA 1RV6X 3GMNB 3HRZB 2AJVH 3L5IA 3AS0A 2AK4A 4XVJL 2AQ3A 1MCSA 3RPIA 4J4PA 3PJSA 4H1LB 4UV4L 3S88L 2CKBA 4XCYA 4V1DA 4LVOC 4MDIA 1YMMB 4QTIL 3WIHL 5HTSA 4QNPE 2VDLH 3BD3A 5DQ9A 2KUTA 5TGBA 2IPUK 4KROC 1CD9B 3S36L 3B9KA 2JELL 5DHYB 2VN4A 2YPLD 1P4BL 2FX8H 3MRDA 1JN6B 4GG6B 2R0KH 3CXHK 1XGRA 5D72H 1AE6H 3HG1A 5E6YA 1MUJB 3MBXH 4IRZH 3TT3H 4D0BB 3HI6L 4PGJA 1QSEB 1U95A 3P4NA 3JWDL 1SJXA 2C4FT 2EYTA 4YDKH 5DLMH 2BXZA 2Z0BA 4URTB 1JGUL 2ICEB 4OCSH 3WNMA 4UV7H 2DQTL 5KSBE 2EDJA 3EYOA 3U7WH 3AU1B 4WJ5B 5ANMA 5DRXB 3PWVA 2NYYD 1UB6B 1YEGH 4YPGA 1L6ZA 3LY6A 4HS6A 1UM6H 3RVWC 4EDWL 2Q7NA 2D31A 1OW0C 2YEZA 4NZUH 1MFNA 2OTWB 1QSZA 2BOBB 3EO9H 1NMAL 1Q9WA 4D8PB 1VERA 4OFIA 4DCQA 3GB7A 1DN0B 5DWUH 4J1UB 3U79A 4NC1E 1OTUC 1T04A 5C8JA 1VKXB 4JRXE 2YSSB 1DUZB 1JF5A 1KXTB 4I13B 2ZUXA 1BD2B 5C0EB 4YHLL 3EW3B 5GJSH 4XVTL 2J6EL 5JW3H 3H42L 4K3JL 2BNUB 3LN4A 3BQUB 2OTPA 1BBJB 3IXTA 5D1QB 1CF8H 3ULUE 2FO1A 1CTOA 4U1MB 1E4XI 4F57H 1PQZA 4NN6B 4JJHA 4YHKL 1HSAA 2MHAA 3LS4L 5BVPL 2QSVA 2W9EL 4Q6YA 3MRKB 3C6LD 5CD3A 2R0ZL 1BVLB 5J6HB 2A9NH 1J0IA 3AC0A 1OGAD 1BIIA 3OX8B 5C0GB 1OSPL 1QO3A 3KXFA 5HYIA 1UEYA 4YE4H 3FRUB 4D0CB 1BQSA 4Y1AD 4OAWB 1ZT7A 4JZNA 3BD5A 1J0ZA 4MVBD 3OR6B 3OGOE 2DDQH 1CFVL 3VWKB 4YO0B 4B0MM 5I30H 4HUWA 5DR5H 2UY6A 5EO9B 3K2UL 3MLSL 4KXZH 2UZYB 5C0FA 1MIMH 3GSXA 4GXUN 5FYJH 1INQB 4PD4K 1CL7L 4XHQA 5SX4I 5HHQB 3T0WA 5D7IF 3MRFA 5EU6B 3X12A 1TZIA 2VKWA 1AD9B 5B39G 2CGRL 2NYYC 2A1WH 4PB9H 2IQ9L 4Z5RB 2QBWA 1BAFL 1KNOA 1WC7B 4MJIA 1MRFH 4WDIB 3K3QA 4ZUWA 1LGVA 1MHCB 4TN9A 1XCTB 2ADFL 4JM4H 1JNNL 2OL3H 1C1EH 3P4MA 1SY6L 3WIFA 3LMJH 5F88A 1R24A 4U49A 1NGQL 3HC0B 1NLDH 5LGHH 5I19H 4HKXA 4XNQA 2BVUA 3GO1L 4IRJC 2R2BA 4EKXA 4XP9H 2VERN 4NQEB 1U8LB 4XP5H 4YK4C 1BGXH 3B8YA 3VFRB 1M05A 3QDAA 2DD8L 1JF1B 3G5VA 3NCYP 3FFDA 5JUEH 4LLUA 4GXUM 4UT6L 3QUXD 5CWSB 3D39D 3VCLA 2FGWH 1FVEA 2VDKH 4BFIA 3G5XA 2FO4A 1FZKB 1MF2L 1K8DA 4LP4A 1ZTXH 3LIZH 1NEZA 3DUHA 1DLHA 3DMMC 1FNHA 2HH0L 4F7EA 2W60A 3STBA 4ZDHB 1TQCB 2WLYA 3ALPA 1FO0B 3TO4C 2BVOB 3TIEB 4OIAA 4I9WD 1XGPB 5FGRA 2AV7A 4X5XB 4N5ED 1GPOH 4RAHA 4MVBC 3EOTH 3G6JA 4Y0GA 2GUOB 2AJYL 3D85D 3I84A 5IB1A 1IEAB 1JNHB 3HMXL 2H2PD 4GH7B 3GBMH 4ISVA 3AY4A 5EOCH 4ZUVA 5IGXH 1Q9KA 2BVQA 3N1FC 4MA1B 5GGUB 1G6RA 6FABL 4QY8B 1WBZA 3WKNA 1MVUB 1KB9K 3L3KA 4UTBH 1EUUA 1Q8MA 4U1GC 4X9HA 2HJKB 2BZDA 4DKEH 3JVGC 4FTVE 1YEIH 2PXYA 4JKKA 1A14H 3ULUH 4RX4A 1V3KA 4APQA 5CJXC 4K3DL 5IT2H 4HSQA 1BWMA 4I0PD 4ENED 3I9GH 4KDTC 2AK4E 4LCUB 4JQXC 4WUKH 1LD9B 5EFIB 4M5YL 3UC0H 3ARBB 4GT7A 3P0YH 1WAAF 1T21A 5C2BH 4HZLA 4XCEA 5HDQH 5T3ZE 1D5IL 4F9PA 2XOTA 4QRUB 3QUXC 1TCRB 4X6CF 4HPOL 3QCTH 4U1LB 1T0PB 1AGBB 1HIMH 4A6YB 1FN4B 1K2DB 3HG1E 4IOIA 3DSFL 4PRHB 4J12A 3C2AH 4XBPA 4K94C 4EI5B 1B88A 2HJFA 2J8OA 4KK8D 2D03L 1UJ3A 4JO4H 4IDJH 1TETL 3E2HC 3LRSA 1NCAH 4P4KB 1LK2A 3C08L 2CD0A 2A74B 3DHJA 1DLFH 2VDPL 4MSWA 1DBJL 4K23H 4MCYA 5D7JA 2JB6B 1ZK9A 4N5EC 3VFUA 3DRTA 1T5WA 3MCLL 1OCWL 2XWTA 4PRDA 5ANME 1BX2B 4HFWB 5F9AC 1U8KB 5CJBA 5HJ3A 1EEYB 4AJ0A 4UINH 2X1PA 1BQLL 2OJZL 3T4YB 2H2PC 3ULVD 1TZGL 1V7NH 4UB0L 1XGYH 4JANA 5IJKA 5DYOA 3HE6B 4WI6A 3UO1H 1V7MH 1IGIL 1N59B 2PKDA 1TVBB 5IVXE 2R1XA 3EO0A 5HVGB 1HKLH 3MUZ1 5D4QA 1AQKH 2HLAB 4MAYB 3QUMH 3ROLA 4Q0XL 1U6AL 4XNUH 3ZDXF 3HZVA 2YRZA 4QRSB 2H45A 1G1YA 1MAKA 4WW2B 4XVUD 3L3GB 3SQOL 4KTEL 2BRRH 4ENEC 1NDMB 2P5EA 3CU1A 3VGAB 3QDGA 4LCIH 4NQCD 2XPGA 1NBZA 3WUWB 1ZGLB 1GIGH 5F3HB 3V7MA 1CDCA 3ZDZE 4F7MA 2WIIA 2VDQH 2GTZA 1JYVA 1TJIL 3CVIH 3HLAB 2OI9B 2EDEA 5FOBB 4PBVC 5DRWA 4G6MH 3HAEH 5SX4H 5F7KC 5T5FL 4JFQA 2DTSA 5HHXH 5J11C 5CIPH 4M00A 2Q8BL 1ZGLM 4XNYH 3T2PA 2PF6A 1LP9A 4ZFOA 2AXJA 4FFYL 3S5LG 4JPWL 4NO2A 1BZ9A 3U0PA 3KGRA 1DQDL 5E24E 3QP3A 3K74B 3QIUB 4IIQB 3FO9B 3LQZA 3RQ3A 5FYKE 1SBSL 3MTRA 3MNVA 3VD4A 1PSKL 4E41A 2XA8H 2FCBA 1ZANH 4EBQH 3RY4A 4XMLL 3VFWA 5BQ7A 1QSFA 1CLYH 4RISL 1FPTL 1TQBB 3V4UH 2DKMA 3M1BA 3JV4A 4JFYA 1YDPB 1HXYA 4PP2B 5FA3B 3K2MC 3ZDYF 3NZHH 4AG4H 4YDVB 3B2VH 4FQLL 2V5MA 2N1KA 1KBGL 2VRAA 3U4BL 4PJ7B 5HDBE 5LAXB 2QR0A 2HFGH 1SMOA 2PETA 5GS1A 4MJIE 4YBHA 4F7PA 4OQ1A 3IKKA 3ULVC 1A7OL 4Y8AA 4HS8L 3EOAA 1TMCB 1FFOB 4R3SB 3NFNB 5BRZA 3KLHD 1MCKA 1ZT4B 2WP3O 3G5YA 3L5XL 4HD9A 1UWXH 3O4LD 3TNNA 1A4JA 3FJTA 4HFUL 3V8CA 1B2WH 4R7DB 2ZOLB 4Y5YC 1HINH 5T3ZH 4OCLC 3ILPB 4OFPA 3DIFB 3MRMA 1Q9OA 2GI7A 4GBXA 4XVUC 1QHPA 3SO3B 1WQVT 5I76A 1SVZA 1A1OB 2VR5A 3ARGD 1ZLSH 4O2FB 2NTSP 3QHFL 1PX4A 1T7ZA 1S7QA 2OS7A 4PJCA 3RIAK 4JLRB 1AIFB 2VQUA 4IDLA 3OPZL 1CFBA 1OF2A 2YUWA 2D7MA 4R7NB 3T3PF 2VLKB 1L9MA 4U33A 5FYLE 4YAQB 1FBIH 3VXTA 3LSOB 1SBBA 1A5FL 3AMKA 3O6MH 5D1ZA 1H5BB 3D69A 2Q1EA 5E0QA 1NBYA 5EA0L 1XT5A 1ZV5A 3I3DA 3UBXI 3MR9A 2F5AH 1J11A 3ULSB 1A47A 4QWWD 3P9LA 3IDXH 3GJFB 4HMCA 4Y4HB 3U4EA 5F1IB 5L9DL 1NC4B 2DMCA 2BC4B 1FSKB 1YEEH 5FHAH 5CILL 3O45A 3G6JE 5CKGA 1XGTB 4PJCF 4YHOH 4Q2ZA 4Y4FB 3D3VA 1A1MA 3B5GA 4X4MA 4TYUA 2EDYA 5IHZB 1N64L 4Z6AT 5AAWA 3M17A 4S11A 4OCRH 3EBAA 1H3WM 4P23B 1Q94A 4XP4L 4X5WA 1P6FA 4FQXB 4OLEA 2DM2A 1FYHB 3AS2A 4QCIB 4HUUA 4P2YA 1MY5A 2DQHH 2Z4QA 2PYEB 4HMDA 5BZWB 1BJMA 3LAFA 5F9OL 5DD0H 3REWA 4K9EH 3F5WA 1P6AB 4KV5E 3UPCA 2D2OA 2HRPL 2E27H 5DVLA 2GHWB 3MUGA 3UAJC 3E3QC 2IAND 3STLB 3CH8A 2XACC 1IZJA 2HVKB 3KLHC 3FB7A 5ICXA 1CLOH 3OHXA 1MFDL 1T22B 3IKCA 4S2SA 1AFVL 5MP6H 5CEYB 3NCYS 4M6NH 1CK0H 4M5ZH 4PJEA 5E94B 1I8MB 2A6KB 4NN7C 3CAFA 5EC1A 4NCC2 4PJHA 4MB3A 4J3UA 4TNVF 3LN5B 4JN2A 1LEGB 4YHZH 5TF0A 2BY1A 2HP4A 1P2CB 4U1HA 1DSFH 5JHLL 5FYKH 3VXNA 4MWFB 1AXTH 2M2DA 5BMFL 3SCMB 1BIHA 3DVGA 3BKMH 4YHMH 2DWEB 2IC2A 5C07D 3IAGC 3RKDD 5DD5L 3SDAB 4EUPA 2OTUB 5F44A 1KIRB 1JGLL 1U8OB 3O8XB 3ESUF 4HAGA 4OF5A 4PJHF 4I18B 4GXVL 1GGBH 4OCXL 1T6WA 4MMXC 4GFTB 4JM2A 4WI5A 4GMSL 2LTQC 1OARH 2PTTB 4Y7MA 2JK5A 5HI3D 2PO6D 4BZ1H 1XZ0A 1MCEA 5JIHA 1T20A 3CC5A 3IDYC 1XIWA 2EIZA 3LEXB 5D5ME 3V6FA 4TRPL 4R97C 4XX1G 1DE4A 2EKJA 3CVHA 3WYRA 4JFZH 1D7FA 4LLVA 1ETZA 4XB8A 4KMQA 4PJGA 4GKNA 2IG2H 3QWOB 2X4TA 2VIRA 4D9QE 4AK1A 1PG7H 2MFNA 3SDXA 4JFPB 2W59A 1IC5H 3WS6C 3FO0L 1N4XH 4G8IB 4X8XA 3UTTD 2DWDB 3OXSB 5F1OB 4UQ3A 2F54D 2MKWA 4NKQB 3SPVA 2CK0H 4OLYL 5DFTA 4MNQB 1JI2A 4NUGH 5EOQH 3KHOA 4KPHL 4LEOA 1AGDB 5F8QC 3T1FB 1QLRB 5FYLH 3NABH 5HYEA 1U3HA 4HWEH 3WKML 1AHWB 1KPVA 5IW1A 5E8PA 4BJLA 5JORA 4OZHA 5D7LE 3VRIA 4CW1A 3S34H 3QZWA 4DOHE 3C8KB 3GBLA 2P5WB 4EIGB 4Y16B 4GRMA 2F8OA 3CDGB 1DQML 4P46B 3F6IA 4XP1L 1J8HD 5KJRH 4FG6D 3TIDB 1EVTC 1I1FB 4X8JB 3PP3K 4G42B 3V5KA 2VITB 1C7SA 3RKDC 1FNGB 1G6RH 1KLUB 5E2WL 5ACLA 5HVHC 1G7JA 4RRPG 5L2JA 1B0GB 2I9TA 5C0RH 3GJEB 5IV2A 2MOVA 1HE7A 4MZ2A 1INDH 4X6EB 2ZUQB 5E7FA 1S9YB 5HI3C 4H25B 5EO0A 1EGJL 2PO6C 4HLJA 2NY2D 4WWID 4XWGH 5F1KC 5JPMA 1PBYA 3G5ZA 3RTQA 1R5IA 1BM3L 3HB3D 4JRXD 3RDTD 1Q0YH 3IXAB 3FFCB 5GGQL 1M7DB 4X6FB 2DOCA 1A1NB 2HTLD 3BAEL 5F21B 4G80B 3T0DA 3U9PL 2G5BA 3LKPB 1JPST 4TUOB 2Z31D 4K3HA 3ULUD 1A9EB 2GJ6B 3RBGA 4ONGH 1P7KB 4HEPG 3BGFC 2G75A 2YD8A 5CJQH 2QQKL 3C9NA 4JG1H 4ELME 2C3HA 2DIAA 1RAMA 3RL1B 5EBMB 2UV3A 4XCCL 3TC9A 3BP7A 2A6IB 4KRPC 3HZKB 3FB5B 2EYSA 4Y89A 5IKCB 1JL8A 5AG8A 2NQCA 4AT6A 5FM5O 5KVDH 1KC5L 4L8DB 1YEKL 1T5XA 5I8CA 3P2TA 4O2CA 1YQVH 5FKAA 3BP4A 1YEDA 3PHOA 4KUZL 3SE8H 1T0MB 2FZ3B 4L3ED 1EHAA 1RURH 3OKKB 3L95A 4I8DA 3BKJL 3G08A 3BXNB 4AQ1B 2R8SL 2LU3A 5I18H 3A67L 4ZNEE 2BSRA 4G6AD 1VFAB 3VMNA 3VFNA 1JTOA 4MD0B 4AEIH 1ZA6B 1DQQA 3W2DL 1SJVA 4H88L 1L9NA 3C60A 4FQHA 1YECL 5ADPL 3OWEA 2EH8L 4LSTL 2N56A 3I02A 3ME0A 4G8GD 2UVFA 5KVFL 3QNYA 3MRNB 4BUGA 1NKOA 2BCKB 4OQTA 5TPWH 4L8SC 4HWZB 2NY2C 1LDPH 1AO7B 4OGYH 4NC1C 5J1AB 1S5HB 2DLHA 4S1SL 5F97E 4NQDB 4F58H 5ILTH 4Z7UA 1RUML 4LSRL 1QVOA 4XT1C 4X6BA 3U9UB 4XH2B 4MXWL 2X7LB 4KC3B 2HTLC 3QBTB 3EO1A 2CLRA 1I9JH 1C5CL 2Z31C 3ULUC 1EZVX 1UCBH 1JJUA 4M6OH 3JV5A 1RULH 1RZKC 3I50L 4JJ5B 4PJEE 5ITFB 1T7YA 3VG9C 4MXVF 3OKEA 4K71C 1JPFA 2ZWLT 4WI2A 3T04D 3VFSA 1D5MB 3PGDA 1E27B 4WUUD 5ISZB 2E7MA 4H8WL 3TP4A 1IM9A 1NGZB 1HQRA 4MNHB 4ZD3L 3LN9A 5IB4B 3GUTB 4R0LA 3JZ7A 1QTYT 3VFPB